F485561

General Info

Members Datasets Scaffolds Average Seq Length
914 352 912 126

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100089754|Ga0070682_1000897543
Length 130
Sequence MSKKVLYTLEYPVRCSPGILYDFLSTPAGLQEWFADKVDERDGVFSFSWNGGTNGSDEKAELLETEQDKFVRFRWLHNAKDEFFEFSIDKSEVTNQTILIIKDFADKKEIKDQSQLWEYQVKDLFHRLGN

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
208 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
211 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
212 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
213 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
214 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
215 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
216 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
217 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
218 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
219 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
220 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
221 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
222 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
223 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
226 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
227 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
228 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
229 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
230 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
231 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
232 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
233 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
244 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
253 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
264 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
265 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
290 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
291 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
297 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
298 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
299 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
300 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
301 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
302 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
303 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
304 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
305 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
306 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
307 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
308 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
309 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
310 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
311 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
312 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
313 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
314 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
315 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
326 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
327 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
328 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
329 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
330 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
331 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
332 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
333 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
334 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
335 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
336 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
337 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
338 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
339 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
340 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
341 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
342 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
343 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
344 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
345 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
346 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
347 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
348 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
349 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
350 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
351 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.55
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.14
Nodule 0
Rhizoplane 2.3
Rhizosphere 89.82
Stem 0
Stem Tuber 0
Unclassified 2.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1004049 3300001904 Bacteria 2520
2 JGI24737J22298_10075046 3300001990 Bacteria 1008
3 JGI24745J21846_1050996 3300002073 Bacteria 525
4 JGI24744J21845_10007180 3300002077 Unclassified 2301
5 JGI24751J29686_10041257 3300002459 Bacteria 955
6 rootH1_10019969 3300003323 Bacteria 6571
7 rootH1_10144194 3300003323 Bacteria 1525
8 rootH1_10163770 3300003323 Bacteria 2320
9 Ga0055535_1001800 3300003761 Bacteria 9378
10 Ga0065712_10010222 3300005290 Bacteria 4198
11 Ga0065712_10032529 3300005290 Bacteria 1532
12 Ga0065712_10363462 3300005290 Bacteria 772
13 Ga0065712_10461770 3300005290 Bacteria 675
14 Ga0065707_10339960 3300005295 Bacteria 935
15 Ga0070658_10261787 3300005327 Bacteria 1469
16 Ga0070658_10297148 3300005327 Bacteria 1377
17 Ga0070658_10339819 3300005327 Bacteria 1284
18 Ga0070658_10948829 3300005327 Bacteria 748
19 Ga0070658_11112402 3300005327 Unclassified 687
20 Ga0070676_10153611 3300005328 Bacteria 1475
21 Ga0070676_10181503 3300005328 Bacteria 1369
22 Ga0070676_10658215 3300005328 Bacteria 761
23 Ga0070676_11396621 3300005328 Bacteria 537
24 Ga0070683_100000468 3300005329 Bacteria 28362
25 Ga0070683_100010147 3300005329 Bacteria 8085
26 Ga0070683_100114315 3300005329 Bacteria 2547
27 Ga0070683_101742005 3300005329 Bacteria 599
28 Ga0070690_100033160 3300005330 Bacteria 3230
29 Ga0070690_100249207 3300005330 Bacteria 1255
30 Ga0070690_100362890 3300005330 Bacteria 1054
31 Ga0070690_100400097 3300005330 Bacteria 1008
32 Ga0070670_100005343 3300005331 Bacteria 10833
33 Ga0070670_100035958 3300005331 Bacteria 4264
34 Ga0070670_100036127 3300005331 Bacteria 4252
35 Ga0070670_100063150 3300005331 Bacteria 3178
36 Ga0070670_100272545 3300005331 Bacteria 1477
37 Ga0070670_100419001 3300005331 Bacteria 1184
38 Ga0070670_100741688 3300005331 Bacteria 885
39 Ga0070670_100781479 3300005331 Bacteria 861
40 Ga0070670_100913885 3300005331 Bacteria 796
41 Ga0070677_10149540 3300005333 Unclassified 1085
42 Ga0070677_10745457 3300005333 Bacteria 555
43 Ga0068869_100009768 3300005334 Bacteria 6232
44 Ga0068869_100012813 3300005334 Bacteria 5548
45 Ga0068869_100017295 3300005334 Bacteria 4884
46 Ga0068869_100063232 3300005334 Bacteria 2718
47 Ga0068869_100079146 3300005334 Bacteria 2449
48 Ga0070666_10000038 3300005335 Bacteria 115799
49 Ga0070666_10004991 3300005335 Bacteria 8117
50 Ga0070666_10017523 3300005335 Bacteria 4592
51 Ga0070666_10065667 3300005335 Unclassified 2462
52 Ga0070666_10078810 3300005335 Bacteria 2249
53 Ga0070666_10160446 3300005335 Bacteria 1571
54 Ga0070666_10693283 3300005335 Bacteria 747
55 Ga0070680_100701041 3300005336 Bacteria 871
56 Ga0070682_100000039 3300005337 Bacteria 144400
57 Ga0070682_100089754 3300005337 Bacteria 2008
58 Ga0068868_100018213 3300005338 Bacteria 5247
59 Ga0068868_100078150 3300005338 Bacteria 2648
60 Ga0068868_100451053 3300005338 Bacteria 1119
61 Ga0068868_100455352 3300005338 Bacteria 1113
62 Ga0068868_100573323 3300005338 Bacteria 997
63 Ga0068868_100703417 3300005338 Bacteria 904
64 Ga0068868_101400190 3300005338 Bacteria 652
65 Ga0070660_100124788 3300005339 Bacteria 2057
66 Ga0070660_100154184 3300005339 Bacteria 1849
67 Ga0070660_100746687 3300005339 Bacteria 822
68 Ga0070660_100825265 3300005339 Bacteria 780
69 Ga0070689_100390503 3300005340 Bacteria 1174
70 Ga0070689_101071285 3300005340 Bacteria 719
71 Ga0070661_100000179 3300005344 Bacteria 52306
72 Ga0070661_100034574 3300005344 Bacteria 3665
73 Ga0070661_100041203 3300005344 Bacteria 3370
74 Ga0070661_100245247 3300005344 Bacteria 1381
75 Ga0070661_100348972 3300005344 Bacteria 1160
76 Ga0070661_100644217 3300005344 Unclassified 860
77 Ga0070661_100762729 3300005344 Unclassified 792
78 Ga0070668_100043263 3300005347 Bacteria 3454
79 Ga0070668_100066643 3300005347 Bacteria 2794
80 Ga0070668_100128656 3300005347 Bacteria 2030
81 Ga0070668_100303381 3300005347 Bacteria 1340
82 Ga0070669_100024662 3300005353 Unclassified 4315
83 Ga0070669_100080917 3300005353 Bacteria 2419
84 Ga0070669_100463594 3300005353 Bacteria 1046
85 Ga0070675_100009635 3300005354 Bacteria 7516
86 Ga0070675_100020576 3300005354 Bacteria 5264
87 Ga0070675_100054348 3300005354 Bacteria 3294
88 Ga0070675_100061215 3300005354 Bacteria 3108
89 Ga0070675_100112895 3300005354 Bacteria 2301
90 Ga0070675_100174024 3300005354 Bacteria 1858
91 Ga0070675_100196931 3300005354 Bacteria 1747
92 Ga0070675_100621474 3300005354 Unclassified 981
93 Ga0070671_100015772 3300005355 Bacteria 6105
94 Ga0070671_100238388 3300005355 Unclassified 1544
95 Ga0070671_100385284 3300005355 Unclassified 1198
96 Ga0070671_100415093 3300005355 Bacteria 1152
97 Ga0070671_101374792 3300005355 Bacteria 623
98 Ga0070674_100004279 3300005356 Bacteria 8121
99 Ga0070674_100184538 3300005356 Bacteria 1600
100 Ga0070674_101537375 3300005356 Unclassified 599
101 Ga0070673_100008952 3300005364 Bacteria 6693
102 Ga0070673_100193037 3300005364 Bacteria 1750
103 Ga0070673_100224099 3300005364 Bacteria 1628
104 Ga0070673_100515191 3300005364 Bacteria 1083
105 Ga0070673_100959417 3300005364 Bacteria 795
106 Ga0070673_101002771 3300005364 Bacteria 777
107 Ga0070673_101024716 3300005364 Bacteria 769
108 Ga0070673_102010022 3300005364 Bacteria 549
109 Ga0070688_100186446 3300005365 Bacteria 1442
110 Ga0070688_100205693 3300005365 Bacteria 1379
111 Ga0070688_100572459 3300005365 Unclassified 861
112 Ga0070659_100009346 3300005366 Bacteria 7200
113 Ga0070659_100366428 3300005366 Bacteria 1211
114 Ga0070659_100748233 3300005366 Bacteria 848
115 Ga0070659_100751956 3300005366 Bacteria 845
116 Ga0070659_101129172 3300005366 Bacteria 691
117 Ga0070659_101419530 3300005366 Bacteria 617
118 Ga0070667_100183990 3300005367 Bacteria 1849
119 Ga0070667_100291951 3300005367 Unclassified 1466
120 Ga0070667_100543420 3300005367 Bacteria 1067
121 Ga0070667_101228153 3300005367 Bacteria 702
122 Ga0070667_101820178 3300005367 Unclassified 573
123 Ga0070701_10279105 3300005438 Bacteria 1019
124 Ga0070701_11203204 3300005438 Bacteria 538
125 Ga0070700_100246934 3300005441 Bacteria 1278
126 Ga0070700_100578069 3300005441 Bacteria 877
127 Ga0070700_100755333 3300005441 Bacteria 779
128 Ga0070700_101437041 3300005441 Bacteria 584
129 Ga0070678_100004697 3300005456 Bacteria 7775
130 Ga0070678_100014866 3300005456 Bacteria 4927
131 Ga0070678_100039709 3300005456 Bacteria 3323
132 Ga0070678_100917164 3300005456 Bacteria 801
133 Ga0070662_100005910 3300005457 Bacteria 7851
134 Ga0070662_100015036 3300005457 Bacteria 5177
135 Ga0070662_100049525 3300005457 Bacteria 3029
136 Ga0070662_100505270 3300005457 Bacteria 1009
137 Ga0070662_100815865 3300005457 Bacteria 793
138 Ga0070662_100885467 3300005457 Bacteria 761
139 Ga0070681_10389720 3300005458 Bacteria 1304
140 Ga0068867_100026385 3300005459 Bacteria 4171
141 Ga0068867_100040030 3300005459 Bacteria 3419
142 Ga0068867_100165085 3300005459 Bacteria 1749
143 Ga0068867_100301896 3300005459 Bacteria 1320
144 Ga0068867_100836426 3300005459 Bacteria 824
145 Ga0068867_100926275 3300005459 Bacteria 786
146 Ga0068867_101753790 3300005459 Bacteria 583
147 Ga0070685_10007192 3300005466 Bacteria 5688
148 Ga0070685_10112716 3300005466 Unclassified 1678
149 Ga0070685_10169882 3300005466 Bacteria 1397
150 Ga0070685_11201048 3300005466 Bacteria 576
151 Ga0070699_100288194 3300005518 Bacteria 1472
152 Ga0070684_100022853 3300005535 Bacteria 5220
153 Ga0070684_100047735 3300005535 Bacteria 3711
154 Ga0070684_100347754 3300005535 Bacteria 1363
155 Ga0070684_101424077 3300005535 Bacteria 653
156 Ga0070684_102119985 3300005535 Bacteria 530
157 Ga0068853_100002821 3300005539 Bacteria 13161
158 Ga0068853_100015211 3300005539 Bacteria 6324
159 Ga0068853_100021602 3300005539 Bacteria 5370
160 Ga0068853_100022828 3300005539 Bacteria 5230
161 Ga0068853_100064395 3300005539 Bacteria 3179
162 Ga0068853_100781567 3300005539 Bacteria 913
163 Ga0068853_100866258 3300005539 Unclassified 867
164 Ga0070672_100036669 3300005543 Bacteria 3736
165 Ga0070672_100091970 3300005543 Bacteria 2448
166 Ga0070672_100159406 3300005543 Bacteria 1871
167 Ga0070672_100320048 3300005543 Bacteria 1318
168 Ga0070672_100352251 3300005543 Bacteria 1255
169 Ga0070672_101395410 3300005543 Bacteria 626
170 Ga0070672_101578769 3300005543 Bacteria 588
171 Ga0070686_100842026 3300005544 Unclassified 742
172 Ga0070686_101010107 3300005544 Bacteria 683
173 Ga0070693_100729554 3300005547 Bacteria 728
174 Ga0070693_100924096 3300005547 Bacteria 655
175 Ga0070693_100999707 3300005547 Bacteria 633
176 Ga0070665_100079455 3300005548 Bacteria 3286
177 Ga0070665_100186701 3300005548 Bacteria 2074
178 Ga0070665_100210394 3300005548 Bacteria 1945
179 Ga0068855_100017041 3300005563 Bacteria 8739
180 Ga0068855_100870216 3300005563 Bacteria 954
181 Ga0070664_100000140 3300005564 Bacteria 49126
182 Ga0070664_100258862 3300005564 Bacteria 1565
183 Ga0070664_100262348 3300005564 Bacteria 1554
184 Ga0070664_100360954 3300005564 Bacteria 1323
185 Ga0070664_100432481 3300005564 Bacteria 1206
186 Ga0070664_101121182 3300005564 Unclassified 741
187 Ga0068857_100007728 3300005577 Bacteria 9263
188 Ga0068857_100075454 3300005577 Bacteria 3006
189 Ga0068857_100136533 3300005577 Bacteria 2214
190 Ga0068857_100341845 3300005577 Bacteria 1385
191 Ga0068857_100764725 3300005577 Bacteria 921
192 Ga0068857_101565094 3300005577 Bacteria 643
193 Ga0068857_102229227 3300005577 Bacteria 538
194 Ga0068854_100011485 3300005578 Bacteria 5769
195 Ga0068854_100065919 3300005578 Bacteria 2634
196 Ga0068854_100468638 3300005578 Bacteria 1055
197 Ga0068854_101330292 3300005578 Bacteria 647
198 Ga0068854_101627649 3300005578 Bacteria 589
199 Ga0068856_100036347 3300005614 Bacteria 4830
200 Ga0068856_101757554 3300005614 Unclassified 632
201 Ga0068856_101869911 3300005614 Unclassified 612
202 Ga0070702_100720279 3300005615 Bacteria 763
203 Ga0068852_100023809 3300005616 Bacteria 4937
204 Ga0068852_100049213 3300005616 Bacteria 3605
205 Ga0068852_100455132 3300005616 Bacteria 1268
206 Ga0068852_100618875 3300005616 Bacteria 1088
207 Ga0068852_100691098 3300005616 Bacteria 1030
208 Ga0068852_101295908 3300005616 Bacteria 750
209 Ga0068852_101882275 3300005616 Bacteria 620
210 Ga0068859_100000007 3300005617 Bacteria 390070
211 Ga0068859_100005939 3300005617 Bacteria 12395
212 Ga0068859_100100050 3300005617 Bacteria 2955
213 Ga0068859_100124931 3300005617 Unclassified 2641
214 Ga0068859_100213447 3300005617 Bacteria 2017
215 Ga0068859_101059311 3300005617 Bacteria 891
216 Ga0068859_101811069 3300005617 Bacteria 674
217 Ga0068864_100000685 3300005618 Bacteria 28427
218 Ga0068864_100061031 3300005618 Unclassified 3265
219 Ga0068864_100668520 3300005618 Bacteria 1012
220 Ga0068866_10008725 3300005718 Bacteria 4285
221 Ga0068866_10045822 3300005718 Bacteria 2196
222 Ga0068861_100020953 3300005719 Bacteria 4692
223 Ga0068861_100143217 3300005719 Bacteria 1953
224 Ga0068861_100156324 3300005719 Bacteria 1876
225 Ga0068861_101043800 3300005719 Bacteria 783
226 Ga0068861_102062290 3300005719 Unclassified 570
227 Ga0068851_10051439 3300005834 Bacteria 2093
228 Ga0068851_10124394 3300005834 Unclassified 1389
229 Ga0068851_10287313 3300005834 Unclassified 942
230 Ga0068851_10290021 3300005834 Bacteria 938
231 Ga0068851_10355106 3300005834 Bacteria 854
232 Ga0068851_10455572 3300005834 Bacteria 761
233 Ga0068851_10534757 3300005834 Bacteria 707
234 Ga0068851_10635160 3300005834 Bacteria 652
235 Ga0068851_11005144 3300005834 Bacteria 526
236 Ga0068870_10093933 3300005840 Bacteria 1683
237 Ga0068870_10106168 3300005840 Bacteria 1596
238 Ga0068863_100097940 3300005841 Bacteria 2785
239 Ga0068863_100111325 3300005841 Bacteria 2608
240 Ga0068863_100262047 3300005841 Bacteria 1671
241 Ga0068863_100633927 3300005841 Bacteria 1059
242 Ga0068863_100909407 3300005841 Bacteria 880
243 Ga0068858_100003163 3300005842 Bacteria 16480
244 Ga0068858_100041888 3300005842 Bacteria 4245
245 Ga0068858_100152160 3300005842 Bacteria 2176
246 Ga0068858_100471825 3300005842 Bacteria 1211
247 Ga0068860_100012160 3300005843 Bacteria 8479
248 Ga0068860_100175676 3300005843 Bacteria 2070
249 Ga0068860_100222848 3300005843 Bacteria 1831
250 Ga0068860_100332635 3300005843 Bacteria 1492
251 Ga0068860_100392845 3300005843 Bacteria 1371
252 Ga0068860_100400522 3300005843 Bacteria 1358
253 Ga0068860_100506718 3300005843 Bacteria 1205
254 Ga0068862_100111328 3300005844 Bacteria 2403
255 Ga0068862_100258213 3300005844 Bacteria 1590
256 Ga0081455_10532077 3300005937 Bacteria 782
257 Ga0081539_10047510 3300005985 Bacteria 2450
258 Ga0070715_10213479 3300006163 Bacteria 988
259 Ga0070716_100415015 3300006173 Bacteria 972
260 Ga0075366_10078707 3300006195 Bacteria 1967
261 Ga0075366_10261881 3300006195 Bacteria 1055
262 Ga0075366_10289024 3300006195 Bacteria 1002
263 Ga0075366_10818331 3300006195 Bacteria 579
264 Ga0097621_100003509 3300006237 Bacteria 10830
265 Ga0097621_100011491 3300006237 Bacteria 6523
266 Ga0097621_100017011 3300006237 Bacteria 5514
267 Ga0097621_100027689 3300006237 Bacteria 4460
268 Ga0097621_100100209 3300006237 Bacteria 2437
269 Ga0097621_100152109 3300006237 Bacteria 1985
270 Ga0097621_100242923 3300006237 Bacteria 1574
271 Ga0097621_100640902 3300006237 Bacteria 974
272 Ga0075370_10691442 3300006353 Bacteria 620
273 Ga0068871_100003013 3300006358 Bacteria 11561
274 Ga0068871_100008869 3300006358 Bacteria 7249
275 Ga0068871_100011269 3300006358 Bacteria 6555
276 Ga0068871_100022594 3300006358 Bacteria 4852
277 Ga0068871_100381836 3300006358 Bacteria 1251
278 Ga0068871_100461850 3300006358 Unclassified 1140
279 Ga0068871_100668136 3300006358 Bacteria 950
280 Ga0068871_100837381 3300006358 Bacteria 850
281 Ga0068871_100881040 3300006358 Bacteria 829
282 Ga0068871_100954062 3300006358 Bacteria 797
283 Ga0068871_101659752 3300006358 Bacteria 606
284 Ga0075428_100093358 3300006844 Bacteria 3281
285 Ga0075430_101132872 3300006846 Unclassified 644
286 Ga0075431_100005210 3300006847 Bacteria 12808
287 Ga0075434_100085548 3300006871 Bacteria 3153
288 Ga0075434_100439577 3300006871 Bacteria 1326
289 Ga0075429_100004647 3300006880 Bacteria 11808
290 Ga0075429_101088347 3300006880 Bacteria 698
291 Ga0068865_100002580 3300006881 Bacteria 10756
292 Ga0068865_100189750 3300006881 Bacteria 1588
293 Ga0068865_100348952 3300006881 Bacteria 1198
294 Ga0068865_100440266 3300006881 Bacteria 1075
295 Ga0068865_101087747 3300006881 Bacteria 704
296 Ga0097620_100000007 3300006931 Bacteria 390070
297 Ga0097620_100005939 3300006931 Bacteria 12395
298 Ga0097620_100100047 3300006931 Bacteria 2955
299 Ga0097620_100124933 3300006931 Unclassified 2641
300 Ga0097620_100213450 3300006931 Bacteria 2017
301 Ga0097620_101059293 3300006931 Bacteria 891
302 Ga0097620_101811725 3300006931 Bacteria 674
303 Ga0105251_10109895 3300009011 Unclassified 1256
304 Ga0105240_10356633 3300009093 Bacteria 1658
305 Ga0105240_11318630 3300009093 Bacteria 761
306 Ga0111539_10043506 3300009094 Bacteria 5383
307 Ga0111539_10119552 3300009094 Bacteria 3088
308 Ga0105245_10217098 3300009098 Bacteria 1843
309 Ga0105247_10010856 3300009101 Bacteria 5501
310 Ga0105247_10382127 3300009101 Bacteria 999
311 Ga0114129_10181526 3300009147 Bacteria 2863
312 Ga0105241_10000104 3300009174 Bacteria 60482
313 Ga0105241_10084119 3300009174 Bacteria 2497
314 Ga0105241_10285817 3300009174 Bacteria 1410
315 Ga0105241_10893525 3300009174 Bacteria 824
316 Ga0105241_10963258 3300009174 Bacteria 796
317 Ga0105242_10039659 3300009176 Bacteria 3791
318 Ga0105242_10077049 3300009176 Bacteria 2781
319 Ga0105242_10186413 3300009176 Bacteria 1834
320 Ga0105242_10664282 3300009176 Bacteria 1015
321 Ga0105242_12830787 3300009176 Bacteria 535
322 Ga0105237_10040911 3300009545 Bacteria 4675
323 Ga0105249_10009352 3300009553 Bacteria 8574
324 Ga0105249_10245322 3300009553 Bacteria 1773
325 Ga0105249_11233162 3300009553 Bacteria 819
326 Ga0105239_10143356 3300010375 Bacteria 2663
327 Ga0105239_10247625 3300010375 Bacteria 2001
328 Ga0105239_11362057 3300010375 Bacteria 819
329 Ga0105239_12675468 3300010375 Bacteria 582
330 Ga0105246_10001838 3300011119 Bacteria 12732
331 Ga0105246_10064135 3300011119 Bacteria 2565
332 Ga0105246_10072325 3300011119 Bacteria 2431
333 Ga0105246_10405929 3300011119 Bacteria 1133
334 Ga0105246_10878482 3300011119 Bacteria 802
335 Ga0105246_12551849 3300011119 Bacteria 504
336 Ga0157323_1027514 3300012495 Bacteria 584
337 Ga0157373_10018995 3300013100 Bacteria 5003
338 Ga0157373_10032880 3300013100 Bacteria 3733
339 Ga0157373_10606467 3300013100 Bacteria 797
340 Ga0157371_10031483 3300013102 Bacteria 3821
341 Ga0157371_10046246 3300013102 Bacteria 3095
342 Ga0157371_10415417 3300013102 Bacteria 986
343 Ga0157371_10430901 3300013102 Bacteria 968
344 Ga0157371_10480712 3300013102 Bacteria 916
345 Ga0157370_10202462 3300013104 Bacteria 1841
346 Ga0157370_10495032 3300013104 Bacteria 1123
347 Ga0157370_10595196 3300013104 Bacteria 1013
348 Ga0157370_10917435 3300013104 Bacteria 794
349 Ga0157369_10203150 3300013105 Bacteria 2079
350 Ga0157369_10241841 3300013105 Bacteria 1885
351 Ga0157369_11014679 3300013105 Unclassified 849
352 Ga0157374_10000237 3300013296 Bacteria 51331
353 Ga0157374_10005388 3300013296 Bacteria 10749
354 Ga0157374_10040035 3300013296 Bacteria 4315
355 Ga0157374_10066087 3300013296 Bacteria 3398
356 Ga0157374_10075500 3300013296 Bacteria 3185
357 Ga0157374_10098966 3300013296 Bacteria 2793
358 Ga0157374_10190525 3300013296 Bacteria 2006
359 Ga0157374_10290082 3300013296 Bacteria 1617
360 Ga0157374_10578079 3300013296 Unclassified 1132
361 Ga0157374_11113166 3300013296 Bacteria 810
362 Ga0157378_10020420 3300013297 Bacteria 5826
363 Ga0157378_10131265 3300013297 Bacteria 2319
364 Ga0157378_10174714 3300013297 Bacteria 2017
365 Ga0157378_10228960 3300013297 Bacteria 1770
366 Ga0157378_10379531 3300013297 Bacteria 1388
367 Ga0157378_11176322 3300013297 Bacteria 806
368 Ga0157378_11265117 3300013297 Bacteria 778
369 Ga0163162_10000226 3300013306 Bacteria 51615
370 Ga0163162_10000576 3300013306 Bacteria 33923
371 Ga0163162_10006217 3300013306 Bacteria 11572
372 Ga0163162_10088452 3300013306 Bacteria 3177
373 Ga0163162_10090364 3300013306 Bacteria 3144
374 Ga0163162_10135776 3300013306 Bacteria 2571
375 Ga0163162_10174200 3300013306 Bacteria 2276
376 Ga0163162_10264187 3300013306 Bacteria 1853
377 Ga0163162_11236596 3300013306 Unclassified 848
378 Ga0163162_12597625 3300013306 Bacteria 583
379 Ga0157372_10004144 3300013307 Bacteria 15522
380 Ga0157372_10034745 3300013307 Bacteria 5545
381 Ga0157372_10132899 3300013307 Bacteria 2865
382 Ga0157372_10359916 3300013307 Bacteria 1695
383 Ga0157372_10505059 3300013307 Bacteria 1410
384 Ga0157372_10577543 3300013307 Unclassified 1310
385 Ga0157372_10717693 3300013307 Bacteria 1163
386 Ga0157372_10872351 3300013307 Bacteria 1044
387 Ga0157372_10952936 3300013307 Bacteria 995
388 Ga0157372_11121395 3300013307 Bacteria 910
389 Ga0157372_11207167 3300013307 Bacteria 874
390 Ga0157372_11239851 3300013307 Unclassified 861
391 Ga0157372_11370375 3300013307 Bacteria 816
392 Ga0157372_13173433 3300013307 Bacteria 524
393 Ga0157375_10079604 3300013308 Bacteria 3313
394 Ga0157375_10092748 3300013308 Bacteria 3084
395 Ga0157375_10171047 3300013308 Bacteria 2320
396 Ga0157375_10257339 3300013308 Bacteria 1907
397 Ga0157375_10634183 3300013308 Bacteria 1226
398 Ga0157375_11279207 3300013308 Unclassified 862
399 Ga0157375_11930254 3300013308 Bacteria 701
400 Ga0157375_13287868 3300013308 Bacteria 539
401 Ga0163163_10000088 3300014325 Bacteria 101126
402 Ga0163163_10003449 3300014325 Bacteria 13434
403 Ga0163163_10012983 3300014325 Bacteria 7608
404 Ga0163163_10191440 3300014325 Bacteria 2094
405 Ga0163163_10601722 3300014325 Unclassified 1162
406 Ga0163163_10661105 3300014325 Bacteria 1108
407 Ga0163163_10958080 3300014325 Bacteria 919
408 Ga0157380_10006616 3300014326 Bacteria 8176
409 Ga0157380_10131722 3300014326 Bacteria 2134
410 Ga0157380_10417482 3300014326 Bacteria 1278
411 Ga0157380_10522069 3300014326 Unclassified 1158
412 Ga0157380_11733959 3300014326 Bacteria 683
413 Ga0157377_10009383 3300014745 Bacteria 4799
414 Ga0157377_10018280 3300014745 Bacteria 3641
415 Ga0157377_10089787 3300014745 Bacteria 1812
416 Ga0157377_10095644 3300014745 Bacteria 1761
417 Ga0157377_10603246 3300014745 Bacteria 783
418 Ga0157377_11560770 3300014745 Bacteria 527
419 Ga0157379_10050431 3300014968 Bacteria 3715
420 Ga0157379_10064911 3300014968 Bacteria 3263
421 Ga0157379_10128633 3300014968 Bacteria 2279
422 Ga0157379_10241953 3300014968 Bacteria 1637
423 Ga0157379_10555359 3300014968 Bacteria 1069
424 Ga0157376_10006924 3300014969 Bacteria 8035
425 Ga0157376_10073355 3300014969 Bacteria 2914
426 Ga0157376_10101097 3300014969 Bacteria 2519
427 Ga0157376_10148730 3300014969 Bacteria 2110
428 Ga0157376_10176198 3300014969 Bacteria 1951
429 Ga0157376_10317978 3300014969 Bacteria 1479
430 Ga0157376_10526578 3300014969 Bacteria 1166
431 Ga0157376_10604161 3300014969 Bacteria 1092
432 Ga0157376_10898120 3300014969 Bacteria 904
433 Ga0182007_10267661 3300015262 Bacteria 618
434 Ga0163161_10002796 3300017792 Bacteria 12374
435 Ga0163161_10027138 3300017792 Bacteria 4061
436 Ga0163161_10123937 3300017792 Bacteria 1944
437 Ga0163161_10135966 3300017792 Bacteria 1858
438 Ga0163161_10326686 3300017792 Bacteria 1214
439 Ga0206356_10707627 3300020070 Bacteria 644
440 Ga0209258_107471 3300025242 Bacteria 1620
441 Ga0209646_1001328 3300025246 Bacteria 6893
442 Ga0207697_10037663 3300025315 Unclassified 1982
443 Ga0207656_10040510 3300025321 Bacteria 1975
444 Ga0207656_10228301 3300025321 Unclassified 907
445 Ga0207656_10346764 3300025321 Unclassified 741
446 Ga0207656_10363256 3300025321 Bacteria 724
447 Ga0207656_10478494 3300025321 Bacteria 631
448 Ga0207682_10052614 3300025893 Unclassified 1688
449 Ga0207682_10468252 3300025893 Bacteria 597
450 Ga0207642_10028662 3300025899 Bacteria 2295
451 Ga0207642_10050953 3300025899 Bacteria 1870
452 Ga0207642_10203548 3300025899 Bacteria 1095
453 Ga0207642_10920230 3300025899 Bacteria 561
454 Ga0207710_10030398 3300025900 Bacteria 2356
455 Ga0207688_10022289 3300025901 Bacteria 3465
456 Ga0207680_10000015 3300025903 Bacteria 138253
457 Ga0207680_10009136 3300025903 Bacteria 4902
458 Ga0207680_10009247 3300025903 Bacteria 4878
459 Ga0207680_10029384 3300025903 Unclassified 3087
460 Ga0207680_10378907 3300025903 Bacteria 997
461 Ga0207680_10901511 3300025903 Unclassified 634
462 Ga0207647_10000061 3300025904 Bacteria 83985
463 Ga0207647_10009722 3300025904 Bacteria 6823
464 Ga0207647_10059317 3300025904 Bacteria 2342
465 Ga0207647_10206732 3300025904 Unclassified 1135
466 Ga0207685_10006223 3300025905 Bacteria 3231
467 Ga0207645_10000136 3300025907 Bacteria 56153
468 Ga0207645_10390545 3300025907 Bacteria 935
469 Ga0207645_10454611 3300025907 Bacteria 865
470 Ga0207645_10660936 3300025907 Bacteria 710
471 Ga0207643_10071381 3300025908 Bacteria 1999
472 Ga0207643_10200968 3300025908 Bacteria 1213
473 Ga0207643_10540481 3300025908 Bacteria 747
474 Ga0207643_10552579 3300025908 Bacteria 739
475 Ga0207643_10878620 3300025908 Bacteria 581
476 Ga0207705_10272093 3300025909 Bacteria 1295
477 Ga0207705_10584278 3300025909 Unclassified 868
478 Ga0207705_10833618 3300025909 Bacteria 715
479 Ga0207654_10020022 3300025911 Bacteria 3540
480 Ga0207654_10074849 3300025911 Bacteria 2022
481 Ga0207654_10089265 3300025911 Bacteria 1875
482 Ga0207654_10403306 3300025911 Bacteria 951
483 Ga0207707_10242770 3300025912 Bacteria 1566
484 Ga0207707_10422418 3300025912 Bacteria 1143
485 Ga0207695_10545403 3300025913 Bacteria 1041
486 Ga0207671_10001528 3300025914 Bacteria 26548
487 Ga0207671_10005708 3300025914 Bacteria 11360
488 Ga0207671_10075947 3300025914 Bacteria 2514
489 Ga0207671_11548732 3300025914 Bacteria 511
490 Ga0207660_10628210 3300025917 Bacteria 875
491 Ga0207660_11319472 3300025917 Bacteria 586
492 Ga0207657_10160448 3300025919 Bacteria 1826
493 Ga0207657_10173809 3300025919 Bacteria 1744
494 Ga0207657_10914942 3300025919 Bacteria 675
495 Ga0207649_10000419 3300025920 Bacteria 31284
496 Ga0207649_10009396 3300025920 Bacteria 5351
497 Ga0207649_10085939 3300025920 Bacteria 2048
498 Ga0207649_10316633 3300025920 Bacteria 1145
499 Ga0207649_10325496 3300025920 Bacteria 1130
500 Ga0207649_11396008 3300025920 Bacteria 554
501 Ga0207681_10099843 3300025923 Bacteria 2091
502 Ga0207681_10329909 3300025923 Bacteria 1216
503 Ga0207681_10736600 3300025923 Bacteria 821
504 Ga0207681_11190182 3300025923 Bacteria 640
505 Ga0207681_11676691 3300025923 Bacteria 531
506 Ga0207694_10045967 3300025924 Bacteria 3374
507 Ga0207650_10020700 3300025925 Bacteria 4642
508 Ga0207650_10038566 3300025925 Bacteria 3490
509 Ga0207650_10071435 3300025925 Bacteria 2611
510 Ga0207650_10203430 3300025925 Bacteria 1587
511 Ga0207650_10612196 3300025925 Bacteria 916
512 Ga0207650_11107726 3300025925 Bacteria 674
513 Ga0207659_10008757 3300025926 Bacteria 6301
514 Ga0207659_10071251 3300025926 Bacteria 2537
515 Ga0207659_10113269 3300025926 Bacteria 2066
516 Ga0207659_10116399 3300025926 Bacteria 2041
517 Ga0207659_10272795 3300025926 Bacteria 1380
518 Ga0207659_10664914 3300025926 Bacteria 891
519 Ga0207687_11274519 3300025927 Bacteria 632
520 Ga0207644_10151465 3300025931 Bacteria 1795
521 Ga0207644_10158308 3300025931 Bacteria 1758
522 Ga0207644_10615736 3300025931 Bacteria 902
523 Ga0207644_10670424 3300025931 Bacteria 864
524 Ga0207690_10011054 3300025932 Bacteria 5383
525 Ga0207690_10190103 3300025932 Bacteria 1552
526 Ga0207706_10002103 3300025933 Bacteria 19496
527 Ga0207706_10018001 3300025933 Bacteria 6357
528 Ga0207706_10074924 3300025933 Bacteria 2976
529 Ga0207706_10084464 3300025933 Bacteria 2791
530 Ga0207706_11386503 3300025933 Unclassified 578
531 Ga0207686_10149086 3300025934 Bacteria 1626
532 Ga0207686_10174675 3300025934 Bacteria 1518
533 Ga0207686_10177655 3300025934 Bacteria 1507
534 Ga0207686_10924259 3300025934 Bacteria 705
535 Ga0207670_10185937 3300025936 Bacteria 1568
536 Ga0207670_10340732 3300025936 Bacteria 1185
537 Ga0207670_11764547 3300025936 Bacteria 526
538 Ga0207669_10075623 3300025937 Bacteria 2134
539 Ga0207669_10189217 3300025937 Bacteria 1483
540 Ga0207704_10128813 3300025938 Bacteria 1748
541 Ga0207704_10177265 3300025938 Bacteria 1536
542 Ga0207665_11071219 3300025939 Bacteria 642
543 Ga0207691_10011435 3300025940 Bacteria 8516
544 Ga0207691_10051301 3300025940 Bacteria 3773
545 Ga0207691_10432383 3300025940 Bacteria 1121
546 Ga0207691_10512499 3300025940 Bacteria 1018
547 Ga0207691_10546586 3300025940 Bacteria 982
548 Ga0207691_10888830 3300025940 Bacteria 746
549 Ga0207689_10001007 3300025942 Bacteria 27057
550 Ga0207689_10021058 3300025942 Bacteria 5481
551 Ga0207689_10167225 3300025942 Bacteria 1812
552 Ga0207689_11353302 3300025942 Unclassified 597
553 Ga0207661_10000370 3300025944 Bacteria 28914
554 Ga0207661_10108637 3300025944 Bacteria 2342
555 Ga0207661_10331612 3300025944 Bacteria 1369
556 Ga0207661_11400893 3300025944 Bacteria 641
557 Ga0207661_11609000 3300025944 Bacteria 594
558 Ga0207679_10000266 3300025945 Bacteria 39927
559 Ga0207679_10163117 3300025945 Bacteria 1827
560 Ga0207679_10169599 3300025945 Bacteria 1795
561 Ga0207679_10418597 3300025945 Bacteria 1182
562 Ga0207679_10812858 3300025945 Unclassified 853
563 Ga0207667_10100362 3300025949 Bacteria 2986
564 Ga0207651_10204392 3300025960 Bacteria 1585
565 Ga0207651_10356230 3300025960 Unclassified 1234
566 Ga0207651_10434882 3300025960 Bacteria 1123
567 Ga0207651_11235144 3300025960 Bacteria 671
568 Ga0207651_11947061 3300025960 Bacteria 528
569 Ga0207712_10186708 3300025961 Bacteria 1633
570 Ga0207668_10011982 3300025972 Bacteria 5292
571 Ga0207668_10256430 3300025972 Bacteria 1423
572 Ga0207640_10021342 3300025981 Bacteria 3859
573 Ga0207640_10074654 3300025981 Bacteria 2295
574 Ga0207640_10651517 3300025981 Bacteria 897
575 Ga0207640_10713989 3300025981 Bacteria 861
576 Ga0207640_11374742 3300025981 Bacteria 632
577 Ga0207640_11540617 3300025981 Bacteria 598
578 Ga0207640_12143983 3300025981 Unclassified 507
579 Ga0207658_10054580 3300025986 Unclassified 2957
580 Ga0207658_10104039 3300025986 Bacteria 2230
581 Ga0207658_10202354 3300025986 Bacteria 1659
582 Ga0207658_10471208 3300025986 Bacteria 1114
583 Ga0207658_10496302 3300025986 Unclassified 1087
584 Ga0207658_10630113 3300025986 Bacteria 965
585 Ga0207677_10005974 3300026023 Bacteria 6630
586 Ga0207677_10285222 3300026023 Unclassified 1357
587 Ga0207677_10778385 3300026023 Unclassified 855
588 Ga0207677_11314847 3300026023 Bacteria 664
589 Ga0207677_11480551 3300026023 Bacteria 627
590 Ga0207703_10007227 3300026035 Bacteria 8831
591 Ga0207703_10097933 3300026035 Bacteria 2479
592 Ga0207703_10546858 3300026035 Bacteria 1091
593 Ga0207703_10813557 3300026035 Bacteria 892
594 Ga0207639_10012815 3300026041 Bacteria 5851
595 Ga0207639_10030223 3300026041 Bacteria 3972
596 Ga0207639_10082339 3300026041 Bacteria 2551
597 Ga0207639_10094529 3300026041 Bacteria 2400
598 Ga0207639_10217142 3300026041 Bacteria 1649
599 Ga0207639_10386592 3300026041 Bacteria 1258
600 Ga0207639_10596252 3300026041 Bacteria 1018
601 Ga0207639_11089568 3300026041 Unclassified 749
602 Ga0207639_11190964 3300026041 Bacteria 715
603 Ga0207639_11465351 3300026041 Bacteria 641
604 Ga0207639_11760258 3300026041 Bacteria 580
605 Ga0207678_10090917 3300026067 Bacteria 2608
606 Ga0207708_10562951 3300026075 Bacteria 962
607 Ga0207708_11176236 3300026075 Unclassified 670
608 Ga0207708_11257629 3300026075 Bacteria 648
609 Ga0207702_10054227 3300026078 Bacteria 3396
610 Ga0207702_10338432 3300026078 Bacteria 1437
611 Ga0207702_10975490 3300026078 Unclassified 840
612 Ga0207702_11499653 3300026078 Unclassified 668
613 Ga0207641_10000056 3300026088 Bacteria 170719
614 Ga0207641_10037835 3300026088 Bacteria 4032
615 Ga0207641_10080565 3300026088 Bacteria 2825
616 Ga0207641_10091216 3300026088 Bacteria 2666
617 Ga0207641_10105683 3300026088 Bacteria 2487
618 Ga0207641_10335652 3300026088 Bacteria 1437
619 Ga0207641_12277170 3300026088 Bacteria 541
620 Ga0207648_10004655 3300026089 Bacteria 14042
621 Ga0207648_10016945 3300026089 Bacteria 6639
622 Ga0207648_10094532 3300026089 Bacteria 2614
623 Ga0207648_10304460 3300026089 Bacteria 1430
624 Ga0207648_10347861 3300026089 Bacteria 1336
625 Ga0207648_10530486 3300026089 Bacteria 1079
626 Ga0207648_10724644 3300026089 Bacteria 922
627 Ga0207648_11148431 3300026089 Bacteria 729
628 Ga0207676_10019254 3300026095 Bacteria 4976
629 Ga0207676_10024265 3300026095 Bacteria 4485
630 Ga0207676_10038829 3300026095 Bacteria 3637
631 Ga0207676_10362899 3300026095 Bacteria 1343
632 Ga0207676_11158063 3300026095 Bacteria 766
633 Ga0207674_10007803 3300026116 Bacteria 12446
634 Ga0207674_10189753 3300026116 Bacteria 2005
635 Ga0207674_10223695 3300026116 Unclassified 1830
636 Ga0207674_10327433 3300026116 Bacteria 1482
637 Ga0207674_10367947 3300026116 Bacteria 1390
638 Ga0207674_11896687 3300026116 Unclassified 562
639 Ga0207675_100021679 3300026118 Bacteria 5980
640 Ga0207675_100044754 3300026118 Bacteria 4137
641 Ga0207675_100150383 3300026118 Bacteria 2215
642 Ga0207675_100754399 3300026118 Bacteria 985
643 Ga0207675_100944893 3300026118 Bacteria 879
644 Ga0207675_101838666 3300026118 Unclassified 625
645 Ga0207683_10002007 3300026121 Bacteria 18003
646 Ga0207683_10007862 3300026121 Bacteria 9124
647 Ga0207683_10010220 3300026121 Bacteria 8005
648 Ga0207683_10311957 3300026121 Bacteria 1440
649 Ga0207683_10328787 3300026121 Bacteria 1401
650 Ga0207698_10014929 3300026142 Bacteria 5184
651 Ga0207698_10048581 3300026142 Bacteria 3222
652 Ga0207698_10063287 3300026142 Bacteria 2894
653 Ga0207698_10070251 3300026142 Bacteria 2774
654 Ga0207698_10118309 3300026142 Bacteria 2237
655 Ga0207698_10278731 3300026142 Bacteria 1545
656 Ga0207698_10694245 3300026142 Bacteria 1012
657 Ga0207698_12250113 3300026142 Unclassified 557
658 Ga0209969_1014467 3300027360 Bacteria 1149
659 Ga0209999_1073538 3300027543 Bacteria 657
660 Ga0268266_10407981 3300028379 Bacteria 1286
661 Ga0268266_10531162 3300028379 Unclassified 1125
662 Ga0268266_10654511 3300028379 Bacteria 1011
663 Ga0268265_10111456 3300028380 Unclassified 2235
664 Ga0268265_10181166 3300028380 Bacteria 1810
665 Ga0268265_10359237 3300028380 Bacteria 1333
666 Ga0268265_11590769 3300028380 Bacteria 658
667 Ga0268264_10000143 3300028381 Bacteria 170031
668 Ga0268264_10001996 3300028381 Bacteria 18331
669 Ga0268264_10006748 3300028381 Bacteria 9645
670 Ga0268264_10102001 3300028381 Bacteria 2496
671 Ga0268264_10252306 3300028381 Bacteria 1639
672 Ga0268264_10703411 3300028381 Bacteria 1004
673 Ga0307517_10012359 3300028786 Bacteria 11728
674 Ga0307517_10537432 3300028786 Bacteria 587
675 Ga0307515_10000010 3300028794 Bacteria 651586
676 Ga0307515_10828988 3300028794 Bacteria 550
677 Ga0307509_10064977 3300031507 Bacteria 3835
678 Ga0307509_10073156 3300031507 Bacteria 3569
679 Ga0307408_100852758 3300031548 Bacteria 831
680 Ga0265313_10097472 3300031595 Bacteria 1310
681 Ga0307508_10005346 3300031616 Bacteria 12230
682 Ga0307508_10409235 3300031616 Unclassified 948
683 Ga0307516_10000310 3300031730 Bacteria 63335
684 Ga0307516_10091390 3300031730 Bacteria 2872
685 Ga0307405_11532758 3300031731 Unclassified 586
686 Ga0307413_10114910 3300031824 Bacteria 1810
687 Ga0307413_10160978 3300031824 Unclassified 1577
688 Ga0307413_11311686 3300031824 Bacteria 634
689 Ga0307410_10135676 3300031852 Bacteria 1814
690 Ga0307410_10394426 3300031852 Bacteria 1117
691 Ga0307406_10457528 3300031901 Bacteria 1025
692 Ga0307406_10801726 3300031901 Bacteria 795
693 Ga0307407_11354767 3300031903 Unclassified 559
694 Ga0307407_11694403 3300031903 Unclassified 503
695 Ga0307412_10261514 3300031911 Unclassified 1349
696 Ga0307412_10694157 3300031911 Bacteria 873
697 Ga0307416_100824398 3300032002 Bacteria 1025
698 Ga0307416_102050624 3300032002 Unclassified 674
699 Ga0307416_102554959 3300032002 Unclassified 609
700 Ga0307414_10017473 3300032004 Bacteria 4390
701 Ga0307414_10040797 3300032004 Bacteria 3138
702 Ga0307414_10109465 3300032004 Bacteria 2099
703 Ga0307414_11434493 3300032004 Unclassified 642
704 Ga0307411_10108887 3300032005 Bacteria 1978
705 Ga0307415_100564415 3300032126 Bacteria 1007
706 Ga0307415_102473008 3300032126 Bacteria 511
707 Ga0373934_0082751 3300035086 Bacteria 1290
708 Ga0373932_0192779 3300035112 Bacteria 721
709 Ga0373945_0242304 3300035116 Bacteria 759
710 Ga0373953_0421267 3300035117 Bacteria 589
711 Ga0373943_0374155 3300035170 Bacteria 819
712 Ga0373946_0195701 3300035171 Bacteria 966
713 Ga0373955_0496221 3300035172 Bacteria 745
714 Ga0373924_0006769 3300035410 Bacteria 4118
715 Ga0373935_0083615 3300035692 Bacteria 2078
716 Ga0373947_0074177 3300035725 Bacteria 2093
717 Ga0373937_0002104 3300036401 Bacteria 16647
718 Ga0373925_0510186 3300037068 Bacteria 987
719 Ga0395900_0110793 3300037418 Bacteria 2820
720 Ga0395900_0188108 3300037418 Bacteria 2095
721 Ga0395898_0070019 3300037466 Bacteria 3393
722 Ga0395905_0001345 3300037471 Bacteria 29943
723 Ga0395905_0136116 3300037471 Bacteria 2311
724 Ga0395905_0179884 3300037471 Bacteria 1985
725 Ga0395905_0202879 3300037471 Bacteria 1859
726 Ga0395905_1287078 3300037471 Bacteria 635
727 Ga0395901_0244126 3300038443 Bacteria 1872
728 Ga0436363_0872388 3300039450 Bacteria 510
729 Ga0439436_0002743 3300041404 Bacteria 5323
730 Ga0439439_0077696 3300041406 Bacteria 894
731 Ga0439439_0183551 3300041406 Bacteria 603
732 Ga0439461_0137082 3300041410 Bacteria 623
733 Ga0451787_785918 3300041441 Bacteria 698
734 Ga0451794_27472 3300041446 Bacteria 606
735 Ga0451791_0399799 3300041451 Bacteria 663
736 Ga0451791_1208094 3300041451 Bacteria 570
737 Ga0451793_1587185 3300041452 Bacteria 606
738 Ga0451797_1588628 3300041453 Bacteria 1018
739 Ga0451795_1448333 3300041456 Bacteria 521
740 Ga0451795_1559977 3300041456 Bacteria 2080
741 Ga0451800_0588693 3300041459 Bacteria 688
742 Ga0451802_1731334 3300041460 Bacteria 2320
743 Ga0451833_0017597 3300041491 Bacteria 974
744 Ga0451835_0789270 3300041492 Bacteria 596
745 Ga0451837_0197040 3300041494 Bacteria 622
746 Ga0451841_0599628 3300041498 Bacteria 1549
747 Ga0451851_0687021 3300041507 Bacteria 1499
748 Ga0451843_1199062 3300041509 Bacteria 522
749 Ga0451853_3623145 3300041512 Bacteria 553
750 Ga0439431_0242308 3300041997 Bacteria 533
751 Ga0439445_0156231 3300042004 Bacteria 665
752 Ga0439449_0031986 3300042007 Bacteria 1960
753 Ga0439457_002182 3300042014 Bacteria 5665
754 Ga0439462_0001485 3300042015 Bacteria 5232
755 Ga0450922_002074 3300042124 Bacteria 1906
756 Ga0450923_031380 3300042125 Bacteria 1085
757 Ga0450891_013892 3300042129 Bacteria 757
758 Ga0439446_0021043 3300042156 Bacteria 1842
759 Ga0451577_0993182 3300042876 Bacteria 754
760 Ga0466969_0000382 3300044656 Bacteria 24366
761 Ga0466972_0000010 3300044658 Bacteria 256339
762 Ga0466972_0032803 3300044658 Bacteria 2549
763 Ga0466972_0174705 3300044658 Unclassified 1008
764 Ga0453683_0039267 3300044673 Bacteria 2975
765 Ga0466965_0159272 3300044683 Bacteria 1183
766 Ga0466966_0000176 3300044684 Bacteria 42093
767 Ga0466961_0051907 3300044693 Bacteria 2618
768 Ga0466961_0908939 3300044693 Bacteria 524
769 Ga0466964_0016312 3300044706 Bacteria 2835
770 Ga0453684_0023172 3300044712 Bacteria 9163
771 Ga0466971_0066558 3300044719 Bacteria 1633
772 Ga0466971_0140109 3300044719 Bacteria 1126
773 Ga0466971_0466661 3300044719 Bacteria 620
774 Ga0466968_0192757 3300044735 Unclassified 952
775 Ga0466957_0000577 3300044842 Bacteria 18517
776 Ga0466959_0000016 3300045049 Bacteria 144600
777 Ga0451576_1131007 3300045051 Bacteria 819
778 Ga0466967_2572569 3300045976 Bacteria 504
779 Ga0495592_0026380 3300046454 Bacteria 4405
780 Ga0495638_0010167 3300046460 Bacteria 6553
781 Ga0495638_0291223 3300046460 Unclassified 883
782 Ga0495653_0043228 3300046463 Bacteria 3505
783 Ga0495650_0047770 3300046471 Bacteria 1788
784 Ga0495580_0473514 3300046472 Bacteria 838
785 Ga0495582_0458872 3300046473 Bacteria 736
786 Ga0495608_0104141 3300046511 Bacteria 1828
787 Ga0495618_0316918 3300046514 Bacteria 966
788 Ga0495628_0062219 3300046516 Bacteria 2926
789 Ga0495630_0003153 3300046517 Bacteria 11441
790 Ga0495632_0230222 3300046519 Bacteria 836
791 Ga0495666_0223564 3300046526 Bacteria 862
792 Ga0495652_0585574 3300046529 Bacteria 763
793 Ga0495665_0578760 3300046531 Bacteria 562
794 Ga0495587_0062204 3300046536 Bacteria 2186
795 Ga0495621_0269283 3300046539 Unclassified 700
796 Ga0495645_0251921 3300046543 Bacteria 1173
797 Ga0495668_0000212 3300046616 Bacteria 84542
798 Ga0495668_0002317 3300046616 Bacteria 15925
799 Ga0495634_0019397 3300046642 Bacteria 4833
800 Ga0495625_0087620 3300046660 Bacteria 2158
801 Ga0495613_0118295 3300046689 Bacteria 1905
802 Ga0495581_0718297 3300047315 Bacteria 576
803 Ga0495674_0330925 3300047319 Bacteria 1239
804 Ga0495672_0013561 3300047320 Bacteria 5617
805 Ga0495672_0028834 3300047320 Bacteria 3505
806 Ga0495672_0106175 3300047320 Bacteria 1514
807 Ga0495676_0376752 3300047321 Bacteria 945
808 Ga0495680_0144564 3300047322 Bacteria 1738
809 Ga0495687_061674 3300047443 Bacteria 1541
810 Ga0495675_0095507 3300047444 Bacteria 1864
811 Ga0495684_0128580 3300047471 Bacteria 1904
812 Ga0495614_0228366 3300048089 Bacteria 848
813 Ga0496100_0268484 3300048903 Bacteria 1268
814 Ga0496101_0500328 3300048904 Bacteria 960
815 Ga0496105_0167115 3300048908 Bacteria 1805
816 Ga0496108_0172689 3300048911 Bacteria 1871
817 Ga0496108_0927975 3300048911 Unclassified 746
818 Ga0496108_1293232 3300048911 Bacteria 614
819 Ga0496109_0420713 3300048912 Bacteria 1262
820 Ga0496109_0436602 3300048912 Bacteria 1237
821 Ga0496110_0879805 3300048913 Unclassified 801
822 Ga0496111_0089780 3300048914 Bacteria 2251
823 Ga0496112_1587198 3300048915 Bacteria 568
824 Ga0496124_0043266 3300048927 Bacteria 3872
825 Ga0501343_024351 3300049132 Bacteria 544
826 Ga0501292_014129 3300049515 Bacteria 1235
827 Ga0501298_011148 3300049521 Bacteria 1557
828 Ga0501336_031623 3300049552 Bacteria 522
829 Ga0501034_0001387 3300049571 Bacteria 32582
830 Ga0501038_0899795 3300049574 Bacteria 653
831 Ga0501043_0066157 3300049579 Bacteria 2838
832 Ga0501072_0233777 3300049588 Bacteria 1464
833 Ga0501202_002207 3300049652 Bacteria 3248
834 Ga0501207_014739 3300049654 Bacteria 1196
835 Ga0501217_000585 3300049661 Bacteria 6139
836 Ga0501217_105623 3300049661 Bacteria 804
837 Ga0501223_016328 3300049663 Bacteria 1467
838 Ga0501223_072954 3300049663 Bacteria 680
839 Ga0501224_047312 3300049664 Bacteria 655
840 Ga0501228_018578 3300049666 Bacteria 767
841 Ga0501233_083594 3300049668 Bacteria 825
842 Ga0501235_011635 3300049669 Bacteria 1930
843 Ga0501243_000796 3300049675 Bacteria 4379
844 Ga0501249_175136 3300049679 Bacteria 552
845 Ga0501252_004199 3300049682 Bacteria 1526
846 Ga0501257_130663 3300049686 Bacteria 679
847 Ga0501259_002156 3300049688 Bacteria 3228
848 Ga0501259_049588 3300049688 Bacteria 848
849 Ga0501259_149958 3300049688 Bacteria 576
850 Ga0501221_000606 3300049704 Bacteria 5723
851 Ga0501221_133229 3300049704 Bacteria 645
852 Ga0501225_0000561 3300049705 Bacteria 11624
853 Ga0501234_003922 3300049707 Bacteria 2336
854 Ga0501245_000123 3300049708 Bacteria 7876
855 Ga0501266_059389 3300049763 Unclassified 608
856 Ga0501266_094946 3300049763 Bacteria 522
857 Ga0501270_119577 3300049767 Bacteria 572
858 Ga0501280_008373 3300049776 Bacteria 1443
859 Ga0501035_0394525 3300049822 Unclassified 1152
860 Ga0501044_0128850 3300049823 Bacteria 2525
861 Ga0501044_0633886 3300049823 Bacteria 959
862 nmdc:mga0k408_145923_c1 3300050493 Bacteria 1409
863 nmdc:mga0k408_164532_c1 3300050493 Bacteria 915
864 nmdc:mga0k408_682342_c1 3300050493 Bacteria 603
865 nmdc:mga05p37_914_c1 3300050507 Bacteria 33336
866 nmdc:mga09592_20986_c1 3300050508 Bacteria 5378
867 nmdc:mga06r32_443171_c1 3300050510 Bacteria 1279
868 nmdc:mga08y16_292197_c1 3300050511 Bacteria 1680
869 nmdc:mga08y16_98820_c1 3300050511 Bacteria 3039
870 nmdc:mga0n895_317322_c1 3300050512 Bacteria 1579
871 nmdc:mga0n895_651069_c1 3300050512 Bacteria 1052
872 Ga0495619_0429352 3300053085 Bacteria 911
873 Ga0500578_0001201 3300053086 Bacteria 27358
874 Ga0500578_0335650 3300053086 Bacteria 887
875 Ga0500646_0002555 3300053090 Bacteria 4721
876 Ga0500646_0052662 3300053090 Bacteria 1178
877 Ga0500583_0000037 3300053092 Bacteria 92466
878 Ga0500651_0292134 3300053093 Bacteria 937
879 Ga0500651_0627231 3300053093 Unclassified 581
880 Ga0500566_0344566 3300053094 Unclassified 685
881 Ga0500648_412996 3300053097 Bacteria 503
882 Ga0500650_0081223 3300053098 Bacteria 1516
883 Ga0500654_140194 3300053099 Bacteria 884
884 Ga0500555_052757 3300053103 Bacteria 1109
885 Ga0500556_0026589 3300053104 Bacteria 1924
886 Ga0500556_0321681 3300053104 Unclassified 602
887 Ga0500569_150109 3300053109 Bacteria 786
888 Ga0500572_149345 3300053111 Bacteria 763
889 Ga0500642_0134766 3300053130 Bacteria 1157
890 Ga0500642_0149458 3300053130 Bacteria 1096
891 Ga0500642_0409984 3300053130 Bacteria 589
892 Ga0500652_086593 3300053131 Bacteria 1306
893 Ga0500652_116468 3300053131 Bacteria 1116
894 Ga0500658_0476512 3300053134 Bacteria 567
895 Ga0500559_0335764 3300053136 Bacteria 708
896 Ga0500568_0073147 3300053139 Bacteria 1309
897 Ga0500568_0287510 3300053139 Unclassified 597
898 Ga0500585_204588 3300053144 Bacteria 655
899 Ga0500589_159099 3300053147 Bacteria 910
900 Ga0500603_025754 3300053150 Bacteria 1482
901 Ga0500603_163692 3300053150 Bacteria 695
902 Ga0500604_0003061 3300053151 Bacteria 4494
903 Ga0500604_0106764 3300053151 Bacteria 927
904 Ga0500616_0008456 3300053153 Bacteria 6388
905 Ga0500619_065082 3300053154 Bacteria 1205
906 Ga0500622_0032820 3300053156 Bacteria 2722
907 Ga0500622_0056323 3300053156 Bacteria 2013
908 Ga0500636_0058636 3300053177 Bacteria 2250
909 Ga0500611_014276 3300053727 Bacteria 1382
910 Ga0587109_120284 3300059624 Bacteria 623
911 Ga0466962_0341871 3300061719 Bacteria 744
912 Ga0466962_0532944 3300061719 Unclassified 596

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035117 Ga0373953_0421267 Ga0373953_0421267_23_349 107
2 3300041491 Ga0451833_0017597 Ga0451833_0017597_583_906 107
3 3300044658 Ga0466972_0174705 Ga0466972_0174705_652_975 107
4 3300037471 Ga0395905_0202879 Ga0395905_0202879_1482_1826 114
5 3300049521 Ga0501298_011148 Ga0501298_011148_20_367 114
6 3300049666 Ga0501228_018578 Ga0501228_018578_399_746 114
7 3300025933 Ga0207706_11386503 Ga0207706_113865031 118
8 3300005329 Ga0070683_100010147 Ga0070683_1000101475 121
9 3300005336 Ga0070680_100701041 Ga0070680_1007010411 121
10 3300005344 Ga0070661_100348972 Ga0070661_1003489722 121
11 3300005355 Ga0070671_100415093 Ga0070671_1004150932 121
12 3300005364 Ga0070673_100959417 Ga0070673_1009594172 121
13 3300005458 Ga0070681_10389720 Ga0070681_103897202 121
14 3300005535 Ga0070684_100047735 Ga0070684_1000477351 121
15 3300005539 Ga0068853_100866258 Ga0068853_1008662581 121
16 3300005564 Ga0070664_100432481 Ga0070664_1004324812 121
17 3300005834 Ga0068851_10051439 Ga0068851_100514392 121
18 3300025321 Ga0207656_10040510 Ga0207656_100405103 121
19 3300025914 Ga0207671_11548732 Ga0207671_115487322 121
20 3300025917 Ga0207660_10628210 Ga0207660_106282102 121
21 3300025917 Ga0207660_11319472 Ga0207660_113194721 121
22 3300025920 Ga0207649_10085939 Ga0207649_100859393 121
23 3300025926 Ga0207659_10071251 Ga0207659_100712513 121
24 3300025931 Ga0207644_10158308 Ga0207644_101583082 121
25 3300025945 Ga0207679_10169599 Ga0207679_101695992 121
26 3300025986 Ga0207658_10202354 Ga0207658_102023542 121
27 3300026142 Ga0207698_10063287 Ga0207698_100632874 121
28 iso_pu_bacteria 2738541278 2738726070 122
29 iso_pu_bacteria 2818991444 2819589842 122
30 3300005290 Ga0065712_10032529 Ga0065712_100325292 125
31 3300005295 Ga0065707_10339960 Ga0065707_103399602 125
32 3300005328 Ga0070676_10153611 Ga0070676_101536112 125
33 3300005329 Ga0070683_100000468 Ga0070683_10000046825 125
34 3300005329 Ga0070683_100114315 Ga0070683_1001143152 125
35 3300005330 Ga0070690_100033160 Ga0070690_1000331602 125
36 3300005330 Ga0070690_100249207 Ga0070690_1002492071 125
37 3300005331 Ga0070670_100036127 Ga0070670_1000361275 125
38 3300005334 Ga0068869_100063232 Ga0068869_1000632323 125
39 3300005334 Ga0068869_100079146 Ga0068869_1000791462 125
40 3300005335 Ga0070666_10004991 Ga0070666_100049916 125
41 3300005335 Ga0070666_10078810 Ga0070666_100788102 125
42 3300005335 Ga0070666_10160446 Ga0070666_101604462 125
43 3300005338 Ga0068868_100078150 Ga0068868_1000781502 125
44 3300005338 Ga0068868_100455352 Ga0068868_1004553522 125
45 3300005339 Ga0070660_100154184 Ga0070660_1001541842 125
46 3300005339 Ga0070660_100746687 Ga0070660_1007466872 125
47 3300005340 Ga0070689_100390503 Ga0070689_1003905032 125
48 3300005340 Ga0070689_101071285 Ga0070689_1010712851 125
49 3300005344 Ga0070661_100000179 Ga0070661_10000017950 125
50 3300005344 Ga0070661_100034574 Ga0070661_1000345744 125
51 3300005344 Ga0070661_100041203 Ga0070661_1000412031 125
52 3300005353 Ga0070669_100080917 Ga0070669_1000809173 125
53 3300005354 Ga0070675_100020576 Ga0070675_1000205763 125
54 3300005354 Ga0070675_100174024 Ga0070675_1001740241 125
55 3300005354 Ga0070675_100621474 Ga0070675_1006214741 125
56 3300005355 Ga0070671_100015772 Ga0070671_1000157728 125
57 3300005356 Ga0070674_101537375 Ga0070674_1015373751 125
58 3300005364 Ga0070673_100224099 Ga0070673_1002240992 125
59 3300005364 Ga0070673_101002771 Ga0070673_1010027711 125
60 3300005365 Ga0070688_100205693 Ga0070688_1002056932 125
61 3300005366 Ga0070659_100366428 Ga0070659_1003664282 125
62 3300005366 Ga0070659_100748233 Ga0070659_1007482331 125
63 3300005366 Ga0070659_100751956 Ga0070659_1007519561 125
64 3300005367 Ga0070667_100183990 Ga0070667_1001839902 125
65 3300005367 Ga0070667_101228153 Ga0070667_1012281531 125
66 3300005438 Ga0070701_11203204 Ga0070701_112032041 125
67 3300005441 Ga0070700_100755333 Ga0070700_1007553332 125
68 3300005456 Ga0070678_100004697 Ga0070678_1000046972 125
69 3300005457 Ga0070662_100005910 Ga0070662_1000059107 125
70 3300005457 Ga0070662_100049525 Ga0070662_1000495252 125
71 3300005457 Ga0070662_100505270 Ga0070662_1005052702 125
72 3300005457 Ga0070662_100815865 Ga0070662_1008158652 125
73 3300005459 Ga0068867_100836426 Ga0068867_1008364262 125
74 3300005459 Ga0068867_100926275 Ga0068867_1009262751 125
75 3300005466 Ga0070685_10007192 Ga0070685_100071928 125
76 3300005466 Ga0070685_10169882 Ga0070685_101698821 125
77 3300005535 Ga0070684_100022853 Ga0070684_1000228535 125
78 3300005535 Ga0070684_100347754 Ga0070684_1003477541 125
79 3300005535 Ga0070684_102119985 Ga0070684_1021199851 125
80 3300005539 Ga0068853_100015211 Ga0068853_1000152112 125
81 3300005543 Ga0070672_100091970 Ga0070672_1000919703 125
82 3300005544 Ga0070686_101010107 Ga0070686_1010101072 125
83 3300005547 Ga0070693_100999707 Ga0070693_1009997071 125
84 3300005548 Ga0070665_100079455 Ga0070665_1000794554 125
85 3300005548 Ga0070665_100210394 Ga0070665_1002103942 125
86 3300005563 Ga0068855_100870216 Ga0068855_1008702162 125
87 3300005564 Ga0070664_100000140 Ga0070664_10000014033 125
88 3300005564 Ga0070664_100258862 Ga0070664_1002588622 125
89 3300005564 Ga0070664_100262348 Ga0070664_1002623482 125
90 3300005577 Ga0068857_100007728 Ga0068857_1000077289 125
91 3300005577 Ga0068857_100075454 Ga0068857_1000754543 125
92 3300005578 Ga0068854_100011485 Ga0068854_1000114857 125
93 3300005578 Ga0068854_101330292 Ga0068854_1013302921 125
94 3300005614 Ga0068856_101869911 Ga0068856_1018699111 125
95 3300005615 Ga0070702_100720279 Ga0070702_1007202791 125
96 3300005616 Ga0068852_100455132 Ga0068852_1004551322 125
97 3300005616 Ga0068852_101882275 Ga0068852_1018822751 125
98 3300005617 Ga0068859_100005939 Ga0068859_10000593910 125
99 3300005617 Ga0068859_101059311 Ga0068859_1010593112 125
100 3300005618 Ga0068864_100061031 Ga0068864_1000610312 125
101 3300005618 Ga0068864_100668520 Ga0068864_1006685202 125
102 3300005718 Ga0068866_10008725 Ga0068866_100087252 125
103 3300005719 Ga0068861_100156324 Ga0068861_1001563242 125
104 3300005719 Ga0068861_101043800 Ga0068861_1010438002 125
105 3300005834 Ga0068851_10534757 Ga0068851_105347572 125
106 3300005840 Ga0068870_10093933 Ga0068870_100939331 125
107 3300005841 Ga0068863_100097940 Ga0068863_1000979401 125
108 3300005841 Ga0068863_100262047 Ga0068863_1002620473 125
109 3300005841 Ga0068863_100909407 Ga0068863_1009094072 125
110 3300005842 Ga0068858_100041888 Ga0068858_1000418884 125
111 3300005842 Ga0068858_100152160 Ga0068858_1001521602 125
112 3300005842 Ga0068858_100471825 Ga0068858_1004718252 125
113 3300005843 Ga0068860_100222848 Ga0068860_1002228482 125
114 3300005843 Ga0068860_100506718 Ga0068860_1005067182 125
115 3300005844 Ga0068862_100258213 Ga0068862_1002582132 125
116 3300005985 Ga0081539_10047510 Ga0081539_100475103 125
117 3300006163 Ga0070715_10213479 Ga0070715_102134792 125
118 3300006173 Ga0070716_100415015 Ga0070716_1004150152 125
119 3300006237 Ga0097621_100011491 Ga0097621_1000114919 125
120 3300006237 Ga0097621_100152109 Ga0097621_1001521091 125
121 3300006237 Ga0097621_100242923 Ga0097621_1002429232 125
122 3300006358 Ga0068871_100011269 Ga0068871_1000112694 125
123 3300006358 Ga0068871_100461850 Ga0068871_1004618502 125
124 3300006358 Ga0068871_101659752 Ga0068871_1016597521 125
125 3300006871 Ga0075434_100085548 Ga0075434_1000855484 125
126 3300006871 Ga0075434_100439577 Ga0075434_1004395771 125
127 3300006881 Ga0068865_100189750 Ga0068865_1001897501 125
128 3300006881 Ga0068865_100440266 Ga0068865_1004402662 125
129 3300006881 Ga0068865_101087747 Ga0068865_1010877471 125
130 3300006931 Ga0097620_100005939 Ga0097620_10000593910 125
131 3300006931 Ga0097620_101059293 Ga0097620_1010592932 125
132 3300009011 Ga0105251_10109895 Ga0105251_101098951 125
133 3300009093 Ga0105240_10356633 Ga0105240_103566332 125
134 3300009101 Ga0105247_10382127 Ga0105247_103821271 125
135 3300009176 Ga0105242_10186413 Ga0105242_101864131 125
136 3300009553 Ga0105249_10245322 Ga0105249_102453223 125
137 3300009553 Ga0105249_11233162 Ga0105249_112331622 125
138 3300010375 Ga0105239_10247625 Ga0105239_102476251 125
139 3300010375 Ga0105239_12675468 Ga0105239_126754681 125
140 3300011119 Ga0105246_10072325 Ga0105246_100723252 125
141 3300011119 Ga0105246_12551849 Ga0105246_125518491 125
142 3300012495 Ga0157323_1027514 Ga0157323_10275141 125
143 3300013102 Ga0157371_10430901 Ga0157371_104309011 125
144 3300013102 Ga0157371_10480712 Ga0157371_104807122 125
145 3300013105 Ga0157369_10241841 Ga0157369_102418412 125
146 3300013296 Ga0157374_10000237 Ga0157374_1000023719 125
147 3300013296 Ga0157374_10005388 Ga0157374_100053881 125
148 3300013296 Ga0157374_10098966 Ga0157374_100989662 125
149 3300013296 Ga0157374_10190525 Ga0157374_101905252 125
150 3300013297 Ga0157378_10131265 Ga0157378_101312652 125
151 3300013297 Ga0157378_10174714 Ga0157378_101747142 125
152 3300013306 Ga0163162_10006217 Ga0163162_100062179 125
153 3300013306 Ga0163162_10174200 Ga0163162_101742003 125
154 3300013306 Ga0163162_10264187 Ga0163162_102641873 125
155 3300013306 Ga0163162_11236596 Ga0163162_112365961 125
156 3300013308 Ga0157375_10079604 Ga0157375_100796041 125
157 3300013308 Ga0157375_10092748 Ga0157375_100927482 125
158 3300013308 Ga0157375_10634183 Ga0157375_106341831 125
159 3300014325 Ga0163163_10000088 Ga0163163_1000008856 125
160 3300014325 Ga0163163_10661105 Ga0163163_106611052 125
161 3300014325 Ga0163163_10958080 Ga0163163_109580801 125
162 3300014326 Ga0157380_10131722 Ga0157380_101317222 125
163 3300014745 Ga0157377_10009383 Ga0157377_100093831 125
164 3300014745 Ga0157377_10089787 Ga0157377_100897872 125
165 3300014745 Ga0157377_10603246 Ga0157377_106032462 125
166 3300014968 Ga0157379_10050431 Ga0157379_100504315 125
167 3300014968 Ga0157379_10555359 Ga0157379_105553592 125
168 3300014969 Ga0157376_10073355 Ga0157376_100733552 125
169 3300014969 Ga0157376_10317978 Ga0157376_103179783 125
170 3300014969 Ga0157376_10526578 Ga0157376_105265781 125
171 3300014969 Ga0157376_10604161 Ga0157376_106041612 125
172 3300017792 Ga0163161_10002796 Ga0163161_1000279613 125
173 3300017792 Ga0163161_10027138 Ga0163161_100271383 125
174 3300017792 Ga0163161_10123937 Ga0163161_101239372 125
175 3300017792 Ga0163161_10326686 Ga0163161_103266862 125
176 3300025899 Ga0207642_10028662 Ga0207642_100286623 125
177 3300025903 Ga0207680_10009247 Ga0207680_100092472 125
178 3300025903 Ga0207680_10378907 Ga0207680_103789072 125
179 3300025903 Ga0207680_10901511 Ga0207680_109015111 125
180 3300025904 Ga0207647_10009722 Ga0207647_100097227 125
181 3300025905 Ga0207685_10006223 Ga0207685_100062233 125
182 3300025907 Ga0207645_10390545 Ga0207645_103905451 125
183 3300025908 Ga0207643_10200968 Ga0207643_102009682 125
184 3300025911 Ga0207654_10403306 Ga0207654_104033062 125
185 3300025912 Ga0207707_10242770 Ga0207707_102427702 125
186 3300025913 Ga0207695_10545403 Ga0207695_105454032 125
187 3300025919 Ga0207657_10173809 Ga0207657_101738092 125
188 3300025920 Ga0207649_10000419 Ga0207649_1000041925 125
189 3300025923 Ga0207681_10329909 Ga0207681_103299092 125
190 3300025923 Ga0207681_11676691 Ga0207681_116766911 125
191 3300025925 Ga0207650_10020700 Ga0207650_100207004 125
192 3300025926 Ga0207659_10113269 Ga0207659_101132693 125
193 3300025926 Ga0207659_10664914 Ga0207659_106649141 125
194 3300025927 Ga0207687_11274519 Ga0207687_112745191 125
195 3300025931 Ga0207644_10615736 Ga0207644_106157362 125
196 3300025931 Ga0207644_10670424 Ga0207644_106704242 125
197 3300025932 Ga0207690_10190103 Ga0207690_101901032 125
198 3300025933 Ga0207706_10002103 Ga0207706_100021034 125
199 3300025933 Ga0207706_10018001 Ga0207706_100180011 125
200 3300025933 Ga0207706_10084464 Ga0207706_100844642 125
201 3300025934 Ga0207686_10149086 Ga0207686_101490862 125
202 3300025936 Ga0207670_10185937 Ga0207670_101859371 125
203 3300025936 Ga0207670_10340732 Ga0207670_103407322 125
204 3300025936 Ga0207670_11764547 Ga0207670_117645471 125
205 3300025938 Ga0207704_10128813 Ga0207704_101288133 125
206 3300025938 Ga0207704_10177265 Ga0207704_101772653 125
207 3300025939 Ga0207665_11071219 Ga0207665_110712192 125
208 3300025940 Ga0207691_10011435 Ga0207691_100114353 125
209 3300025942 Ga0207689_10021058 Ga0207689_100210581 125
210 3300025942 Ga0207689_10167225 Ga0207689_101672253 125
211 3300025944 Ga0207661_10000370 Ga0207661_100003708 125
212 3300025944 Ga0207661_10331612 Ga0207661_103316122 125
213 3300025944 Ga0207661_11400893 Ga0207661_114008931 125
214 3300025945 Ga0207679_10000266 Ga0207679_1000026614 125
215 3300025945 Ga0207679_10163117 Ga0207679_101631173 125
216 3300025960 Ga0207651_10204392 Ga0207651_102043922 125
217 3300025960 Ga0207651_11235144 Ga0207651_112351441 125
218 3300025960 Ga0207651_11947061 Ga0207651_119470611 125
219 3300025981 Ga0207640_10021342 Ga0207640_100213423 125
220 3300025981 Ga0207640_10713989 Ga0207640_107139891 125
221 3300025986 Ga0207658_10630113 Ga0207658_106301131 125
222 3300026023 Ga0207677_10285222 Ga0207677_102852222 125
223 3300026023 Ga0207677_11314847 Ga0207677_113148471 125
224 3300026035 Ga0207703_10097933 Ga0207703_100979332 125
225 3300026035 Ga0207703_10813557 Ga0207703_108135572 125
226 3300026041 Ga0207639_10082339 Ga0207639_100823393 125
227 3300026041 Ga0207639_11089568 Ga0207639_110895681 125
228 3300026041 Ga0207639_11760258 Ga0207639_117602581 125
229 3300026067 Ga0207678_10090917 Ga0207678_100909172 125
230 3300026075 Ga0207708_10562951 Ga0207708_105629512 125
231 3300026078 Ga0207702_10338432 Ga0207702_103384322 125
232 3300026088 Ga0207641_10037835 Ga0207641_100378354 125
233 3300026088 Ga0207641_10091216 Ga0207641_100912162 125
234 3300026088 Ga0207641_10105683 Ga0207641_101056832 125
235 3300026088 Ga0207641_12277170 Ga0207641_122771701 125
236 3300026089 Ga0207648_10304460 Ga0207648_103044603 125
237 3300026089 Ga0207648_10530486 Ga0207648_105304862 125
238 3300026089 Ga0207648_10724644 Ga0207648_107246442 125
239 3300026095 Ga0207676_10019254 Ga0207676_100192541 125
240 3300026095 Ga0207676_10038829 Ga0207676_100388293 125
241 3300026116 Ga0207674_10007803 Ga0207674_1000780312 125
242 3300026118 Ga0207675_100150383 Ga0207675_1001503832 125
243 3300026118 Ga0207675_100754399 Ga0207675_1007543991 125
244 3300026121 Ga0207683_10010220 Ga0207683_100102209 125
245 3300026121 Ga0207683_10311957 Ga0207683_103119573 125
246 3300026142 Ga0207698_10048581 Ga0207698_100485813 125
247 3300026142 Ga0207698_10070251 Ga0207698_100702512 125
248 3300028379 Ga0268266_10654511 Ga0268266_106545111 125
249 3300035086 Ga0373934_0082751 Ga0373934_0082751_29_415 125
250 3300035170 Ga0373943_0374155 Ga0373943_0374155_159_545 125
251 3300035171 Ga0373946_0195701 Ga0373946_0195701_476_862 125
252 3300035172 Ga0373955_0496221 Ga0373955_0496221_107_493 125
253 3300035410 Ga0373924_0006769 Ga0373924_0006769_2266_2652 125
254 3300035692 Ga0373935_0083615 Ga0373935_0083615_136_522 125
255 3300035725 Ga0373947_0074177 Ga0373947_0074177_1561_1947 125
256 3300036401 Ga0373937_0002104 Ga0373937_0002104_13312_13698 125
257 3300037068 Ga0373925_0510186 Ga0373925_0510186_413_799 125
258 3300046454 Ga0495592_0026380 Ga0495592_0026380_634_1020 125
259 3300046463 Ga0495653_0043228 Ga0495653_0043228_2795_3181 125
260 3300046472 Ga0495580_0473514 Ga0495580_0473514_419_805 125
261 3300046473 Ga0495582_0458872 Ga0495582_0458872_231_617 125
262 3300046511 Ga0495608_0104141 Ga0495608_0104141_1232_1618 125
263 3300046514 Ga0495618_0316918 Ga0495618_0316918_343_729 125
264 3300046516 Ga0495628_0062219 Ga0495628_0062219_56_442 125
265 3300046517 Ga0495630_0003153 Ga0495630_0003153_6853_7239 125
266 3300046526 Ga0495666_0223564 Ga0495666_0223564_177_563 125
267 3300046529 Ga0495652_0585574 Ga0495652_0585574_363_749 125
268 3300046531 Ga0495665_0578760 Ga0495665_0578760_157_543 125
269 3300046536 Ga0495587_0062204 Ga0495587_0062204_692_1078 125
270 3300046543 Ga0495645_0251921 Ga0495645_0251921_570_956 125
271 3300046642 Ga0495634_0019397 Ga0495634_0019397_784_1170 125
272 3300046689 Ga0495613_0118295 Ga0495613_0118295_799_1185 125
273 3300047315 Ga0495581_0718297 Ga0495581_0718297_135_521 125
274 3300047319 Ga0495674_0330925 Ga0495674_0330925_771_1157 125
275 3300047321 Ga0495676_0376752 Ga0495676_0376752_470_856 125
276 3300047322 Ga0495680_0144564 Ga0495680_0144564_238_624 125
277 3300047444 Ga0495675_0095507 Ga0495675_0095507_349_735 125
278 3300047471 Ga0495684_0128580 Ga0495684_0128580_1121_1507 125
279 3300048089 Ga0495614_0228366 Ga0495614_0228366_176_562 125
280 3300048903 Ga0496100_0268484 Ga0496100_0268484_661_1047 125
281 3300048904 Ga0496101_0500328 Ga0496101_0500328_517_903 125
282 3300048908 Ga0496105_0167115 Ga0496105_0167115_125_511 125
283 3300048911 Ga0496108_0927975 Ga0496108_0927975_227_613 125
284 3300048912 Ga0496109_0436602 Ga0496109_0436602_130_516 125
285 3300048913 Ga0496110_0879805 Ga0496110_0879805_231_617 125
286 3300048914 Ga0496111_0089780 Ga0496111_0089780_657_1043 125
287 3300049588 Ga0501072_0233777 Ga0501072_0233777_233_613 125
288 3300049767 Ga0501270_119577 Ga0501270_119577_97_474 125
289 3300050512 nmdc:mga0n895_317322_c1 nmdc:mga0n895_317322_c1_1115_1501 125
290 3300050512 nmdc:mga0n895_651069_c1 nmdc:mga0n895_651069_c1_610_996 125
291 3300053085 Ga0495619_0429352 Ga0495619_0429352_77_463 125
292 3300001904 JGI24736J21556_1004049 JGI24736J21556_10040494 126
293 3300001990 JGI24737J22298_10075046 JGI24737J22298_100750462 126
294 3300002073 JGI24745J21846_1050996 JGI24745J21846_10509962 126
295 3300002077 JGI24744J21845_10007180 JGI24744J21845_100071802 126
296 3300002459 JGI24751J29686_10041257 JGI24751J29686_100412572 126
297 3300003323 rootH1_10019969 rootH1_100199693 126
298 3300003323 rootH1_10144194 rootH1_101441942 126
299 3300003323 rootH1_10163770 rootH1_101637703 126
300 3300003761 Ga0055535_1001800 Ga0055535_10018004 126
301 3300005290 Ga0065712_10010222 Ga0065712_100102222 126
302 3300005290 Ga0065712_10363462 Ga0065712_103634621 126
303 3300005290 Ga0065712_10461770 Ga0065712_104617702 126
304 3300005327 Ga0070658_10261787 Ga0070658_102617872 126
305 3300005327 Ga0070658_10297148 Ga0070658_102971481 126
306 3300005327 Ga0070658_10339819 Ga0070658_103398191 126
307 3300005327 Ga0070658_10948829 Ga0070658_109488292 126
308 3300005327 Ga0070658_11112402 Ga0070658_111124021 126
309 3300005328 Ga0070676_10181503 Ga0070676_101815032 126
310 3300005328 Ga0070676_10658215 Ga0070676_106582151 126
311 3300005328 Ga0070676_11396621 Ga0070676_113966211 126
312 3300005329 Ga0070683_101742005 Ga0070683_1017420051 126
313 3300005330 Ga0070690_100362890 Ga0070690_1003628901 126
314 3300005330 Ga0070690_100400097 Ga0070690_1004000972 126
315 3300005331 Ga0070670_100005343 Ga0070670_1000053437 126
316 3300005331 Ga0070670_100035958 Ga0070670_1000359583 126
317 3300005331 Ga0070670_100063150 Ga0070670_1000631502 126
318 3300005331 Ga0070670_100272545 Ga0070670_1002725453 126
319 3300005331 Ga0070670_100419001 Ga0070670_1004190012 126
320 3300005331 Ga0070670_100741688 Ga0070670_1007416882 126
321 3300005331 Ga0070670_100781479 Ga0070670_1007814792 126
322 3300005331 Ga0070670_100913885 Ga0070670_1009138852 126
323 3300005333 Ga0070677_10149540 Ga0070677_101495402 126
324 3300005333 Ga0070677_10745457 Ga0070677_107454571 126
325 3300005334 Ga0068869_100009768 Ga0068869_1000097683 126
326 3300005334 Ga0068869_100012813 Ga0068869_1000128134 126
327 3300005334 Ga0068869_100017295 Ga0068869_1000172956 126
328 3300005335 Ga0070666_10000038 Ga0070666_1000003881 126
329 3300005335 Ga0070666_10017523 Ga0070666_100175232 126
330 3300005335 Ga0070666_10065667 Ga0070666_100656673 126
331 3300005335 Ga0070666_10693283 Ga0070666_106932831 126
332 3300005337 Ga0070682_100000039 Ga0070682_10000003927 126
333 3300005337 Ga0070682_100089754 Ga0070682_1000897543 126
334 3300005338 Ga0068868_100018213 Ga0068868_1000182132 126
335 3300005338 Ga0068868_100451053 Ga0068868_1004510531 126
336 3300005338 Ga0068868_100573323 Ga0068868_1005733232 126
337 3300005338 Ga0068868_100703417 Ga0068868_1007034171 126
338 3300005338 Ga0068868_101400190 Ga0068868_1014001901 126
339 3300005339 Ga0070660_100124788 Ga0070660_1001247883 126
340 3300005339 Ga0070660_100825265 Ga0070660_1008252652 126
341 3300005344 Ga0070661_100245247 Ga0070661_1002452472 126
342 3300005344 Ga0070661_100644217 Ga0070661_1006442172 126
343 3300005344 Ga0070661_100762729 Ga0070661_1007627291 126
344 3300005347 Ga0070668_100043263 Ga0070668_1000432633 126
345 3300005347 Ga0070668_100066643 Ga0070668_1000666433 126
346 3300005347 Ga0070668_100128656 Ga0070668_1001286562 126
347 3300005347 Ga0070668_100303381 Ga0070668_1003033812 126
348 3300005353 Ga0070669_100024662 Ga0070669_1000246622 126
349 3300005353 Ga0070669_100463594 Ga0070669_1004635943 126
350 3300005354 Ga0070675_100009635 Ga0070675_1000096359 126
351 3300005354 Ga0070675_100054348 Ga0070675_1000543484 126
352 3300005354 Ga0070675_100061215 Ga0070675_1000612153 126
353 3300005354 Ga0070675_100112895 Ga0070675_1001128953 126
354 3300005354 Ga0070675_100196931 Ga0070675_1001969312 126
355 3300005355 Ga0070671_100238388 Ga0070671_1002383881 126
356 3300005355 Ga0070671_100385284 Ga0070671_1003852841 126
357 3300005355 Ga0070671_101374792 Ga0070671_1013747922 126
358 3300005356 Ga0070674_100004279 Ga0070674_1000042798 126
359 3300005356 Ga0070674_100184538 Ga0070674_1001845383 126
360 3300005364 Ga0070673_100008952 Ga0070673_1000089523 126
361 3300005364 Ga0070673_100193037 Ga0070673_1001930372 126
362 3300005364 Ga0070673_100515191 Ga0070673_1005151912 126
363 3300005364 Ga0070673_101024716 Ga0070673_1010247161 126
364 3300005364 Ga0070673_102010022 Ga0070673_1020100221 126
365 3300005365 Ga0070688_100186446 Ga0070688_1001864463 126
366 3300005365 Ga0070688_100572459 Ga0070688_1005724591 126
367 3300005366 Ga0070659_100009346 Ga0070659_1000093466 126
368 3300005366 Ga0070659_101129172 Ga0070659_1011291721 126
369 3300005366 Ga0070659_101419530 Ga0070659_1014195302 126
370 3300005367 Ga0070667_100291951 Ga0070667_1002919512 126
371 3300005367 Ga0070667_100543420 Ga0070667_1005434202 126
372 3300005367 Ga0070667_101820178 Ga0070667_1018201781 126
373 3300005438 Ga0070701_10279105 Ga0070701_102791052 126
374 3300005441 Ga0070700_100246934 Ga0070700_1002469342 126
375 3300005441 Ga0070700_100578069 Ga0070700_1005780691 126
376 3300005441 Ga0070700_101437041 Ga0070700_1014370411 126
377 3300005456 Ga0070678_100014866 Ga0070678_1000148663 126
378 3300005456 Ga0070678_100039709 Ga0070678_1000397091 126
379 3300005456 Ga0070678_100917164 Ga0070678_1009171641 126
380 3300005457 Ga0070662_100015036 Ga0070662_1000150364 126
381 3300005457 Ga0070662_100885467 Ga0070662_1008854672 126
382 3300005459 Ga0068867_100026385 Ga0068867_1000263852 126
383 3300005459 Ga0068867_100040030 Ga0068867_1000400303 126
384 3300005459 Ga0068867_100165085 Ga0068867_1001650852 126
385 3300005459 Ga0068867_100301896 Ga0068867_1003018962 126
386 3300005459 Ga0068867_101753790 Ga0068867_1017537901 126
387 3300005466 Ga0070685_10112716 Ga0070685_101127163 126
388 3300005466 Ga0070685_11201048 Ga0070685_112010481 126
389 3300005518 Ga0070699_100288194 Ga0070699_1002881942 126
390 3300005535 Ga0070684_101424077 Ga0070684_1014240772 126
391 3300005539 Ga0068853_100002821 Ga0068853_1000028213 126
392 3300005539 Ga0068853_100021602 Ga0068853_1000216024 126
393 3300005539 Ga0068853_100022828 Ga0068853_1000228282 126
394 3300005539 Ga0068853_100064395 Ga0068853_1000643951 126
395 3300005539 Ga0068853_100781567 Ga0068853_1007815672 126
396 3300005543 Ga0070672_100036669 Ga0070672_1000366693 126
397 3300005543 Ga0070672_100159406 Ga0070672_1001594062 126
398 3300005543 Ga0070672_100320048 Ga0070672_1003200482 126
399 3300005543 Ga0070672_100352251 Ga0070672_1003522512 126
400 3300005543 Ga0070672_101395410 Ga0070672_1013954101 126
401 3300005543 Ga0070672_101578769 Ga0070672_1015787691 126
402 3300005544 Ga0070686_100842026 Ga0070686_1008420262 126
403 3300005547 Ga0070693_100729554 Ga0070693_1007295542 126
404 3300005547 Ga0070693_100924096 Ga0070693_1009240961 126
405 3300005548 Ga0070665_100186701 Ga0070665_1001867011 126
406 3300005563 Ga0068855_100017041 Ga0068855_1000170414 126
407 3300005564 Ga0070664_100360954 Ga0070664_1003609543 126
408 3300005564 Ga0070664_101121182 Ga0070664_1011211821 126
409 3300005577 Ga0068857_100136533 Ga0068857_1001365332 126
410 3300005577 Ga0068857_100341845 Ga0068857_1003418452 126
411 3300005577 Ga0068857_100764725 Ga0068857_1007647251 126
412 3300005577 Ga0068857_101565094 Ga0068857_1015650941 126
413 3300005577 Ga0068857_102229227 Ga0068857_1022292271 126
414 3300005578 Ga0068854_100065919 Ga0068854_1000659192 126
415 3300005578 Ga0068854_100468638 Ga0068854_1004686382 126
416 3300005578 Ga0068854_101627649 Ga0068854_1016276492 126
417 3300005614 Ga0068856_100036347 Ga0068856_1000363473 126
418 3300005614 Ga0068856_101757554 Ga0068856_1017575541 126
419 3300005616 Ga0068852_100023809 Ga0068852_1000238094 126
420 3300005616 Ga0068852_100049213 Ga0068852_1000492134 126
421 3300005616 Ga0068852_100618875 Ga0068852_1006188751 126
422 3300005616 Ga0068852_100691098 Ga0068852_1006910982 126
423 3300005616 Ga0068852_101295908 Ga0068852_1012959082 126
424 3300005617 Ga0068859_100000007 Ga0068859_10000000788 126
425 3300005617 Ga0068859_100100050 Ga0068859_1001000502 126
426 3300005617 Ga0068859_100124931 Ga0068859_1001249313 126
427 3300005617 Ga0068859_100213447 Ga0068859_1002134471 126
428 3300005617 Ga0068859_101811069 Ga0068859_1018110691 126
429 3300005618 Ga0068864_100000685 Ga0068864_10000068512 126
430 3300005718 Ga0068866_10045822 Ga0068866_100458222 126
431 3300005719 Ga0068861_100020953 Ga0068861_1000209534 126
432 3300005719 Ga0068861_100143217 Ga0068861_1001432172 126
433 3300005719 Ga0068861_102062290 Ga0068861_1020622902 126
434 3300005834 Ga0068851_10124394 Ga0068851_101243942 126
435 3300005834 Ga0068851_10287313 Ga0068851_102873132 126
436 3300005834 Ga0068851_10290021 Ga0068851_102900211 126
437 3300005834 Ga0068851_10355106 Ga0068851_103551061 126
438 3300005834 Ga0068851_10455572 Ga0068851_104555722 126
439 3300005834 Ga0068851_10635160 Ga0068851_106351602 126
440 3300005834 Ga0068851_11005144 Ga0068851_110051441 126
441 3300005840 Ga0068870_10106168 Ga0068870_101061682 126
442 3300005841 Ga0068863_100111325 Ga0068863_1001113253 126
443 3300005841 Ga0068863_100633927 Ga0068863_1006339272 126
444 3300005842 Ga0068858_100003163 Ga0068858_1000031635 126
445 3300005843 Ga0068860_100012160 Ga0068860_1000121608 126
446 3300005843 Ga0068860_100175676 Ga0068860_1001756762 126
447 3300005843 Ga0068860_100332635 Ga0068860_1003326352 126
448 3300005843 Ga0068860_100392845 Ga0068860_1003928452 126
449 3300005843 Ga0068860_100400522 Ga0068860_1004005222 126
450 3300005844 Ga0068862_100111328 Ga0068862_1001113282 126
451 3300005937 Ga0081455_10532077 Ga0081455_105320771 126
452 3300006195 Ga0075366_10078707 Ga0075366_100787072 126
453 3300006195 Ga0075366_10261881 Ga0075366_102618811 126
454 3300006195 Ga0075366_10289024 Ga0075366_102890242 126
455 3300006195 Ga0075366_10818331 Ga0075366_108183311 126
456 3300006237 Ga0097621_100003509 Ga0097621_1000035097 126
457 3300006237 Ga0097621_100017011 Ga0097621_1000170116 126
458 3300006237 Ga0097621_100027689 Ga0097621_1000276893 126
459 3300006237 Ga0097621_100100209 Ga0097621_1001002092 126
460 3300006237 Ga0097621_100640902 Ga0097621_1006409022 126
461 3300006353 Ga0075370_10691442 Ga0075370_106914421 126
462 3300006358 Ga0068871_100003013 Ga0068871_1000030138 126
463 3300006358 Ga0068871_100008869 Ga0068871_1000088693 126
464 3300006358 Ga0068871_100022594 Ga0068871_1000225944 126
465 3300006358 Ga0068871_100381836 Ga0068871_1003818362 126
466 3300006358 Ga0068871_100668136 Ga0068871_1006681361 126
467 3300006358 Ga0068871_100837381 Ga0068871_1008373812 126
468 3300006358 Ga0068871_100881040 Ga0068871_1008810401 126
469 3300006358 Ga0068871_100954062 Ga0068871_1009540622 126
470 3300006844 Ga0075428_100093358 Ga0075428_1000933582 126
471 3300006846 Ga0075430_101132872 Ga0075430_1011328721 126
472 3300006847 Ga0075431_100005210 Ga0075431_10000521012 126
473 3300006880 Ga0075429_100004647 Ga0075429_1000046478 126
474 3300006880 Ga0075429_101088347 Ga0075429_1010883472 126
475 3300006881 Ga0068865_100002580 Ga0068865_1000025804 126
476 3300006881 Ga0068865_100348952 Ga0068865_1003489522 126
477 3300006931 Ga0097620_100000007 Ga0097620_10000000789 126
478 3300006931 Ga0097620_100100047 Ga0097620_1001000472 126
479 3300006931 Ga0097620_100124933 Ga0097620_1001249332 126
480 3300006931 Ga0097620_100213450 Ga0097620_1002134501 126
481 3300006931 Ga0097620_101811725 Ga0097620_1018117252 126
482 3300009093 Ga0105240_11318630 Ga0105240_113186302 126
483 3300009094 Ga0111539_10043506 Ga0111539_100435062 126
484 3300009094 Ga0111539_10119552 Ga0111539_101195524 126
485 3300009098 Ga0105245_10217098 Ga0105245_102170983 126
486 3300009101 Ga0105247_10010856 Ga0105247_100108563 126
487 3300009147 Ga0114129_10181526 Ga0114129_101815263 126
488 3300009174 Ga0105241_10000104 Ga0105241_1000010453 126
489 3300009174 Ga0105241_10084119 Ga0105241_100841193 126
490 3300009174 Ga0105241_10285817 Ga0105241_102858172 126
491 3300009174 Ga0105241_10893525 Ga0105241_108935251 126
492 3300009174 Ga0105241_10963258 Ga0105241_109632582 126
493 3300009176 Ga0105242_10039659 Ga0105242_100396593 126
494 3300009176 Ga0105242_10077049 Ga0105242_100770492 126
495 3300009176 Ga0105242_10664282 Ga0105242_106642822 126
496 3300009176 Ga0105242_12830787 Ga0105242_128307872 126
497 3300009545 Ga0105237_10040911 Ga0105237_100409112 126
498 3300009553 Ga0105249_10009352 Ga0105249_100093528 126
499 3300010375 Ga0105239_10143356 Ga0105239_101433563 126
500 3300010375 Ga0105239_11362057 Ga0105239_113620572 126
501 3300011119 Ga0105246_10001838 Ga0105246_100018382 126
502 3300011119 Ga0105246_10064135 Ga0105246_100641351 126
503 3300011119 Ga0105246_10405929 Ga0105246_104059292 126
504 3300011119 Ga0105246_10878482 Ga0105246_108784821 126
505 3300013100 Ga0157373_10018995 Ga0157373_100189953 126
506 3300013100 Ga0157373_10032880 Ga0157373_100328803 126
507 3300013100 Ga0157373_10606467 Ga0157373_106064671 126
508 3300013102 Ga0157371_10031483 Ga0157371_100314834 126
509 3300013102 Ga0157371_10046246 Ga0157371_100462463 126
510 3300013102 Ga0157371_10415417 Ga0157371_104154172 126
511 3300013104 Ga0157370_10202462 Ga0157370_102024623 126
512 3300013104 Ga0157370_10495032 Ga0157370_104950322 126
513 3300013104 Ga0157370_10595196 Ga0157370_105951961 126
514 3300013104 Ga0157370_10917435 Ga0157370_109174351 126
515 3300013105 Ga0157369_10203150 Ga0157369_102031503 126
516 3300013105 Ga0157369_11014679 Ga0157369_110146791 126
517 3300013296 Ga0157374_10040035 Ga0157374_100400353 126
518 3300013296 Ga0157374_10066087 Ga0157374_100660873 126
519 3300013296 Ga0157374_10075500 Ga0157374_100755002 126
520 3300013296 Ga0157374_10290082 Ga0157374_102900822 126
521 3300013296 Ga0157374_10578079 Ga0157374_105780792 126
522 3300013296 Ga0157374_11113166 Ga0157374_111131662 126
523 3300013297 Ga0157378_10020420 Ga0157378_100204202 126
524 3300013297 Ga0157378_10228960 Ga0157378_102289602 126
525 3300013297 Ga0157378_10379531 Ga0157378_103795312 126
526 3300013297 Ga0157378_11176322 Ga0157378_111763221 126
527 3300013297 Ga0157378_11265117 Ga0157378_112651172 126
528 3300013306 Ga0163162_10000226 Ga0163162_1000022616 126
529 3300013306 Ga0163162_10000576 Ga0163162_1000057615 126
530 3300013306 Ga0163162_10088452 Ga0163162_100884522 126
531 3300013306 Ga0163162_10090364 Ga0163162_100903643 126
532 3300013306 Ga0163162_10135776 Ga0163162_101357763 126
533 3300013306 Ga0163162_12597625 Ga0163162_125976252 126
534 3300013307 Ga0157372_10004144 Ga0157372_1000414412 126
535 3300013307 Ga0157372_10034745 Ga0157372_100347453 126
536 3300013307 Ga0157372_10132899 Ga0157372_101328993 126
537 3300013307 Ga0157372_10359916 Ga0157372_103599162 126
538 3300013307 Ga0157372_10505059 Ga0157372_105050592 126
539 3300013307 Ga0157372_10577543 Ga0157372_105775431 126
540 3300013307 Ga0157372_10717693 Ga0157372_107176932 126
541 3300013307 Ga0157372_10872351 Ga0157372_108723512 126
542 3300013307 Ga0157372_10952936 Ga0157372_109529362 126
543 3300013307 Ga0157372_11121395 Ga0157372_111213952 126
544 3300013307 Ga0157372_11207167 Ga0157372_112071672 126
545 3300013307 Ga0157372_11239851 Ga0157372_112398512 126
546 3300013307 Ga0157372_11370375 Ga0157372_113703752 126
547 3300013307 Ga0157372_13173433 Ga0157372_131734332 126
548 3300013308 Ga0157375_10171047 Ga0157375_101710472 126
549 3300013308 Ga0157375_10257339 Ga0157375_102573393 126
550 3300013308 Ga0157375_11279207 Ga0157375_112792072 126
551 3300013308 Ga0157375_11930254 Ga0157375_119302541 126
552 3300013308 Ga0157375_13287868 Ga0157375_132878681 126
553 3300014325 Ga0163163_10003449 Ga0163163_100034495 126
554 3300014325 Ga0163163_10012983 Ga0163163_100129835 126
555 3300014325 Ga0163163_10191440 Ga0163163_101914402 126
556 3300014325 Ga0163163_10601722 Ga0163163_106017221 126
557 3300014326 Ga0157380_10006616 Ga0157380_100066163 126
558 3300014326 Ga0157380_10417482 Ga0157380_104174822 126
559 3300014326 Ga0157380_10522069 Ga0157380_105220691 126
560 3300014326 Ga0157380_11733959 Ga0157380_117339591 126
561 3300014745 Ga0157377_10018280 Ga0157377_100182803 126
562 3300014745 Ga0157377_10095644 Ga0157377_100956444 126
563 3300014745 Ga0157377_11560770 Ga0157377_115607702 126
564 3300014968 Ga0157379_10064911 Ga0157379_100649113 126
565 3300014968 Ga0157379_10128633 Ga0157379_101286332 126
566 3300014968 Ga0157379_10241953 Ga0157379_102419533 126
567 3300014969 Ga0157376_10006924 Ga0157376_100069245 126
568 3300014969 Ga0157376_10101097 Ga0157376_101010972 126
569 3300014969 Ga0157376_10148730 Ga0157376_101487302 126
570 3300014969 Ga0157376_10176198 Ga0157376_101761982 126
571 3300014969 Ga0157376_10898120 Ga0157376_108981202 126
572 3300015262 Ga0182007_10267661 Ga0182007_102676612 126
573 3300017792 Ga0163161_10135966 Ga0163161_101359662 126
574 3300020070 Ga0206356_10707627 Ga0206356_107076271 126
575 3300025242 Ga0209258_107471 Ga0209258_1074712 126
576 3300025246 Ga0209646_1001328 Ga0209646_10013283 126
577 3300025315 Ga0207697_10037663 Ga0207697_100376631 126
578 3300025321 Ga0207656_10228301 Ga0207656_102283012 126
579 3300025321 Ga0207656_10346764 Ga0207656_103467641 126
580 3300025321 Ga0207656_10363256 Ga0207656_103632562 126
581 3300025321 Ga0207656_10478494 Ga0207656_104784941 126
582 3300025893 Ga0207682_10052614 Ga0207682_100526142 126
583 3300025893 Ga0207682_10468252 Ga0207682_104682521 126
584 3300025899 Ga0207642_10050953 Ga0207642_100509532 126
585 3300025899 Ga0207642_10203548 Ga0207642_102035482 126
586 3300025899 Ga0207642_10920230 Ga0207642_109202301 126
587 3300025900 Ga0207710_10030398 Ga0207710_100303982 126
588 3300025901 Ga0207688_10022289 Ga0207688_100222892 126
589 3300025903 Ga0207680_10000015 Ga0207680_1000001583 126
590 3300025903 Ga0207680_10009136 Ga0207680_100091363 126
591 3300025903 Ga0207680_10029384 Ga0207680_100293845 126
592 3300025904 Ga0207647_10000061 Ga0207647_1000006149 126
593 3300025904 Ga0207647_10059317 Ga0207647_100593172 126
594 3300025904 Ga0207647_10206732 Ga0207647_102067322 126
595 3300025907 Ga0207645_10000136 Ga0207645_1000013630 126
596 3300025907 Ga0207645_10454611 Ga0207645_104546112 126
597 3300025907 Ga0207645_10660936 Ga0207645_106609362 126
598 3300025908 Ga0207643_10071381 Ga0207643_100713813 126
599 3300025908 Ga0207643_10540481 Ga0207643_105404811 126
600 3300025908 Ga0207643_10552579 Ga0207643_105525791 126
601 3300025908 Ga0207643_10878620 Ga0207643_108786201 126
602 3300025909 Ga0207705_10272093 Ga0207705_102720932 126
603 3300025909 Ga0207705_10584278 Ga0207705_105842781 126
604 3300025909 Ga0207705_10833618 Ga0207705_108336182 126
605 3300025911 Ga0207654_10020022 Ga0207654_100200223 126
606 3300025911 Ga0207654_10074849 Ga0207654_100748492 126
607 3300025911 Ga0207654_10089265 Ga0207654_100892651 126
608 3300025912 Ga0207707_10422418 Ga0207707_104224181 126
609 3300025914 Ga0207671_10001528 Ga0207671_1000152816 126
610 3300025914 Ga0207671_10005708 Ga0207671_100057089 126
611 3300025914 Ga0207671_10075947 Ga0207671_100759472 126
612 3300025919 Ga0207657_10160448 Ga0207657_101604483 126
613 3300025919 Ga0207657_10914942 Ga0207657_109149421 126
614 3300025920 Ga0207649_10009396 Ga0207649_100093963 126
615 3300025920 Ga0207649_10316633 Ga0207649_103166332 126
616 3300025920 Ga0207649_10325496 Ga0207649_103254963 126
617 3300025920 Ga0207649_11396008 Ga0207649_113960081 126
618 3300025923 Ga0207681_10099843 Ga0207681_100998432 126
619 3300025923 Ga0207681_10736600 Ga0207681_107366002 126
620 3300025923 Ga0207681_11190182 Ga0207681_111901821 126
621 3300025924 Ga0207694_10045967 Ga0207694_100459673 126
622 3300025925 Ga0207650_10038566 Ga0207650_100385662 126
623 3300025925 Ga0207650_10071435 Ga0207650_100714353 126
624 3300025925 Ga0207650_10203430 Ga0207650_102034302 126
625 3300025925 Ga0207650_10612196 Ga0207650_106121962 126
626 3300025925 Ga0207650_11107726 Ga0207650_111077261 126
627 3300025926 Ga0207659_10008757 Ga0207659_100087572 126
628 3300025926 Ga0207659_10116399 Ga0207659_101163993 126
629 3300025926 Ga0207659_10272795 Ga0207659_102727952 126
630 3300025931 Ga0207644_10151465 Ga0207644_101514652 126
631 3300025932 Ga0207690_10011054 Ga0207690_100110545 126
632 3300025933 Ga0207706_10074924 Ga0207706_100749243 126
633 3300025934 Ga0207686_10174675 Ga0207686_101746752 126
634 3300025934 Ga0207686_10177655 Ga0207686_101776551 126
635 3300025934 Ga0207686_10924259 Ga0207686_109242591 126
636 3300025937 Ga0207669_10075623 Ga0207669_100756233 126
637 3300025937 Ga0207669_10189217 Ga0207669_101892173 126
638 3300025940 Ga0207691_10051301 Ga0207691_100513013 126
639 3300025940 Ga0207691_10432383 Ga0207691_104323832 126
640 3300025940 Ga0207691_10512499 Ga0207691_105124992 126
641 3300025940 Ga0207691_10546586 Ga0207691_105465862 126
642 3300025940 Ga0207691_10888830 Ga0207691_108888301 126
643 3300025942 Ga0207689_10001007 Ga0207689_1000100718 126
644 3300025942 Ga0207689_11353302 Ga0207689_113533022 126
645 3300025944 Ga0207661_10108637 Ga0207661_101086372 126
646 3300025944 Ga0207661_11609000 Ga0207661_116090001 126
647 3300025945 Ga0207679_10418597 Ga0207679_104185972 126
648 3300025945 Ga0207679_10812858 Ga0207679_108128581 126
649 3300025949 Ga0207667_10100362 Ga0207667_101003624 126
650 3300025960 Ga0207651_10356230 Ga0207651_103562303 126
651 3300025960 Ga0207651_10434882 Ga0207651_104348822 126
652 3300025961 Ga0207712_10186708 Ga0207712_101867082 126
653 3300025972 Ga0207668_10011982 Ga0207668_100119826 126
654 3300025972 Ga0207668_10256430 Ga0207668_102564302 126
655 3300025981 Ga0207640_10074654 Ga0207640_100746542 126
656 3300025981 Ga0207640_10651517 Ga0207640_106515172 126
657 3300025981 Ga0207640_11374742 Ga0207640_113747421 126
658 3300025981 Ga0207640_11540617 Ga0207640_115406172 126
659 3300025981 Ga0207640_12143983 Ga0207640_121439831 126
660 3300025986 Ga0207658_10054580 Ga0207658_100545802 126
661 3300025986 Ga0207658_10104039 Ga0207658_101040393 126
662 3300025986 Ga0207658_10471208 Ga0207658_104712082 126
663 3300025986 Ga0207658_10496302 Ga0207658_104963022 126
664 3300026023 Ga0207677_10005974 Ga0207677_100059748 126
665 3300026023 Ga0207677_10778385 Ga0207677_107783852 126
666 3300026023 Ga0207677_11480551 Ga0207677_114805512 126
667 3300026035 Ga0207703_10007227 Ga0207703_100072277 126
668 3300026035 Ga0207703_10546858 Ga0207703_105468582 126
669 3300026041 Ga0207639_10012815 Ga0207639_100128155 126
670 3300026041 Ga0207639_10030223 Ga0207639_100302234 126
671 3300026041 Ga0207639_10094529 Ga0207639_100945292 126
672 3300026041 Ga0207639_10217142 Ga0207639_102171422 126
673 3300026041 Ga0207639_10386592 Ga0207639_103865922 126
674 3300026041 Ga0207639_10596252 Ga0207639_105962523 126
675 3300026041 Ga0207639_11190964 Ga0207639_111909641 126
676 3300026041 Ga0207639_11465351 Ga0207639_114653511 126
677 3300026075 Ga0207708_11176236 Ga0207708_111762361 126
678 3300026075 Ga0207708_11257629 Ga0207708_112576291 126
679 3300026078 Ga0207702_10054227 Ga0207702_100542273 126
680 3300026078 Ga0207702_10975490 Ga0207702_109754901 126
681 3300026078 Ga0207702_11499653 Ga0207702_114996532 126
682 3300026088 Ga0207641_10000056 Ga0207641_1000005683 126
683 3300026088 Ga0207641_10080565 Ga0207641_100805653 126
684 3300026088 Ga0207641_10335652 Ga0207641_103356522 126
685 3300026089 Ga0207648_10004655 Ga0207648_1000465510 126
686 3300026089 Ga0207648_10016945 Ga0207648_100169457 126
687 3300026089 Ga0207648_10094532 Ga0207648_100945323 126
688 3300026089 Ga0207648_10347861 Ga0207648_103478612 126
689 3300026089 Ga0207648_11148431 Ga0207648_111484312 126
690 3300026095 Ga0207676_10024265 Ga0207676_100242652 126
691 3300026095 Ga0207676_10362899 Ga0207676_103628992 126
692 3300026095 Ga0207676_11158063 Ga0207676_111580632 126
693 3300026116 Ga0207674_10189753 Ga0207674_101897532 126
694 3300026116 Ga0207674_10223695 Ga0207674_102236953 126
695 3300026116 Ga0207674_10327433 Ga0207674_103274333 126
696 3300026116 Ga0207674_10367947 Ga0207674_103679472 126
697 3300026116 Ga0207674_11896687 Ga0207674_118966871 126
698 3300026118 Ga0207675_100021679 Ga0207675_1000216794 126
699 3300026118 Ga0207675_100044754 Ga0207675_1000447544 126
700 3300026118 Ga0207675_100944893 Ga0207675_1009448932 126
701 3300026118 Ga0207675_101838666 Ga0207675_1018386661 126
702 3300026121 Ga0207683_10002007 Ga0207683_1000200711 126
703 3300026121 Ga0207683_10007862 Ga0207683_100078624 126
704 3300026121 Ga0207683_10328787 Ga0207683_103287872 126
705 3300026142 Ga0207698_10014929 Ga0207698_100149294 126
706 3300026142 Ga0207698_10118309 Ga0207698_101183092 126
707 3300026142 Ga0207698_10278731 Ga0207698_102787311 126
708 3300026142 Ga0207698_10694245 Ga0207698_106942452 126
709 3300026142 Ga0207698_12250113 Ga0207698_122501131 126
710 3300027360 Ga0209969_1014467 Ga0209969_10144672 126
711 3300027543 Ga0209999_1073538 Ga0209999_10735381 126
712 3300028379 Ga0268266_10407981 Ga0268266_104079812 126
713 3300028379 Ga0268266_10531162 Ga0268266_105311622 126
714 3300028380 Ga0268265_10111456 Ga0268265_101114562 126
715 3300028380 Ga0268265_10181166 Ga0268265_101811662 126
716 3300028380 Ga0268265_10359237 Ga0268265_103592372 126
717 3300028380 Ga0268265_11590769 Ga0268265_115907691 126
718 3300028381 Ga0268264_10000143 Ga0268264_10000143123 126
719 3300028381 Ga0268264_10001996 Ga0268264_1000199619 126
720 3300028381 Ga0268264_10006748 Ga0268264_100067486 126
721 3300028381 Ga0268264_10102001 Ga0268264_101020012 126
722 3300028381 Ga0268264_10252306 Ga0268264_102523062 126
723 3300028381 Ga0268264_10703411 Ga0268264_107034111 126
724 3300028786 Ga0307517_10012359 Ga0307517_100123596 126
725 3300028786 Ga0307517_10537432 Ga0307517_105374321 126
726 3300028794 Ga0307515_10000010 Ga0307515_10000010125 126
727 3300028794 Ga0307515_10828988 Ga0307515_108289881 126
728 3300031507 Ga0307509_10064977 Ga0307509_100649773 126
729 3300031507 Ga0307509_10073156 Ga0307509_100731561 126
730 3300031548 Ga0307408_100852758 Ga0307408_1008527581 126
731 3300031595 Ga0265313_10097472 Ga0265313_100974722 126
732 3300031616 Ga0307508_10005346 Ga0307508_100053469 126
733 3300031616 Ga0307508_10409235 Ga0307508_104092352 126
734 3300031730 Ga0307516_10000310 Ga0307516_1000031035 126
735 3300031730 Ga0307516_10091390 Ga0307516_100913903 126
736 3300031731 Ga0307405_11532758 Ga0307405_115327581 126
737 3300031824 Ga0307413_10114910 Ga0307413_101149103 126
738 3300031824 Ga0307413_10160978 Ga0307413_101609783 126
739 3300031824 Ga0307413_11311686 Ga0307413_113116861 126
740 3300031852 Ga0307410_10135676 Ga0307410_101356762 126
741 3300031852 Ga0307410_10394426 Ga0307410_103944262 126
742 3300031901 Ga0307406_10457528 Ga0307406_104575282 126
743 3300031901 Ga0307406_10801726 Ga0307406_108017262 126
744 3300031903 Ga0307407_11354767 Ga0307407_113547671 126
745 3300031903 Ga0307407_11694403 Ga0307407_116944032 126
746 3300031911 Ga0307412_10261514 Ga0307412_102615141 126
747 3300031911 Ga0307412_10694157 Ga0307412_106941572 126
748 3300032002 Ga0307416_100824398 Ga0307416_1008243982 126
749 3300032002 Ga0307416_102050624 Ga0307416_1020506241 126
750 3300032002 Ga0307416_102554959 Ga0307416_1025549591 126
751 3300032004 Ga0307414_10017473 Ga0307414_100174732 126
752 3300032004 Ga0307414_10040797 Ga0307414_100407973 126
753 3300032004 Ga0307414_10109465 Ga0307414_101094653 126
754 3300032004 Ga0307414_11434493 Ga0307414_114344932 126
755 3300032005 Ga0307411_10108887 Ga0307411_101088873 126
756 3300032126 Ga0307415_100564415 Ga0307415_1005644152 126
757 3300032126 Ga0307415_102473008 Ga0307415_1024730082 126
758 3300035112 Ga0373932_0192779 Ga0373932_0192779_146_526 126
759 3300035116 Ga0373945_0242304 Ga0373945_0242304_338_718 126
760 3300037418 Ga0395900_0110793 Ga0395900_0110793_1207_1587 126
761 3300037418 Ga0395900_0188108 Ga0395900_0188108_903_1283 126
762 3300037466 Ga0395898_0070019 Ga0395898_0070019_155_535 126
763 3300037471 Ga0395905_0001345 Ga0395905_0001345_126_506 126
764 3300037471 Ga0395905_0136116 Ga0395905_0136116_1345_1725 126
765 3300037471 Ga0395905_0179884 Ga0395905_0179884_1401_1781 126
766 3300037471 Ga0395905_1287078 Ga0395905_1287078_134_514 126
767 3300038443 Ga0395901_0244126 Ga0395901_0244126_586_966 126
768 3300039450 Ga0436363_0872388 Ga0436363_0872388_77_457 126
769 3300041404 Ga0439436_0002743 Ga0439436_0002743_4738_5118 126
770 3300041406 Ga0439439_0077696 Ga0439439_0077696_403_783 126
771 3300041406 Ga0439439_0183551 Ga0439439_0183551_148_528 126
772 3300041410 Ga0439461_0137082 Ga0439461_0137082_202_585 126
773 3300041441 Ga0451787_785918 Ga0451787_785918_180_563 126
774 3300041446 Ga0451794_27472 Ga0451794_27472_22_405 126
775 3300041451 Ga0451791_0399799 Ga0451791_0399799_134_517 126
776 3300041451 Ga0451791_1208094 Ga0451791_1208094_109_489 126
777 3300041452 Ga0451793_1587185 Ga0451793_1587185_93_473 126
778 3300041453 Ga0451797_1588628 Ga0451797_1588628_248_631 126
779 3300041456 Ga0451795_1448333 Ga0451795_1448333_85_465 126
780 3300041456 Ga0451795_1559977 Ga0451795_1559977_1453_1836 126
781 3300041459 Ga0451800_0588693 Ga0451800_0588693_32_415 126
782 3300041460 Ga0451802_1731334 Ga0451802_1731334_806_1189 126
783 3300041492 Ga0451835_0789270 Ga0451835_0789270_82_465 126
784 3300041494 Ga0451837_0197040 Ga0451837_0197040_127_507 126
785 3300041498 Ga0451841_0599628 Ga0451841_0599628_142_525 126
786 3300041507 Ga0451851_0687021 Ga0451851_0687021_917_1300 126
787 3300041509 Ga0451843_1199062 Ga0451843_1199062_109_489 126
788 3300041512 Ga0451853_3623145 Ga0451853_3623145_22_405 126
789 3300041997 Ga0439431_0242308 Ga0439431_0242308_137_517 126
790 3300042004 Ga0439445_0156231 Ga0439445_0156231_258_641 126
791 3300042007 Ga0439449_0031986 Ga0439449_0031986_485_865 126
792 3300042014 Ga0439457_002182 Ga0439457_002182_4855_5235 126
793 3300042015 Ga0439462_0001485 Ga0439462_0001485_4431_4811 126
794 3300042124 Ga0450922_002074 Ga0450922_002074_1332_1712 126
795 3300042125 Ga0450923_031380 Ga0450923_031380_171_551 126
796 3300042129 Ga0450891_013892 Ga0450891_013892_161_541 126
797 3300042156 Ga0439446_0021043 Ga0439446_0021043_912_1295 126
798 3300042876 Ga0451577_0993182 Ga0451577_0993182_261_641 126
799 3300044656 Ga0466969_0000382 Ga0466969_0000382_5955_6335 126
800 3300044658 Ga0466972_0000010 Ga0466972_0000010_67713_68165 126
801 3300044658 Ga0466972_0032803 Ga0466972_0032803_1482_1862 126
802 3300044673 Ga0453683_0039267 Ga0453683_0039267_1110_1490 126
803 3300044683 Ga0466965_0159272 Ga0466965_0159272_337_717 126
804 3300044684 Ga0466966_0000176 Ga0466966_0000176_325_705 126
805 3300044693 Ga0466961_0051907 Ga0466961_0051907_1305_1685 126
806 3300044693 Ga0466961_0908939 Ga0466961_0908939_46_426 126
807 3300044706 Ga0466964_0016312 Ga0466964_0016312_1439_1819 126
808 3300044712 Ga0453684_0023172 Ga0453684_0023172_3080_3460 126
809 3300044719 Ga0466971_0066558 Ga0466971_0066558_1140_1520 126
810 3300044719 Ga0466971_0140109 Ga0466971_0140109_112_492 126
811 3300044719 Ga0466971_0466661 Ga0466971_0466661_53_433 126
812 3300044735 Ga0466968_0192757 Ga0466968_0192757_492_872 126
813 3300044842 Ga0466957_0000577 Ga0466957_0000577_13120_13500 126
814 3300045049 Ga0466959_0000016 Ga0466959_0000016_48835_49215 126
815 3300045051 Ga0451576_1131007 Ga0451576_1131007_285_665 126
816 3300045976 Ga0466967_2572569 Ga0466967_2572569_15_395 126
817 3300046460 Ga0495638_0010167 Ga0495638_0010167_931_1314 126
818 3300046460 Ga0495638_0291223 Ga0495638_0291223_450_830 126
819 3300046471 Ga0495650_0047770 Ga0495650_0047770_1221_1601 126
820 3300046519 Ga0495632_0230222 Ga0495632_0230222_193_576 126
821 3300046539 Ga0495621_0269283 Ga0495621_0269283_228_608 126
822 3300046616 Ga0495668_0000212 Ga0495668_0000212_4847_5227 126
823 3300046616 Ga0495668_0002317 Ga0495668_0002317_10701_11084 126
824 3300046660 Ga0495625_0087620 Ga0495625_0087620_1248_1628 126
825 3300047320 Ga0495672_0013561 Ga0495672_0013561_5127_5507 126
826 3300047320 Ga0495672_0028834 Ga0495672_0028834_884_1264 126
827 3300047320 Ga0495672_0106175 Ga0495672_0106175_68_448 126
828 3300047443 Ga0495687_061674 Ga0495687_061674_905_1285 126
829 3300048911 Ga0496108_0172689 Ga0496108_0172689_1090_1470 126
830 3300048911 Ga0496108_1293232 Ga0496108_1293232_48_428 126
831 3300048912 Ga0496109_0420713 Ga0496109_0420713_841_1221 126
832 3300048915 Ga0496112_1587198 Ga0496112_1587198_36_416 126
833 3300048927 Ga0496124_0043266 Ga0496124_0043266_1574_1957 126
834 3300049132 Ga0501343_024351 Ga0501343_024351_154_534 126
835 3300049515 Ga0501292_014129 Ga0501292_014129_481_864 126
836 3300049552 Ga0501336_031623 Ga0501336_031623_132_512 126
837 3300049571 Ga0501034_0001387 Ga0501034_0001387_3869_4249 126
838 3300049574 Ga0501038_0899795 Ga0501038_0899795_81_461 126
839 3300049579 Ga0501043_0066157 Ga0501043_0066157_2411_2791 126
840 3300049652 Ga0501202_002207 Ga0501202_002207_1771_2154 126
841 3300049654 Ga0501207_014739 Ga0501207_014739_152_535 126
842 3300049661 Ga0501217_000585 Ga0501217_000585_909_1292 126
843 3300049661 Ga0501217_105623 Ga0501217_105623_351_734 126
844 3300049663 Ga0501223_016328 Ga0501223_016328_935_1318 126
845 3300049663 Ga0501223_072954 Ga0501223_072954_233_616 126
846 3300049664 Ga0501224_047312 Ga0501224_047312_122_505 126
847 3300049668 Ga0501233_083594 Ga0501233_083594_141_524 126
848 3300049669 Ga0501235_011635 Ga0501235_011635_378_761 126
849 3300049675 Ga0501243_000796 Ga0501243_000796_2052_2435 126
850 3300049679 Ga0501249_175136 Ga0501249_175136_150_530 126
851 3300049682 Ga0501252_004199 Ga0501252_004199_883_1263 126
852 3300049686 Ga0501257_130663 Ga0501257_130663_271_654 126
853 3300049688 Ga0501259_002156 Ga0501259_002156_983_1363 126
854 3300049688 Ga0501259_049588 Ga0501259_049588_266_649 126
855 3300049688 Ga0501259_149958 Ga0501259_149958_153_536 126
856 3300049704 Ga0501221_000606 Ga0501221_000606_3468_3851 126
857 3300049704 Ga0501221_133229 Ga0501221_133229_201_581 126
858 3300049705 Ga0501225_0000561 Ga0501225_0000561_6002_6385 126
859 3300049707 Ga0501234_003922 Ga0501234_003922_16_399 126
860 3300049708 Ga0501245_000123 Ga0501245_000123_965_1348 126
861 3300049763 Ga0501266_059389 Ga0501266_059389_136_519 126
862 3300049763 Ga0501266_094946 Ga0501266_094946_34_417 126
863 3300049776 Ga0501280_008373 Ga0501280_008373_126_509 126
864 3300049822 Ga0501035_0394525 Ga0501035_0394525_62_442 126
865 3300049823 Ga0501044_0128850 Ga0501044_0128850_1501_1881 126
866 3300049823 Ga0501044_0633886 Ga0501044_0633886_551_931 126
867 3300050493 nmdc:mga0k408_145923_c1 nmdc:mga0k408_145923_c1_291_671 126
868 3300050493 nmdc:mga0k408_164532_c1 nmdc:mga0k408_164532_c1_153_533 126
869 3300050493 nmdc:mga0k408_682342_c1 nmdc:mga0k408_682342_c1_52_432 126
870 3300050507 nmdc:mga05p37_914_c1 nmdc:mga05p37_914_c1_13349_13729 126
871 3300050508 nmdc:mga09592_20986_c1 nmdc:mga09592_20986_c1_1862_2242 126
872 3300050510 nmdc:mga06r32_443171_c1 nmdc:mga06r32_443171_c1_283_663 126
873 3300050511 nmdc:mga08y16_292197_c1 nmdc:mga08y16_292197_c1_1073_1453 126
874 3300050511 nmdc:mga08y16_98820_c1 nmdc:mga08y16_98820_c1_1209_1589 126
875 3300053086 Ga0500578_0001201 Ga0500578_0001201_24107_24487 126
876 3300053086 Ga0500578_0335650 Ga0500578_0335650_473_853 126
877 3300053090 Ga0500646_0002555 Ga0500646_0002555_1842_2225 126
878 3300053090 Ga0500646_0052662 Ga0500646_0052662_542_922 126
879 3300053092 Ga0500583_0000037 Ga0500583_0000037_29478_29861 126
880 3300053093 Ga0500651_0292134 Ga0500651_0292134_112_495 126
881 3300053093 Ga0500651_0627231 Ga0500651_0627231_85_465 126
882 3300053094 Ga0500566_0344566 Ga0500566_0344566_205_585 126
883 3300053097 Ga0500648_412996 Ga0500648_412996_77_457 126
884 3300053098 Ga0500650_0081223 Ga0500650_0081223_185_565 126
885 3300053099 Ga0500654_140194 Ga0500654_140194_238_618 126
886 3300053103 Ga0500555_052757 Ga0500555_052757_256_636 126
887 3300053104 Ga0500556_0026589 Ga0500556_0026589_1210_1593 126
888 3300053104 Ga0500556_0321681 Ga0500556_0321681_180_560 126
889 3300053109 Ga0500569_150109 Ga0500569_150109_196_579 126
890 3300053111 Ga0500572_149345 Ga0500572_149345_118_498 126
891 3300053130 Ga0500642_0134766 Ga0500642_0134766_761_1141 126
892 3300053130 Ga0500642_0149458 Ga0500642_0149458_418_798 126
893 3300053130 Ga0500642_0409984 Ga0500642_0409984_45_425 126
894 3300053131 Ga0500652_086593 Ga0500652_086593_582_965 126
895 3300053131 Ga0500652_116468 Ga0500652_116468_403_783 126
896 3300053134 Ga0500658_0476512 Ga0500658_0476512_23_403 126
897 3300053136 Ga0500559_0335764 Ga0500559_0335764_134_514 126
898 3300053139 Ga0500568_0073147 Ga0500568_0073147_423_803 126
899 3300053139 Ga0500568_0287510 Ga0500568_0287510_53_433 126
900 3300053144 Ga0500585_204588 Ga0500585_204588_167_547 126
901 3300053147 Ga0500589_159099 Ga0500589_159099_414_794 126
902 3300053150 Ga0500603_025754 Ga0500603_025754_1000_1380 126
903 3300053150 Ga0500603_163692 Ga0500603_163692_23_403 126
904 3300053151 Ga0500604_0003061 Ga0500604_0003061_3845_4228 126
905 3300053151 Ga0500604_0106764 Ga0500604_0106764_262_642 126
906 3300053153 Ga0500616_0008456 Ga0500616_0008456_290_670 126
907 3300053154 Ga0500619_065082 Ga0500619_065082_564_944 126
908 3300053156 Ga0500622_0032820 Ga0500622_0032820_568_951 126
909 3300053156 Ga0500622_0056323 Ga0500622_0056323_886_1269 126
910 3300053177 Ga0500636_0058636 Ga0500636_0058636_1540_1923 126
911 3300053727 Ga0500611_014276 Ga0500611_014276_717_1100 126
912 3300059624 Ga0587109_120284 Ga0587109_120284_55_435 126
913 3300061719 Ga0466962_0341871 Ga0466962_0341871_190_570 126
914 3300061719 Ga0466962_0532944 Ga0466962_0532944_181_564 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19569

START_2

START-like superfamily domain

1

130

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cnw-assembly1.cif.gz_A three-dimensional structure of the protein xoxi (q81ay6) from bacillus cereus. northeast structural genomics consortium target bcr196. 0.8305 6 123
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.8202 5 121
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.815 6 126
4n0g-assembly1.cif.gz_C crystal structure of pyl13-pp2ca complex 0.7971 2 122
4jda-assembly1.cif.gz_B complex structure of abscisic acid receptor pyl3 with (-)-aba 0.7889 1 120
ID Description Score Start End Superfamily
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8202 5 121 3.30.530.20
af_Q8T2R4_3_145_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8019 5 126 3.30.530.20
3f08B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.787 5 126 3.30.530.20
af_I6X666_8_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7778 5 125 3.30.530.20
af_I1LX70_3_186_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7748 1 122 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A4Q3BNH9-F1-model_v4 SRPBCC domain-containing protein 0.9465 1 126
AF-A0A7T9FHS6-F1-model_v4 deleted 0.9461 4 125
AF-A0A4Q3RXA8-F1-model_v4 ATPase 0.9435 1 126
AF-A0A6I5I4F3-F1-model_v4 SRPBCC domain-containing protein 0.942 4 125
AF-A0A2E4J8N8-F1-model_v4 START-like domain-containing protein 0.9413 5 126

Feature Viewer

pLDDT pTM Quality
85.57 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map