F485561
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 914 | 352 | 912 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300005337|Ga0070682_100089754|Ga0070682_1000897543 |
| Length | 130 |
| Sequence | MSKKVLYTLEYPVRCSPGILYDFLSTPAGLQEWFADKVDERDGVFSFSWNGGTNGSDEKAELLETEQDKFVRFRWLHNAKDEFFEFSIDKSEVTNQTILIIKDFADKKEIKDQSQLWEYQVKDLFHRLGN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 174 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 175 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 179 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 207 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 208 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 209 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 210 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 212 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 219 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 220 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 221 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 222 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 223 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 224 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 225 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 226 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 227 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 228 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 229 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 230 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 231 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 232 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 233 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 236 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 237 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 238 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 241 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 242 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 243 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 244 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 245 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 246 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 247 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 288 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 290 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 291 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 297 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 298 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 299 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 301 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 302 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 305 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 306 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 307 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 308 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 309 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 310 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 313 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 314 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 315 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 326 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 327 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 328 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 329 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 330 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 331 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 332 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 334 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 335 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 336 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 337 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 338 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 339 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 341 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 342 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 343 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 344 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 345 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 346 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 347 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 348 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 349 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 351 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.23 |
| Metatranscriptomes | 0.55 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.14 |
| Nodule | 0 |
| Rhizoplane | 2.3 |
| Rhizosphere | 89.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1004049 | 3300001904 | Bacteria | 2520 |
| 2 | JGI24737J22298_10075046 | 3300001990 | Bacteria | 1008 |
| 3 | JGI24745J21846_1050996 | 3300002073 | Bacteria | 525 |
| 4 | JGI24744J21845_10007180 | 3300002077 | Unclassified | 2301 |
| 5 | JGI24751J29686_10041257 | 3300002459 | Bacteria | 955 |
| 6 | rootH1_10019969 | 3300003323 | Bacteria | 6571 |
| 7 | rootH1_10144194 | 3300003323 | Bacteria | 1525 |
| 8 | rootH1_10163770 | 3300003323 | Bacteria | 2320 |
| 9 | Ga0055535_1001800 | 3300003761 | Bacteria | 9378 |
| 10 | Ga0065712_10010222 | 3300005290 | Bacteria | 4198 |
| 11 | Ga0065712_10032529 | 3300005290 | Bacteria | 1532 |
| 12 | Ga0065712_10363462 | 3300005290 | Bacteria | 772 |
| 13 | Ga0065712_10461770 | 3300005290 | Bacteria | 675 |
| 14 | Ga0065707_10339960 | 3300005295 | Bacteria | 935 |
| 15 | Ga0070658_10261787 | 3300005327 | Bacteria | 1469 |
| 16 | Ga0070658_10297148 | 3300005327 | Bacteria | 1377 |
| 17 | Ga0070658_10339819 | 3300005327 | Bacteria | 1284 |
| 18 | Ga0070658_10948829 | 3300005327 | Bacteria | 748 |
| 19 | Ga0070658_11112402 | 3300005327 | Unclassified | 687 |
| 20 | Ga0070676_10153611 | 3300005328 | Bacteria | 1475 |
| 21 | Ga0070676_10181503 | 3300005328 | Bacteria | 1369 |
| 22 | Ga0070676_10658215 | 3300005328 | Bacteria | 761 |
| 23 | Ga0070676_11396621 | 3300005328 | Bacteria | 537 |
| 24 | Ga0070683_100000468 | 3300005329 | Bacteria | 28362 |
| 25 | Ga0070683_100010147 | 3300005329 | Bacteria | 8085 |
| 26 | Ga0070683_100114315 | 3300005329 | Bacteria | 2547 |
| 27 | Ga0070683_101742005 | 3300005329 | Bacteria | 599 |
| 28 | Ga0070690_100033160 | 3300005330 | Bacteria | 3230 |
| 29 | Ga0070690_100249207 | 3300005330 | Bacteria | 1255 |
| 30 | Ga0070690_100362890 | 3300005330 | Bacteria | 1054 |
| 31 | Ga0070690_100400097 | 3300005330 | Bacteria | 1008 |
| 32 | Ga0070670_100005343 | 3300005331 | Bacteria | 10833 |
| 33 | Ga0070670_100035958 | 3300005331 | Bacteria | 4264 |
| 34 | Ga0070670_100036127 | 3300005331 | Bacteria | 4252 |
| 35 | Ga0070670_100063150 | 3300005331 | Bacteria | 3178 |
| 36 | Ga0070670_100272545 | 3300005331 | Bacteria | 1477 |
| 37 | Ga0070670_100419001 | 3300005331 | Bacteria | 1184 |
| 38 | Ga0070670_100741688 | 3300005331 | Bacteria | 885 |
| 39 | Ga0070670_100781479 | 3300005331 | Bacteria | 861 |
| 40 | Ga0070670_100913885 | 3300005331 | Bacteria | 796 |
| 41 | Ga0070677_10149540 | 3300005333 | Unclassified | 1085 |
| 42 | Ga0070677_10745457 | 3300005333 | Bacteria | 555 |
| 43 | Ga0068869_100009768 | 3300005334 | Bacteria | 6232 |
| 44 | Ga0068869_100012813 | 3300005334 | Bacteria | 5548 |
| 45 | Ga0068869_100017295 | 3300005334 | Bacteria | 4884 |
| 46 | Ga0068869_100063232 | 3300005334 | Bacteria | 2718 |
| 47 | Ga0068869_100079146 | 3300005334 | Bacteria | 2449 |
| 48 | Ga0070666_10000038 | 3300005335 | Bacteria | 115799 |
| 49 | Ga0070666_10004991 | 3300005335 | Bacteria | 8117 |
| 50 | Ga0070666_10017523 | 3300005335 | Bacteria | 4592 |
| 51 | Ga0070666_10065667 | 3300005335 | Unclassified | 2462 |
| 52 | Ga0070666_10078810 | 3300005335 | Bacteria | 2249 |
| 53 | Ga0070666_10160446 | 3300005335 | Bacteria | 1571 |
| 54 | Ga0070666_10693283 | 3300005335 | Bacteria | 747 |
| 55 | Ga0070680_100701041 | 3300005336 | Bacteria | 871 |
| 56 | Ga0070682_100000039 | 3300005337 | Bacteria | 144400 |
| 57 | Ga0070682_100089754 | 3300005337 | Bacteria | 2008 |
| 58 | Ga0068868_100018213 | 3300005338 | Bacteria | 5247 |
| 59 | Ga0068868_100078150 | 3300005338 | Bacteria | 2648 |
| 60 | Ga0068868_100451053 | 3300005338 | Bacteria | 1119 |
| 61 | Ga0068868_100455352 | 3300005338 | Bacteria | 1113 |
| 62 | Ga0068868_100573323 | 3300005338 | Bacteria | 997 |
| 63 | Ga0068868_100703417 | 3300005338 | Bacteria | 904 |
| 64 | Ga0068868_101400190 | 3300005338 | Bacteria | 652 |
| 65 | Ga0070660_100124788 | 3300005339 | Bacteria | 2057 |
| 66 | Ga0070660_100154184 | 3300005339 | Bacteria | 1849 |
| 67 | Ga0070660_100746687 | 3300005339 | Bacteria | 822 |
| 68 | Ga0070660_100825265 | 3300005339 | Bacteria | 780 |
| 69 | Ga0070689_100390503 | 3300005340 | Bacteria | 1174 |
| 70 | Ga0070689_101071285 | 3300005340 | Bacteria | 719 |
| 71 | Ga0070661_100000179 | 3300005344 | Bacteria | 52306 |
| 72 | Ga0070661_100034574 | 3300005344 | Bacteria | 3665 |
| 73 | Ga0070661_100041203 | 3300005344 | Bacteria | 3370 |
| 74 | Ga0070661_100245247 | 3300005344 | Bacteria | 1381 |
| 75 | Ga0070661_100348972 | 3300005344 | Bacteria | 1160 |
| 76 | Ga0070661_100644217 | 3300005344 | Unclassified | 860 |
| 77 | Ga0070661_100762729 | 3300005344 | Unclassified | 792 |
| 78 | Ga0070668_100043263 | 3300005347 | Bacteria | 3454 |
| 79 | Ga0070668_100066643 | 3300005347 | Bacteria | 2794 |
| 80 | Ga0070668_100128656 | 3300005347 | Bacteria | 2030 |
| 81 | Ga0070668_100303381 | 3300005347 | Bacteria | 1340 |
| 82 | Ga0070669_100024662 | 3300005353 | Unclassified | 4315 |
| 83 | Ga0070669_100080917 | 3300005353 | Bacteria | 2419 |
| 84 | Ga0070669_100463594 | 3300005353 | Bacteria | 1046 |
| 85 | Ga0070675_100009635 | 3300005354 | Bacteria | 7516 |
| 86 | Ga0070675_100020576 | 3300005354 | Bacteria | 5264 |
| 87 | Ga0070675_100054348 | 3300005354 | Bacteria | 3294 |
| 88 | Ga0070675_100061215 | 3300005354 | Bacteria | 3108 |
| 89 | Ga0070675_100112895 | 3300005354 | Bacteria | 2301 |
| 90 | Ga0070675_100174024 | 3300005354 | Bacteria | 1858 |
| 91 | Ga0070675_100196931 | 3300005354 | Bacteria | 1747 |
| 92 | Ga0070675_100621474 | 3300005354 | Unclassified | 981 |
| 93 | Ga0070671_100015772 | 3300005355 | Bacteria | 6105 |
| 94 | Ga0070671_100238388 | 3300005355 | Unclassified | 1544 |
| 95 | Ga0070671_100385284 | 3300005355 | Unclassified | 1198 |
| 96 | Ga0070671_100415093 | 3300005355 | Bacteria | 1152 |
| 97 | Ga0070671_101374792 | 3300005355 | Bacteria | 623 |
| 98 | Ga0070674_100004279 | 3300005356 | Bacteria | 8121 |
| 99 | Ga0070674_100184538 | 3300005356 | Bacteria | 1600 |
| 100 | Ga0070674_101537375 | 3300005356 | Unclassified | 599 |
| 101 | Ga0070673_100008952 | 3300005364 | Bacteria | 6693 |
| 102 | Ga0070673_100193037 | 3300005364 | Bacteria | 1750 |
| 103 | Ga0070673_100224099 | 3300005364 | Bacteria | 1628 |
| 104 | Ga0070673_100515191 | 3300005364 | Bacteria | 1083 |
| 105 | Ga0070673_100959417 | 3300005364 | Bacteria | 795 |
| 106 | Ga0070673_101002771 | 3300005364 | Bacteria | 777 |
| 107 | Ga0070673_101024716 | 3300005364 | Bacteria | 769 |
| 108 | Ga0070673_102010022 | 3300005364 | Bacteria | 549 |
| 109 | Ga0070688_100186446 | 3300005365 | Bacteria | 1442 |
| 110 | Ga0070688_100205693 | 3300005365 | Bacteria | 1379 |
| 111 | Ga0070688_100572459 | 3300005365 | Unclassified | 861 |
| 112 | Ga0070659_100009346 | 3300005366 | Bacteria | 7200 |
| 113 | Ga0070659_100366428 | 3300005366 | Bacteria | 1211 |
| 114 | Ga0070659_100748233 | 3300005366 | Bacteria | 848 |
| 115 | Ga0070659_100751956 | 3300005366 | Bacteria | 845 |
| 116 | Ga0070659_101129172 | 3300005366 | Bacteria | 691 |
| 117 | Ga0070659_101419530 | 3300005366 | Bacteria | 617 |
| 118 | Ga0070667_100183990 | 3300005367 | Bacteria | 1849 |
| 119 | Ga0070667_100291951 | 3300005367 | Unclassified | 1466 |
| 120 | Ga0070667_100543420 | 3300005367 | Bacteria | 1067 |
| 121 | Ga0070667_101228153 | 3300005367 | Bacteria | 702 |
| 122 | Ga0070667_101820178 | 3300005367 | Unclassified | 573 |
| 123 | Ga0070701_10279105 | 3300005438 | Bacteria | 1019 |
| 124 | Ga0070701_11203204 | 3300005438 | Bacteria | 538 |
| 125 | Ga0070700_100246934 | 3300005441 | Bacteria | 1278 |
| 126 | Ga0070700_100578069 | 3300005441 | Bacteria | 877 |
| 127 | Ga0070700_100755333 | 3300005441 | Bacteria | 779 |
| 128 | Ga0070700_101437041 | 3300005441 | Bacteria | 584 |
| 129 | Ga0070678_100004697 | 3300005456 | Bacteria | 7775 |
| 130 | Ga0070678_100014866 | 3300005456 | Bacteria | 4927 |
| 131 | Ga0070678_100039709 | 3300005456 | Bacteria | 3323 |
| 132 | Ga0070678_100917164 | 3300005456 | Bacteria | 801 |
| 133 | Ga0070662_100005910 | 3300005457 | Bacteria | 7851 |
| 134 | Ga0070662_100015036 | 3300005457 | Bacteria | 5177 |
| 135 | Ga0070662_100049525 | 3300005457 | Bacteria | 3029 |
| 136 | Ga0070662_100505270 | 3300005457 | Bacteria | 1009 |
| 137 | Ga0070662_100815865 | 3300005457 | Bacteria | 793 |
| 138 | Ga0070662_100885467 | 3300005457 | Bacteria | 761 |
| 139 | Ga0070681_10389720 | 3300005458 | Bacteria | 1304 |
| 140 | Ga0068867_100026385 | 3300005459 | Bacteria | 4171 |
| 141 | Ga0068867_100040030 | 3300005459 | Bacteria | 3419 |
| 142 | Ga0068867_100165085 | 3300005459 | Bacteria | 1749 |
| 143 | Ga0068867_100301896 | 3300005459 | Bacteria | 1320 |
| 144 | Ga0068867_100836426 | 3300005459 | Bacteria | 824 |
| 145 | Ga0068867_100926275 | 3300005459 | Bacteria | 786 |
| 146 | Ga0068867_101753790 | 3300005459 | Bacteria | 583 |
| 147 | Ga0070685_10007192 | 3300005466 | Bacteria | 5688 |
| 148 | Ga0070685_10112716 | 3300005466 | Unclassified | 1678 |
| 149 | Ga0070685_10169882 | 3300005466 | Bacteria | 1397 |
| 150 | Ga0070685_11201048 | 3300005466 | Bacteria | 576 |
| 151 | Ga0070699_100288194 | 3300005518 | Bacteria | 1472 |
| 152 | Ga0070684_100022853 | 3300005535 | Bacteria | 5220 |
| 153 | Ga0070684_100047735 | 3300005535 | Bacteria | 3711 |
| 154 | Ga0070684_100347754 | 3300005535 | Bacteria | 1363 |
| 155 | Ga0070684_101424077 | 3300005535 | Bacteria | 653 |
| 156 | Ga0070684_102119985 | 3300005535 | Bacteria | 530 |
| 157 | Ga0068853_100002821 | 3300005539 | Bacteria | 13161 |
| 158 | Ga0068853_100015211 | 3300005539 | Bacteria | 6324 |
| 159 | Ga0068853_100021602 | 3300005539 | Bacteria | 5370 |
| 160 | Ga0068853_100022828 | 3300005539 | Bacteria | 5230 |
| 161 | Ga0068853_100064395 | 3300005539 | Bacteria | 3179 |
| 162 | Ga0068853_100781567 | 3300005539 | Bacteria | 913 |
| 163 | Ga0068853_100866258 | 3300005539 | Unclassified | 867 |
| 164 | Ga0070672_100036669 | 3300005543 | Bacteria | 3736 |
| 165 | Ga0070672_100091970 | 3300005543 | Bacteria | 2448 |
| 166 | Ga0070672_100159406 | 3300005543 | Bacteria | 1871 |
| 167 | Ga0070672_100320048 | 3300005543 | Bacteria | 1318 |
| 168 | Ga0070672_100352251 | 3300005543 | Bacteria | 1255 |
| 169 | Ga0070672_101395410 | 3300005543 | Bacteria | 626 |
| 170 | Ga0070672_101578769 | 3300005543 | Bacteria | 588 |
| 171 | Ga0070686_100842026 | 3300005544 | Unclassified | 742 |
| 172 | Ga0070686_101010107 | 3300005544 | Bacteria | 683 |
| 173 | Ga0070693_100729554 | 3300005547 | Bacteria | 728 |
| 174 | Ga0070693_100924096 | 3300005547 | Bacteria | 655 |
| 175 | Ga0070693_100999707 | 3300005547 | Bacteria | 633 |
| 176 | Ga0070665_100079455 | 3300005548 | Bacteria | 3286 |
| 177 | Ga0070665_100186701 | 3300005548 | Bacteria | 2074 |
| 178 | Ga0070665_100210394 | 3300005548 | Bacteria | 1945 |
| 179 | Ga0068855_100017041 | 3300005563 | Bacteria | 8739 |
| 180 | Ga0068855_100870216 | 3300005563 | Bacteria | 954 |
| 181 | Ga0070664_100000140 | 3300005564 | Bacteria | 49126 |
| 182 | Ga0070664_100258862 | 3300005564 | Bacteria | 1565 |
| 183 | Ga0070664_100262348 | 3300005564 | Bacteria | 1554 |
| 184 | Ga0070664_100360954 | 3300005564 | Bacteria | 1323 |
| 185 | Ga0070664_100432481 | 3300005564 | Bacteria | 1206 |
| 186 | Ga0070664_101121182 | 3300005564 | Unclassified | 741 |
| 187 | Ga0068857_100007728 | 3300005577 | Bacteria | 9263 |
| 188 | Ga0068857_100075454 | 3300005577 | Bacteria | 3006 |
| 189 | Ga0068857_100136533 | 3300005577 | Bacteria | 2214 |
| 190 | Ga0068857_100341845 | 3300005577 | Bacteria | 1385 |
| 191 | Ga0068857_100764725 | 3300005577 | Bacteria | 921 |
| 192 | Ga0068857_101565094 | 3300005577 | Bacteria | 643 |
| 193 | Ga0068857_102229227 | 3300005577 | Bacteria | 538 |
| 194 | Ga0068854_100011485 | 3300005578 | Bacteria | 5769 |
| 195 | Ga0068854_100065919 | 3300005578 | Bacteria | 2634 |
| 196 | Ga0068854_100468638 | 3300005578 | Bacteria | 1055 |
| 197 | Ga0068854_101330292 | 3300005578 | Bacteria | 647 |
| 198 | Ga0068854_101627649 | 3300005578 | Bacteria | 589 |
| 199 | Ga0068856_100036347 | 3300005614 | Bacteria | 4830 |
| 200 | Ga0068856_101757554 | 3300005614 | Unclassified | 632 |
| 201 | Ga0068856_101869911 | 3300005614 | Unclassified | 612 |
| 202 | Ga0070702_100720279 | 3300005615 | Bacteria | 763 |
| 203 | Ga0068852_100023809 | 3300005616 | Bacteria | 4937 |
| 204 | Ga0068852_100049213 | 3300005616 | Bacteria | 3605 |
| 205 | Ga0068852_100455132 | 3300005616 | Bacteria | 1268 |
| 206 | Ga0068852_100618875 | 3300005616 | Bacteria | 1088 |
| 207 | Ga0068852_100691098 | 3300005616 | Bacteria | 1030 |
| 208 | Ga0068852_101295908 | 3300005616 | Bacteria | 750 |
| 209 | Ga0068852_101882275 | 3300005616 | Bacteria | 620 |
| 210 | Ga0068859_100000007 | 3300005617 | Bacteria | 390070 |
| 211 | Ga0068859_100005939 | 3300005617 | Bacteria | 12395 |
| 212 | Ga0068859_100100050 | 3300005617 | Bacteria | 2955 |
| 213 | Ga0068859_100124931 | 3300005617 | Unclassified | 2641 |
| 214 | Ga0068859_100213447 | 3300005617 | Bacteria | 2017 |
| 215 | Ga0068859_101059311 | 3300005617 | Bacteria | 891 |
| 216 | Ga0068859_101811069 | 3300005617 | Bacteria | 674 |
| 217 | Ga0068864_100000685 | 3300005618 | Bacteria | 28427 |
| 218 | Ga0068864_100061031 | 3300005618 | Unclassified | 3265 |
| 219 | Ga0068864_100668520 | 3300005618 | Bacteria | 1012 |
| 220 | Ga0068866_10008725 | 3300005718 | Bacteria | 4285 |
| 221 | Ga0068866_10045822 | 3300005718 | Bacteria | 2196 |
| 222 | Ga0068861_100020953 | 3300005719 | Bacteria | 4692 |
| 223 | Ga0068861_100143217 | 3300005719 | Bacteria | 1953 |
| 224 | Ga0068861_100156324 | 3300005719 | Bacteria | 1876 |
| 225 | Ga0068861_101043800 | 3300005719 | Bacteria | 783 |
| 226 | Ga0068861_102062290 | 3300005719 | Unclassified | 570 |
| 227 | Ga0068851_10051439 | 3300005834 | Bacteria | 2093 |
| 228 | Ga0068851_10124394 | 3300005834 | Unclassified | 1389 |
| 229 | Ga0068851_10287313 | 3300005834 | Unclassified | 942 |
| 230 | Ga0068851_10290021 | 3300005834 | Bacteria | 938 |
| 231 | Ga0068851_10355106 | 3300005834 | Bacteria | 854 |
| 232 | Ga0068851_10455572 | 3300005834 | Bacteria | 761 |
| 233 | Ga0068851_10534757 | 3300005834 | Bacteria | 707 |
| 234 | Ga0068851_10635160 | 3300005834 | Bacteria | 652 |
| 235 | Ga0068851_11005144 | 3300005834 | Bacteria | 526 |
| 236 | Ga0068870_10093933 | 3300005840 | Bacteria | 1683 |
| 237 | Ga0068870_10106168 | 3300005840 | Bacteria | 1596 |
| 238 | Ga0068863_100097940 | 3300005841 | Bacteria | 2785 |
| 239 | Ga0068863_100111325 | 3300005841 | Bacteria | 2608 |
| 240 | Ga0068863_100262047 | 3300005841 | Bacteria | 1671 |
| 241 | Ga0068863_100633927 | 3300005841 | Bacteria | 1059 |
| 242 | Ga0068863_100909407 | 3300005841 | Bacteria | 880 |
| 243 | Ga0068858_100003163 | 3300005842 | Bacteria | 16480 |
| 244 | Ga0068858_100041888 | 3300005842 | Bacteria | 4245 |
| 245 | Ga0068858_100152160 | 3300005842 | Bacteria | 2176 |
| 246 | Ga0068858_100471825 | 3300005842 | Bacteria | 1211 |
| 247 | Ga0068860_100012160 | 3300005843 | Bacteria | 8479 |
| 248 | Ga0068860_100175676 | 3300005843 | Bacteria | 2070 |
| 249 | Ga0068860_100222848 | 3300005843 | Bacteria | 1831 |
| 250 | Ga0068860_100332635 | 3300005843 | Bacteria | 1492 |
| 251 | Ga0068860_100392845 | 3300005843 | Bacteria | 1371 |
| 252 | Ga0068860_100400522 | 3300005843 | Bacteria | 1358 |
| 253 | Ga0068860_100506718 | 3300005843 | Bacteria | 1205 |
| 254 | Ga0068862_100111328 | 3300005844 | Bacteria | 2403 |
| 255 | Ga0068862_100258213 | 3300005844 | Bacteria | 1590 |
| 256 | Ga0081455_10532077 | 3300005937 | Bacteria | 782 |
| 257 | Ga0081539_10047510 | 3300005985 | Bacteria | 2450 |
| 258 | Ga0070715_10213479 | 3300006163 | Bacteria | 988 |
| 259 | Ga0070716_100415015 | 3300006173 | Bacteria | 972 |
| 260 | Ga0075366_10078707 | 3300006195 | Bacteria | 1967 |
| 261 | Ga0075366_10261881 | 3300006195 | Bacteria | 1055 |
| 262 | Ga0075366_10289024 | 3300006195 | Bacteria | 1002 |
| 263 | Ga0075366_10818331 | 3300006195 | Bacteria | 579 |
| 264 | Ga0097621_100003509 | 3300006237 | Bacteria | 10830 |
| 265 | Ga0097621_100011491 | 3300006237 | Bacteria | 6523 |
| 266 | Ga0097621_100017011 | 3300006237 | Bacteria | 5514 |
| 267 | Ga0097621_100027689 | 3300006237 | Bacteria | 4460 |
| 268 | Ga0097621_100100209 | 3300006237 | Bacteria | 2437 |
| 269 | Ga0097621_100152109 | 3300006237 | Bacteria | 1985 |
| 270 | Ga0097621_100242923 | 3300006237 | Bacteria | 1574 |
| 271 | Ga0097621_100640902 | 3300006237 | Bacteria | 974 |
| 272 | Ga0075370_10691442 | 3300006353 | Bacteria | 620 |
| 273 | Ga0068871_100003013 | 3300006358 | Bacteria | 11561 |
| 274 | Ga0068871_100008869 | 3300006358 | Bacteria | 7249 |
| 275 | Ga0068871_100011269 | 3300006358 | Bacteria | 6555 |
| 276 | Ga0068871_100022594 | 3300006358 | Bacteria | 4852 |
| 277 | Ga0068871_100381836 | 3300006358 | Bacteria | 1251 |
| 278 | Ga0068871_100461850 | 3300006358 | Unclassified | 1140 |
| 279 | Ga0068871_100668136 | 3300006358 | Bacteria | 950 |
| 280 | Ga0068871_100837381 | 3300006358 | Bacteria | 850 |
| 281 | Ga0068871_100881040 | 3300006358 | Bacteria | 829 |
| 282 | Ga0068871_100954062 | 3300006358 | Bacteria | 797 |
| 283 | Ga0068871_101659752 | 3300006358 | Bacteria | 606 |
| 284 | Ga0075428_100093358 | 3300006844 | Bacteria | 3281 |
| 285 | Ga0075430_101132872 | 3300006846 | Unclassified | 644 |
| 286 | Ga0075431_100005210 | 3300006847 | Bacteria | 12808 |
| 287 | Ga0075434_100085548 | 3300006871 | Bacteria | 3153 |
| 288 | Ga0075434_100439577 | 3300006871 | Bacteria | 1326 |
| 289 | Ga0075429_100004647 | 3300006880 | Bacteria | 11808 |
| 290 | Ga0075429_101088347 | 3300006880 | Bacteria | 698 |
| 291 | Ga0068865_100002580 | 3300006881 | Bacteria | 10756 |
| 292 | Ga0068865_100189750 | 3300006881 | Bacteria | 1588 |
| 293 | Ga0068865_100348952 | 3300006881 | Bacteria | 1198 |
| 294 | Ga0068865_100440266 | 3300006881 | Bacteria | 1075 |
| 295 | Ga0068865_101087747 | 3300006881 | Bacteria | 704 |
| 296 | Ga0097620_100000007 | 3300006931 | Bacteria | 390070 |
| 297 | Ga0097620_100005939 | 3300006931 | Bacteria | 12395 |
| 298 | Ga0097620_100100047 | 3300006931 | Bacteria | 2955 |
| 299 | Ga0097620_100124933 | 3300006931 | Unclassified | 2641 |
| 300 | Ga0097620_100213450 | 3300006931 | Bacteria | 2017 |
| 301 | Ga0097620_101059293 | 3300006931 | Bacteria | 891 |
| 302 | Ga0097620_101811725 | 3300006931 | Bacteria | 674 |
| 303 | Ga0105251_10109895 | 3300009011 | Unclassified | 1256 |
| 304 | Ga0105240_10356633 | 3300009093 | Bacteria | 1658 |
| 305 | Ga0105240_11318630 | 3300009093 | Bacteria | 761 |
| 306 | Ga0111539_10043506 | 3300009094 | Bacteria | 5383 |
| 307 | Ga0111539_10119552 | 3300009094 | Bacteria | 3088 |
| 308 | Ga0105245_10217098 | 3300009098 | Bacteria | 1843 |
| 309 | Ga0105247_10010856 | 3300009101 | Bacteria | 5501 |
| 310 | Ga0105247_10382127 | 3300009101 | Bacteria | 999 |
| 311 | Ga0114129_10181526 | 3300009147 | Bacteria | 2863 |
| 312 | Ga0105241_10000104 | 3300009174 | Bacteria | 60482 |
| 313 | Ga0105241_10084119 | 3300009174 | Bacteria | 2497 |
| 314 | Ga0105241_10285817 | 3300009174 | Bacteria | 1410 |
| 315 | Ga0105241_10893525 | 3300009174 | Bacteria | 824 |
| 316 | Ga0105241_10963258 | 3300009174 | Bacteria | 796 |
| 317 | Ga0105242_10039659 | 3300009176 | Bacteria | 3791 |
| 318 | Ga0105242_10077049 | 3300009176 | Bacteria | 2781 |
| 319 | Ga0105242_10186413 | 3300009176 | Bacteria | 1834 |
| 320 | Ga0105242_10664282 | 3300009176 | Bacteria | 1015 |
| 321 | Ga0105242_12830787 | 3300009176 | Bacteria | 535 |
| 322 | Ga0105237_10040911 | 3300009545 | Bacteria | 4675 |
| 323 | Ga0105249_10009352 | 3300009553 | Bacteria | 8574 |
| 324 | Ga0105249_10245322 | 3300009553 | Bacteria | 1773 |
| 325 | Ga0105249_11233162 | 3300009553 | Bacteria | 819 |
| 326 | Ga0105239_10143356 | 3300010375 | Bacteria | 2663 |
| 327 | Ga0105239_10247625 | 3300010375 | Bacteria | 2001 |
| 328 | Ga0105239_11362057 | 3300010375 | Bacteria | 819 |
| 329 | Ga0105239_12675468 | 3300010375 | Bacteria | 582 |
| 330 | Ga0105246_10001838 | 3300011119 | Bacteria | 12732 |
| 331 | Ga0105246_10064135 | 3300011119 | Bacteria | 2565 |
| 332 | Ga0105246_10072325 | 3300011119 | Bacteria | 2431 |
| 333 | Ga0105246_10405929 | 3300011119 | Bacteria | 1133 |
| 334 | Ga0105246_10878482 | 3300011119 | Bacteria | 802 |
| 335 | Ga0105246_12551849 | 3300011119 | Bacteria | 504 |
| 336 | Ga0157323_1027514 | 3300012495 | Bacteria | 584 |
| 337 | Ga0157373_10018995 | 3300013100 | Bacteria | 5003 |
| 338 | Ga0157373_10032880 | 3300013100 | Bacteria | 3733 |
| 339 | Ga0157373_10606467 | 3300013100 | Bacteria | 797 |
| 340 | Ga0157371_10031483 | 3300013102 | Bacteria | 3821 |
| 341 | Ga0157371_10046246 | 3300013102 | Bacteria | 3095 |
| 342 | Ga0157371_10415417 | 3300013102 | Bacteria | 986 |
| 343 | Ga0157371_10430901 | 3300013102 | Bacteria | 968 |
| 344 | Ga0157371_10480712 | 3300013102 | Bacteria | 916 |
| 345 | Ga0157370_10202462 | 3300013104 | Bacteria | 1841 |
| 346 | Ga0157370_10495032 | 3300013104 | Bacteria | 1123 |
| 347 | Ga0157370_10595196 | 3300013104 | Bacteria | 1013 |
| 348 | Ga0157370_10917435 | 3300013104 | Bacteria | 794 |
| 349 | Ga0157369_10203150 | 3300013105 | Bacteria | 2079 |
| 350 | Ga0157369_10241841 | 3300013105 | Bacteria | 1885 |
| 351 | Ga0157369_11014679 | 3300013105 | Unclassified | 849 |
| 352 | Ga0157374_10000237 | 3300013296 | Bacteria | 51331 |
| 353 | Ga0157374_10005388 | 3300013296 | Bacteria | 10749 |
| 354 | Ga0157374_10040035 | 3300013296 | Bacteria | 4315 |
| 355 | Ga0157374_10066087 | 3300013296 | Bacteria | 3398 |
| 356 | Ga0157374_10075500 | 3300013296 | Bacteria | 3185 |
| 357 | Ga0157374_10098966 | 3300013296 | Bacteria | 2793 |
| 358 | Ga0157374_10190525 | 3300013296 | Bacteria | 2006 |
| 359 | Ga0157374_10290082 | 3300013296 | Bacteria | 1617 |
| 360 | Ga0157374_10578079 | 3300013296 | Unclassified | 1132 |
| 361 | Ga0157374_11113166 | 3300013296 | Bacteria | 810 |
| 362 | Ga0157378_10020420 | 3300013297 | Bacteria | 5826 |
| 363 | Ga0157378_10131265 | 3300013297 | Bacteria | 2319 |
| 364 | Ga0157378_10174714 | 3300013297 | Bacteria | 2017 |
| 365 | Ga0157378_10228960 | 3300013297 | Bacteria | 1770 |
| 366 | Ga0157378_10379531 | 3300013297 | Bacteria | 1388 |
| 367 | Ga0157378_11176322 | 3300013297 | Bacteria | 806 |
| 368 | Ga0157378_11265117 | 3300013297 | Bacteria | 778 |
| 369 | Ga0163162_10000226 | 3300013306 | Bacteria | 51615 |
| 370 | Ga0163162_10000576 | 3300013306 | Bacteria | 33923 |
| 371 | Ga0163162_10006217 | 3300013306 | Bacteria | 11572 |
| 372 | Ga0163162_10088452 | 3300013306 | Bacteria | 3177 |
| 373 | Ga0163162_10090364 | 3300013306 | Bacteria | 3144 |
| 374 | Ga0163162_10135776 | 3300013306 | Bacteria | 2571 |
| 375 | Ga0163162_10174200 | 3300013306 | Bacteria | 2276 |
| 376 | Ga0163162_10264187 | 3300013306 | Bacteria | 1853 |
| 377 | Ga0163162_11236596 | 3300013306 | Unclassified | 848 |
| 378 | Ga0163162_12597625 | 3300013306 | Bacteria | 583 |
| 379 | Ga0157372_10004144 | 3300013307 | Bacteria | 15522 |
| 380 | Ga0157372_10034745 | 3300013307 | Bacteria | 5545 |
| 381 | Ga0157372_10132899 | 3300013307 | Bacteria | 2865 |
| 382 | Ga0157372_10359916 | 3300013307 | Bacteria | 1695 |
| 383 | Ga0157372_10505059 | 3300013307 | Bacteria | 1410 |
| 384 | Ga0157372_10577543 | 3300013307 | Unclassified | 1310 |
| 385 | Ga0157372_10717693 | 3300013307 | Bacteria | 1163 |
| 386 | Ga0157372_10872351 | 3300013307 | Bacteria | 1044 |
| 387 | Ga0157372_10952936 | 3300013307 | Bacteria | 995 |
| 388 | Ga0157372_11121395 | 3300013307 | Bacteria | 910 |
| 389 | Ga0157372_11207167 | 3300013307 | Bacteria | 874 |
| 390 | Ga0157372_11239851 | 3300013307 | Unclassified | 861 |
| 391 | Ga0157372_11370375 | 3300013307 | Bacteria | 816 |
| 392 | Ga0157372_13173433 | 3300013307 | Bacteria | 524 |
| 393 | Ga0157375_10079604 | 3300013308 | Bacteria | 3313 |
| 394 | Ga0157375_10092748 | 3300013308 | Bacteria | 3084 |
| 395 | Ga0157375_10171047 | 3300013308 | Bacteria | 2320 |
| 396 | Ga0157375_10257339 | 3300013308 | Bacteria | 1907 |
| 397 | Ga0157375_10634183 | 3300013308 | Bacteria | 1226 |
| 398 | Ga0157375_11279207 | 3300013308 | Unclassified | 862 |
| 399 | Ga0157375_11930254 | 3300013308 | Bacteria | 701 |
| 400 | Ga0157375_13287868 | 3300013308 | Bacteria | 539 |
| 401 | Ga0163163_10000088 | 3300014325 | Bacteria | 101126 |
| 402 | Ga0163163_10003449 | 3300014325 | Bacteria | 13434 |
| 403 | Ga0163163_10012983 | 3300014325 | Bacteria | 7608 |
| 404 | Ga0163163_10191440 | 3300014325 | Bacteria | 2094 |
| 405 | Ga0163163_10601722 | 3300014325 | Unclassified | 1162 |
| 406 | Ga0163163_10661105 | 3300014325 | Bacteria | 1108 |
| 407 | Ga0163163_10958080 | 3300014325 | Bacteria | 919 |
| 408 | Ga0157380_10006616 | 3300014326 | Bacteria | 8176 |
| 409 | Ga0157380_10131722 | 3300014326 | Bacteria | 2134 |
| 410 | Ga0157380_10417482 | 3300014326 | Bacteria | 1278 |
| 411 | Ga0157380_10522069 | 3300014326 | Unclassified | 1158 |
| 412 | Ga0157380_11733959 | 3300014326 | Bacteria | 683 |
| 413 | Ga0157377_10009383 | 3300014745 | Bacteria | 4799 |
| 414 | Ga0157377_10018280 | 3300014745 | Bacteria | 3641 |
| 415 | Ga0157377_10089787 | 3300014745 | Bacteria | 1812 |
| 416 | Ga0157377_10095644 | 3300014745 | Bacteria | 1761 |
| 417 | Ga0157377_10603246 | 3300014745 | Bacteria | 783 |
| 418 | Ga0157377_11560770 | 3300014745 | Bacteria | 527 |
| 419 | Ga0157379_10050431 | 3300014968 | Bacteria | 3715 |
| 420 | Ga0157379_10064911 | 3300014968 | Bacteria | 3263 |
| 421 | Ga0157379_10128633 | 3300014968 | Bacteria | 2279 |
| 422 | Ga0157379_10241953 | 3300014968 | Bacteria | 1637 |
| 423 | Ga0157379_10555359 | 3300014968 | Bacteria | 1069 |
| 424 | Ga0157376_10006924 | 3300014969 | Bacteria | 8035 |
| 425 | Ga0157376_10073355 | 3300014969 | Bacteria | 2914 |
| 426 | Ga0157376_10101097 | 3300014969 | Bacteria | 2519 |
| 427 | Ga0157376_10148730 | 3300014969 | Bacteria | 2110 |
| 428 | Ga0157376_10176198 | 3300014969 | Bacteria | 1951 |
| 429 | Ga0157376_10317978 | 3300014969 | Bacteria | 1479 |
| 430 | Ga0157376_10526578 | 3300014969 | Bacteria | 1166 |
| 431 | Ga0157376_10604161 | 3300014969 | Bacteria | 1092 |
| 432 | Ga0157376_10898120 | 3300014969 | Bacteria | 904 |
| 433 | Ga0182007_10267661 | 3300015262 | Bacteria | 618 |
| 434 | Ga0163161_10002796 | 3300017792 | Bacteria | 12374 |
| 435 | Ga0163161_10027138 | 3300017792 | Bacteria | 4061 |
| 436 | Ga0163161_10123937 | 3300017792 | Bacteria | 1944 |
| 437 | Ga0163161_10135966 | 3300017792 | Bacteria | 1858 |
| 438 | Ga0163161_10326686 | 3300017792 | Bacteria | 1214 |
| 439 | Ga0206356_10707627 | 3300020070 | Bacteria | 644 |
| 440 | Ga0209258_107471 | 3300025242 | Bacteria | 1620 |
| 441 | Ga0209646_1001328 | 3300025246 | Bacteria | 6893 |
| 442 | Ga0207697_10037663 | 3300025315 | Unclassified | 1982 |
| 443 | Ga0207656_10040510 | 3300025321 | Bacteria | 1975 |
| 444 | Ga0207656_10228301 | 3300025321 | Unclassified | 907 |
| 445 | Ga0207656_10346764 | 3300025321 | Unclassified | 741 |
| 446 | Ga0207656_10363256 | 3300025321 | Bacteria | 724 |
| 447 | Ga0207656_10478494 | 3300025321 | Bacteria | 631 |
| 448 | Ga0207682_10052614 | 3300025893 | Unclassified | 1688 |
| 449 | Ga0207682_10468252 | 3300025893 | Bacteria | 597 |
| 450 | Ga0207642_10028662 | 3300025899 | Bacteria | 2295 |
| 451 | Ga0207642_10050953 | 3300025899 | Bacteria | 1870 |
| 452 | Ga0207642_10203548 | 3300025899 | Bacteria | 1095 |
| 453 | Ga0207642_10920230 | 3300025899 | Bacteria | 561 |
| 454 | Ga0207710_10030398 | 3300025900 | Bacteria | 2356 |
| 455 | Ga0207688_10022289 | 3300025901 | Bacteria | 3465 |
| 456 | Ga0207680_10000015 | 3300025903 | Bacteria | 138253 |
| 457 | Ga0207680_10009136 | 3300025903 | Bacteria | 4902 |
| 458 | Ga0207680_10009247 | 3300025903 | Bacteria | 4878 |
| 459 | Ga0207680_10029384 | 3300025903 | Unclassified | 3087 |
| 460 | Ga0207680_10378907 | 3300025903 | Bacteria | 997 |
| 461 | Ga0207680_10901511 | 3300025903 | Unclassified | 634 |
| 462 | Ga0207647_10000061 | 3300025904 | Bacteria | 83985 |
| 463 | Ga0207647_10009722 | 3300025904 | Bacteria | 6823 |
| 464 | Ga0207647_10059317 | 3300025904 | Bacteria | 2342 |
| 465 | Ga0207647_10206732 | 3300025904 | Unclassified | 1135 |
| 466 | Ga0207685_10006223 | 3300025905 | Bacteria | 3231 |
| 467 | Ga0207645_10000136 | 3300025907 | Bacteria | 56153 |
| 468 | Ga0207645_10390545 | 3300025907 | Bacteria | 935 |
| 469 | Ga0207645_10454611 | 3300025907 | Bacteria | 865 |
| 470 | Ga0207645_10660936 | 3300025907 | Bacteria | 710 |
| 471 | Ga0207643_10071381 | 3300025908 | Bacteria | 1999 |
| 472 | Ga0207643_10200968 | 3300025908 | Bacteria | 1213 |
| 473 | Ga0207643_10540481 | 3300025908 | Bacteria | 747 |
| 474 | Ga0207643_10552579 | 3300025908 | Bacteria | 739 |
| 475 | Ga0207643_10878620 | 3300025908 | Bacteria | 581 |
| 476 | Ga0207705_10272093 | 3300025909 | Bacteria | 1295 |
| 477 | Ga0207705_10584278 | 3300025909 | Unclassified | 868 |
| 478 | Ga0207705_10833618 | 3300025909 | Bacteria | 715 |
| 479 | Ga0207654_10020022 | 3300025911 | Bacteria | 3540 |
| 480 | Ga0207654_10074849 | 3300025911 | Bacteria | 2022 |
| 481 | Ga0207654_10089265 | 3300025911 | Bacteria | 1875 |
| 482 | Ga0207654_10403306 | 3300025911 | Bacteria | 951 |
| 483 | Ga0207707_10242770 | 3300025912 | Bacteria | 1566 |
| 484 | Ga0207707_10422418 | 3300025912 | Bacteria | 1143 |
| 485 | Ga0207695_10545403 | 3300025913 | Bacteria | 1041 |
| 486 | Ga0207671_10001528 | 3300025914 | Bacteria | 26548 |
| 487 | Ga0207671_10005708 | 3300025914 | Bacteria | 11360 |
| 488 | Ga0207671_10075947 | 3300025914 | Bacteria | 2514 |
| 489 | Ga0207671_11548732 | 3300025914 | Bacteria | 511 |
| 490 | Ga0207660_10628210 | 3300025917 | Bacteria | 875 |
| 491 | Ga0207660_11319472 | 3300025917 | Bacteria | 586 |
| 492 | Ga0207657_10160448 | 3300025919 | Bacteria | 1826 |
| 493 | Ga0207657_10173809 | 3300025919 | Bacteria | 1744 |
| 494 | Ga0207657_10914942 | 3300025919 | Bacteria | 675 |
| 495 | Ga0207649_10000419 | 3300025920 | Bacteria | 31284 |
| 496 | Ga0207649_10009396 | 3300025920 | Bacteria | 5351 |
| 497 | Ga0207649_10085939 | 3300025920 | Bacteria | 2048 |
| 498 | Ga0207649_10316633 | 3300025920 | Bacteria | 1145 |
| 499 | Ga0207649_10325496 | 3300025920 | Bacteria | 1130 |
| 500 | Ga0207649_11396008 | 3300025920 | Bacteria | 554 |
| 501 | Ga0207681_10099843 | 3300025923 | Bacteria | 2091 |
| 502 | Ga0207681_10329909 | 3300025923 | Bacteria | 1216 |
| 503 | Ga0207681_10736600 | 3300025923 | Bacteria | 821 |
| 504 | Ga0207681_11190182 | 3300025923 | Bacteria | 640 |
| 505 | Ga0207681_11676691 | 3300025923 | Bacteria | 531 |
| 506 | Ga0207694_10045967 | 3300025924 | Bacteria | 3374 |
| 507 | Ga0207650_10020700 | 3300025925 | Bacteria | 4642 |
| 508 | Ga0207650_10038566 | 3300025925 | Bacteria | 3490 |
| 509 | Ga0207650_10071435 | 3300025925 | Bacteria | 2611 |
| 510 | Ga0207650_10203430 | 3300025925 | Bacteria | 1587 |
| 511 | Ga0207650_10612196 | 3300025925 | Bacteria | 916 |
| 512 | Ga0207650_11107726 | 3300025925 | Bacteria | 674 |
| 513 | Ga0207659_10008757 | 3300025926 | Bacteria | 6301 |
| 514 | Ga0207659_10071251 | 3300025926 | Bacteria | 2537 |
| 515 | Ga0207659_10113269 | 3300025926 | Bacteria | 2066 |
| 516 | Ga0207659_10116399 | 3300025926 | Bacteria | 2041 |
| 517 | Ga0207659_10272795 | 3300025926 | Bacteria | 1380 |
| 518 | Ga0207659_10664914 | 3300025926 | Bacteria | 891 |
| 519 | Ga0207687_11274519 | 3300025927 | Bacteria | 632 |
| 520 | Ga0207644_10151465 | 3300025931 | Bacteria | 1795 |
| 521 | Ga0207644_10158308 | 3300025931 | Bacteria | 1758 |
| 522 | Ga0207644_10615736 | 3300025931 | Bacteria | 902 |
| 523 | Ga0207644_10670424 | 3300025931 | Bacteria | 864 |
| 524 | Ga0207690_10011054 | 3300025932 | Bacteria | 5383 |
| 525 | Ga0207690_10190103 | 3300025932 | Bacteria | 1552 |
| 526 | Ga0207706_10002103 | 3300025933 | Bacteria | 19496 |
| 527 | Ga0207706_10018001 | 3300025933 | Bacteria | 6357 |
| 528 | Ga0207706_10074924 | 3300025933 | Bacteria | 2976 |
| 529 | Ga0207706_10084464 | 3300025933 | Bacteria | 2791 |
| 530 | Ga0207706_11386503 | 3300025933 | Unclassified | 578 |
| 531 | Ga0207686_10149086 | 3300025934 | Bacteria | 1626 |
| 532 | Ga0207686_10174675 | 3300025934 | Bacteria | 1518 |
| 533 | Ga0207686_10177655 | 3300025934 | Bacteria | 1507 |
| 534 | Ga0207686_10924259 | 3300025934 | Bacteria | 705 |
| 535 | Ga0207670_10185937 | 3300025936 | Bacteria | 1568 |
| 536 | Ga0207670_10340732 | 3300025936 | Bacteria | 1185 |
| 537 | Ga0207670_11764547 | 3300025936 | Bacteria | 526 |
| 538 | Ga0207669_10075623 | 3300025937 | Bacteria | 2134 |
| 539 | Ga0207669_10189217 | 3300025937 | Bacteria | 1483 |
| 540 | Ga0207704_10128813 | 3300025938 | Bacteria | 1748 |
| 541 | Ga0207704_10177265 | 3300025938 | Bacteria | 1536 |
| 542 | Ga0207665_11071219 | 3300025939 | Bacteria | 642 |
| 543 | Ga0207691_10011435 | 3300025940 | Bacteria | 8516 |
| 544 | Ga0207691_10051301 | 3300025940 | Bacteria | 3773 |
| 545 | Ga0207691_10432383 | 3300025940 | Bacteria | 1121 |
| 546 | Ga0207691_10512499 | 3300025940 | Bacteria | 1018 |
| 547 | Ga0207691_10546586 | 3300025940 | Bacteria | 982 |
| 548 | Ga0207691_10888830 | 3300025940 | Bacteria | 746 |
| 549 | Ga0207689_10001007 | 3300025942 | Bacteria | 27057 |
| 550 | Ga0207689_10021058 | 3300025942 | Bacteria | 5481 |
| 551 | Ga0207689_10167225 | 3300025942 | Bacteria | 1812 |
| 552 | Ga0207689_11353302 | 3300025942 | Unclassified | 597 |
| 553 | Ga0207661_10000370 | 3300025944 | Bacteria | 28914 |
| 554 | Ga0207661_10108637 | 3300025944 | Bacteria | 2342 |
| 555 | Ga0207661_10331612 | 3300025944 | Bacteria | 1369 |
| 556 | Ga0207661_11400893 | 3300025944 | Bacteria | 641 |
| 557 | Ga0207661_11609000 | 3300025944 | Bacteria | 594 |
| 558 | Ga0207679_10000266 | 3300025945 | Bacteria | 39927 |
| 559 | Ga0207679_10163117 | 3300025945 | Bacteria | 1827 |
| 560 | Ga0207679_10169599 | 3300025945 | Bacteria | 1795 |
| 561 | Ga0207679_10418597 | 3300025945 | Bacteria | 1182 |
| 562 | Ga0207679_10812858 | 3300025945 | Unclassified | 853 |
| 563 | Ga0207667_10100362 | 3300025949 | Bacteria | 2986 |
| 564 | Ga0207651_10204392 | 3300025960 | Bacteria | 1585 |
| 565 | Ga0207651_10356230 | 3300025960 | Unclassified | 1234 |
| 566 | Ga0207651_10434882 | 3300025960 | Bacteria | 1123 |
| 567 | Ga0207651_11235144 | 3300025960 | Bacteria | 671 |
| 568 | Ga0207651_11947061 | 3300025960 | Bacteria | 528 |
| 569 | Ga0207712_10186708 | 3300025961 | Bacteria | 1633 |
| 570 | Ga0207668_10011982 | 3300025972 | Bacteria | 5292 |
| 571 | Ga0207668_10256430 | 3300025972 | Bacteria | 1423 |
| 572 | Ga0207640_10021342 | 3300025981 | Bacteria | 3859 |
| 573 | Ga0207640_10074654 | 3300025981 | Bacteria | 2295 |
| 574 | Ga0207640_10651517 | 3300025981 | Bacteria | 897 |
| 575 | Ga0207640_10713989 | 3300025981 | Bacteria | 861 |
| 576 | Ga0207640_11374742 | 3300025981 | Bacteria | 632 |
| 577 | Ga0207640_11540617 | 3300025981 | Bacteria | 598 |
| 578 | Ga0207640_12143983 | 3300025981 | Unclassified | 507 |
| 579 | Ga0207658_10054580 | 3300025986 | Unclassified | 2957 |
| 580 | Ga0207658_10104039 | 3300025986 | Bacteria | 2230 |
| 581 | Ga0207658_10202354 | 3300025986 | Bacteria | 1659 |
| 582 | Ga0207658_10471208 | 3300025986 | Bacteria | 1114 |
| 583 | Ga0207658_10496302 | 3300025986 | Unclassified | 1087 |
| 584 | Ga0207658_10630113 | 3300025986 | Bacteria | 965 |
| 585 | Ga0207677_10005974 | 3300026023 | Bacteria | 6630 |
| 586 | Ga0207677_10285222 | 3300026023 | Unclassified | 1357 |
| 587 | Ga0207677_10778385 | 3300026023 | Unclassified | 855 |
| 588 | Ga0207677_11314847 | 3300026023 | Bacteria | 664 |
| 589 | Ga0207677_11480551 | 3300026023 | Bacteria | 627 |
| 590 | Ga0207703_10007227 | 3300026035 | Bacteria | 8831 |
| 591 | Ga0207703_10097933 | 3300026035 | Bacteria | 2479 |
| 592 | Ga0207703_10546858 | 3300026035 | Bacteria | 1091 |
| 593 | Ga0207703_10813557 | 3300026035 | Bacteria | 892 |
| 594 | Ga0207639_10012815 | 3300026041 | Bacteria | 5851 |
| 595 | Ga0207639_10030223 | 3300026041 | Bacteria | 3972 |
| 596 | Ga0207639_10082339 | 3300026041 | Bacteria | 2551 |
| 597 | Ga0207639_10094529 | 3300026041 | Bacteria | 2400 |
| 598 | Ga0207639_10217142 | 3300026041 | Bacteria | 1649 |
| 599 | Ga0207639_10386592 | 3300026041 | Bacteria | 1258 |
| 600 | Ga0207639_10596252 | 3300026041 | Bacteria | 1018 |
| 601 | Ga0207639_11089568 | 3300026041 | Unclassified | 749 |
| 602 | Ga0207639_11190964 | 3300026041 | Bacteria | 715 |
| 603 | Ga0207639_11465351 | 3300026041 | Bacteria | 641 |
| 604 | Ga0207639_11760258 | 3300026041 | Bacteria | 580 |
| 605 | Ga0207678_10090917 | 3300026067 | Bacteria | 2608 |
| 606 | Ga0207708_10562951 | 3300026075 | Bacteria | 962 |
| 607 | Ga0207708_11176236 | 3300026075 | Unclassified | 670 |
| 608 | Ga0207708_11257629 | 3300026075 | Bacteria | 648 |
| 609 | Ga0207702_10054227 | 3300026078 | Bacteria | 3396 |
| 610 | Ga0207702_10338432 | 3300026078 | Bacteria | 1437 |
| 611 | Ga0207702_10975490 | 3300026078 | Unclassified | 840 |
| 612 | Ga0207702_11499653 | 3300026078 | Unclassified | 668 |
| 613 | Ga0207641_10000056 | 3300026088 | Bacteria | 170719 |
| 614 | Ga0207641_10037835 | 3300026088 | Bacteria | 4032 |
| 615 | Ga0207641_10080565 | 3300026088 | Bacteria | 2825 |
| 616 | Ga0207641_10091216 | 3300026088 | Bacteria | 2666 |
| 617 | Ga0207641_10105683 | 3300026088 | Bacteria | 2487 |
| 618 | Ga0207641_10335652 | 3300026088 | Bacteria | 1437 |
| 619 | Ga0207641_12277170 | 3300026088 | Bacteria | 541 |
| 620 | Ga0207648_10004655 | 3300026089 | Bacteria | 14042 |
| 621 | Ga0207648_10016945 | 3300026089 | Bacteria | 6639 |
| 622 | Ga0207648_10094532 | 3300026089 | Bacteria | 2614 |
| 623 | Ga0207648_10304460 | 3300026089 | Bacteria | 1430 |
| 624 | Ga0207648_10347861 | 3300026089 | Bacteria | 1336 |
| 625 | Ga0207648_10530486 | 3300026089 | Bacteria | 1079 |
| 626 | Ga0207648_10724644 | 3300026089 | Bacteria | 922 |
| 627 | Ga0207648_11148431 | 3300026089 | Bacteria | 729 |
| 628 | Ga0207676_10019254 | 3300026095 | Bacteria | 4976 |
| 629 | Ga0207676_10024265 | 3300026095 | Bacteria | 4485 |
| 630 | Ga0207676_10038829 | 3300026095 | Bacteria | 3637 |
| 631 | Ga0207676_10362899 | 3300026095 | Bacteria | 1343 |
| 632 | Ga0207676_11158063 | 3300026095 | Bacteria | 766 |
| 633 | Ga0207674_10007803 | 3300026116 | Bacteria | 12446 |
| 634 | Ga0207674_10189753 | 3300026116 | Bacteria | 2005 |
| 635 | Ga0207674_10223695 | 3300026116 | Unclassified | 1830 |
| 636 | Ga0207674_10327433 | 3300026116 | Bacteria | 1482 |
| 637 | Ga0207674_10367947 | 3300026116 | Bacteria | 1390 |
| 638 | Ga0207674_11896687 | 3300026116 | Unclassified | 562 |
| 639 | Ga0207675_100021679 | 3300026118 | Bacteria | 5980 |
| 640 | Ga0207675_100044754 | 3300026118 | Bacteria | 4137 |
| 641 | Ga0207675_100150383 | 3300026118 | Bacteria | 2215 |
| 642 | Ga0207675_100754399 | 3300026118 | Bacteria | 985 |
| 643 | Ga0207675_100944893 | 3300026118 | Bacteria | 879 |
| 644 | Ga0207675_101838666 | 3300026118 | Unclassified | 625 |
| 645 | Ga0207683_10002007 | 3300026121 | Bacteria | 18003 |
| 646 | Ga0207683_10007862 | 3300026121 | Bacteria | 9124 |
| 647 | Ga0207683_10010220 | 3300026121 | Bacteria | 8005 |
| 648 | Ga0207683_10311957 | 3300026121 | Bacteria | 1440 |
| 649 | Ga0207683_10328787 | 3300026121 | Bacteria | 1401 |
| 650 | Ga0207698_10014929 | 3300026142 | Bacteria | 5184 |
| 651 | Ga0207698_10048581 | 3300026142 | Bacteria | 3222 |
| 652 | Ga0207698_10063287 | 3300026142 | Bacteria | 2894 |
| 653 | Ga0207698_10070251 | 3300026142 | Bacteria | 2774 |
| 654 | Ga0207698_10118309 | 3300026142 | Bacteria | 2237 |
| 655 | Ga0207698_10278731 | 3300026142 | Bacteria | 1545 |
| 656 | Ga0207698_10694245 | 3300026142 | Bacteria | 1012 |
| 657 | Ga0207698_12250113 | 3300026142 | Unclassified | 557 |
| 658 | Ga0209969_1014467 | 3300027360 | Bacteria | 1149 |
| 659 | Ga0209999_1073538 | 3300027543 | Bacteria | 657 |
| 660 | Ga0268266_10407981 | 3300028379 | Bacteria | 1286 |
| 661 | Ga0268266_10531162 | 3300028379 | Unclassified | 1125 |
| 662 | Ga0268266_10654511 | 3300028379 | Bacteria | 1011 |
| 663 | Ga0268265_10111456 | 3300028380 | Unclassified | 2235 |
| 664 | Ga0268265_10181166 | 3300028380 | Bacteria | 1810 |
| 665 | Ga0268265_10359237 | 3300028380 | Bacteria | 1333 |
| 666 | Ga0268265_11590769 | 3300028380 | Bacteria | 658 |
| 667 | Ga0268264_10000143 | 3300028381 | Bacteria | 170031 |
| 668 | Ga0268264_10001996 | 3300028381 | Bacteria | 18331 |
| 669 | Ga0268264_10006748 | 3300028381 | Bacteria | 9645 |
| 670 | Ga0268264_10102001 | 3300028381 | Bacteria | 2496 |
| 671 | Ga0268264_10252306 | 3300028381 | Bacteria | 1639 |
| 672 | Ga0268264_10703411 | 3300028381 | Bacteria | 1004 |
| 673 | Ga0307517_10012359 | 3300028786 | Bacteria | 11728 |
| 674 | Ga0307517_10537432 | 3300028786 | Bacteria | 587 |
| 675 | Ga0307515_10000010 | 3300028794 | Bacteria | 651586 |
| 676 | Ga0307515_10828988 | 3300028794 | Bacteria | 550 |
| 677 | Ga0307509_10064977 | 3300031507 | Bacteria | 3835 |
| 678 | Ga0307509_10073156 | 3300031507 | Bacteria | 3569 |
| 679 | Ga0307408_100852758 | 3300031548 | Bacteria | 831 |
| 680 | Ga0265313_10097472 | 3300031595 | Bacteria | 1310 |
| 681 | Ga0307508_10005346 | 3300031616 | Bacteria | 12230 |
| 682 | Ga0307508_10409235 | 3300031616 | Unclassified | 948 |
| 683 | Ga0307516_10000310 | 3300031730 | Bacteria | 63335 |
| 684 | Ga0307516_10091390 | 3300031730 | Bacteria | 2872 |
| 685 | Ga0307405_11532758 | 3300031731 | Unclassified | 586 |
| 686 | Ga0307413_10114910 | 3300031824 | Bacteria | 1810 |
| 687 | Ga0307413_10160978 | 3300031824 | Unclassified | 1577 |
| 688 | Ga0307413_11311686 | 3300031824 | Bacteria | 634 |
| 689 | Ga0307410_10135676 | 3300031852 | Bacteria | 1814 |
| 690 | Ga0307410_10394426 | 3300031852 | Bacteria | 1117 |
| 691 | Ga0307406_10457528 | 3300031901 | Bacteria | 1025 |
| 692 | Ga0307406_10801726 | 3300031901 | Bacteria | 795 |
| 693 | Ga0307407_11354767 | 3300031903 | Unclassified | 559 |
| 694 | Ga0307407_11694403 | 3300031903 | Unclassified | 503 |
| 695 | Ga0307412_10261514 | 3300031911 | Unclassified | 1349 |
| 696 | Ga0307412_10694157 | 3300031911 | Bacteria | 873 |
| 697 | Ga0307416_100824398 | 3300032002 | Bacteria | 1025 |
| 698 | Ga0307416_102050624 | 3300032002 | Unclassified | 674 |
| 699 | Ga0307416_102554959 | 3300032002 | Unclassified | 609 |
| 700 | Ga0307414_10017473 | 3300032004 | Bacteria | 4390 |
| 701 | Ga0307414_10040797 | 3300032004 | Bacteria | 3138 |
| 702 | Ga0307414_10109465 | 3300032004 | Bacteria | 2099 |
| 703 | Ga0307414_11434493 | 3300032004 | Unclassified | 642 |
| 704 | Ga0307411_10108887 | 3300032005 | Bacteria | 1978 |
| 705 | Ga0307415_100564415 | 3300032126 | Bacteria | 1007 |
| 706 | Ga0307415_102473008 | 3300032126 | Bacteria | 511 |
| 707 | Ga0373934_0082751 | 3300035086 | Bacteria | 1290 |
| 708 | Ga0373932_0192779 | 3300035112 | Bacteria | 721 |
| 709 | Ga0373945_0242304 | 3300035116 | Bacteria | 759 |
| 710 | Ga0373953_0421267 | 3300035117 | Bacteria | 589 |
| 711 | Ga0373943_0374155 | 3300035170 | Bacteria | 819 |
| 712 | Ga0373946_0195701 | 3300035171 | Bacteria | 966 |
| 713 | Ga0373955_0496221 | 3300035172 | Bacteria | 745 |
| 714 | Ga0373924_0006769 | 3300035410 | Bacteria | 4118 |
| 715 | Ga0373935_0083615 | 3300035692 | Bacteria | 2078 |
| 716 | Ga0373947_0074177 | 3300035725 | Bacteria | 2093 |
| 717 | Ga0373937_0002104 | 3300036401 | Bacteria | 16647 |
| 718 | Ga0373925_0510186 | 3300037068 | Bacteria | 987 |
| 719 | Ga0395900_0110793 | 3300037418 | Bacteria | 2820 |
| 720 | Ga0395900_0188108 | 3300037418 | Bacteria | 2095 |
| 721 | Ga0395898_0070019 | 3300037466 | Bacteria | 3393 |
| 722 | Ga0395905_0001345 | 3300037471 | Bacteria | 29943 |
| 723 | Ga0395905_0136116 | 3300037471 | Bacteria | 2311 |
| 724 | Ga0395905_0179884 | 3300037471 | Bacteria | 1985 |
| 725 | Ga0395905_0202879 | 3300037471 | Bacteria | 1859 |
| 726 | Ga0395905_1287078 | 3300037471 | Bacteria | 635 |
| 727 | Ga0395901_0244126 | 3300038443 | Bacteria | 1872 |
| 728 | Ga0436363_0872388 | 3300039450 | Bacteria | 510 |
| 729 | Ga0439436_0002743 | 3300041404 | Bacteria | 5323 |
| 730 | Ga0439439_0077696 | 3300041406 | Bacteria | 894 |
| 731 | Ga0439439_0183551 | 3300041406 | Bacteria | 603 |
| 732 | Ga0439461_0137082 | 3300041410 | Bacteria | 623 |
| 733 | Ga0451787_785918 | 3300041441 | Bacteria | 698 |
| 734 | Ga0451794_27472 | 3300041446 | Bacteria | 606 |
| 735 | Ga0451791_0399799 | 3300041451 | Bacteria | 663 |
| 736 | Ga0451791_1208094 | 3300041451 | Bacteria | 570 |
| 737 | Ga0451793_1587185 | 3300041452 | Bacteria | 606 |
| 738 | Ga0451797_1588628 | 3300041453 | Bacteria | 1018 |
| 739 | Ga0451795_1448333 | 3300041456 | Bacteria | 521 |
| 740 | Ga0451795_1559977 | 3300041456 | Bacteria | 2080 |
| 741 | Ga0451800_0588693 | 3300041459 | Bacteria | 688 |
| 742 | Ga0451802_1731334 | 3300041460 | Bacteria | 2320 |
| 743 | Ga0451833_0017597 | 3300041491 | Bacteria | 974 |
| 744 | Ga0451835_0789270 | 3300041492 | Bacteria | 596 |
| 745 | Ga0451837_0197040 | 3300041494 | Bacteria | 622 |
| 746 | Ga0451841_0599628 | 3300041498 | Bacteria | 1549 |
| 747 | Ga0451851_0687021 | 3300041507 | Bacteria | 1499 |
| 748 | Ga0451843_1199062 | 3300041509 | Bacteria | 522 |
| 749 | Ga0451853_3623145 | 3300041512 | Bacteria | 553 |
| 750 | Ga0439431_0242308 | 3300041997 | Bacteria | 533 |
| 751 | Ga0439445_0156231 | 3300042004 | Bacteria | 665 |
| 752 | Ga0439449_0031986 | 3300042007 | Bacteria | 1960 |
| 753 | Ga0439457_002182 | 3300042014 | Bacteria | 5665 |
| 754 | Ga0439462_0001485 | 3300042015 | Bacteria | 5232 |
| 755 | Ga0450922_002074 | 3300042124 | Bacteria | 1906 |
| 756 | Ga0450923_031380 | 3300042125 | Bacteria | 1085 |
| 757 | Ga0450891_013892 | 3300042129 | Bacteria | 757 |
| 758 | Ga0439446_0021043 | 3300042156 | Bacteria | 1842 |
| 759 | Ga0451577_0993182 | 3300042876 | Bacteria | 754 |
| 760 | Ga0466969_0000382 | 3300044656 | Bacteria | 24366 |
| 761 | Ga0466972_0000010 | 3300044658 | Bacteria | 256339 |
| 762 | Ga0466972_0032803 | 3300044658 | Bacteria | 2549 |
| 763 | Ga0466972_0174705 | 3300044658 | Unclassified | 1008 |
| 764 | Ga0453683_0039267 | 3300044673 | Bacteria | 2975 |
| 765 | Ga0466965_0159272 | 3300044683 | Bacteria | 1183 |
| 766 | Ga0466966_0000176 | 3300044684 | Bacteria | 42093 |
| 767 | Ga0466961_0051907 | 3300044693 | Bacteria | 2618 |
| 768 | Ga0466961_0908939 | 3300044693 | Bacteria | 524 |
| 769 | Ga0466964_0016312 | 3300044706 | Bacteria | 2835 |
| 770 | Ga0453684_0023172 | 3300044712 | Bacteria | 9163 |
| 771 | Ga0466971_0066558 | 3300044719 | Bacteria | 1633 |
| 772 | Ga0466971_0140109 | 3300044719 | Bacteria | 1126 |
| 773 | Ga0466971_0466661 | 3300044719 | Bacteria | 620 |
| 774 | Ga0466968_0192757 | 3300044735 | Unclassified | 952 |
| 775 | Ga0466957_0000577 | 3300044842 | Bacteria | 18517 |
| 776 | Ga0466959_0000016 | 3300045049 | Bacteria | 144600 |
| 777 | Ga0451576_1131007 | 3300045051 | Bacteria | 819 |
| 778 | Ga0466967_2572569 | 3300045976 | Bacteria | 504 |
| 779 | Ga0495592_0026380 | 3300046454 | Bacteria | 4405 |
| 780 | Ga0495638_0010167 | 3300046460 | Bacteria | 6553 |
| 781 | Ga0495638_0291223 | 3300046460 | Unclassified | 883 |
| 782 | Ga0495653_0043228 | 3300046463 | Bacteria | 3505 |
| 783 | Ga0495650_0047770 | 3300046471 | Bacteria | 1788 |
| 784 | Ga0495580_0473514 | 3300046472 | Bacteria | 838 |
| 785 | Ga0495582_0458872 | 3300046473 | Bacteria | 736 |
| 786 | Ga0495608_0104141 | 3300046511 | Bacteria | 1828 |
| 787 | Ga0495618_0316918 | 3300046514 | Bacteria | 966 |
| 788 | Ga0495628_0062219 | 3300046516 | Bacteria | 2926 |
| 789 | Ga0495630_0003153 | 3300046517 | Bacteria | 11441 |
| 790 | Ga0495632_0230222 | 3300046519 | Bacteria | 836 |
| 791 | Ga0495666_0223564 | 3300046526 | Bacteria | 862 |
| 792 | Ga0495652_0585574 | 3300046529 | Bacteria | 763 |
| 793 | Ga0495665_0578760 | 3300046531 | Bacteria | 562 |
| 794 | Ga0495587_0062204 | 3300046536 | Bacteria | 2186 |
| 795 | Ga0495621_0269283 | 3300046539 | Unclassified | 700 |
| 796 | Ga0495645_0251921 | 3300046543 | Bacteria | 1173 |
| 797 | Ga0495668_0000212 | 3300046616 | Bacteria | 84542 |
| 798 | Ga0495668_0002317 | 3300046616 | Bacteria | 15925 |
| 799 | Ga0495634_0019397 | 3300046642 | Bacteria | 4833 |
| 800 | Ga0495625_0087620 | 3300046660 | Bacteria | 2158 |
| 801 | Ga0495613_0118295 | 3300046689 | Bacteria | 1905 |
| 802 | Ga0495581_0718297 | 3300047315 | Bacteria | 576 |
| 803 | Ga0495674_0330925 | 3300047319 | Bacteria | 1239 |
| 804 | Ga0495672_0013561 | 3300047320 | Bacteria | 5617 |
| 805 | Ga0495672_0028834 | 3300047320 | Bacteria | 3505 |
| 806 | Ga0495672_0106175 | 3300047320 | Bacteria | 1514 |
| 807 | Ga0495676_0376752 | 3300047321 | Bacteria | 945 |
| 808 | Ga0495680_0144564 | 3300047322 | Bacteria | 1738 |
| 809 | Ga0495687_061674 | 3300047443 | Bacteria | 1541 |
| 810 | Ga0495675_0095507 | 3300047444 | Bacteria | 1864 |
| 811 | Ga0495684_0128580 | 3300047471 | Bacteria | 1904 |
| 812 | Ga0495614_0228366 | 3300048089 | Bacteria | 848 |
| 813 | Ga0496100_0268484 | 3300048903 | Bacteria | 1268 |
| 814 | Ga0496101_0500328 | 3300048904 | Bacteria | 960 |
| 815 | Ga0496105_0167115 | 3300048908 | Bacteria | 1805 |
| 816 | Ga0496108_0172689 | 3300048911 | Bacteria | 1871 |
| 817 | Ga0496108_0927975 | 3300048911 | Unclassified | 746 |
| 818 | Ga0496108_1293232 | 3300048911 | Bacteria | 614 |
| 819 | Ga0496109_0420713 | 3300048912 | Bacteria | 1262 |
| 820 | Ga0496109_0436602 | 3300048912 | Bacteria | 1237 |
| 821 | Ga0496110_0879805 | 3300048913 | Unclassified | 801 |
| 822 | Ga0496111_0089780 | 3300048914 | Bacteria | 2251 |
| 823 | Ga0496112_1587198 | 3300048915 | Bacteria | 568 |
| 824 | Ga0496124_0043266 | 3300048927 | Bacteria | 3872 |
| 825 | Ga0501343_024351 | 3300049132 | Bacteria | 544 |
| 826 | Ga0501292_014129 | 3300049515 | Bacteria | 1235 |
| 827 | Ga0501298_011148 | 3300049521 | Bacteria | 1557 |
| 828 | Ga0501336_031623 | 3300049552 | Bacteria | 522 |
| 829 | Ga0501034_0001387 | 3300049571 | Bacteria | 32582 |
| 830 | Ga0501038_0899795 | 3300049574 | Bacteria | 653 |
| 831 | Ga0501043_0066157 | 3300049579 | Bacteria | 2838 |
| 832 | Ga0501072_0233777 | 3300049588 | Bacteria | 1464 |
| 833 | Ga0501202_002207 | 3300049652 | Bacteria | 3248 |
| 834 | Ga0501207_014739 | 3300049654 | Bacteria | 1196 |
| 835 | Ga0501217_000585 | 3300049661 | Bacteria | 6139 |
| 836 | Ga0501217_105623 | 3300049661 | Bacteria | 804 |
| 837 | Ga0501223_016328 | 3300049663 | Bacteria | 1467 |
| 838 | Ga0501223_072954 | 3300049663 | Bacteria | 680 |
| 839 | Ga0501224_047312 | 3300049664 | Bacteria | 655 |
| 840 | Ga0501228_018578 | 3300049666 | Bacteria | 767 |
| 841 | Ga0501233_083594 | 3300049668 | Bacteria | 825 |
| 842 | Ga0501235_011635 | 3300049669 | Bacteria | 1930 |
| 843 | Ga0501243_000796 | 3300049675 | Bacteria | 4379 |
| 844 | Ga0501249_175136 | 3300049679 | Bacteria | 552 |
| 845 | Ga0501252_004199 | 3300049682 | Bacteria | 1526 |
| 846 | Ga0501257_130663 | 3300049686 | Bacteria | 679 |
| 847 | Ga0501259_002156 | 3300049688 | Bacteria | 3228 |
| 848 | Ga0501259_049588 | 3300049688 | Bacteria | 848 |
| 849 | Ga0501259_149958 | 3300049688 | Bacteria | 576 |
| 850 | Ga0501221_000606 | 3300049704 | Bacteria | 5723 |
| 851 | Ga0501221_133229 | 3300049704 | Bacteria | 645 |
| 852 | Ga0501225_0000561 | 3300049705 | Bacteria | 11624 |
| 853 | Ga0501234_003922 | 3300049707 | Bacteria | 2336 |
| 854 | Ga0501245_000123 | 3300049708 | Bacteria | 7876 |
| 855 | Ga0501266_059389 | 3300049763 | Unclassified | 608 |
| 856 | Ga0501266_094946 | 3300049763 | Bacteria | 522 |
| 857 | Ga0501270_119577 | 3300049767 | Bacteria | 572 |
| 858 | Ga0501280_008373 | 3300049776 | Bacteria | 1443 |
| 859 | Ga0501035_0394525 | 3300049822 | Unclassified | 1152 |
| 860 | Ga0501044_0128850 | 3300049823 | Bacteria | 2525 |
| 861 | Ga0501044_0633886 | 3300049823 | Bacteria | 959 |
| 862 | nmdc:mga0k408_145923_c1 | 3300050493 | Bacteria | 1409 |
| 863 | nmdc:mga0k408_164532_c1 | 3300050493 | Bacteria | 915 |
| 864 | nmdc:mga0k408_682342_c1 | 3300050493 | Bacteria | 603 |
| 865 | nmdc:mga05p37_914_c1 | 3300050507 | Bacteria | 33336 |
| 866 | nmdc:mga09592_20986_c1 | 3300050508 | Bacteria | 5378 |
| 867 | nmdc:mga06r32_443171_c1 | 3300050510 | Bacteria | 1279 |
| 868 | nmdc:mga08y16_292197_c1 | 3300050511 | Bacteria | 1680 |
| 869 | nmdc:mga08y16_98820_c1 | 3300050511 | Bacteria | 3039 |
| 870 | nmdc:mga0n895_317322_c1 | 3300050512 | Bacteria | 1579 |
| 871 | nmdc:mga0n895_651069_c1 | 3300050512 | Bacteria | 1052 |
| 872 | Ga0495619_0429352 | 3300053085 | Bacteria | 911 |
| 873 | Ga0500578_0001201 | 3300053086 | Bacteria | 27358 |
| 874 | Ga0500578_0335650 | 3300053086 | Bacteria | 887 |
| 875 | Ga0500646_0002555 | 3300053090 | Bacteria | 4721 |
| 876 | Ga0500646_0052662 | 3300053090 | Bacteria | 1178 |
| 877 | Ga0500583_0000037 | 3300053092 | Bacteria | 92466 |
| 878 | Ga0500651_0292134 | 3300053093 | Bacteria | 937 |
| 879 | Ga0500651_0627231 | 3300053093 | Unclassified | 581 |
| 880 | Ga0500566_0344566 | 3300053094 | Unclassified | 685 |
| 881 | Ga0500648_412996 | 3300053097 | Bacteria | 503 |
| 882 | Ga0500650_0081223 | 3300053098 | Bacteria | 1516 |
| 883 | Ga0500654_140194 | 3300053099 | Bacteria | 884 |
| 884 | Ga0500555_052757 | 3300053103 | Bacteria | 1109 |
| 885 | Ga0500556_0026589 | 3300053104 | Bacteria | 1924 |
| 886 | Ga0500556_0321681 | 3300053104 | Unclassified | 602 |
| 887 | Ga0500569_150109 | 3300053109 | Bacteria | 786 |
| 888 | Ga0500572_149345 | 3300053111 | Bacteria | 763 |
| 889 | Ga0500642_0134766 | 3300053130 | Bacteria | 1157 |
| 890 | Ga0500642_0149458 | 3300053130 | Bacteria | 1096 |
| 891 | Ga0500642_0409984 | 3300053130 | Bacteria | 589 |
| 892 | Ga0500652_086593 | 3300053131 | Bacteria | 1306 |
| 893 | Ga0500652_116468 | 3300053131 | Bacteria | 1116 |
| 894 | Ga0500658_0476512 | 3300053134 | Bacteria | 567 |
| 895 | Ga0500559_0335764 | 3300053136 | Bacteria | 708 |
| 896 | Ga0500568_0073147 | 3300053139 | Bacteria | 1309 |
| 897 | Ga0500568_0287510 | 3300053139 | Unclassified | 597 |
| 898 | Ga0500585_204588 | 3300053144 | Bacteria | 655 |
| 899 | Ga0500589_159099 | 3300053147 | Bacteria | 910 |
| 900 | Ga0500603_025754 | 3300053150 | Bacteria | 1482 |
| 901 | Ga0500603_163692 | 3300053150 | Bacteria | 695 |
| 902 | Ga0500604_0003061 | 3300053151 | Bacteria | 4494 |
| 903 | Ga0500604_0106764 | 3300053151 | Bacteria | 927 |
| 904 | Ga0500616_0008456 | 3300053153 | Bacteria | 6388 |
| 905 | Ga0500619_065082 | 3300053154 | Bacteria | 1205 |
| 906 | Ga0500622_0032820 | 3300053156 | Bacteria | 2722 |
| 907 | Ga0500622_0056323 | 3300053156 | Bacteria | 2013 |
| 908 | Ga0500636_0058636 | 3300053177 | Bacteria | 2250 |
| 909 | Ga0500611_014276 | 3300053727 | Bacteria | 1382 |
| 910 | Ga0587109_120284 | 3300059624 | Bacteria | 623 |
| 911 | Ga0466962_0341871 | 3300061719 | Bacteria | 744 |
| 912 | Ga0466962_0532944 | 3300061719 | Unclassified | 596 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035117 | Ga0373953_0421267 | Ga0373953_0421267_23_349 | 107 |
| 2 | 3300041491 | Ga0451833_0017597 | Ga0451833_0017597_583_906 | 107 |
| 3 | 3300044658 | Ga0466972_0174705 | Ga0466972_0174705_652_975 | 107 |
| 4 | 3300037471 | Ga0395905_0202879 | Ga0395905_0202879_1482_1826 | 114 |
| 5 | 3300049521 | Ga0501298_011148 | Ga0501298_011148_20_367 | 114 |
| 6 | 3300049666 | Ga0501228_018578 | Ga0501228_018578_399_746 | 114 |
| 7 | 3300025933 | Ga0207706_11386503 | Ga0207706_113865031 | 118 |
| 8 | 3300005329 | Ga0070683_100010147 | Ga0070683_1000101475 | 121 |
| 9 | 3300005336 | Ga0070680_100701041 | Ga0070680_1007010411 | 121 |
| 10 | 3300005344 | Ga0070661_100348972 | Ga0070661_1003489722 | 121 |
| 11 | 3300005355 | Ga0070671_100415093 | Ga0070671_1004150932 | 121 |
| 12 | 3300005364 | Ga0070673_100959417 | Ga0070673_1009594172 | 121 |
| 13 | 3300005458 | Ga0070681_10389720 | Ga0070681_103897202 | 121 |
| 14 | 3300005535 | Ga0070684_100047735 | Ga0070684_1000477351 | 121 |
| 15 | 3300005539 | Ga0068853_100866258 | Ga0068853_1008662581 | 121 |
| 16 | 3300005564 | Ga0070664_100432481 | Ga0070664_1004324812 | 121 |
| 17 | 3300005834 | Ga0068851_10051439 | Ga0068851_100514392 | 121 |
| 18 | 3300025321 | Ga0207656_10040510 | Ga0207656_100405103 | 121 |
| 19 | 3300025914 | Ga0207671_11548732 | Ga0207671_115487322 | 121 |
| 20 | 3300025917 | Ga0207660_10628210 | Ga0207660_106282102 | 121 |
| 21 | 3300025917 | Ga0207660_11319472 | Ga0207660_113194721 | 121 |
| 22 | 3300025920 | Ga0207649_10085939 | Ga0207649_100859393 | 121 |
| 23 | 3300025926 | Ga0207659_10071251 | Ga0207659_100712513 | 121 |
| 24 | 3300025931 | Ga0207644_10158308 | Ga0207644_101583082 | 121 |
| 25 | 3300025945 | Ga0207679_10169599 | Ga0207679_101695992 | 121 |
| 26 | 3300025986 | Ga0207658_10202354 | Ga0207658_102023542 | 121 |
| 27 | 3300026142 | Ga0207698_10063287 | Ga0207698_100632874 | 121 |
| 28 | iso_pu_bacteria | 2738541278 | 2738726070 | 122 |
| 29 | iso_pu_bacteria | 2818991444 | 2819589842 | 122 |
| 30 | 3300005290 | Ga0065712_10032529 | Ga0065712_100325292 | 125 |
| 31 | 3300005295 | Ga0065707_10339960 | Ga0065707_103399602 | 125 |
| 32 | 3300005328 | Ga0070676_10153611 | Ga0070676_101536112 | 125 |
| 33 | 3300005329 | Ga0070683_100000468 | Ga0070683_10000046825 | 125 |
| 34 | 3300005329 | Ga0070683_100114315 | Ga0070683_1001143152 | 125 |
| 35 | 3300005330 | Ga0070690_100033160 | Ga0070690_1000331602 | 125 |
| 36 | 3300005330 | Ga0070690_100249207 | Ga0070690_1002492071 | 125 |
| 37 | 3300005331 | Ga0070670_100036127 | Ga0070670_1000361275 | 125 |
| 38 | 3300005334 | Ga0068869_100063232 | Ga0068869_1000632323 | 125 |
| 39 | 3300005334 | Ga0068869_100079146 | Ga0068869_1000791462 | 125 |
| 40 | 3300005335 | Ga0070666_10004991 | Ga0070666_100049916 | 125 |
| 41 | 3300005335 | Ga0070666_10078810 | Ga0070666_100788102 | 125 |
| 42 | 3300005335 | Ga0070666_10160446 | Ga0070666_101604462 | 125 |
| 43 | 3300005338 | Ga0068868_100078150 | Ga0068868_1000781502 | 125 |
| 44 | 3300005338 | Ga0068868_100455352 | Ga0068868_1004553522 | 125 |
| 45 | 3300005339 | Ga0070660_100154184 | Ga0070660_1001541842 | 125 |
| 46 | 3300005339 | Ga0070660_100746687 | Ga0070660_1007466872 | 125 |
| 47 | 3300005340 | Ga0070689_100390503 | Ga0070689_1003905032 | 125 |
| 48 | 3300005340 | Ga0070689_101071285 | Ga0070689_1010712851 | 125 |
| 49 | 3300005344 | Ga0070661_100000179 | Ga0070661_10000017950 | 125 |
| 50 | 3300005344 | Ga0070661_100034574 | Ga0070661_1000345744 | 125 |
| 51 | 3300005344 | Ga0070661_100041203 | Ga0070661_1000412031 | 125 |
| 52 | 3300005353 | Ga0070669_100080917 | Ga0070669_1000809173 | 125 |
| 53 | 3300005354 | Ga0070675_100020576 | Ga0070675_1000205763 | 125 |
| 54 | 3300005354 | Ga0070675_100174024 | Ga0070675_1001740241 | 125 |
| 55 | 3300005354 | Ga0070675_100621474 | Ga0070675_1006214741 | 125 |
| 56 | 3300005355 | Ga0070671_100015772 | Ga0070671_1000157728 | 125 |
| 57 | 3300005356 | Ga0070674_101537375 | Ga0070674_1015373751 | 125 |
| 58 | 3300005364 | Ga0070673_100224099 | Ga0070673_1002240992 | 125 |
| 59 | 3300005364 | Ga0070673_101002771 | Ga0070673_1010027711 | 125 |
| 60 | 3300005365 | Ga0070688_100205693 | Ga0070688_1002056932 | 125 |
| 61 | 3300005366 | Ga0070659_100366428 | Ga0070659_1003664282 | 125 |
| 62 | 3300005366 | Ga0070659_100748233 | Ga0070659_1007482331 | 125 |
| 63 | 3300005366 | Ga0070659_100751956 | Ga0070659_1007519561 | 125 |
| 64 | 3300005367 | Ga0070667_100183990 | Ga0070667_1001839902 | 125 |
| 65 | 3300005367 | Ga0070667_101228153 | Ga0070667_1012281531 | 125 |
| 66 | 3300005438 | Ga0070701_11203204 | Ga0070701_112032041 | 125 |
| 67 | 3300005441 | Ga0070700_100755333 | Ga0070700_1007553332 | 125 |
| 68 | 3300005456 | Ga0070678_100004697 | Ga0070678_1000046972 | 125 |
| 69 | 3300005457 | Ga0070662_100005910 | Ga0070662_1000059107 | 125 |
| 70 | 3300005457 | Ga0070662_100049525 | Ga0070662_1000495252 | 125 |
| 71 | 3300005457 | Ga0070662_100505270 | Ga0070662_1005052702 | 125 |
| 72 | 3300005457 | Ga0070662_100815865 | Ga0070662_1008158652 | 125 |
| 73 | 3300005459 | Ga0068867_100836426 | Ga0068867_1008364262 | 125 |
| 74 | 3300005459 | Ga0068867_100926275 | Ga0068867_1009262751 | 125 |
| 75 | 3300005466 | Ga0070685_10007192 | Ga0070685_100071928 | 125 |
| 76 | 3300005466 | Ga0070685_10169882 | Ga0070685_101698821 | 125 |
| 77 | 3300005535 | Ga0070684_100022853 | Ga0070684_1000228535 | 125 |
| 78 | 3300005535 | Ga0070684_100347754 | Ga0070684_1003477541 | 125 |
| 79 | 3300005535 | Ga0070684_102119985 | Ga0070684_1021199851 | 125 |
| 80 | 3300005539 | Ga0068853_100015211 | Ga0068853_1000152112 | 125 |
| 81 | 3300005543 | Ga0070672_100091970 | Ga0070672_1000919703 | 125 |
| 82 | 3300005544 | Ga0070686_101010107 | Ga0070686_1010101072 | 125 |
| 83 | 3300005547 | Ga0070693_100999707 | Ga0070693_1009997071 | 125 |
| 84 | 3300005548 | Ga0070665_100079455 | Ga0070665_1000794554 | 125 |
| 85 | 3300005548 | Ga0070665_100210394 | Ga0070665_1002103942 | 125 |
| 86 | 3300005563 | Ga0068855_100870216 | Ga0068855_1008702162 | 125 |
| 87 | 3300005564 | Ga0070664_100000140 | Ga0070664_10000014033 | 125 |
| 88 | 3300005564 | Ga0070664_100258862 | Ga0070664_1002588622 | 125 |
| 89 | 3300005564 | Ga0070664_100262348 | Ga0070664_1002623482 | 125 |
| 90 | 3300005577 | Ga0068857_100007728 | Ga0068857_1000077289 | 125 |
| 91 | 3300005577 | Ga0068857_100075454 | Ga0068857_1000754543 | 125 |
| 92 | 3300005578 | Ga0068854_100011485 | Ga0068854_1000114857 | 125 |
| 93 | 3300005578 | Ga0068854_101330292 | Ga0068854_1013302921 | 125 |
| 94 | 3300005614 | Ga0068856_101869911 | Ga0068856_1018699111 | 125 |
| 95 | 3300005615 | Ga0070702_100720279 | Ga0070702_1007202791 | 125 |
| 96 | 3300005616 | Ga0068852_100455132 | Ga0068852_1004551322 | 125 |
| 97 | 3300005616 | Ga0068852_101882275 | Ga0068852_1018822751 | 125 |
| 98 | 3300005617 | Ga0068859_100005939 | Ga0068859_10000593910 | 125 |
| 99 | 3300005617 | Ga0068859_101059311 | Ga0068859_1010593112 | 125 |
| 100 | 3300005618 | Ga0068864_100061031 | Ga0068864_1000610312 | 125 |
| 101 | 3300005618 | Ga0068864_100668520 | Ga0068864_1006685202 | 125 |
| 102 | 3300005718 | Ga0068866_10008725 | Ga0068866_100087252 | 125 |
| 103 | 3300005719 | Ga0068861_100156324 | Ga0068861_1001563242 | 125 |
| 104 | 3300005719 | Ga0068861_101043800 | Ga0068861_1010438002 | 125 |
| 105 | 3300005834 | Ga0068851_10534757 | Ga0068851_105347572 | 125 |
| 106 | 3300005840 | Ga0068870_10093933 | Ga0068870_100939331 | 125 |
| 107 | 3300005841 | Ga0068863_100097940 | Ga0068863_1000979401 | 125 |
| 108 | 3300005841 | Ga0068863_100262047 | Ga0068863_1002620473 | 125 |
| 109 | 3300005841 | Ga0068863_100909407 | Ga0068863_1009094072 | 125 |
| 110 | 3300005842 | Ga0068858_100041888 | Ga0068858_1000418884 | 125 |
| 111 | 3300005842 | Ga0068858_100152160 | Ga0068858_1001521602 | 125 |
| 112 | 3300005842 | Ga0068858_100471825 | Ga0068858_1004718252 | 125 |
| 113 | 3300005843 | Ga0068860_100222848 | Ga0068860_1002228482 | 125 |
| 114 | 3300005843 | Ga0068860_100506718 | Ga0068860_1005067182 | 125 |
| 115 | 3300005844 | Ga0068862_100258213 | Ga0068862_1002582132 | 125 |
| 116 | 3300005985 | Ga0081539_10047510 | Ga0081539_100475103 | 125 |
| 117 | 3300006163 | Ga0070715_10213479 | Ga0070715_102134792 | 125 |
| 118 | 3300006173 | Ga0070716_100415015 | Ga0070716_1004150152 | 125 |
| 119 | 3300006237 | Ga0097621_100011491 | Ga0097621_1000114919 | 125 |
| 120 | 3300006237 | Ga0097621_100152109 | Ga0097621_1001521091 | 125 |
| 121 | 3300006237 | Ga0097621_100242923 | Ga0097621_1002429232 | 125 |
| 122 | 3300006358 | Ga0068871_100011269 | Ga0068871_1000112694 | 125 |
| 123 | 3300006358 | Ga0068871_100461850 | Ga0068871_1004618502 | 125 |
| 124 | 3300006358 | Ga0068871_101659752 | Ga0068871_1016597521 | 125 |
| 125 | 3300006871 | Ga0075434_100085548 | Ga0075434_1000855484 | 125 |
| 126 | 3300006871 | Ga0075434_100439577 | Ga0075434_1004395771 | 125 |
| 127 | 3300006881 | Ga0068865_100189750 | Ga0068865_1001897501 | 125 |
| 128 | 3300006881 | Ga0068865_100440266 | Ga0068865_1004402662 | 125 |
| 129 | 3300006881 | Ga0068865_101087747 | Ga0068865_1010877471 | 125 |
| 130 | 3300006931 | Ga0097620_100005939 | Ga0097620_10000593910 | 125 |
| 131 | 3300006931 | Ga0097620_101059293 | Ga0097620_1010592932 | 125 |
| 132 | 3300009011 | Ga0105251_10109895 | Ga0105251_101098951 | 125 |
| 133 | 3300009093 | Ga0105240_10356633 | Ga0105240_103566332 | 125 |
| 134 | 3300009101 | Ga0105247_10382127 | Ga0105247_103821271 | 125 |
| 135 | 3300009176 | Ga0105242_10186413 | Ga0105242_101864131 | 125 |
| 136 | 3300009553 | Ga0105249_10245322 | Ga0105249_102453223 | 125 |
| 137 | 3300009553 | Ga0105249_11233162 | Ga0105249_112331622 | 125 |
| 138 | 3300010375 | Ga0105239_10247625 | Ga0105239_102476251 | 125 |
| 139 | 3300010375 | Ga0105239_12675468 | Ga0105239_126754681 | 125 |
| 140 | 3300011119 | Ga0105246_10072325 | Ga0105246_100723252 | 125 |
| 141 | 3300011119 | Ga0105246_12551849 | Ga0105246_125518491 | 125 |
| 142 | 3300012495 | Ga0157323_1027514 | Ga0157323_10275141 | 125 |
| 143 | 3300013102 | Ga0157371_10430901 | Ga0157371_104309011 | 125 |
| 144 | 3300013102 | Ga0157371_10480712 | Ga0157371_104807122 | 125 |
| 145 | 3300013105 | Ga0157369_10241841 | Ga0157369_102418412 | 125 |
| 146 | 3300013296 | Ga0157374_10000237 | Ga0157374_1000023719 | 125 |
| 147 | 3300013296 | Ga0157374_10005388 | Ga0157374_100053881 | 125 |
| 148 | 3300013296 | Ga0157374_10098966 | Ga0157374_100989662 | 125 |
| 149 | 3300013296 | Ga0157374_10190525 | Ga0157374_101905252 | 125 |
| 150 | 3300013297 | Ga0157378_10131265 | Ga0157378_101312652 | 125 |
| 151 | 3300013297 | Ga0157378_10174714 | Ga0157378_101747142 | 125 |
| 152 | 3300013306 | Ga0163162_10006217 | Ga0163162_100062179 | 125 |
| 153 | 3300013306 | Ga0163162_10174200 | Ga0163162_101742003 | 125 |
| 154 | 3300013306 | Ga0163162_10264187 | Ga0163162_102641873 | 125 |
| 155 | 3300013306 | Ga0163162_11236596 | Ga0163162_112365961 | 125 |
| 156 | 3300013308 | Ga0157375_10079604 | Ga0157375_100796041 | 125 |
| 157 | 3300013308 | Ga0157375_10092748 | Ga0157375_100927482 | 125 |
| 158 | 3300013308 | Ga0157375_10634183 | Ga0157375_106341831 | 125 |
| 159 | 3300014325 | Ga0163163_10000088 | Ga0163163_1000008856 | 125 |
| 160 | 3300014325 | Ga0163163_10661105 | Ga0163163_106611052 | 125 |
| 161 | 3300014325 | Ga0163163_10958080 | Ga0163163_109580801 | 125 |
| 162 | 3300014326 | Ga0157380_10131722 | Ga0157380_101317222 | 125 |
| 163 | 3300014745 | Ga0157377_10009383 | Ga0157377_100093831 | 125 |
| 164 | 3300014745 | Ga0157377_10089787 | Ga0157377_100897872 | 125 |
| 165 | 3300014745 | Ga0157377_10603246 | Ga0157377_106032462 | 125 |
| 166 | 3300014968 | Ga0157379_10050431 | Ga0157379_100504315 | 125 |
| 167 | 3300014968 | Ga0157379_10555359 | Ga0157379_105553592 | 125 |
| 168 | 3300014969 | Ga0157376_10073355 | Ga0157376_100733552 | 125 |
| 169 | 3300014969 | Ga0157376_10317978 | Ga0157376_103179783 | 125 |
| 170 | 3300014969 | Ga0157376_10526578 | Ga0157376_105265781 | 125 |
| 171 | 3300014969 | Ga0157376_10604161 | Ga0157376_106041612 | 125 |
| 172 | 3300017792 | Ga0163161_10002796 | Ga0163161_1000279613 | 125 |
| 173 | 3300017792 | Ga0163161_10027138 | Ga0163161_100271383 | 125 |
| 174 | 3300017792 | Ga0163161_10123937 | Ga0163161_101239372 | 125 |
| 175 | 3300017792 | Ga0163161_10326686 | Ga0163161_103266862 | 125 |
| 176 | 3300025899 | Ga0207642_10028662 | Ga0207642_100286623 | 125 |
| 177 | 3300025903 | Ga0207680_10009247 | Ga0207680_100092472 | 125 |
| 178 | 3300025903 | Ga0207680_10378907 | Ga0207680_103789072 | 125 |
| 179 | 3300025903 | Ga0207680_10901511 | Ga0207680_109015111 | 125 |
| 180 | 3300025904 | Ga0207647_10009722 | Ga0207647_100097227 | 125 |
| 181 | 3300025905 | Ga0207685_10006223 | Ga0207685_100062233 | 125 |
| 182 | 3300025907 | Ga0207645_10390545 | Ga0207645_103905451 | 125 |
| 183 | 3300025908 | Ga0207643_10200968 | Ga0207643_102009682 | 125 |
| 184 | 3300025911 | Ga0207654_10403306 | Ga0207654_104033062 | 125 |
| 185 | 3300025912 | Ga0207707_10242770 | Ga0207707_102427702 | 125 |
| 186 | 3300025913 | Ga0207695_10545403 | Ga0207695_105454032 | 125 |
| 187 | 3300025919 | Ga0207657_10173809 | Ga0207657_101738092 | 125 |
| 188 | 3300025920 | Ga0207649_10000419 | Ga0207649_1000041925 | 125 |
| 189 | 3300025923 | Ga0207681_10329909 | Ga0207681_103299092 | 125 |
| 190 | 3300025923 | Ga0207681_11676691 | Ga0207681_116766911 | 125 |
| 191 | 3300025925 | Ga0207650_10020700 | Ga0207650_100207004 | 125 |
| 192 | 3300025926 | Ga0207659_10113269 | Ga0207659_101132693 | 125 |
| 193 | 3300025926 | Ga0207659_10664914 | Ga0207659_106649141 | 125 |
| 194 | 3300025927 | Ga0207687_11274519 | Ga0207687_112745191 | 125 |
| 195 | 3300025931 | Ga0207644_10615736 | Ga0207644_106157362 | 125 |
| 196 | 3300025931 | Ga0207644_10670424 | Ga0207644_106704242 | 125 |
| 197 | 3300025932 | Ga0207690_10190103 | Ga0207690_101901032 | 125 |
| 198 | 3300025933 | Ga0207706_10002103 | Ga0207706_100021034 | 125 |
| 199 | 3300025933 | Ga0207706_10018001 | Ga0207706_100180011 | 125 |
| 200 | 3300025933 | Ga0207706_10084464 | Ga0207706_100844642 | 125 |
| 201 | 3300025934 | Ga0207686_10149086 | Ga0207686_101490862 | 125 |
| 202 | 3300025936 | Ga0207670_10185937 | Ga0207670_101859371 | 125 |
| 203 | 3300025936 | Ga0207670_10340732 | Ga0207670_103407322 | 125 |
| 204 | 3300025936 | Ga0207670_11764547 | Ga0207670_117645471 | 125 |
| 205 | 3300025938 | Ga0207704_10128813 | Ga0207704_101288133 | 125 |
| 206 | 3300025938 | Ga0207704_10177265 | Ga0207704_101772653 | 125 |
| 207 | 3300025939 | Ga0207665_11071219 | Ga0207665_110712192 | 125 |
| 208 | 3300025940 | Ga0207691_10011435 | Ga0207691_100114353 | 125 |
| 209 | 3300025942 | Ga0207689_10021058 | Ga0207689_100210581 | 125 |
| 210 | 3300025942 | Ga0207689_10167225 | Ga0207689_101672253 | 125 |
| 211 | 3300025944 | Ga0207661_10000370 | Ga0207661_100003708 | 125 |
| 212 | 3300025944 | Ga0207661_10331612 | Ga0207661_103316122 | 125 |
| 213 | 3300025944 | Ga0207661_11400893 | Ga0207661_114008931 | 125 |
| 214 | 3300025945 | Ga0207679_10000266 | Ga0207679_1000026614 | 125 |
| 215 | 3300025945 | Ga0207679_10163117 | Ga0207679_101631173 | 125 |
| 216 | 3300025960 | Ga0207651_10204392 | Ga0207651_102043922 | 125 |
| 217 | 3300025960 | Ga0207651_11235144 | Ga0207651_112351441 | 125 |
| 218 | 3300025960 | Ga0207651_11947061 | Ga0207651_119470611 | 125 |
| 219 | 3300025981 | Ga0207640_10021342 | Ga0207640_100213423 | 125 |
| 220 | 3300025981 | Ga0207640_10713989 | Ga0207640_107139891 | 125 |
| 221 | 3300025986 | Ga0207658_10630113 | Ga0207658_106301131 | 125 |
| 222 | 3300026023 | Ga0207677_10285222 | Ga0207677_102852222 | 125 |
| 223 | 3300026023 | Ga0207677_11314847 | Ga0207677_113148471 | 125 |
| 224 | 3300026035 | Ga0207703_10097933 | Ga0207703_100979332 | 125 |
| 225 | 3300026035 | Ga0207703_10813557 | Ga0207703_108135572 | 125 |
| 226 | 3300026041 | Ga0207639_10082339 | Ga0207639_100823393 | 125 |
| 227 | 3300026041 | Ga0207639_11089568 | Ga0207639_110895681 | 125 |
| 228 | 3300026041 | Ga0207639_11760258 | Ga0207639_117602581 | 125 |
| 229 | 3300026067 | Ga0207678_10090917 | Ga0207678_100909172 | 125 |
| 230 | 3300026075 | Ga0207708_10562951 | Ga0207708_105629512 | 125 |
| 231 | 3300026078 | Ga0207702_10338432 | Ga0207702_103384322 | 125 |
| 232 | 3300026088 | Ga0207641_10037835 | Ga0207641_100378354 | 125 |
| 233 | 3300026088 | Ga0207641_10091216 | Ga0207641_100912162 | 125 |
| 234 | 3300026088 | Ga0207641_10105683 | Ga0207641_101056832 | 125 |
| 235 | 3300026088 | Ga0207641_12277170 | Ga0207641_122771701 | 125 |
| 236 | 3300026089 | Ga0207648_10304460 | Ga0207648_103044603 | 125 |
| 237 | 3300026089 | Ga0207648_10530486 | Ga0207648_105304862 | 125 |
| 238 | 3300026089 | Ga0207648_10724644 | Ga0207648_107246442 | 125 |
| 239 | 3300026095 | Ga0207676_10019254 | Ga0207676_100192541 | 125 |
| 240 | 3300026095 | Ga0207676_10038829 | Ga0207676_100388293 | 125 |
| 241 | 3300026116 | Ga0207674_10007803 | Ga0207674_1000780312 | 125 |
| 242 | 3300026118 | Ga0207675_100150383 | Ga0207675_1001503832 | 125 |
| 243 | 3300026118 | Ga0207675_100754399 | Ga0207675_1007543991 | 125 |
| 244 | 3300026121 | Ga0207683_10010220 | Ga0207683_100102209 | 125 |
| 245 | 3300026121 | Ga0207683_10311957 | Ga0207683_103119573 | 125 |
| 246 | 3300026142 | Ga0207698_10048581 | Ga0207698_100485813 | 125 |
| 247 | 3300026142 | Ga0207698_10070251 | Ga0207698_100702512 | 125 |
| 248 | 3300028379 | Ga0268266_10654511 | Ga0268266_106545111 | 125 |
| 249 | 3300035086 | Ga0373934_0082751 | Ga0373934_0082751_29_415 | 125 |
| 250 | 3300035170 | Ga0373943_0374155 | Ga0373943_0374155_159_545 | 125 |
| 251 | 3300035171 | Ga0373946_0195701 | Ga0373946_0195701_476_862 | 125 |
| 252 | 3300035172 | Ga0373955_0496221 | Ga0373955_0496221_107_493 | 125 |
| 253 | 3300035410 | Ga0373924_0006769 | Ga0373924_0006769_2266_2652 | 125 |
| 254 | 3300035692 | Ga0373935_0083615 | Ga0373935_0083615_136_522 | 125 |
| 255 | 3300035725 | Ga0373947_0074177 | Ga0373947_0074177_1561_1947 | 125 |
| 256 | 3300036401 | Ga0373937_0002104 | Ga0373937_0002104_13312_13698 | 125 |
| 257 | 3300037068 | Ga0373925_0510186 | Ga0373925_0510186_413_799 | 125 |
| 258 | 3300046454 | Ga0495592_0026380 | Ga0495592_0026380_634_1020 | 125 |
| 259 | 3300046463 | Ga0495653_0043228 | Ga0495653_0043228_2795_3181 | 125 |
| 260 | 3300046472 | Ga0495580_0473514 | Ga0495580_0473514_419_805 | 125 |
| 261 | 3300046473 | Ga0495582_0458872 | Ga0495582_0458872_231_617 | 125 |
| 262 | 3300046511 | Ga0495608_0104141 | Ga0495608_0104141_1232_1618 | 125 |
| 263 | 3300046514 | Ga0495618_0316918 | Ga0495618_0316918_343_729 | 125 |
| 264 | 3300046516 | Ga0495628_0062219 | Ga0495628_0062219_56_442 | 125 |
| 265 | 3300046517 | Ga0495630_0003153 | Ga0495630_0003153_6853_7239 | 125 |
| 266 | 3300046526 | Ga0495666_0223564 | Ga0495666_0223564_177_563 | 125 |
| 267 | 3300046529 | Ga0495652_0585574 | Ga0495652_0585574_363_749 | 125 |
| 268 | 3300046531 | Ga0495665_0578760 | Ga0495665_0578760_157_543 | 125 |
| 269 | 3300046536 | Ga0495587_0062204 | Ga0495587_0062204_692_1078 | 125 |
| 270 | 3300046543 | Ga0495645_0251921 | Ga0495645_0251921_570_956 | 125 |
| 271 | 3300046642 | Ga0495634_0019397 | Ga0495634_0019397_784_1170 | 125 |
| 272 | 3300046689 | Ga0495613_0118295 | Ga0495613_0118295_799_1185 | 125 |
| 273 | 3300047315 | Ga0495581_0718297 | Ga0495581_0718297_135_521 | 125 |
| 274 | 3300047319 | Ga0495674_0330925 | Ga0495674_0330925_771_1157 | 125 |
| 275 | 3300047321 | Ga0495676_0376752 | Ga0495676_0376752_470_856 | 125 |
| 276 | 3300047322 | Ga0495680_0144564 | Ga0495680_0144564_238_624 | 125 |
| 277 | 3300047444 | Ga0495675_0095507 | Ga0495675_0095507_349_735 | 125 |
| 278 | 3300047471 | Ga0495684_0128580 | Ga0495684_0128580_1121_1507 | 125 |
| 279 | 3300048089 | Ga0495614_0228366 | Ga0495614_0228366_176_562 | 125 |
| 280 | 3300048903 | Ga0496100_0268484 | Ga0496100_0268484_661_1047 | 125 |
| 281 | 3300048904 | Ga0496101_0500328 | Ga0496101_0500328_517_903 | 125 |
| 282 | 3300048908 | Ga0496105_0167115 | Ga0496105_0167115_125_511 | 125 |
| 283 | 3300048911 | Ga0496108_0927975 | Ga0496108_0927975_227_613 | 125 |
| 284 | 3300048912 | Ga0496109_0436602 | Ga0496109_0436602_130_516 | 125 |
| 285 | 3300048913 | Ga0496110_0879805 | Ga0496110_0879805_231_617 | 125 |
| 286 | 3300048914 | Ga0496111_0089780 | Ga0496111_0089780_657_1043 | 125 |
| 287 | 3300049588 | Ga0501072_0233777 | Ga0501072_0233777_233_613 | 125 |
| 288 | 3300049767 | Ga0501270_119577 | Ga0501270_119577_97_474 | 125 |
| 289 | 3300050512 | nmdc:mga0n895_317322_c1 | nmdc:mga0n895_317322_c1_1115_1501 | 125 |
| 290 | 3300050512 | nmdc:mga0n895_651069_c1 | nmdc:mga0n895_651069_c1_610_996 | 125 |
| 291 | 3300053085 | Ga0495619_0429352 | Ga0495619_0429352_77_463 | 125 |
| 292 | 3300001904 | JGI24736J21556_1004049 | JGI24736J21556_10040494 | 126 |
| 293 | 3300001990 | JGI24737J22298_10075046 | JGI24737J22298_100750462 | 126 |
| 294 | 3300002073 | JGI24745J21846_1050996 | JGI24745J21846_10509962 | 126 |
| 295 | 3300002077 | JGI24744J21845_10007180 | JGI24744J21845_100071802 | 126 |
| 296 | 3300002459 | JGI24751J29686_10041257 | JGI24751J29686_100412572 | 126 |
| 297 | 3300003323 | rootH1_10019969 | rootH1_100199693 | 126 |
| 298 | 3300003323 | rootH1_10144194 | rootH1_101441942 | 126 |
| 299 | 3300003323 | rootH1_10163770 | rootH1_101637703 | 126 |
| 300 | 3300003761 | Ga0055535_1001800 | Ga0055535_10018004 | 126 |
| 301 | 3300005290 | Ga0065712_10010222 | Ga0065712_100102222 | 126 |
| 302 | 3300005290 | Ga0065712_10363462 | Ga0065712_103634621 | 126 |
| 303 | 3300005290 | Ga0065712_10461770 | Ga0065712_104617702 | 126 |
| 304 | 3300005327 | Ga0070658_10261787 | Ga0070658_102617872 | 126 |
| 305 | 3300005327 | Ga0070658_10297148 | Ga0070658_102971481 | 126 |
| 306 | 3300005327 | Ga0070658_10339819 | Ga0070658_103398191 | 126 |
| 307 | 3300005327 | Ga0070658_10948829 | Ga0070658_109488292 | 126 |
| 308 | 3300005327 | Ga0070658_11112402 | Ga0070658_111124021 | 126 |
| 309 | 3300005328 | Ga0070676_10181503 | Ga0070676_101815032 | 126 |
| 310 | 3300005328 | Ga0070676_10658215 | Ga0070676_106582151 | 126 |
| 311 | 3300005328 | Ga0070676_11396621 | Ga0070676_113966211 | 126 |
| 312 | 3300005329 | Ga0070683_101742005 | Ga0070683_1017420051 | 126 |
| 313 | 3300005330 | Ga0070690_100362890 | Ga0070690_1003628901 | 126 |
| 314 | 3300005330 | Ga0070690_100400097 | Ga0070690_1004000972 | 126 |
| 315 | 3300005331 | Ga0070670_100005343 | Ga0070670_1000053437 | 126 |
| 316 | 3300005331 | Ga0070670_100035958 | Ga0070670_1000359583 | 126 |
| 317 | 3300005331 | Ga0070670_100063150 | Ga0070670_1000631502 | 126 |
| 318 | 3300005331 | Ga0070670_100272545 | Ga0070670_1002725453 | 126 |
| 319 | 3300005331 | Ga0070670_100419001 | Ga0070670_1004190012 | 126 |
| 320 | 3300005331 | Ga0070670_100741688 | Ga0070670_1007416882 | 126 |
| 321 | 3300005331 | Ga0070670_100781479 | Ga0070670_1007814792 | 126 |
| 322 | 3300005331 | Ga0070670_100913885 | Ga0070670_1009138852 | 126 |
| 323 | 3300005333 | Ga0070677_10149540 | Ga0070677_101495402 | 126 |
| 324 | 3300005333 | Ga0070677_10745457 | Ga0070677_107454571 | 126 |
| 325 | 3300005334 | Ga0068869_100009768 | Ga0068869_1000097683 | 126 |
| 326 | 3300005334 | Ga0068869_100012813 | Ga0068869_1000128134 | 126 |
| 327 | 3300005334 | Ga0068869_100017295 | Ga0068869_1000172956 | 126 |
| 328 | 3300005335 | Ga0070666_10000038 | Ga0070666_1000003881 | 126 |
| 329 | 3300005335 | Ga0070666_10017523 | Ga0070666_100175232 | 126 |
| 330 | 3300005335 | Ga0070666_10065667 | Ga0070666_100656673 | 126 |
| 331 | 3300005335 | Ga0070666_10693283 | Ga0070666_106932831 | 126 |
| 332 | 3300005337 | Ga0070682_100000039 | Ga0070682_10000003927 | 126 |
| 333 | 3300005337 | Ga0070682_100089754 | Ga0070682_1000897543 | 126 |
| 334 | 3300005338 | Ga0068868_100018213 | Ga0068868_1000182132 | 126 |
| 335 | 3300005338 | Ga0068868_100451053 | Ga0068868_1004510531 | 126 |
| 336 | 3300005338 | Ga0068868_100573323 | Ga0068868_1005733232 | 126 |
| 337 | 3300005338 | Ga0068868_100703417 | Ga0068868_1007034171 | 126 |
| 338 | 3300005338 | Ga0068868_101400190 | Ga0068868_1014001901 | 126 |
| 339 | 3300005339 | Ga0070660_100124788 | Ga0070660_1001247883 | 126 |
| 340 | 3300005339 | Ga0070660_100825265 | Ga0070660_1008252652 | 126 |
| 341 | 3300005344 | Ga0070661_100245247 | Ga0070661_1002452472 | 126 |
| 342 | 3300005344 | Ga0070661_100644217 | Ga0070661_1006442172 | 126 |
| 343 | 3300005344 | Ga0070661_100762729 | Ga0070661_1007627291 | 126 |
| 344 | 3300005347 | Ga0070668_100043263 | Ga0070668_1000432633 | 126 |
| 345 | 3300005347 | Ga0070668_100066643 | Ga0070668_1000666433 | 126 |
| 346 | 3300005347 | Ga0070668_100128656 | Ga0070668_1001286562 | 126 |
| 347 | 3300005347 | Ga0070668_100303381 | Ga0070668_1003033812 | 126 |
| 348 | 3300005353 | Ga0070669_100024662 | Ga0070669_1000246622 | 126 |
| 349 | 3300005353 | Ga0070669_100463594 | Ga0070669_1004635943 | 126 |
| 350 | 3300005354 | Ga0070675_100009635 | Ga0070675_1000096359 | 126 |
| 351 | 3300005354 | Ga0070675_100054348 | Ga0070675_1000543484 | 126 |
| 352 | 3300005354 | Ga0070675_100061215 | Ga0070675_1000612153 | 126 |
| 353 | 3300005354 | Ga0070675_100112895 | Ga0070675_1001128953 | 126 |
| 354 | 3300005354 | Ga0070675_100196931 | Ga0070675_1001969312 | 126 |
| 355 | 3300005355 | Ga0070671_100238388 | Ga0070671_1002383881 | 126 |
| 356 | 3300005355 | Ga0070671_100385284 | Ga0070671_1003852841 | 126 |
| 357 | 3300005355 | Ga0070671_101374792 | Ga0070671_1013747922 | 126 |
| 358 | 3300005356 | Ga0070674_100004279 | Ga0070674_1000042798 | 126 |
| 359 | 3300005356 | Ga0070674_100184538 | Ga0070674_1001845383 | 126 |
| 360 | 3300005364 | Ga0070673_100008952 | Ga0070673_1000089523 | 126 |
| 361 | 3300005364 | Ga0070673_100193037 | Ga0070673_1001930372 | 126 |
| 362 | 3300005364 | Ga0070673_100515191 | Ga0070673_1005151912 | 126 |
| 363 | 3300005364 | Ga0070673_101024716 | Ga0070673_1010247161 | 126 |
| 364 | 3300005364 | Ga0070673_102010022 | Ga0070673_1020100221 | 126 |
| 365 | 3300005365 | Ga0070688_100186446 | Ga0070688_1001864463 | 126 |
| 366 | 3300005365 | Ga0070688_100572459 | Ga0070688_1005724591 | 126 |
| 367 | 3300005366 | Ga0070659_100009346 | Ga0070659_1000093466 | 126 |
| 368 | 3300005366 | Ga0070659_101129172 | Ga0070659_1011291721 | 126 |
| 369 | 3300005366 | Ga0070659_101419530 | Ga0070659_1014195302 | 126 |
| 370 | 3300005367 | Ga0070667_100291951 | Ga0070667_1002919512 | 126 |
| 371 | 3300005367 | Ga0070667_100543420 | Ga0070667_1005434202 | 126 |
| 372 | 3300005367 | Ga0070667_101820178 | Ga0070667_1018201781 | 126 |
| 373 | 3300005438 | Ga0070701_10279105 | Ga0070701_102791052 | 126 |
| 374 | 3300005441 | Ga0070700_100246934 | Ga0070700_1002469342 | 126 |
| 375 | 3300005441 | Ga0070700_100578069 | Ga0070700_1005780691 | 126 |
| 376 | 3300005441 | Ga0070700_101437041 | Ga0070700_1014370411 | 126 |
| 377 | 3300005456 | Ga0070678_100014866 | Ga0070678_1000148663 | 126 |
| 378 | 3300005456 | Ga0070678_100039709 | Ga0070678_1000397091 | 126 |
| 379 | 3300005456 | Ga0070678_100917164 | Ga0070678_1009171641 | 126 |
| 380 | 3300005457 | Ga0070662_100015036 | Ga0070662_1000150364 | 126 |
| 381 | 3300005457 | Ga0070662_100885467 | Ga0070662_1008854672 | 126 |
| 382 | 3300005459 | Ga0068867_100026385 | Ga0068867_1000263852 | 126 |
| 383 | 3300005459 | Ga0068867_100040030 | Ga0068867_1000400303 | 126 |
| 384 | 3300005459 | Ga0068867_100165085 | Ga0068867_1001650852 | 126 |
| 385 | 3300005459 | Ga0068867_100301896 | Ga0068867_1003018962 | 126 |
| 386 | 3300005459 | Ga0068867_101753790 | Ga0068867_1017537901 | 126 |
| 387 | 3300005466 | Ga0070685_10112716 | Ga0070685_101127163 | 126 |
| 388 | 3300005466 | Ga0070685_11201048 | Ga0070685_112010481 | 126 |
| 389 | 3300005518 | Ga0070699_100288194 | Ga0070699_1002881942 | 126 |
| 390 | 3300005535 | Ga0070684_101424077 | Ga0070684_1014240772 | 126 |
| 391 | 3300005539 | Ga0068853_100002821 | Ga0068853_1000028213 | 126 |
| 392 | 3300005539 | Ga0068853_100021602 | Ga0068853_1000216024 | 126 |
| 393 | 3300005539 | Ga0068853_100022828 | Ga0068853_1000228282 | 126 |
| 394 | 3300005539 | Ga0068853_100064395 | Ga0068853_1000643951 | 126 |
| 395 | 3300005539 | Ga0068853_100781567 | Ga0068853_1007815672 | 126 |
| 396 | 3300005543 | Ga0070672_100036669 | Ga0070672_1000366693 | 126 |
| 397 | 3300005543 | Ga0070672_100159406 | Ga0070672_1001594062 | 126 |
| 398 | 3300005543 | Ga0070672_100320048 | Ga0070672_1003200482 | 126 |
| 399 | 3300005543 | Ga0070672_100352251 | Ga0070672_1003522512 | 126 |
| 400 | 3300005543 | Ga0070672_101395410 | Ga0070672_1013954101 | 126 |
| 401 | 3300005543 | Ga0070672_101578769 | Ga0070672_1015787691 | 126 |
| 402 | 3300005544 | Ga0070686_100842026 | Ga0070686_1008420262 | 126 |
| 403 | 3300005547 | Ga0070693_100729554 | Ga0070693_1007295542 | 126 |
| 404 | 3300005547 | Ga0070693_100924096 | Ga0070693_1009240961 | 126 |
| 405 | 3300005548 | Ga0070665_100186701 | Ga0070665_1001867011 | 126 |
| 406 | 3300005563 | Ga0068855_100017041 | Ga0068855_1000170414 | 126 |
| 407 | 3300005564 | Ga0070664_100360954 | Ga0070664_1003609543 | 126 |
| 408 | 3300005564 | Ga0070664_101121182 | Ga0070664_1011211821 | 126 |
| 409 | 3300005577 | Ga0068857_100136533 | Ga0068857_1001365332 | 126 |
| 410 | 3300005577 | Ga0068857_100341845 | Ga0068857_1003418452 | 126 |
| 411 | 3300005577 | Ga0068857_100764725 | Ga0068857_1007647251 | 126 |
| 412 | 3300005577 | Ga0068857_101565094 | Ga0068857_1015650941 | 126 |
| 413 | 3300005577 | Ga0068857_102229227 | Ga0068857_1022292271 | 126 |
| 414 | 3300005578 | Ga0068854_100065919 | Ga0068854_1000659192 | 126 |
| 415 | 3300005578 | Ga0068854_100468638 | Ga0068854_1004686382 | 126 |
| 416 | 3300005578 | Ga0068854_101627649 | Ga0068854_1016276492 | 126 |
| 417 | 3300005614 | Ga0068856_100036347 | Ga0068856_1000363473 | 126 |
| 418 | 3300005614 | Ga0068856_101757554 | Ga0068856_1017575541 | 126 |
| 419 | 3300005616 | Ga0068852_100023809 | Ga0068852_1000238094 | 126 |
| 420 | 3300005616 | Ga0068852_100049213 | Ga0068852_1000492134 | 126 |
| 421 | 3300005616 | Ga0068852_100618875 | Ga0068852_1006188751 | 126 |
| 422 | 3300005616 | Ga0068852_100691098 | Ga0068852_1006910982 | 126 |
| 423 | 3300005616 | Ga0068852_101295908 | Ga0068852_1012959082 | 126 |
| 424 | 3300005617 | Ga0068859_100000007 | Ga0068859_10000000788 | 126 |
| 425 | 3300005617 | Ga0068859_100100050 | Ga0068859_1001000502 | 126 |
| 426 | 3300005617 | Ga0068859_100124931 | Ga0068859_1001249313 | 126 |
| 427 | 3300005617 | Ga0068859_100213447 | Ga0068859_1002134471 | 126 |
| 428 | 3300005617 | Ga0068859_101811069 | Ga0068859_1018110691 | 126 |
| 429 | 3300005618 | Ga0068864_100000685 | Ga0068864_10000068512 | 126 |
| 430 | 3300005718 | Ga0068866_10045822 | Ga0068866_100458222 | 126 |
| 431 | 3300005719 | Ga0068861_100020953 | Ga0068861_1000209534 | 126 |
| 432 | 3300005719 | Ga0068861_100143217 | Ga0068861_1001432172 | 126 |
| 433 | 3300005719 | Ga0068861_102062290 | Ga0068861_1020622902 | 126 |
| 434 | 3300005834 | Ga0068851_10124394 | Ga0068851_101243942 | 126 |
| 435 | 3300005834 | Ga0068851_10287313 | Ga0068851_102873132 | 126 |
| 436 | 3300005834 | Ga0068851_10290021 | Ga0068851_102900211 | 126 |
| 437 | 3300005834 | Ga0068851_10355106 | Ga0068851_103551061 | 126 |
| 438 | 3300005834 | Ga0068851_10455572 | Ga0068851_104555722 | 126 |
| 439 | 3300005834 | Ga0068851_10635160 | Ga0068851_106351602 | 126 |
| 440 | 3300005834 | Ga0068851_11005144 | Ga0068851_110051441 | 126 |
| 441 | 3300005840 | Ga0068870_10106168 | Ga0068870_101061682 | 126 |
| 442 | 3300005841 | Ga0068863_100111325 | Ga0068863_1001113253 | 126 |
| 443 | 3300005841 | Ga0068863_100633927 | Ga0068863_1006339272 | 126 |
| 444 | 3300005842 | Ga0068858_100003163 | Ga0068858_1000031635 | 126 |
| 445 | 3300005843 | Ga0068860_100012160 | Ga0068860_1000121608 | 126 |
| 446 | 3300005843 | Ga0068860_100175676 | Ga0068860_1001756762 | 126 |
| 447 | 3300005843 | Ga0068860_100332635 | Ga0068860_1003326352 | 126 |
| 448 | 3300005843 | Ga0068860_100392845 | Ga0068860_1003928452 | 126 |
| 449 | 3300005843 | Ga0068860_100400522 | Ga0068860_1004005222 | 126 |
| 450 | 3300005844 | Ga0068862_100111328 | Ga0068862_1001113282 | 126 |
| 451 | 3300005937 | Ga0081455_10532077 | Ga0081455_105320771 | 126 |
| 452 | 3300006195 | Ga0075366_10078707 | Ga0075366_100787072 | 126 |
| 453 | 3300006195 | Ga0075366_10261881 | Ga0075366_102618811 | 126 |
| 454 | 3300006195 | Ga0075366_10289024 | Ga0075366_102890242 | 126 |
| 455 | 3300006195 | Ga0075366_10818331 | Ga0075366_108183311 | 126 |
| 456 | 3300006237 | Ga0097621_100003509 | Ga0097621_1000035097 | 126 |
| 457 | 3300006237 | Ga0097621_100017011 | Ga0097621_1000170116 | 126 |
| 458 | 3300006237 | Ga0097621_100027689 | Ga0097621_1000276893 | 126 |
| 459 | 3300006237 | Ga0097621_100100209 | Ga0097621_1001002092 | 126 |
| 460 | 3300006237 | Ga0097621_100640902 | Ga0097621_1006409022 | 126 |
| 461 | 3300006353 | Ga0075370_10691442 | Ga0075370_106914421 | 126 |
| 462 | 3300006358 | Ga0068871_100003013 | Ga0068871_1000030138 | 126 |
| 463 | 3300006358 | Ga0068871_100008869 | Ga0068871_1000088693 | 126 |
| 464 | 3300006358 | Ga0068871_100022594 | Ga0068871_1000225944 | 126 |
| 465 | 3300006358 | Ga0068871_100381836 | Ga0068871_1003818362 | 126 |
| 466 | 3300006358 | Ga0068871_100668136 | Ga0068871_1006681361 | 126 |
| 467 | 3300006358 | Ga0068871_100837381 | Ga0068871_1008373812 | 126 |
| 468 | 3300006358 | Ga0068871_100881040 | Ga0068871_1008810401 | 126 |
| 469 | 3300006358 | Ga0068871_100954062 | Ga0068871_1009540622 | 126 |
| 470 | 3300006844 | Ga0075428_100093358 | Ga0075428_1000933582 | 126 |
| 471 | 3300006846 | Ga0075430_101132872 | Ga0075430_1011328721 | 126 |
| 472 | 3300006847 | Ga0075431_100005210 | Ga0075431_10000521012 | 126 |
| 473 | 3300006880 | Ga0075429_100004647 | Ga0075429_1000046478 | 126 |
| 474 | 3300006880 | Ga0075429_101088347 | Ga0075429_1010883472 | 126 |
| 475 | 3300006881 | Ga0068865_100002580 | Ga0068865_1000025804 | 126 |
| 476 | 3300006881 | Ga0068865_100348952 | Ga0068865_1003489522 | 126 |
| 477 | 3300006931 | Ga0097620_100000007 | Ga0097620_10000000789 | 126 |
| 478 | 3300006931 | Ga0097620_100100047 | Ga0097620_1001000472 | 126 |
| 479 | 3300006931 | Ga0097620_100124933 | Ga0097620_1001249332 | 126 |
| 480 | 3300006931 | Ga0097620_100213450 | Ga0097620_1002134501 | 126 |
| 481 | 3300006931 | Ga0097620_101811725 | Ga0097620_1018117252 | 126 |
| 482 | 3300009093 | Ga0105240_11318630 | Ga0105240_113186302 | 126 |
| 483 | 3300009094 | Ga0111539_10043506 | Ga0111539_100435062 | 126 |
| 484 | 3300009094 | Ga0111539_10119552 | Ga0111539_101195524 | 126 |
| 485 | 3300009098 | Ga0105245_10217098 | Ga0105245_102170983 | 126 |
| 486 | 3300009101 | Ga0105247_10010856 | Ga0105247_100108563 | 126 |
| 487 | 3300009147 | Ga0114129_10181526 | Ga0114129_101815263 | 126 |
| 488 | 3300009174 | Ga0105241_10000104 | Ga0105241_1000010453 | 126 |
| 489 | 3300009174 | Ga0105241_10084119 | Ga0105241_100841193 | 126 |
| 490 | 3300009174 | Ga0105241_10285817 | Ga0105241_102858172 | 126 |
| 491 | 3300009174 | Ga0105241_10893525 | Ga0105241_108935251 | 126 |
| 492 | 3300009174 | Ga0105241_10963258 | Ga0105241_109632582 | 126 |
| 493 | 3300009176 | Ga0105242_10039659 | Ga0105242_100396593 | 126 |
| 494 | 3300009176 | Ga0105242_10077049 | Ga0105242_100770492 | 126 |
| 495 | 3300009176 | Ga0105242_10664282 | Ga0105242_106642822 | 126 |
| 496 | 3300009176 | Ga0105242_12830787 | Ga0105242_128307872 | 126 |
| 497 | 3300009545 | Ga0105237_10040911 | Ga0105237_100409112 | 126 |
| 498 | 3300009553 | Ga0105249_10009352 | Ga0105249_100093528 | 126 |
| 499 | 3300010375 | Ga0105239_10143356 | Ga0105239_101433563 | 126 |
| 500 | 3300010375 | Ga0105239_11362057 | Ga0105239_113620572 | 126 |
| 501 | 3300011119 | Ga0105246_10001838 | Ga0105246_100018382 | 126 |
| 502 | 3300011119 | Ga0105246_10064135 | Ga0105246_100641351 | 126 |
| 503 | 3300011119 | Ga0105246_10405929 | Ga0105246_104059292 | 126 |
| 504 | 3300011119 | Ga0105246_10878482 | Ga0105246_108784821 | 126 |
| 505 | 3300013100 | Ga0157373_10018995 | Ga0157373_100189953 | 126 |
| 506 | 3300013100 | Ga0157373_10032880 | Ga0157373_100328803 | 126 |
| 507 | 3300013100 | Ga0157373_10606467 | Ga0157373_106064671 | 126 |
| 508 | 3300013102 | Ga0157371_10031483 | Ga0157371_100314834 | 126 |
| 509 | 3300013102 | Ga0157371_10046246 | Ga0157371_100462463 | 126 |
| 510 | 3300013102 | Ga0157371_10415417 | Ga0157371_104154172 | 126 |
| 511 | 3300013104 | Ga0157370_10202462 | Ga0157370_102024623 | 126 |
| 512 | 3300013104 | Ga0157370_10495032 | Ga0157370_104950322 | 126 |
| 513 | 3300013104 | Ga0157370_10595196 | Ga0157370_105951961 | 126 |
| 514 | 3300013104 | Ga0157370_10917435 | Ga0157370_109174351 | 126 |
| 515 | 3300013105 | Ga0157369_10203150 | Ga0157369_102031503 | 126 |
| 516 | 3300013105 | Ga0157369_11014679 | Ga0157369_110146791 | 126 |
| 517 | 3300013296 | Ga0157374_10040035 | Ga0157374_100400353 | 126 |
| 518 | 3300013296 | Ga0157374_10066087 | Ga0157374_100660873 | 126 |
| 519 | 3300013296 | Ga0157374_10075500 | Ga0157374_100755002 | 126 |
| 520 | 3300013296 | Ga0157374_10290082 | Ga0157374_102900822 | 126 |
| 521 | 3300013296 | Ga0157374_10578079 | Ga0157374_105780792 | 126 |
| 522 | 3300013296 | Ga0157374_11113166 | Ga0157374_111131662 | 126 |
| 523 | 3300013297 | Ga0157378_10020420 | Ga0157378_100204202 | 126 |
| 524 | 3300013297 | Ga0157378_10228960 | Ga0157378_102289602 | 126 |
| 525 | 3300013297 | Ga0157378_10379531 | Ga0157378_103795312 | 126 |
| 526 | 3300013297 | Ga0157378_11176322 | Ga0157378_111763221 | 126 |
| 527 | 3300013297 | Ga0157378_11265117 | Ga0157378_112651172 | 126 |
| 528 | 3300013306 | Ga0163162_10000226 | Ga0163162_1000022616 | 126 |
| 529 | 3300013306 | Ga0163162_10000576 | Ga0163162_1000057615 | 126 |
| 530 | 3300013306 | Ga0163162_10088452 | Ga0163162_100884522 | 126 |
| 531 | 3300013306 | Ga0163162_10090364 | Ga0163162_100903643 | 126 |
| 532 | 3300013306 | Ga0163162_10135776 | Ga0163162_101357763 | 126 |
| 533 | 3300013306 | Ga0163162_12597625 | Ga0163162_125976252 | 126 |
| 534 | 3300013307 | Ga0157372_10004144 | Ga0157372_1000414412 | 126 |
| 535 | 3300013307 | Ga0157372_10034745 | Ga0157372_100347453 | 126 |
| 536 | 3300013307 | Ga0157372_10132899 | Ga0157372_101328993 | 126 |
| 537 | 3300013307 | Ga0157372_10359916 | Ga0157372_103599162 | 126 |
| 538 | 3300013307 | Ga0157372_10505059 | Ga0157372_105050592 | 126 |
| 539 | 3300013307 | Ga0157372_10577543 | Ga0157372_105775431 | 126 |
| 540 | 3300013307 | Ga0157372_10717693 | Ga0157372_107176932 | 126 |
| 541 | 3300013307 | Ga0157372_10872351 | Ga0157372_108723512 | 126 |
| 542 | 3300013307 | Ga0157372_10952936 | Ga0157372_109529362 | 126 |
| 543 | 3300013307 | Ga0157372_11121395 | Ga0157372_111213952 | 126 |
| 544 | 3300013307 | Ga0157372_11207167 | Ga0157372_112071672 | 126 |
| 545 | 3300013307 | Ga0157372_11239851 | Ga0157372_112398512 | 126 |
| 546 | 3300013307 | Ga0157372_11370375 | Ga0157372_113703752 | 126 |
| 547 | 3300013307 | Ga0157372_13173433 | Ga0157372_131734332 | 126 |
| 548 | 3300013308 | Ga0157375_10171047 | Ga0157375_101710472 | 126 |
| 549 | 3300013308 | Ga0157375_10257339 | Ga0157375_102573393 | 126 |
| 550 | 3300013308 | Ga0157375_11279207 | Ga0157375_112792072 | 126 |
| 551 | 3300013308 | Ga0157375_11930254 | Ga0157375_119302541 | 126 |
| 552 | 3300013308 | Ga0157375_13287868 | Ga0157375_132878681 | 126 |
| 553 | 3300014325 | Ga0163163_10003449 | Ga0163163_100034495 | 126 |
| 554 | 3300014325 | Ga0163163_10012983 | Ga0163163_100129835 | 126 |
| 555 | 3300014325 | Ga0163163_10191440 | Ga0163163_101914402 | 126 |
| 556 | 3300014325 | Ga0163163_10601722 | Ga0163163_106017221 | 126 |
| 557 | 3300014326 | Ga0157380_10006616 | Ga0157380_100066163 | 126 |
| 558 | 3300014326 | Ga0157380_10417482 | Ga0157380_104174822 | 126 |
| 559 | 3300014326 | Ga0157380_10522069 | Ga0157380_105220691 | 126 |
| 560 | 3300014326 | Ga0157380_11733959 | Ga0157380_117339591 | 126 |
| 561 | 3300014745 | Ga0157377_10018280 | Ga0157377_100182803 | 126 |
| 562 | 3300014745 | Ga0157377_10095644 | Ga0157377_100956444 | 126 |
| 563 | 3300014745 | Ga0157377_11560770 | Ga0157377_115607702 | 126 |
| 564 | 3300014968 | Ga0157379_10064911 | Ga0157379_100649113 | 126 |
| 565 | 3300014968 | Ga0157379_10128633 | Ga0157379_101286332 | 126 |
| 566 | 3300014968 | Ga0157379_10241953 | Ga0157379_102419533 | 126 |
| 567 | 3300014969 | Ga0157376_10006924 | Ga0157376_100069245 | 126 |
| 568 | 3300014969 | Ga0157376_10101097 | Ga0157376_101010972 | 126 |
| 569 | 3300014969 | Ga0157376_10148730 | Ga0157376_101487302 | 126 |
| 570 | 3300014969 | Ga0157376_10176198 | Ga0157376_101761982 | 126 |
| 571 | 3300014969 | Ga0157376_10898120 | Ga0157376_108981202 | 126 |
| 572 | 3300015262 | Ga0182007_10267661 | Ga0182007_102676612 | 126 |
| 573 | 3300017792 | Ga0163161_10135966 | Ga0163161_101359662 | 126 |
| 574 | 3300020070 | Ga0206356_10707627 | Ga0206356_107076271 | 126 |
| 575 | 3300025242 | Ga0209258_107471 | Ga0209258_1074712 | 126 |
| 576 | 3300025246 | Ga0209646_1001328 | Ga0209646_10013283 | 126 |
| 577 | 3300025315 | Ga0207697_10037663 | Ga0207697_100376631 | 126 |
| 578 | 3300025321 | Ga0207656_10228301 | Ga0207656_102283012 | 126 |
| 579 | 3300025321 | Ga0207656_10346764 | Ga0207656_103467641 | 126 |
| 580 | 3300025321 | Ga0207656_10363256 | Ga0207656_103632562 | 126 |
| 581 | 3300025321 | Ga0207656_10478494 | Ga0207656_104784941 | 126 |
| 582 | 3300025893 | Ga0207682_10052614 | Ga0207682_100526142 | 126 |
| 583 | 3300025893 | Ga0207682_10468252 | Ga0207682_104682521 | 126 |
| 584 | 3300025899 | Ga0207642_10050953 | Ga0207642_100509532 | 126 |
| 585 | 3300025899 | Ga0207642_10203548 | Ga0207642_102035482 | 126 |
| 586 | 3300025899 | Ga0207642_10920230 | Ga0207642_109202301 | 126 |
| 587 | 3300025900 | Ga0207710_10030398 | Ga0207710_100303982 | 126 |
| 588 | 3300025901 | Ga0207688_10022289 | Ga0207688_100222892 | 126 |
| 589 | 3300025903 | Ga0207680_10000015 | Ga0207680_1000001583 | 126 |
| 590 | 3300025903 | Ga0207680_10009136 | Ga0207680_100091363 | 126 |
| 591 | 3300025903 | Ga0207680_10029384 | Ga0207680_100293845 | 126 |
| 592 | 3300025904 | Ga0207647_10000061 | Ga0207647_1000006149 | 126 |
| 593 | 3300025904 | Ga0207647_10059317 | Ga0207647_100593172 | 126 |
| 594 | 3300025904 | Ga0207647_10206732 | Ga0207647_102067322 | 126 |
| 595 | 3300025907 | Ga0207645_10000136 | Ga0207645_1000013630 | 126 |
| 596 | 3300025907 | Ga0207645_10454611 | Ga0207645_104546112 | 126 |
| 597 | 3300025907 | Ga0207645_10660936 | Ga0207645_106609362 | 126 |
| 598 | 3300025908 | Ga0207643_10071381 | Ga0207643_100713813 | 126 |
| 599 | 3300025908 | Ga0207643_10540481 | Ga0207643_105404811 | 126 |
| 600 | 3300025908 | Ga0207643_10552579 | Ga0207643_105525791 | 126 |
| 601 | 3300025908 | Ga0207643_10878620 | Ga0207643_108786201 | 126 |
| 602 | 3300025909 | Ga0207705_10272093 | Ga0207705_102720932 | 126 |
| 603 | 3300025909 | Ga0207705_10584278 | Ga0207705_105842781 | 126 |
| 604 | 3300025909 | Ga0207705_10833618 | Ga0207705_108336182 | 126 |
| 605 | 3300025911 | Ga0207654_10020022 | Ga0207654_100200223 | 126 |
| 606 | 3300025911 | Ga0207654_10074849 | Ga0207654_100748492 | 126 |
| 607 | 3300025911 | Ga0207654_10089265 | Ga0207654_100892651 | 126 |
| 608 | 3300025912 | Ga0207707_10422418 | Ga0207707_104224181 | 126 |
| 609 | 3300025914 | Ga0207671_10001528 | Ga0207671_1000152816 | 126 |
| 610 | 3300025914 | Ga0207671_10005708 | Ga0207671_100057089 | 126 |
| 611 | 3300025914 | Ga0207671_10075947 | Ga0207671_100759472 | 126 |
| 612 | 3300025919 | Ga0207657_10160448 | Ga0207657_101604483 | 126 |
| 613 | 3300025919 | Ga0207657_10914942 | Ga0207657_109149421 | 126 |
| 614 | 3300025920 | Ga0207649_10009396 | Ga0207649_100093963 | 126 |
| 615 | 3300025920 | Ga0207649_10316633 | Ga0207649_103166332 | 126 |
| 616 | 3300025920 | Ga0207649_10325496 | Ga0207649_103254963 | 126 |
| 617 | 3300025920 | Ga0207649_11396008 | Ga0207649_113960081 | 126 |
| 618 | 3300025923 | Ga0207681_10099843 | Ga0207681_100998432 | 126 |
| 619 | 3300025923 | Ga0207681_10736600 | Ga0207681_107366002 | 126 |
| 620 | 3300025923 | Ga0207681_11190182 | Ga0207681_111901821 | 126 |
| 621 | 3300025924 | Ga0207694_10045967 | Ga0207694_100459673 | 126 |
| 622 | 3300025925 | Ga0207650_10038566 | Ga0207650_100385662 | 126 |
| 623 | 3300025925 | Ga0207650_10071435 | Ga0207650_100714353 | 126 |
| 624 | 3300025925 | Ga0207650_10203430 | Ga0207650_102034302 | 126 |
| 625 | 3300025925 | Ga0207650_10612196 | Ga0207650_106121962 | 126 |
| 626 | 3300025925 | Ga0207650_11107726 | Ga0207650_111077261 | 126 |
| 627 | 3300025926 | Ga0207659_10008757 | Ga0207659_100087572 | 126 |
| 628 | 3300025926 | Ga0207659_10116399 | Ga0207659_101163993 | 126 |
| 629 | 3300025926 | Ga0207659_10272795 | Ga0207659_102727952 | 126 |
| 630 | 3300025931 | Ga0207644_10151465 | Ga0207644_101514652 | 126 |
| 631 | 3300025932 | Ga0207690_10011054 | Ga0207690_100110545 | 126 |
| 632 | 3300025933 | Ga0207706_10074924 | Ga0207706_100749243 | 126 |
| 633 | 3300025934 | Ga0207686_10174675 | Ga0207686_101746752 | 126 |
| 634 | 3300025934 | Ga0207686_10177655 | Ga0207686_101776551 | 126 |
| 635 | 3300025934 | Ga0207686_10924259 | Ga0207686_109242591 | 126 |
| 636 | 3300025937 | Ga0207669_10075623 | Ga0207669_100756233 | 126 |
| 637 | 3300025937 | Ga0207669_10189217 | Ga0207669_101892173 | 126 |
| 638 | 3300025940 | Ga0207691_10051301 | Ga0207691_100513013 | 126 |
| 639 | 3300025940 | Ga0207691_10432383 | Ga0207691_104323832 | 126 |
| 640 | 3300025940 | Ga0207691_10512499 | Ga0207691_105124992 | 126 |
| 641 | 3300025940 | Ga0207691_10546586 | Ga0207691_105465862 | 126 |
| 642 | 3300025940 | Ga0207691_10888830 | Ga0207691_108888301 | 126 |
| 643 | 3300025942 | Ga0207689_10001007 | Ga0207689_1000100718 | 126 |
| 644 | 3300025942 | Ga0207689_11353302 | Ga0207689_113533022 | 126 |
| 645 | 3300025944 | Ga0207661_10108637 | Ga0207661_101086372 | 126 |
| 646 | 3300025944 | Ga0207661_11609000 | Ga0207661_116090001 | 126 |
| 647 | 3300025945 | Ga0207679_10418597 | Ga0207679_104185972 | 126 |
| 648 | 3300025945 | Ga0207679_10812858 | Ga0207679_108128581 | 126 |
| 649 | 3300025949 | Ga0207667_10100362 | Ga0207667_101003624 | 126 |
| 650 | 3300025960 | Ga0207651_10356230 | Ga0207651_103562303 | 126 |
| 651 | 3300025960 | Ga0207651_10434882 | Ga0207651_104348822 | 126 |
| 652 | 3300025961 | Ga0207712_10186708 | Ga0207712_101867082 | 126 |
| 653 | 3300025972 | Ga0207668_10011982 | Ga0207668_100119826 | 126 |
| 654 | 3300025972 | Ga0207668_10256430 | Ga0207668_102564302 | 126 |
| 655 | 3300025981 | Ga0207640_10074654 | Ga0207640_100746542 | 126 |
| 656 | 3300025981 | Ga0207640_10651517 | Ga0207640_106515172 | 126 |
| 657 | 3300025981 | Ga0207640_11374742 | Ga0207640_113747421 | 126 |
| 658 | 3300025981 | Ga0207640_11540617 | Ga0207640_115406172 | 126 |
| 659 | 3300025981 | Ga0207640_12143983 | Ga0207640_121439831 | 126 |
| 660 | 3300025986 | Ga0207658_10054580 | Ga0207658_100545802 | 126 |
| 661 | 3300025986 | Ga0207658_10104039 | Ga0207658_101040393 | 126 |
| 662 | 3300025986 | Ga0207658_10471208 | Ga0207658_104712082 | 126 |
| 663 | 3300025986 | Ga0207658_10496302 | Ga0207658_104963022 | 126 |
| 664 | 3300026023 | Ga0207677_10005974 | Ga0207677_100059748 | 126 |
| 665 | 3300026023 | Ga0207677_10778385 | Ga0207677_107783852 | 126 |
| 666 | 3300026023 | Ga0207677_11480551 | Ga0207677_114805512 | 126 |
| 667 | 3300026035 | Ga0207703_10007227 | Ga0207703_100072277 | 126 |
| 668 | 3300026035 | Ga0207703_10546858 | Ga0207703_105468582 | 126 |
| 669 | 3300026041 | Ga0207639_10012815 | Ga0207639_100128155 | 126 |
| 670 | 3300026041 | Ga0207639_10030223 | Ga0207639_100302234 | 126 |
| 671 | 3300026041 | Ga0207639_10094529 | Ga0207639_100945292 | 126 |
| 672 | 3300026041 | Ga0207639_10217142 | Ga0207639_102171422 | 126 |
| 673 | 3300026041 | Ga0207639_10386592 | Ga0207639_103865922 | 126 |
| 674 | 3300026041 | Ga0207639_10596252 | Ga0207639_105962523 | 126 |
| 675 | 3300026041 | Ga0207639_11190964 | Ga0207639_111909641 | 126 |
| 676 | 3300026041 | Ga0207639_11465351 | Ga0207639_114653511 | 126 |
| 677 | 3300026075 | Ga0207708_11176236 | Ga0207708_111762361 | 126 |
| 678 | 3300026075 | Ga0207708_11257629 | Ga0207708_112576291 | 126 |
| 679 | 3300026078 | Ga0207702_10054227 | Ga0207702_100542273 | 126 |
| 680 | 3300026078 | Ga0207702_10975490 | Ga0207702_109754901 | 126 |
| 681 | 3300026078 | Ga0207702_11499653 | Ga0207702_114996532 | 126 |
| 682 | 3300026088 | Ga0207641_10000056 | Ga0207641_1000005683 | 126 |
| 683 | 3300026088 | Ga0207641_10080565 | Ga0207641_100805653 | 126 |
| 684 | 3300026088 | Ga0207641_10335652 | Ga0207641_103356522 | 126 |
| 685 | 3300026089 | Ga0207648_10004655 | Ga0207648_1000465510 | 126 |
| 686 | 3300026089 | Ga0207648_10016945 | Ga0207648_100169457 | 126 |
| 687 | 3300026089 | Ga0207648_10094532 | Ga0207648_100945323 | 126 |
| 688 | 3300026089 | Ga0207648_10347861 | Ga0207648_103478612 | 126 |
| 689 | 3300026089 | Ga0207648_11148431 | Ga0207648_111484312 | 126 |
| 690 | 3300026095 | Ga0207676_10024265 | Ga0207676_100242652 | 126 |
| 691 | 3300026095 | Ga0207676_10362899 | Ga0207676_103628992 | 126 |
| 692 | 3300026095 | Ga0207676_11158063 | Ga0207676_111580632 | 126 |
| 693 | 3300026116 | Ga0207674_10189753 | Ga0207674_101897532 | 126 |
| 694 | 3300026116 | Ga0207674_10223695 | Ga0207674_102236953 | 126 |
| 695 | 3300026116 | Ga0207674_10327433 | Ga0207674_103274333 | 126 |
| 696 | 3300026116 | Ga0207674_10367947 | Ga0207674_103679472 | 126 |
| 697 | 3300026116 | Ga0207674_11896687 | Ga0207674_118966871 | 126 |
| 698 | 3300026118 | Ga0207675_100021679 | Ga0207675_1000216794 | 126 |
| 699 | 3300026118 | Ga0207675_100044754 | Ga0207675_1000447544 | 126 |
| 700 | 3300026118 | Ga0207675_100944893 | Ga0207675_1009448932 | 126 |
| 701 | 3300026118 | Ga0207675_101838666 | Ga0207675_1018386661 | 126 |
| 702 | 3300026121 | Ga0207683_10002007 | Ga0207683_1000200711 | 126 |
| 703 | 3300026121 | Ga0207683_10007862 | Ga0207683_100078624 | 126 |
| 704 | 3300026121 | Ga0207683_10328787 | Ga0207683_103287872 | 126 |
| 705 | 3300026142 | Ga0207698_10014929 | Ga0207698_100149294 | 126 |
| 706 | 3300026142 | Ga0207698_10118309 | Ga0207698_101183092 | 126 |
| 707 | 3300026142 | Ga0207698_10278731 | Ga0207698_102787311 | 126 |
| 708 | 3300026142 | Ga0207698_10694245 | Ga0207698_106942452 | 126 |
| 709 | 3300026142 | Ga0207698_12250113 | Ga0207698_122501131 | 126 |
| 710 | 3300027360 | Ga0209969_1014467 | Ga0209969_10144672 | 126 |
| 711 | 3300027543 | Ga0209999_1073538 | Ga0209999_10735381 | 126 |
| 712 | 3300028379 | Ga0268266_10407981 | Ga0268266_104079812 | 126 |
| 713 | 3300028379 | Ga0268266_10531162 | Ga0268266_105311622 | 126 |
| 714 | 3300028380 | Ga0268265_10111456 | Ga0268265_101114562 | 126 |
| 715 | 3300028380 | Ga0268265_10181166 | Ga0268265_101811662 | 126 |
| 716 | 3300028380 | Ga0268265_10359237 | Ga0268265_103592372 | 126 |
| 717 | 3300028380 | Ga0268265_11590769 | Ga0268265_115907691 | 126 |
| 718 | 3300028381 | Ga0268264_10000143 | Ga0268264_10000143123 | 126 |
| 719 | 3300028381 | Ga0268264_10001996 | Ga0268264_1000199619 | 126 |
| 720 | 3300028381 | Ga0268264_10006748 | Ga0268264_100067486 | 126 |
| 721 | 3300028381 | Ga0268264_10102001 | Ga0268264_101020012 | 126 |
| 722 | 3300028381 | Ga0268264_10252306 | Ga0268264_102523062 | 126 |
| 723 | 3300028381 | Ga0268264_10703411 | Ga0268264_107034111 | 126 |
| 724 | 3300028786 | Ga0307517_10012359 | Ga0307517_100123596 | 126 |
| 725 | 3300028786 | Ga0307517_10537432 | Ga0307517_105374321 | 126 |
| 726 | 3300028794 | Ga0307515_10000010 | Ga0307515_10000010125 | 126 |
| 727 | 3300028794 | Ga0307515_10828988 | Ga0307515_108289881 | 126 |
| 728 | 3300031507 | Ga0307509_10064977 | Ga0307509_100649773 | 126 |
| 729 | 3300031507 | Ga0307509_10073156 | Ga0307509_100731561 | 126 |
| 730 | 3300031548 | Ga0307408_100852758 | Ga0307408_1008527581 | 126 |
| 731 | 3300031595 | Ga0265313_10097472 | Ga0265313_100974722 | 126 |
| 732 | 3300031616 | Ga0307508_10005346 | Ga0307508_100053469 | 126 |
| 733 | 3300031616 | Ga0307508_10409235 | Ga0307508_104092352 | 126 |
| 734 | 3300031730 | Ga0307516_10000310 | Ga0307516_1000031035 | 126 |
| 735 | 3300031730 | Ga0307516_10091390 | Ga0307516_100913903 | 126 |
| 736 | 3300031731 | Ga0307405_11532758 | Ga0307405_115327581 | 126 |
| 737 | 3300031824 | Ga0307413_10114910 | Ga0307413_101149103 | 126 |
| 738 | 3300031824 | Ga0307413_10160978 | Ga0307413_101609783 | 126 |
| 739 | 3300031824 | Ga0307413_11311686 | Ga0307413_113116861 | 126 |
| 740 | 3300031852 | Ga0307410_10135676 | Ga0307410_101356762 | 126 |
| 741 | 3300031852 | Ga0307410_10394426 | Ga0307410_103944262 | 126 |
| 742 | 3300031901 | Ga0307406_10457528 | Ga0307406_104575282 | 126 |
| 743 | 3300031901 | Ga0307406_10801726 | Ga0307406_108017262 | 126 |
| 744 | 3300031903 | Ga0307407_11354767 | Ga0307407_113547671 | 126 |
| 745 | 3300031903 | Ga0307407_11694403 | Ga0307407_116944032 | 126 |
| 746 | 3300031911 | Ga0307412_10261514 | Ga0307412_102615141 | 126 |
| 747 | 3300031911 | Ga0307412_10694157 | Ga0307412_106941572 | 126 |
| 748 | 3300032002 | Ga0307416_100824398 | Ga0307416_1008243982 | 126 |
| 749 | 3300032002 | Ga0307416_102050624 | Ga0307416_1020506241 | 126 |
| 750 | 3300032002 | Ga0307416_102554959 | Ga0307416_1025549591 | 126 |
| 751 | 3300032004 | Ga0307414_10017473 | Ga0307414_100174732 | 126 |
| 752 | 3300032004 | Ga0307414_10040797 | Ga0307414_100407973 | 126 |
| 753 | 3300032004 | Ga0307414_10109465 | Ga0307414_101094653 | 126 |
| 754 | 3300032004 | Ga0307414_11434493 | Ga0307414_114344932 | 126 |
| 755 | 3300032005 | Ga0307411_10108887 | Ga0307411_101088873 | 126 |
| 756 | 3300032126 | Ga0307415_100564415 | Ga0307415_1005644152 | 126 |
| 757 | 3300032126 | Ga0307415_102473008 | Ga0307415_1024730082 | 126 |
| 758 | 3300035112 | Ga0373932_0192779 | Ga0373932_0192779_146_526 | 126 |
| 759 | 3300035116 | Ga0373945_0242304 | Ga0373945_0242304_338_718 | 126 |
| 760 | 3300037418 | Ga0395900_0110793 | Ga0395900_0110793_1207_1587 | 126 |
| 761 | 3300037418 | Ga0395900_0188108 | Ga0395900_0188108_903_1283 | 126 |
| 762 | 3300037466 | Ga0395898_0070019 | Ga0395898_0070019_155_535 | 126 |
| 763 | 3300037471 | Ga0395905_0001345 | Ga0395905_0001345_126_506 | 126 |
| 764 | 3300037471 | Ga0395905_0136116 | Ga0395905_0136116_1345_1725 | 126 |
| 765 | 3300037471 | Ga0395905_0179884 | Ga0395905_0179884_1401_1781 | 126 |
| 766 | 3300037471 | Ga0395905_1287078 | Ga0395905_1287078_134_514 | 126 |
| 767 | 3300038443 | Ga0395901_0244126 | Ga0395901_0244126_586_966 | 126 |
| 768 | 3300039450 | Ga0436363_0872388 | Ga0436363_0872388_77_457 | 126 |
| 769 | 3300041404 | Ga0439436_0002743 | Ga0439436_0002743_4738_5118 | 126 |
| 770 | 3300041406 | Ga0439439_0077696 | Ga0439439_0077696_403_783 | 126 |
| 771 | 3300041406 | Ga0439439_0183551 | Ga0439439_0183551_148_528 | 126 |
| 772 | 3300041410 | Ga0439461_0137082 | Ga0439461_0137082_202_585 | 126 |
| 773 | 3300041441 | Ga0451787_785918 | Ga0451787_785918_180_563 | 126 |
| 774 | 3300041446 | Ga0451794_27472 | Ga0451794_27472_22_405 | 126 |
| 775 | 3300041451 | Ga0451791_0399799 | Ga0451791_0399799_134_517 | 126 |
| 776 | 3300041451 | Ga0451791_1208094 | Ga0451791_1208094_109_489 | 126 |
| 777 | 3300041452 | Ga0451793_1587185 | Ga0451793_1587185_93_473 | 126 |
| 778 | 3300041453 | Ga0451797_1588628 | Ga0451797_1588628_248_631 | 126 |
| 779 | 3300041456 | Ga0451795_1448333 | Ga0451795_1448333_85_465 | 126 |
| 780 | 3300041456 | Ga0451795_1559977 | Ga0451795_1559977_1453_1836 | 126 |
| 781 | 3300041459 | Ga0451800_0588693 | Ga0451800_0588693_32_415 | 126 |
| 782 | 3300041460 | Ga0451802_1731334 | Ga0451802_1731334_806_1189 | 126 |
| 783 | 3300041492 | Ga0451835_0789270 | Ga0451835_0789270_82_465 | 126 |
| 784 | 3300041494 | Ga0451837_0197040 | Ga0451837_0197040_127_507 | 126 |
| 785 | 3300041498 | Ga0451841_0599628 | Ga0451841_0599628_142_525 | 126 |
| 786 | 3300041507 | Ga0451851_0687021 | Ga0451851_0687021_917_1300 | 126 |
| 787 | 3300041509 | Ga0451843_1199062 | Ga0451843_1199062_109_489 | 126 |
| 788 | 3300041512 | Ga0451853_3623145 | Ga0451853_3623145_22_405 | 126 |
| 789 | 3300041997 | Ga0439431_0242308 | Ga0439431_0242308_137_517 | 126 |
| 790 | 3300042004 | Ga0439445_0156231 | Ga0439445_0156231_258_641 | 126 |
| 791 | 3300042007 | Ga0439449_0031986 | Ga0439449_0031986_485_865 | 126 |
| 792 | 3300042014 | Ga0439457_002182 | Ga0439457_002182_4855_5235 | 126 |
| 793 | 3300042015 | Ga0439462_0001485 | Ga0439462_0001485_4431_4811 | 126 |
| 794 | 3300042124 | Ga0450922_002074 | Ga0450922_002074_1332_1712 | 126 |
| 795 | 3300042125 | Ga0450923_031380 | Ga0450923_031380_171_551 | 126 |
| 796 | 3300042129 | Ga0450891_013892 | Ga0450891_013892_161_541 | 126 |
| 797 | 3300042156 | Ga0439446_0021043 | Ga0439446_0021043_912_1295 | 126 |
| 798 | 3300042876 | Ga0451577_0993182 | Ga0451577_0993182_261_641 | 126 |
| 799 | 3300044656 | Ga0466969_0000382 | Ga0466969_0000382_5955_6335 | 126 |
| 800 | 3300044658 | Ga0466972_0000010 | Ga0466972_0000010_67713_68165 | 126 |
| 801 | 3300044658 | Ga0466972_0032803 | Ga0466972_0032803_1482_1862 | 126 |
| 802 | 3300044673 | Ga0453683_0039267 | Ga0453683_0039267_1110_1490 | 126 |
| 803 | 3300044683 | Ga0466965_0159272 | Ga0466965_0159272_337_717 | 126 |
| 804 | 3300044684 | Ga0466966_0000176 | Ga0466966_0000176_325_705 | 126 |
| 805 | 3300044693 | Ga0466961_0051907 | Ga0466961_0051907_1305_1685 | 126 |
| 806 | 3300044693 | Ga0466961_0908939 | Ga0466961_0908939_46_426 | 126 |
| 807 | 3300044706 | Ga0466964_0016312 | Ga0466964_0016312_1439_1819 | 126 |
| 808 | 3300044712 | Ga0453684_0023172 | Ga0453684_0023172_3080_3460 | 126 |
| 809 | 3300044719 | Ga0466971_0066558 | Ga0466971_0066558_1140_1520 | 126 |
| 810 | 3300044719 | Ga0466971_0140109 | Ga0466971_0140109_112_492 | 126 |
| 811 | 3300044719 | Ga0466971_0466661 | Ga0466971_0466661_53_433 | 126 |
| 812 | 3300044735 | Ga0466968_0192757 | Ga0466968_0192757_492_872 | 126 |
| 813 | 3300044842 | Ga0466957_0000577 | Ga0466957_0000577_13120_13500 | 126 |
| 814 | 3300045049 | Ga0466959_0000016 | Ga0466959_0000016_48835_49215 | 126 |
| 815 | 3300045051 | Ga0451576_1131007 | Ga0451576_1131007_285_665 | 126 |
| 816 | 3300045976 | Ga0466967_2572569 | Ga0466967_2572569_15_395 | 126 |
| 817 | 3300046460 | Ga0495638_0010167 | Ga0495638_0010167_931_1314 | 126 |
| 818 | 3300046460 | Ga0495638_0291223 | Ga0495638_0291223_450_830 | 126 |
| 819 | 3300046471 | Ga0495650_0047770 | Ga0495650_0047770_1221_1601 | 126 |
| 820 | 3300046519 | Ga0495632_0230222 | Ga0495632_0230222_193_576 | 126 |
| 821 | 3300046539 | Ga0495621_0269283 | Ga0495621_0269283_228_608 | 126 |
| 822 | 3300046616 | Ga0495668_0000212 | Ga0495668_0000212_4847_5227 | 126 |
| 823 | 3300046616 | Ga0495668_0002317 | Ga0495668_0002317_10701_11084 | 126 |
| 824 | 3300046660 | Ga0495625_0087620 | Ga0495625_0087620_1248_1628 | 126 |
| 825 | 3300047320 | Ga0495672_0013561 | Ga0495672_0013561_5127_5507 | 126 |
| 826 | 3300047320 | Ga0495672_0028834 | Ga0495672_0028834_884_1264 | 126 |
| 827 | 3300047320 | Ga0495672_0106175 | Ga0495672_0106175_68_448 | 126 |
| 828 | 3300047443 | Ga0495687_061674 | Ga0495687_061674_905_1285 | 126 |
| 829 | 3300048911 | Ga0496108_0172689 | Ga0496108_0172689_1090_1470 | 126 |
| 830 | 3300048911 | Ga0496108_1293232 | Ga0496108_1293232_48_428 | 126 |
| 831 | 3300048912 | Ga0496109_0420713 | Ga0496109_0420713_841_1221 | 126 |
| 832 | 3300048915 | Ga0496112_1587198 | Ga0496112_1587198_36_416 | 126 |
| 833 | 3300048927 | Ga0496124_0043266 | Ga0496124_0043266_1574_1957 | 126 |
| 834 | 3300049132 | Ga0501343_024351 | Ga0501343_024351_154_534 | 126 |
| 835 | 3300049515 | Ga0501292_014129 | Ga0501292_014129_481_864 | 126 |
| 836 | 3300049552 | Ga0501336_031623 | Ga0501336_031623_132_512 | 126 |
| 837 | 3300049571 | Ga0501034_0001387 | Ga0501034_0001387_3869_4249 | 126 |
| 838 | 3300049574 | Ga0501038_0899795 | Ga0501038_0899795_81_461 | 126 |
| 839 | 3300049579 | Ga0501043_0066157 | Ga0501043_0066157_2411_2791 | 126 |
| 840 | 3300049652 | Ga0501202_002207 | Ga0501202_002207_1771_2154 | 126 |
| 841 | 3300049654 | Ga0501207_014739 | Ga0501207_014739_152_535 | 126 |
| 842 | 3300049661 | Ga0501217_000585 | Ga0501217_000585_909_1292 | 126 |
| 843 | 3300049661 | Ga0501217_105623 | Ga0501217_105623_351_734 | 126 |
| 844 | 3300049663 | Ga0501223_016328 | Ga0501223_016328_935_1318 | 126 |
| 845 | 3300049663 | Ga0501223_072954 | Ga0501223_072954_233_616 | 126 |
| 846 | 3300049664 | Ga0501224_047312 | Ga0501224_047312_122_505 | 126 |
| 847 | 3300049668 | Ga0501233_083594 | Ga0501233_083594_141_524 | 126 |
| 848 | 3300049669 | Ga0501235_011635 | Ga0501235_011635_378_761 | 126 |
| 849 | 3300049675 | Ga0501243_000796 | Ga0501243_000796_2052_2435 | 126 |
| 850 | 3300049679 | Ga0501249_175136 | Ga0501249_175136_150_530 | 126 |
| 851 | 3300049682 | Ga0501252_004199 | Ga0501252_004199_883_1263 | 126 |
| 852 | 3300049686 | Ga0501257_130663 | Ga0501257_130663_271_654 | 126 |
| 853 | 3300049688 | Ga0501259_002156 | Ga0501259_002156_983_1363 | 126 |
| 854 | 3300049688 | Ga0501259_049588 | Ga0501259_049588_266_649 | 126 |
| 855 | 3300049688 | Ga0501259_149958 | Ga0501259_149958_153_536 | 126 |
| 856 | 3300049704 | Ga0501221_000606 | Ga0501221_000606_3468_3851 | 126 |
| 857 | 3300049704 | Ga0501221_133229 | Ga0501221_133229_201_581 | 126 |
| 858 | 3300049705 | Ga0501225_0000561 | Ga0501225_0000561_6002_6385 | 126 |
| 859 | 3300049707 | Ga0501234_003922 | Ga0501234_003922_16_399 | 126 |
| 860 | 3300049708 | Ga0501245_000123 | Ga0501245_000123_965_1348 | 126 |
| 861 | 3300049763 | Ga0501266_059389 | Ga0501266_059389_136_519 | 126 |
| 862 | 3300049763 | Ga0501266_094946 | Ga0501266_094946_34_417 | 126 |
| 863 | 3300049776 | Ga0501280_008373 | Ga0501280_008373_126_509 | 126 |
| 864 | 3300049822 | Ga0501035_0394525 | Ga0501035_0394525_62_442 | 126 |
| 865 | 3300049823 | Ga0501044_0128850 | Ga0501044_0128850_1501_1881 | 126 |
| 866 | 3300049823 | Ga0501044_0633886 | Ga0501044_0633886_551_931 | 126 |
| 867 | 3300050493 | nmdc:mga0k408_145923_c1 | nmdc:mga0k408_145923_c1_291_671 | 126 |
| 868 | 3300050493 | nmdc:mga0k408_164532_c1 | nmdc:mga0k408_164532_c1_153_533 | 126 |
| 869 | 3300050493 | nmdc:mga0k408_682342_c1 | nmdc:mga0k408_682342_c1_52_432 | 126 |
| 870 | 3300050507 | nmdc:mga05p37_914_c1 | nmdc:mga05p37_914_c1_13349_13729 | 126 |
| 871 | 3300050508 | nmdc:mga09592_20986_c1 | nmdc:mga09592_20986_c1_1862_2242 | 126 |
| 872 | 3300050510 | nmdc:mga06r32_443171_c1 | nmdc:mga06r32_443171_c1_283_663 | 126 |
| 873 | 3300050511 | nmdc:mga08y16_292197_c1 | nmdc:mga08y16_292197_c1_1073_1453 | 126 |
| 874 | 3300050511 | nmdc:mga08y16_98820_c1 | nmdc:mga08y16_98820_c1_1209_1589 | 126 |
| 875 | 3300053086 | Ga0500578_0001201 | Ga0500578_0001201_24107_24487 | 126 |
| 876 | 3300053086 | Ga0500578_0335650 | Ga0500578_0335650_473_853 | 126 |
| 877 | 3300053090 | Ga0500646_0002555 | Ga0500646_0002555_1842_2225 | 126 |
| 878 | 3300053090 | Ga0500646_0052662 | Ga0500646_0052662_542_922 | 126 |
| 879 | 3300053092 | Ga0500583_0000037 | Ga0500583_0000037_29478_29861 | 126 |
| 880 | 3300053093 | Ga0500651_0292134 | Ga0500651_0292134_112_495 | 126 |
| 881 | 3300053093 | Ga0500651_0627231 | Ga0500651_0627231_85_465 | 126 |
| 882 | 3300053094 | Ga0500566_0344566 | Ga0500566_0344566_205_585 | 126 |
| 883 | 3300053097 | Ga0500648_412996 | Ga0500648_412996_77_457 | 126 |
| 884 | 3300053098 | Ga0500650_0081223 | Ga0500650_0081223_185_565 | 126 |
| 885 | 3300053099 | Ga0500654_140194 | Ga0500654_140194_238_618 | 126 |
| 886 | 3300053103 | Ga0500555_052757 | Ga0500555_052757_256_636 | 126 |
| 887 | 3300053104 | Ga0500556_0026589 | Ga0500556_0026589_1210_1593 | 126 |
| 888 | 3300053104 | Ga0500556_0321681 | Ga0500556_0321681_180_560 | 126 |
| 889 | 3300053109 | Ga0500569_150109 | Ga0500569_150109_196_579 | 126 |
| 890 | 3300053111 | Ga0500572_149345 | Ga0500572_149345_118_498 | 126 |
| 891 | 3300053130 | Ga0500642_0134766 | Ga0500642_0134766_761_1141 | 126 |
| 892 | 3300053130 | Ga0500642_0149458 | Ga0500642_0149458_418_798 | 126 |
| 893 | 3300053130 | Ga0500642_0409984 | Ga0500642_0409984_45_425 | 126 |
| 894 | 3300053131 | Ga0500652_086593 | Ga0500652_086593_582_965 | 126 |
| 895 | 3300053131 | Ga0500652_116468 | Ga0500652_116468_403_783 | 126 |
| 896 | 3300053134 | Ga0500658_0476512 | Ga0500658_0476512_23_403 | 126 |
| 897 | 3300053136 | Ga0500559_0335764 | Ga0500559_0335764_134_514 | 126 |
| 898 | 3300053139 | Ga0500568_0073147 | Ga0500568_0073147_423_803 | 126 |
| 899 | 3300053139 | Ga0500568_0287510 | Ga0500568_0287510_53_433 | 126 |
| 900 | 3300053144 | Ga0500585_204588 | Ga0500585_204588_167_547 | 126 |
| 901 | 3300053147 | Ga0500589_159099 | Ga0500589_159099_414_794 | 126 |
| 902 | 3300053150 | Ga0500603_025754 | Ga0500603_025754_1000_1380 | 126 |
| 903 | 3300053150 | Ga0500603_163692 | Ga0500603_163692_23_403 | 126 |
| 904 | 3300053151 | Ga0500604_0003061 | Ga0500604_0003061_3845_4228 | 126 |
| 905 | 3300053151 | Ga0500604_0106764 | Ga0500604_0106764_262_642 | 126 |
| 906 | 3300053153 | Ga0500616_0008456 | Ga0500616_0008456_290_670 | 126 |
| 907 | 3300053154 | Ga0500619_065082 | Ga0500619_065082_564_944 | 126 |
| 908 | 3300053156 | Ga0500622_0032820 | Ga0500622_0032820_568_951 | 126 |
| 909 | 3300053156 | Ga0500622_0056323 | Ga0500622_0056323_886_1269 | 126 |
| 910 | 3300053177 | Ga0500636_0058636 | Ga0500636_0058636_1540_1923 | 126 |
| 911 | 3300053727 | Ga0500611_014276 | Ga0500611_014276_717_1100 | 126 |
| 912 | 3300059624 | Ga0587109_120284 | Ga0587109_120284_55_435 | 126 |
| 913 | 3300061719 | Ga0466962_0341871 | Ga0466962_0341871_190_570 | 126 |
| 914 | 3300061719 | Ga0466962_0532944 | Ga0466962_0532944_181_564 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cnw-assembly1.cif.gz_A | three-dimensional structure of the protein xoxi (q81ay6) from bacillus cereus. northeast structural genomics consortium target bcr196. | 0.8305 | 6 | 123 |
| 2m89-assembly1.cif.gz_B | solution structure of the aha1 dimer from colwellia psychrerythraea | 0.8202 | 5 | 121 |
| 6v04-assembly1.cif.gz_A | dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus | 0.815 | 6 | 126 |
| 4n0g-assembly1.cif.gz_C | crystal structure of pyl13-pp2ca complex | 0.7971 | 2 | 122 |
| 4jda-assembly1.cif.gz_B | complex structure of abscisic acid receptor pyl3 with (-)-aba | 0.7889 | 1 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2m89B00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8202 | 5 | 121 | 3.30.530.20 |
| af_Q8T2R4_3_145_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8019 | 5 | 126 | 3.30.530.20 |
| 3f08B00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.787 | 5 | 126 | 3.30.530.20 |
| af_I6X666_8_157_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7778 | 5 | 125 | 3.30.530.20 |
| af_I1LX70_3_186_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7748 | 1 | 122 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3BNH9-F1-model_v4 | SRPBCC domain-containing protein | 0.9465 | 1 | 126 |
|
| AF-A0A7T9FHS6-F1-model_v4 | deleted | 0.9461 | 4 | 125 |
|
| AF-A0A4Q3RXA8-F1-model_v4 | ATPase | 0.9435 | 1 | 126 |
|
| AF-A0A6I5I4F3-F1-model_v4 | SRPBCC domain-containing protein | 0.942 | 4 | 125 |
|
| AF-A0A2E4J8N8-F1-model_v4 | START-like domain-containing protein | 0.9413 | 5 | 126 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar