F485526

General Info

Members Datasets Scaffolds Average Seq Length
913 413 1826 114

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100688636|Ga0068869_1006886362
Length 136
Sequence MEVVRRRMLERRYSRRIPIRLPPMAKYLISFPSAAMVVPEGQLEAVGRDAHAVIDEAKAAGVYVFAGGIDENVPPMLVSADGSVADGGYPWAPRLDGGFTVLELRSREEAVGWAARIAKACRCDQELRVFGFDPQS

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
107 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
108 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
109 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
195 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
199 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
200 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
201 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
202 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
207 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
212 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
220 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
221 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
222 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
225 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
226 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
227 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
230 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
231 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
232 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
237 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
238 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
250 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
251 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
252 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
253 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
254 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
255 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
256 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
257 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
258 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
259 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
260 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
261 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
262 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
263 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
264 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
265 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
266 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
267 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
268 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
269 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
270 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
271 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
274 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
275 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
283 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
284 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
285 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
286 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
287 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
288 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
289 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
292 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
293 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
294 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
295 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
296 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
297 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
298 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
302 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
303 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
304 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
305 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
306 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
307 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
308 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
309 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
310 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
311 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
312 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
313 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
314 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
315 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
316 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
317 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
318 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
319 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
320 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
321 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
322 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
323 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
324 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
325 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
326 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
327 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
328 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
329 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
330 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
331 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
332 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
333 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
334 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
335 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
336 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
337 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
338 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
339 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
340 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
341 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
342 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
343 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
344 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
345 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
346 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
347 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
348 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
349 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
350 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
351 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
352 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
353 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
354 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
355 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
356 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
357 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
358 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
359 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
360 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
361 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
362 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
363 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
364 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
365 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
366 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
367 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
368 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
369 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
370 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
371 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
372 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
373 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
374 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
375 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
376 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
377 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
378 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
383 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
384 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
388 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
389 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
390 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
391 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
398 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
399 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
400 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
401 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
402 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
403 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
404 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
405 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
406 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
407 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
408 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
409 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
410 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
411 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
412 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
413 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.3
Nodule 0
Rhizoplane 4.05
Rhizosphere 92
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100688636 3300005334 Bacteria 871
2 SwRhRL2b_contig_1041543 2162886007 Bacteria 9916
3 ARcpr5oldR_c016840 3300000041 Bacteria 639
4 rootL2_10000415 3300003322 Bacteria 223695
5 Ga0065715_10013988 3300005293 Bacteria 2353
6 Ga0065715_10140931 3300005293 Bacteria 1843
7 Ga0070658_10157300 3300005327 Bacteria 1905
8 Ga0070658_10526545 3300005327 Bacteria 1022
9 Ga0070658_10536424 3300005327 Bacteria 1012
10 Ga0070658_11414876 3300005327 Bacteria 603
11 Ga0070676_10968853 3300005328 Bacteria 637
12 Ga0070683_100123594 3300005329 Bacteria 2446
13 Ga0070683_100146292 3300005329 Bacteria 2239
14 Ga0070683_100235318 3300005329 Bacteria 1742
15 Ga0070683_100686450 3300005329 Bacteria 980
16 Ga0070690_100001170 3300005330 Bacteria 13492
17 Ga0070690_100011978 3300005330 Bacteria 5088
18 Ga0070670_100003894 3300005331 Bacteria 12447
19 Ga0070670_100005698 3300005331 Bacteria 10522
20 Ga0070670_100035529 3300005331 Bacteria 4290
21 Ga0070670_100173155 3300005331 Bacteria 1872
22 Ga0070670_100328211 3300005331 Bacteria 1341
23 Ga0070670_100434785 3300005331 Bacteria 1161
24 Ga0070670_101611927 3300005331 Bacteria 597
25 Ga0070677_10092614 3300005333 Bacteria 1317
26 Ga0070677_10524321 3300005333 Bacteria 645
27 Ga0070677_10707856 3300005333 Bacteria 568
28 Ga0070666_10008526 3300005335 Bacteria 6368
29 Ga0070680_100134706 3300005336 Bacteria 2068
30 Ga0070680_100243649 3300005336 Bacteria 1520
31 Ga0070680_100331935 3300005336 Bacteria 1292
32 Ga0070680_100974814 3300005336 Bacteria 732
33 Ga0070682_100857650 3300005337 Bacteria 743
34 Ga0068868_100014926 3300005338 Bacteria 5735
35 Ga0068868_100237433 3300005338 Bacteria 1530
36 Ga0068868_102381742 3300005338 Unclassified 506
37 Ga0070660_100003994 3300005339 Bacteria 10188
38 Ga0070660_100110289 3300005339 Bacteria 2188
39 Ga0070660_100247166 3300005339 Bacteria 1454
40 Ga0070660_100641026 3300005339 Bacteria 889
41 Ga0070660_101457113 3300005339 Bacteria 582
42 Ga0070689_100489510 3300005340 Bacteria 1052
43 Ga0070689_100659325 3300005340 Bacteria 911
44 Ga0070691_10568825 3300005341 Bacteria 665
45 Ga0070687_100013469 3300005343 Bacteria 3647
46 Ga0070661_100012304 3300005344 Bacteria 5984
47 Ga0070661_100044413 3300005344 Bacteria 3247
48 Ga0070661_100096892 3300005344 Bacteria 2189
49 Ga0070661_100633371 3300005344 Bacteria 867
50 Ga0070661_100817374 3300005344 Bacteria 765
51 Ga0070668_100010288 3300005347 Bacteria 6944
52 Ga0070668_100228665 3300005347 Bacteria 1537
53 Ga0070669_100000130 3300005353 Bacteria 68799
54 Ga0070669_100026278 3300005353 Bacteria 4188
55 Ga0070669_100029392 3300005353 Bacteria 3961
56 Ga0070675_100002617 3300005354 Bacteria 13517
57 Ga0070675_100922424 3300005354 Bacteria 801
58 Ga0070671_100023372 3300005355 Bacteria 5059
59 Ga0070671_100115523 3300005355 Bacteria 2256
60 Ga0070671_100299398 3300005355 Bacteria 1369
61 Ga0070671_100935699 3300005355 Bacteria 758
62 Ga0070673_100020448 3300005364 Bacteria 4776
63 Ga0070673_100040400 3300005364 Bacteria 3578
64 Ga0070673_100689019 3300005364 Bacteria 938
65 Ga0070673_101317248 3300005364 Unclassified 678
66 Ga0070673_101411230 3300005364 Bacteria 655
67 Ga0070688_100058391 3300005365 Bacteria 2429
68 Ga0070688_100506081 3300005365 Bacteria 912
69 Ga0070659_100480068 3300005366 Bacteria 1058
70 Ga0070659_100578164 3300005366 Bacteria 964
71 Ga0070667_100002126 3300005367 Bacteria 17468
72 Ga0070667_100037440 3300005367 Bacteria 4067
73 Ga0070667_100054780 3300005367 Bacteria 3368
74 Ga0070667_100796079 3300005367 Bacteria 877
75 Ga0070667_101493537 3300005367 Bacteria 634
76 Ga0070714_100006729 3300005435 Bacteria 8906
77 Ga0070714_100717021 3300005435 Bacteria 966
78 Ga0070713_100068119 3300005436 Bacteria 2999
79 Ga0070713_100513486 3300005436 Bacteria 1132
80 Ga0070701_10852229 3300005438 Bacteria 626
81 Ga0070711_100281133 3300005439 Bacteria 1317
82 Ga0070711_101352739 3300005439 Bacteria 619
83 Ga0070705_100328073 3300005440 Bacteria 1108
84 Ga0070705_100997214 3300005440 Bacteria 680
85 Ga0070700_100341360 3300005441 Bacteria 1107
86 Ga0070700_100637859 3300005441 Bacteria 840
87 Ga0070694_100615837 3300005444 Bacteria 876
88 Ga0070694_100983098 3300005444 Bacteria 700
89 Ga0070708_100259133 3300005445 Bacteria 1635
90 Ga0070663_100080859 3300005455 Bacteria 2387
91 Ga0070663_100106380 3300005455 Bacteria 2101
92 Ga0070663_100613112 3300005455 Bacteria 917
93 Ga0070663_100811887 3300005455 Bacteria 803
94 Ga0070678_100014617 3300005456 Bacteria 4960
95 Ga0070678_100021272 3300005456 Bacteria 4274
96 Ga0070678_100586509 3300005456 Bacteria 994
97 Ga0070662_101265213 3300005457 Bacteria 635
98 Ga0070681_10114497 3300005458 Bacteria 2635
99 Ga0070681_10611118 3300005458 Bacteria 1005
100 Ga0068867_100227684 3300005459 Bacteria 1505
101 Ga0070706_100000729 3300005467 Bacteria 37037
102 Ga0070706_100047532 3300005467 Bacteria 3960
103 Ga0070706_101714926 3300005467 Bacteria 572
104 Ga0070698_101160265 3300005471 Bacteria 721
105 Ga0070679_100783261 3300005530 Bacteria 897
106 Ga0070684_100150140 3300005535 Bacteria 2111
107 Ga0070684_100369463 3300005535 Bacteria 1320
108 Ga0070684_100759059 3300005535 Bacteria 906
109 Ga0070697_101443162 3300005536 Bacteria 615
110 Ga0070697_101710854 3300005536 Bacteria 563
111 Ga0068853_100248746 3300005539 Bacteria 1631
112 Ga0068853_100317455 3300005539 Bacteria 1444
113 Ga0068853_100368092 3300005539 Bacteria 1340
114 Ga0068853_100835843 3300005539 Bacteria 883
115 Ga0068853_101406138 3300005539 Bacteria 675
116 Ga0070672_100002530 3300005543 Bacteria 11646
117 Ga0070672_100039524 3300005543 Bacteria 3614
118 Ga0070672_100064285 3300005543 Bacteria 2899
119 Ga0070672_100101633 3300005543 Bacteria 2332
120 Ga0070672_100544189 3300005543 Bacteria 1007
121 Ga0070686_100019085 3300005544 Bacteria 4035
122 Ga0070686_100105927 3300005544 Bacteria 1908
123 Ga0070695_100390892 3300005545 Bacteria 1052
124 Ga0070696_100005507 3300005546 Bacteria 8447
125 Ga0070696_100302947 3300005546 Bacteria 1225
126 Ga0070696_100794332 3300005546 Bacteria 779
127 Ga0070696_100909317 3300005546 Bacteria 731
128 Ga0070693_100299818 3300005547 Bacteria 1083
129 Ga0070665_100000379 3300005548 Bacteria 65890
130 Ga0070665_100122874 3300005548 Bacteria 2598
131 Ga0070665_100366825 3300005548 Bacteria 1446
132 Ga0070704_101020893 3300005549 Bacteria 749
133 Ga0068855_100083099 3300005563 Bacteria 3710
134 Ga0068855_100331680 3300005563 Bacteria 1679
135 Ga0068855_100556863 3300005563 Bacteria 1241
136 Ga0068855_100878136 3300005563 Bacteria 948
137 Ga0068855_101342331 3300005563 Bacteria 739
138 Ga0068855_101936058 3300005563 Bacteria 596
139 Ga0068855_102173936 3300005563 Bacteria 557
140 Ga0068855_102453644 3300005563 Bacteria 519
141 Ga0070664_100004320 3300005564 Bacteria 11422
142 Ga0070664_100088327 3300005564 Bacteria 2680
143 Ga0070664_100536568 3300005564 Bacteria 1081
144 Ga0070664_100555721 3300005564 Bacteria 1061
145 Ga0070664_100634818 3300005564 Bacteria 992
146 Ga0068857_100097924 3300005577 Bacteria 2630
147 Ga0068857_100349253 3300005577 Bacteria 1369
148 Ga0068854_100143543 3300005578 Bacteria 1834
149 Ga0068854_100231588 3300005578 Bacteria 1466
150 Ga0068854_101403126 3300005578 Bacteria 631
151 Ga0068856_100194539 3300005614 Bacteria 2042
152 Ga0068856_100204457 3300005614 Bacteria 1989
153 Ga0068856_100280232 3300005614 Bacteria 1684
154 Ga0070702_100093248 3300005615 Bacteria 1831
155 Ga0070702_100282826 3300005615 Bacteria 1140
156 Ga0070702_100973503 3300005615 Bacteria 670
157 Ga0068852_100077154 3300005616 Bacteria 2944
158 Ga0068852_100100210 3300005616 Bacteria 2613
159 Ga0068852_100186574 3300005616 Bacteria 1953
160 Ga0068852_100754166 3300005616 Bacteria 986
161 Ga0068852_101092467 3300005616 Bacteria 818
162 Ga0068859_100294972 3300005617 Bacteria 1715
163 Ga0068859_100587159 3300005617 Bacteria 1207
164 Ga0068859_101281396 3300005617 Bacteria 807
165 Ga0068864_100008915 3300005618 Bacteria 8267
166 Ga0068864_100024725 3300005618 Bacteria 5053
167 Ga0068864_100025724 3300005618 Bacteria 4960
168 Ga0068864_100669350 3300005618 Bacteria 1012
169 Ga0068864_100911167 3300005618 Bacteria 868
170 Ga0068866_10401728 3300005718 Bacteria 884
171 Ga0068866_11020470 3300005718 Bacteria 589
172 Ga0068861_101182868 3300005719 Bacteria 738
173 Ga0068861_102552042 3300005719 Bacteria 515
174 Ga0068870_10086820 3300005840 Bacteria 1741
175 Ga0068870_10799111 3300005840 Bacteria 659
176 Ga0068870_11006631 3300005840 Bacteria 595
177 Ga0068863_100014714 3300005841 Bacteria 7529
178 Ga0068863_100219709 3300005841 Bacteria 1830
179 Ga0068863_100257501 3300005841 Bacteria 1686
180 Ga0068863_100276083 3300005841 Bacteria 1627
181 Ga0068863_101172534 3300005841 Bacteria 774
182 Ga0068858_100029892 3300005842 Bacteria 5061
183 Ga0068858_100192548 3300005842 Bacteria 1927
184 Ga0068858_100362841 3300005842 Bacteria 1388
185 Ga0068858_101573336 3300005842 Bacteria 649
186 Ga0068860_100104417 3300005843 Bacteria 2705
187 Ga0068860_100228868 3300005843 Bacteria 1806
188 Ga0068862_100207801 3300005844 Bacteria 1768
189 Ga0068862_100536010 3300005844 Bacteria 1116
190 Ga0068862_100588621 3300005844 Bacteria 1067
191 Ga0068862_102487726 3300005844 Bacteria 529
192 Ga0081455_10077025 3300005937 Bacteria 2745
193 Ga0081455_10093586 3300005937 Bacteria 2429
194 Ga0081455_10191655 3300005937 Bacteria 1539
195 Ga0081455_10291334 3300005937 Bacteria 1175
196 Ga0081538_10360341 3300005981 Bacteria 526
197 Ga0081539_10375654 3300005985 Bacteria 594
198 Ga0070717_10175129 3300006028 Bacteria 1867
199 Ga0070717_10180503 3300006028 Bacteria 1840
200 Ga0075363_100728229 3300006048 Bacteria 600
201 Ga0070715_10687425 3300006163 Bacteria 610
202 Ga0070712_100224924 3300006175 Bacteria 1487
203 Ga0075366_10291877 3300006195 Bacteria 997
204 Ga0097621_100005815 3300006237 Bacteria 8710
205 Ga0097621_100042892 3300006237 Bacteria 3645
206 Ga0097621_100044054 3300006237 Bacteria 3599
207 Ga0097621_100065709 3300006237 Bacteria 2986
208 Ga0097621_100944407 3300006237 Bacteria 805
209 Ga0068871_100010010 3300006358 Bacteria 6891
210 Ga0068871_100016550 3300006358 Bacteria 5559
211 Ga0068871_100321055 3300006358 Bacteria 1364
212 Ga0068871_100449655 3300006358 Bacteria 1154
213 Ga0068871_100791363 3300006358 Bacteria 874
214 Ga0075428_100060232 3300006844 Bacteria 4157
215 Ga0075428_100223563 3300006844 Bacteria 2033
216 Ga0075430_100000352 3300006846 Bacteria 33429
217 Ga0075431_100007157 3300006847 Bacteria 11093
218 Ga0075431_100763738 3300006847 Bacteria 941
219 Ga0075431_101155989 3300006847 Bacteria 737
220 Ga0075433_10095096 3300006852 Bacteria 2636
221 Ga0075433_10584906 3300006852 Bacteria 980
222 Ga0075434_100371759 3300006871 Bacteria 1450
223 Ga0075434_100814684 3300006871 Bacteria 950
224 Ga0075429_100558959 3300006880 Bacteria 1003
225 Ga0075429_100682760 3300006880 Bacteria 900
226 Ga0068865_100124433 3300006881 Bacteria 1922
227 Ga0075436_100045137 3300006914 Bacteria 3039
228 Ga0075436_100274952 3300006914 Bacteria 1203
229 Ga0097620_100294971 3300006931 Bacteria 1715
230 Ga0097620_100587164 3300006931 Bacteria 1207
231 Ga0097620_101281407 3300006931 Bacteria 807
232 Ga0075435_100434265 3300007076 Bacteria 1131
233 Ga0075435_100761274 3300007076 Bacteria 842
234 Ga0075435_100966103 3300007076 Bacteria 744
235 Ga0075435_101073227 3300007076 Bacteria 704
236 Ga0075435_101491826 3300007076 Bacteria 593
237 Ga0105240_10000021 3300009093 Bacteria 394304
238 Ga0105240_10053328 3300009093 Bacteria 5076
239 Ga0111539_10447008 3300009094 Bacteria 1505
240 Ga0111539_10717773 3300009094 Bacteria 1164
241 Ga0111539_11578416 3300009094 Bacteria 761
242 Ga0111539_12166703 3300009094 Bacteria 645
243 Ga0105245_10281476 3300009098 Bacteria 1625
244 Ga0105245_10336910 3300009098 Bacteria 1490
245 Ga0105247_10281501 3300009101 Bacteria 1147
246 Ga0105247_10940113 3300009101 Bacteria 671
247 Ga0114129_10019046 3300009147 Bacteria 9777
248 Ga0114129_10190806 3300009147 Bacteria 2782
249 Ga0114129_11962185 3300009147 Bacteria 709
250 Ga0114129_11993030 3300009147 Bacteria 702
251 Ga0114129_12782406 3300009147 Bacteria 582
252 Ga0105243_10072635 3300009148 Bacteria 2785
253 Ga0105241_10046494 3300009174 Bacteria 3296
254 Ga0105241_10339458 3300009174 Bacteria 1301
255 Ga0105241_12025246 3300009174 Bacteria 567
256 Ga0105242_10311609 3300009176 Bacteria 1440
257 Ga0105242_11516168 3300009176 Bacteria 701
258 Ga0105242_11567996 3300009176 Bacteria 691
259 Ga0105242_11687708 3300009176 Bacteria 669
260 Ga0105248_10025897 3300009177 Bacteria 6524
261 Ga0105248_10043113 3300009177 Bacteria 5060
262 Ga0105248_10168423 3300009177 Bacteria 2469
263 Ga0105248_10221509 3300009177 Bacteria 2130
264 Ga0105248_11006689 3300009177 Bacteria 941
265 Ga0105237_12685228 3300009545 Bacteria 509
266 Ga0105238_10174733 3300009551 Bacteria 2124
267 Ga0105249_10391429 3300009553 Bacteria 1418
268 Ga0105249_10414821 3300009553 Bacteria 1379
269 Ga0105249_12581977 3300009553 Bacteria 580
270 Ga0105032_103903 3300009979 Bacteria 1284
271 Ga0105239_10021770 3300010375 Bacteria 7067
272 Ga0105239_10196982 3300010375 Bacteria 2256
273 Ga0105239_10514222 3300010375 Bacteria 1362
274 Ga0105239_11883343 3300010375 Bacteria 693
275 Ga0105239_12844325 3300010375 Bacteria 565
276 Ga0105246_10218168 3300011119 Bacteria 1493
277 Ga0105246_11109744 3300011119 Bacteria 723
278 Ga0105246_11409753 3300011119 Bacteria 650
279 Ga0157335_1014612 3300012492 Bacteria 682
280 Ga0157319_1012508 3300012497 Bacteria 718
281 Ga0157347_1042685 3300012502 Bacteria 604
282 Ga0157342_1073801 3300012507 Bacteria 524
283 Ga0157373_10073638 3300013100 Bacteria 2410
284 Ga0157373_10156287 3300013100 Bacteria 1604
285 Ga0157373_10303758 3300013100 Bacteria 1133
286 Ga0157371_10026042 3300013102 Bacteria 4255
287 Ga0157371_10035768 3300013102 Bacteria 3558
288 Ga0157371_10036528 3300013102 Bacteria 3518
289 Ga0157371_10058946 3300013102 Bacteria 2723
290 Ga0157371_10204510 3300013102 Bacteria 1416
291 Ga0157370_10129725 3300013104 Bacteria 2352
292 Ga0157370_10335579 3300013104 Bacteria 1393
293 Ga0157370_11094884 3300013104 Bacteria 720
294 Ga0157369_10110956 3300013105 Bacteria 2916
295 Ga0157369_10325471 3300013105 Bacteria 1598
296 Ga0157369_10702500 3300013105 Bacteria 1041
297 Ga0157369_11293556 3300013105 Bacteria 743
298 Ga0157369_12529258 3300013105 Bacteria 520
299 Ga0157374_10034347 3300013296 Bacteria 4631
300 Ga0157374_10063082 3300013296 Bacteria 3475
301 Ga0157374_10104853 3300013296 Bacteria 2715
302 Ga0157374_10824950 3300013296 Bacteria 944
303 Ga0157374_11067666 3300013296 Bacteria 828
304 Ga0157378_10179830 3300013297 Bacteria 1989
305 Ga0157378_10281090 3300013297 Bacteria 1604
306 Ga0163162_10027387 3300013306 Bacteria 5636
307 Ga0163162_10269353 3300013306 Bacteria 1835
308 Ga0163162_11712274 3300013306 Bacteria 718
309 Ga0157372_10014677 3300013307 Bacteria 8383
310 Ga0157372_10047545 3300013307 Bacteria 4769
311 Ga0157372_10047686 3300013307 Bacteria 4761
312 Ga0157372_10258185 3300013307 Bacteria 2023
313 Ga0157372_10898378 3300013307 Bacteria 1028
314 Ga0157375_10011174 3300013308 Bacteria 7920
315 Ga0157375_10022253 3300013308 Bacteria 5833
316 Ga0157375_10286152 3300013308 Bacteria 1811
317 Ga0157375_11251950 3300013308 Bacteria 871
318 Ga0157375_11896288 3300013308 Bacteria 707
319 Ga0163163_10011474 3300014325 Bacteria 8039
320 Ga0163163_10037699 3300014325 Bacteria 4704
321 Ga0163163_10089840 3300014325 Bacteria 3084
322 Ga0163163_10220910 3300014325 Bacteria 1943
323 Ga0163163_11008927 3300014325 Bacteria 896
324 Ga0157380_10145216 3300014326 Bacteria 2044
325 Ga0157380_12148488 3300014326 Bacteria 622
326 Ga0182008_10209936 3300014497 Bacteria 993
327 Ga0157377_10246268 3300014745 Bacteria 1156
328 Ga0157377_10827929 3300014745 Bacteria 685
329 Ga0157377_11022368 3300014745 Bacteria 627
330 Ga0157377_11771945 3300014745 Bacteria 500
331 Ga0157379_10028109 3300014968 Bacteria 5005
332 Ga0157379_10853364 3300014968 Bacteria 862
333 Ga0157379_11201331 3300014968 Bacteria 729
334 Ga0157376_10031005 3300014969 Bacteria 4276
335 Ga0157376_10039819 3300014969 Bacteria 3836
336 Ga0157376_10078433 3300014969 Bacteria 2828
337 Ga0182007_10376596 3300015262 Bacteria 538
338 Ga0163161_10057804 3300017792 Bacteria 2818
339 Ga0163161_10153903 3300017792 Bacteria 1749
340 Ga0163161_10868392 3300017792 Bacteria 762
341 Ga0163161_11229822 3300017792 Bacteria 649
342 Ga0209564_1002653 3300025295 Bacteria 13632
343 Ga0207697_10109575 3300025315 Bacteria 1182
344 Ga0207656_10010952 3300025321 Bacteria 3413
345 Ga0207682_10068262 3300025893 Bacteria 1502
346 Ga0207688_10428423 3300025901 Bacteria 823
347 Ga0207680_10009139 3300025903 Bacteria 4901
348 Ga0207680_10009229 3300025903 Bacteria 4880
349 Ga0207647_10420116 3300025904 Bacteria 752
350 Ga0207645_10210813 3300025907 Bacteria 1280
351 Ga0207645_10566674 3300025907 Bacteria 771
352 Ga0207643_10199950 3300025908 Bacteria 1216
353 Ga0207643_10276110 3300025908 Bacteria 1041
354 Ga0207643_10665954 3300025908 Bacteria 672
355 Ga0207705_10037708 3300025909 Bacteria 3458
356 Ga0207705_10108757 3300025909 Bacteria 2046
357 Ga0207705_10204926 3300025909 Bacteria 1495
358 Ga0207705_10343488 3300025909 Bacteria 1149
359 Ga0207705_10390512 3300025909 Bacteria 1076
360 Ga0207705_10655060 3300025909 Bacteria 817
361 Ga0207705_10715348 3300025909 Bacteria 778
362 Ga0207684_10000249 3300025910 Bacteria 80711
363 Ga0207684_10223701 3300025910 Bacteria 1624
364 Ga0207684_10544532 3300025910 Bacteria 993
365 Ga0207654_10010307 3300025911 Bacteria 4757
366 Ga0207654_10315278 3300025911 Bacteria 1067
367 Ga0207707_10044820 3300025912 Bacteria 3855
368 Ga0207707_10088216 3300025912 Bacteria 2709
369 Ga0207707_10205933 3300025912 Bacteria 1714
370 Ga0207707_10307854 3300025912 Bacteria 1369
371 Ga0207695_10000083 3300025913 Bacteria 284102
372 Ga0207695_10059179 3300025913 Bacteria 3975
373 Ga0207695_10260454 3300025913 Bacteria 1632
374 Ga0207695_10650366 3300025913 Bacteria 935
375 Ga0207671_10626462 3300025914 Bacteria 857
376 Ga0207693_10201824 3300025915 Bacteria 1564
377 Ga0207663_10241903 3300025916 Bacteria 1324
378 Ga0207660_10012842 3300025917 Bacteria 5483
379 Ga0207660_10054791 3300025917 Bacteria 2847
380 Ga0207660_10448899 3300025917 Bacteria 1043
381 Ga0207662_10052316 3300025918 Bacteria 2430
382 Ga0207662_10191522 3300025918 Bacteria 1320
383 Ga0207662_10231576 3300025918 Bacteria 1207
384 Ga0207662_10410490 3300025918 Bacteria 920
385 Ga0207662_10440262 3300025918 Bacteria 890
386 Ga0207662_11356857 3300025918 Bacteria 505
387 Ga0207657_10001588 3300025919 Bacteria 24427
388 Ga0207657_10187948 3300025919 Bacteria 1667
389 Ga0207657_10190059 3300025919 Bacteria 1657
390 Ga0207657_10200662 3300025919 Bacteria 1605
391 Ga0207657_10639054 3300025919 Bacteria 829
392 Ga0207649_10027084 3300025920 Bacteria 3361
393 Ga0207649_10208044 3300025920 Bacteria 1386
394 Ga0207652_10037996 3300025921 Bacteria 4078
395 Ga0207652_10303941 3300025921 Bacteria 1440
396 Ga0207652_10438935 3300025921 Bacteria 1177
397 Ga0207646_10136081 3300025922 Bacteria 2212
398 Ga0207681_10000016 3300025923 Bacteria 345352
399 Ga0207681_10046394 3300025923 Bacteria 2922
400 Ga0207650_10034428 3300025925 Bacteria 3673
401 Ga0207650_10081275 3300025925 Bacteria 2458
402 Ga0207650_10136265 3300025925 Bacteria 1926
403 Ga0207650_10579457 3300025925 Bacteria 942
404 Ga0207659_10054587 3300025926 Bacteria 2854
405 Ga0207659_10126345 3300025926 Bacteria 1967
406 Ga0207659_10185873 3300025926 Bacteria 1650
407 Ga0207659_10796233 3300025926 Bacteria 812
408 Ga0207700_11596250 3300025928 Bacteria 577
409 Ga0207664_10005143 3300025929 Bacteria 8913
410 Ga0207664_10173135 3300025929 Bacteria 1849
411 Ga0207644_10296179 3300025931 Bacteria 1302
412 Ga0207644_10400008 3300025931 Bacteria 1122
413 Ga0207644_10585852 3300025931 Bacteria 925
414 Ga0207690_10005180 3300025932 Bacteria 7690
415 Ga0207690_10135515 3300025932 Bacteria 1807
416 Ga0207706_10407697 3300025933 Bacteria 1178
417 Ga0207706_10756820 3300025933 Bacteria 827
418 Ga0207686_10263409 3300025934 Bacteria 1265
419 Ga0207686_10880063 3300025934 Bacteria 722
420 Ga0207709_10130906 3300025935 Bacteria 1710
421 Ga0207709_10519590 3300025935 Bacteria 932
422 Ga0207709_11737107 3300025935 Bacteria 519
423 Ga0207670_10027837 3300025936 Bacteria 3579
424 Ga0207670_10285608 3300025936 Bacteria 1287
425 Ga0207670_11006518 3300025936 Bacteria 701
426 Ga0207704_10041837 3300025938 Bacteria 2691
427 Ga0207704_10900821 3300025938 Bacteria 744
428 Ga0207704_11322676 3300025938 Bacteria 616
429 Ga0207665_11219906 3300025939 Bacteria 600
430 Ga0207691_10004663 3300025940 Bacteria 13268
431 Ga0207691_10005035 3300025940 Bacteria 12749
432 Ga0207691_10025419 3300025940 Bacteria 5560
433 Ga0207691_10047731 3300025940 Bacteria 3928
434 Ga0207691_10278649 3300025940 Bacteria 1439
435 Ga0207711_10012890 3300025941 Bacteria 6945
436 Ga0207711_10146171 3300025941 Bacteria 2130
437 Ga0207711_10277669 3300025941 Bacteria 1542
438 Ga0207711_10474310 3300025941 Bacteria 1165
439 Ga0207689_10646900 3300025942 Bacteria 890
440 Ga0207661_10018076 3300025944 Bacteria 5234
441 Ga0207661_10763142 3300025944 Bacteria 890
442 Ga0207661_11702383 3300025944 Unclassified 576
443 Ga0207679_10061976 3300025945 Bacteria 2785
444 Ga0207679_10127745 3300025945 Bacteria 2034
445 Ga0207679_10227907 3300025945 Bacteria 1571
446 Ga0207679_10253149 3300025945 Bacteria 1498
447 Ga0207679_10417623 3300025945 Bacteria 1183
448 Ga0207667_10029168 3300025949 Bacteria 5984
449 Ga0207667_10136162 3300025949 Bacteria 2529
450 Ga0207667_10393835 3300025949 Bacteria 1410
451 Ga0207667_10481544 3300025949 Bacteria 1260
452 Ga0207651_10001224 3300025960 Bacteria 11514
453 Ga0207651_10023284 3300025960 Bacteria 3806
454 Ga0207651_11142497 3300025960 Bacteria 698
455 Ga0207651_11386514 3300025960 Bacteria 632
456 Ga0207712_10363735 3300025961 Bacteria 1206
457 Ga0207712_11707358 3300025961 Bacteria 564
458 Ga0207668_10034105 3300025972 Bacteria 3377
459 Ga0207668_11050188 3300025972 Bacteria 729
460 Ga0207640_10058752 3300025981 Bacteria 2535
461 Ga0207640_10299088 3300025981 Bacteria 1272
462 Ga0207640_12082144 3300025981 Bacteria 514
463 Ga0207658_10014761 3300025986 Bacteria 5352
464 Ga0207658_10061197 3300025986 Bacteria 2812
465 Ga0207658_10152961 3300025986 Bacteria 1882
466 Ga0207658_11117742 3300025986 Bacteria 720
467 Ga0207677_10012057 3300026023 Bacteria 4951
468 Ga0207677_10043998 3300026023 Bacteria 2972
469 Ga0207677_10200874 3300026023 Bacteria 1584
470 Ga0207677_10727811 3300026023 Bacteria 882
471 Ga0207703_10005239 3300026035 Bacteria 10461
472 Ga0207703_10237684 3300026035 Bacteria 1636
473 Ga0207703_11689799 3300026035 Bacteria 609
474 Ga0207703_11853842 3300026035 Bacteria 579
475 Ga0207639_10027797 3300026041 Bacteria 4124
476 Ga0207639_11548031 3300026041 Bacteria 622
477 Ga0207639_12057286 3300026041 Bacteria 532
478 Ga0207678_10009602 3300026067 Bacteria 8509
479 Ga0207678_10157190 3300026067 Bacteria 1941
480 Ga0207678_10544583 3300026067 Bacteria 1014
481 Ga0207678_10696371 3300026067 Bacteria 894
482 Ga0207708_10267143 3300026075 Bacteria 1382
483 Ga0207708_11119712 3300026075 Bacteria 687
484 Ga0207702_10002552 3300026078 Bacteria 17142
485 Ga0207702_10081871 3300026078 Bacteria 2805
486 Ga0207702_10690995 3300026078 Bacteria 1005
487 Ga0207641_10177914 3300026088 Bacteria 1946
488 Ga0207641_10724211 3300026088 Bacteria 981
489 Ga0207641_10740860 3300026088 Bacteria 970
490 Ga0207641_10817003 3300026088 Bacteria 923
491 Ga0207641_11087184 3300026088 Bacteria 798
492 Ga0207641_11344944 3300026088 Bacteria 715
493 Ga0207676_10012598 3300026095 Bacteria 6064
494 Ga0207676_10027601 3300026095 Bacteria 4230
495 Ga0207676_10055718 3300026095 Bacteria 3105
496 Ga0207676_10068779 3300026095 Bacteria 2834
497 Ga0207676_10390469 3300026095 Bacteria 1298
498 Ga0207676_11827947 3300026095 Bacteria 606
499 Ga0207674_10134342 3300026116 Bacteria 2437
500 Ga0207674_10177073 3300026116 Bacteria 2085
501 Ga0207674_10376001 3300026116 Bacteria 1373
502 Ga0207674_10536082 3300026116 Bacteria 1131
503 Ga0207674_10536527 3300026116 Bacteria 1130
504 Ga0207674_10844617 3300026116 Bacteria 883
505 Ga0207675_100361783 3300026118 Bacteria 1423
506 Ga0207675_100429846 3300026118 Bacteria 1305
507 Ga0207683_10005718 3300026121 Bacteria 10667
508 Ga0207683_10026945 3300026121 Bacteria 4966
509 Ga0207683_10073855 3300026121 Bacteria 3017
510 Ga0207683_11666465 3300026121 Bacteria 587
511 Ga0207698_10252960 3300026142 Bacteria 1613
512 Ga0207698_11608155 3300026142 Bacteria 665
513 Ga0207698_12001694 3300026142 Bacteria 593
514 Ga0207698_12187843 3300026142 Bacteria 566
515 Ga0209179_1070594 3300027512 Bacteria 765
516 Ga0209999_1105469 3300027543 Bacteria 550
517 Ga0209966_1174317 3300027695 Bacteria 504
518 Ga0209974_10062839 3300027876 Bacteria 1259
519 Ga0207428_10681706 3300027907 Bacteria 736
520 Ga0268266_10001791 3300028379 Bacteria 24352
521 Ga0268266_10226801 3300028379 Bacteria 1719
522 Ga0268265_10393768 3300028380 Bacteria 1278
523 Ga0268265_10641947 3300028380 Bacteria 1019
524 Ga0268265_11279356 3300028380 Bacteria 733
525 Ga0268265_12030748 3300028380 Bacteria 582
526 Ga0268264_10237617 3300028381 Bacteria 1686
527 Ga0268264_12338099 3300028381 Bacteria 541
528 Ga0265334_10000014 3300028573 Bacteria 154345
529 Ga0307517_10526453 3300028786 Bacteria 596
530 Ga0307515_10000425 3300028794 Bacteria 101790
531 Ga0265338_10052097 3300028800 Bacteria 3678
532 Ga0265338_10749334 3300028800 Bacteria 672
533 Ga0316177_1195276 3300030731 Bacteria 809
534 Ga0316176_1102781 3300030732 Bacteria 868
535 Ga0265330_10192074 3300031235 Bacteria 864
536 Ga0265332_10015259 3300031238 Bacteria 3390
537 Ga0265320_10000059 3300031240 Bacteria 102018
538 Ga0265325_10094637 3300031241 Bacteria 1469
539 Ga0265329_10218647 3300031242 Bacteria 630
540 Ga0265339_10003360 3300031249 Bacteria 11196
541 Ga0265331_10537510 3300031250 Bacteria 527
542 Ga0307513_10240832 3300031456 Bacteria 1614
543 Ga0307408_100000052 3300031548 Bacteria 149094
544 Ga0307408_100098004 3300031548 Bacteria 2228
545 Ga0307408_101966886 3300031548 Bacteria 562
546 Ga0307508_10882745 3300031616 Bacteria 519
547 Ga0265314_10003562 3300031711 Bacteria 15024
548 Ga0265342_10006487 3300031712 Bacteria 8709
549 Ga0316576_10512581 3300031727 Bacteria 882
550 Ga0307405_10510149 3300031731 Bacteria 966
551 Ga0307413_10805325 3300031824 Bacteria 790
552 Ga0307410_10270054 3300031852 Bacteria 1330
553 Ga0307410_11336868 3300031852 Bacteria 628
554 Ga0307406_10327176 3300031901 Bacteria 1188
555 Ga0307406_11476034 3300031901 Bacteria 598
556 Ga0307409_100910129 3300031995 Bacteria 894
557 Ga0307409_102652824 3300031995 Bacteria 529
558 Ga0307416_100360411 3300032002 Bacteria 1476
559 Ga0307416_100979215 3300032002 Bacteria 948
560 Ga0307414_10063524 3300032004 Bacteria 2625
561 Ga0307414_10242935 3300032004 Bacteria 1492
562 Ga0307414_10346490 3300032004 Bacteria 1274
563 Ga0307507_10665227 3300033179 Bacteria 526
564 Ga0373926_0295938 3300035083 Bacteria 631
565 Ga0373928_0142079 3300035084 Bacteria 659
566 Ga0373934_0157249 3300035086 Bacteria 932
567 Ga0373934_0475480 3300035086 Bacteria 525
568 Ga0373944_0165770 3300035089 Bacteria 786
569 Ga0373944_0342546 3300035089 Bacteria 568
570 Ga0373951_0042417 3300035091 Bacteria 1101
571 Ga0373952_0120837 3300035092 Bacteria 711
572 Ga0373923_0501240 3300035111 Bacteria 592
573 Ga0373936_0142408 3300035113 Bacteria 1036
574 Ga0373953_0017990 3300035117 Bacteria 2607
575 Ga0373953_0234838 3300035117 Bacteria 795
576 Ga0373954_0013929 3300035118 Bacteria 3584
577 Ga0373954_0206420 3300035118 Bacteria 966
578 Ga0373956_0211101 3300035119 Bacteria 921
579 Ga0373956_0267906 3300035119 Bacteria 812
580 Ga0373956_0309453 3300035119 Bacteria 753
581 Ga0373957_0005424 3300035120 Bacteria 3950
582 Ga0373943_0609647 3300035170 Bacteria 643
583 Ga0373946_0366536 3300035171 Bacteria 723
584 Ga0373955_0003055 3300035172 Bacteria 7329
585 Ga0373955_0636768 3300035172 Bacteria 653
586 Ga0373961_0222504 3300035241 Bacteria 674
587 Ga0373962_0292142 3300035242 Bacteria 576
588 Ga0373962_0363660 3300035242 Bacteria 525
589 Ga0373924_0004612 3300035410 Bacteria 4826
590 Ga0373931_0140256 3300035691 Bacteria 1399
591 Ga0373931_0260611 3300035691 Bacteria 1058
592 Ga0373935_0207026 3300035692 Bacteria 1358
593 Ga0373927_0052911 3300035695 Bacteria 2626
594 Ga0373927_0285315 3300035695 Bacteria 1086
595 Ga0373933_0037359 3300035724 Bacteria 2848
596 Ga0373933_0607233 3300035724 Bacteria 718
597 Ga0373933_0715413 3300035724 Bacteria 659
598 Ga0373947_0792037 3300035725 Bacteria 647
599 Ga0373937_0018590 3300036401 Bacteria 6208
600 Ga0373937_0019935 3300036401 Bacteria 6006
601 Ga0373937_0064977 3300036401 Bacteria 3358
602 Ga0373937_0559847 3300036401 Bacteria 1086
603 Ga0373937_1206883 3300036401 Bacteria 705
604 Ga0373925_0027485 3300037068 Bacteria 4164
605 Ga0373925_0503320 3300037068 Bacteria 995
606 Ga0395900_0067903 3300037418 Bacteria 3663
607 Ga0395900_0517009 3300037418 Bacteria 1142
608 Ga0395900_0541064 3300037418 Bacteria 1110
609 Ga0395898_0190041 3300037466 Bacteria 1962
610 Ga0395905_0271690 3300037471 Bacteria 1581
611 Ga0395901_0009319 3300038443 Bacteria 9951
612 Ga0395901_0161195 3300038443 Bacteria 2355
613 Ga0395901_0970882 3300038443 Bacteria 827
614 Ga0395901_1811897 3300038443 Bacteria 559
615 Ga0439436_0005108 3300041404 Bacteria 4021
616 Ga0439465_0015534 3300041413 Bacteria 2376
617 Ga0439465_0319919 3300041413 Bacteria 583
618 Ga0451789_1086300 3300041443 Bacteria 579
619 Ga0451791_1321094 3300041451 Bacteria 980
620 Ga0451791_1887272 3300041451 Bacteria 1204
621 Ga0451793_0846499 3300041452 Bacteria 3060
622 Ga0451793_1467702 3300041452 Bacteria 544
623 Ga0451797_0445999 3300041453 Bacteria 1382
624 Ga0451797_0574674 3300041453 Bacteria 2406
625 Ga0451795_1028350 3300041456 Bacteria 1432
626 Ga0451807_1167832 3300041486 Bacteria 749
627 Ga0451837_0257342 3300041494 Bacteria 1514
628 Ga0451837_1290614 3300041494 Bacteria 1242
629 Ga0451851_0846263 3300041507 Bacteria 597
630 Ga0451843_1004066 3300041509 Bacteria 601
631 Ga0451843_1133094 3300041509 Bacteria 1870
632 Ga0451843_1185491 3300041509 Bacteria 1699
633 Ga0439448_0146638 3300042005 Bacteria 818
634 Ga0439432_013383 3300042006 Bacteria 2792
635 Ga0439449_0025820 3300042007 Bacteria 2194
636 Ga0439449_0064453 3300042007 Bacteria 1351
637 Ga0439449_0078310 3300042007 Bacteria 1219
638 Ga0439452_041619 3300042010 Bacteria 1080
639 Ga0439463_026210 3300042016 Bacteria 1464
640 Ga0450903_000545 3300042138 Bacteria 7829
641 Ga0439460_0000280 3300042461 Bacteria 10605
642 Ga0451577_0002859 3300042876 Bacteria 19848
643 Ga0451577_0004094 3300042876 Bacteria 15658
644 Ga0451577_0009700 3300042876 Bacteria 9231
645 Ga0451577_0065649 3300042876 Bacteria 3236
646 Ga0451577_0454410 3300042876 Bacteria 1163
647 Ga0451577_1123844 3300042876 Bacteria 703
648 Ga0466972_0001665 3300044658 Bacteria 10868
649 Ga0453683_0150477 3300044673 Bacteria 1471
650 Ga0453683_0232215 3300044673 Bacteria 1174
651 Ga0453684_0003650 3300044712 Bacteria 34176
652 Ga0453684_0021892 3300044712 Bacteria 9513
653 Ga0453684_0052400 3300044712 Bacteria 5336
654 Ga0453684_0190552 3300044712 Bacteria 2399
655 Ga0453684_1066375 3300044712 Bacteria 856
656 Ga0453684_1477321 3300044712 Bacteria 702
657 Ga0466971_0445615 3300044719 Bacteria 635
658 Ga0466957_0021327 3300044842 Bacteria 3817
659 Ga0451576_0002452 3300045051 Bacteria 27656
660 Ga0451576_0048474 3300045051 Bacteria 4462
661 Ga0451576_1652928 3300045051 Bacteria 664
662 Ga0495617_000079 3300046452 Bacteria 76356
663 Ga0495617_000116 3300046452 Bacteria 55671
664 Ga0495592_0041360 3300046454 Bacteria 3454
665 Ga0495592_0270100 3300046454 Bacteria 1116
666 Ga0495603_0082571 3300046455 Bacteria 1882
667 Ga0495591_157102 3300046458 Bacteria 545
668 Ga0495629_0000001 3300046459 Bacteria 807972
669 Ga0495629_0240617 3300046459 Bacteria 1246
670 Ga0495629_0433091 3300046459 Bacteria 892
671 Ga0495638_0011638 3300046460 Bacteria 6059
672 Ga0495638_0020583 3300046460 Bacteria 4357
673 Ga0495638_0301295 3300046460 Bacteria 863
674 Ga0495651_0078940 3300046462 Bacteria 2489
675 Ga0495650_0001832 3300046471 Bacteria 19032
676 Ga0495650_0013892 3300046471 Bacteria 4229
677 Ga0495580_0679130 3300046472 Bacteria 675
678 Ga0495582_0042920 3300046473 Bacteria 2490
679 Ga0495582_0092048 3300046473 Bacteria 1691
680 Ga0495582_0357034 3300046473 Bacteria 842
681 Ga0495639_0020584 3300046475 Bacteria 2883
682 Ga0495639_0365331 3300046475 Bacteria 726
683 Ga0495639_0413149 3300046475 Bacteria 683
684 Ga0495662_0156924 3300046476 Bacteria 1121
685 Ga0495662_0180209 3300046476 Bacteria 1041
686 Ga0495664_0024325 3300046477 Bacteria 3519
687 Ga0495584_0001736 3300046491 Bacteria 12740
688 Ga0495584_0112702 3300046491 Bacteria 1376
689 Ga0495584_0373140 3300046491 Bacteria 724
690 Ga0495585_0000061 3300046492 Bacteria 110727
691 Ga0495585_0000160 3300046492 Bacteria 72066
692 Ga0495585_0591037 3300046492 Bacteria 522
693 Ga0495594_0042264 3300046499 Bacteria 2496
694 Ga0495594_0290552 3300046499 Bacteria 931
695 Ga0495607_0192643 3300046501 Bacteria 1014
696 Ga0495607_0511111 3300046501 Unclassified 532
697 Ga0495583_0154257 3300046506 Bacteria 950
698 Ga0495606_0014804 3300046507 Bacteria 6059
699 Ga0495606_0427338 3300046507 Bacteria 684
700 Ga0495608_0007588 3300046511 Bacteria 7648
701 Ga0495610_0023717 3300046512 Bacteria 3327
702 Ga0495616_0002979 3300046513 Bacteria 10997
703 Ga0495616_0332940 3300046513 Bacteria 635
704 Ga0495618_0012395 3300046514 Bacteria 5178
705 Ga0495618_0384017 3300046514 Bacteria 861
706 Ga0495620_0002249 3300046515 Bacteria 11189
707 Ga0495620_0156166 3300046515 Bacteria 888
708 Ga0495628_0093367 3300046516 Bacteria 2327
709 Ga0495628_0261091 3300046516 Bacteria 1291
710 Ga0495630_0007364 3300046517 Bacteria 7860
711 Ga0495630_0020127 3300046517 Bacteria 4916
712 Ga0495630_0410395 3300046517 Bacteria 1038
713 Ga0495631_0002296 3300046518 Bacteria 10921
714 Ga0495631_0437528 3300046518 Bacteria 557
715 Ga0495632_0007217 3300046519 Bacteria 7014
716 Ga0495632_0009517 3300046519 Bacteria 5850
717 Ga0495632_0053139 3300046519 Bacteria 1990
718 Ga0495637_0009441 3300046520 Bacteria 4758
719 Ga0495637_0190461 3300046520 Bacteria 757
720 Ga0495643_0013859 3300046522 Bacteria 4810
721 Ga0495643_0109676 3300046522 Bacteria 1404
722 Ga0495644_0286199 3300046523 Bacteria 643
723 Ga0495648_0000096 3300046524 Bacteria 110227
724 Ga0495648_0000190 3300046524 Bacteria 70740
725 Ga0495648_0036045 3300046524 Bacteria 3198
726 Ga0495663_0011931 3300046525 Bacteria 2421
727 Ga0495663_0275906 3300046525 Bacteria 601
728 Ga0495666_0020379 3300046526 Bacteria 3286
729 Ga0495666_0203983 3300046526 Bacteria 908
730 Ga0495642_0027969 3300046528 Bacteria 2244
731 Ga0495642_0155740 3300046528 Bacteria 989
732 Ga0495652_0911630 3300046529 Bacteria 579
733 Ga0495654_0004069 3300046530 Bacteria 8781
734 Ga0495654_0013444 3300046530 Bacteria 4380
735 Ga0495640_0298160 3300046533 Bacteria 1002
736 Ga0495586_0008890 3300046535 Bacteria 5347
737 Ga0495586_0040693 3300046535 Bacteria 2501
738 Ga0495587_0183756 3300046536 Bacteria 1185
739 Ga0495587_0489851 3300046536 Bacteria 680
740 Ga0495598_0075539 3300046537 Bacteria 1070
741 Ga0495609_0010652 3300046538 Bacteria 4400
742 Ga0495621_0003852 3300046539 Bacteria 4164
743 Ga0495621_0007120 3300046539 Bacteria 3299
744 Ga0495622_0062906 3300046557 Bacteria 1717
745 Ga0495633_0008418 3300046558 Bacteria 5814
746 Ga0495633_0110334 3300046558 Bacteria 1275
747 Ga0495633_0180883 3300046558 Bacteria 970
748 Ga0495633_0375669 3300046558 Bacteria 643
749 Ga0495667_0030361 3300046559 Bacteria 3632
750 Ga0495667_0152974 3300046559 Bacteria 1485
751 Ga0495667_0367040 3300046559 Bacteria 908
752 Ga0495656_0027581 3300046615 Bacteria 2269
753 Ga0495656_0248104 3300046615 Bacteria 898
754 Ga0495668_0001741 3300046616 Bacteria 19967
755 Ga0495668_0191049 3300046616 Bacteria 1121
756 Ga0495668_0327296 3300046616 Bacteria 840
757 Ga0495634_0008655 3300046642 Bacteria 7550
758 Ga0495634_0010808 3300046642 Bacteria 6677
759 Ga0495634_0193841 3300046642 Bacteria 1266
760 Ga0495611_0242929 3300046648 Bacteria 835
761 Ga0495611_0423990 3300046648 Bacteria 607
762 Ga0495625_0027264 3300046660 Bacteria 4304
763 Ga0495625_0214514 3300046660 Bacteria 1264
764 Ga0495635_0082284 3300046663 Bacteria 2203
765 Ga0495635_1009559 3300046663 Bacteria 529
766 Ga0495659_0012303 3300046664 Bacteria 2768
767 Ga0495661_0045483 3300046665 Bacteria 2684
768 Ga0495661_0056138 3300046665 Bacteria 2357
769 Ga0495661_0204293 3300046665 Bacteria 1032
770 Ga0495661_0207861 3300046665 Bacteria 1021
771 Ga0495657_0239406 3300046675 Bacteria 1095
772 Ga0495599_0333858 3300046678 Bacteria 911
773 Ga0495623_0605674 3300046679 Bacteria 569
774 Ga0495647_0004407 3300046681 Bacteria 4575
775 Ga0495647_0083102 3300046681 Bacteria 1301
776 Ga0495647_0130652 3300046681 Bacteria 1064
777 Ga0495658_0247585 3300046683 Bacteria 1120
778 Ga0495669_0035457 3300046684 Bacteria 2202
779 Ga0495613_0001726 3300046689 Bacteria 16621
780 Ga0495613_0853728 3300046689 Bacteria 591
781 Ga0495624_0362269 3300046690 Bacteria 872
782 Ga0495670_0002973 3300046691 Bacteria 8355
783 Ga0495670_0085546 3300046691 Bacteria 1609
784 Ga0495671_0007520 3300046692 Bacteria 6204
785 Ga0495671_0377304 3300046692 Bacteria 679
786 Ga0495649_0316452 3300046694 Bacteria 792
787 Ga0495589_0001915 3300046794 Bacteria 11786
788 Ga0495589_0369562 3300046794 Bacteria 660
789 Ga0495600_0629562 3300046809 Bacteria 650
790 Ga0495660_0002227 3300046810 Bacteria 12473
791 Ga0495660_0041542 3300046810 Bacteria 2545
792 Ga0495581_0824462 3300047315 Bacteria 532
793 Ga0495604_0452256 3300047317 Bacteria 839
794 Ga0495636_0047654 3300047318 Bacteria 1789
795 Ga0495674_0245325 3300047319 Bacteria 1475
796 Ga0495674_0309700 3300047319 Bacteria 1288
797 Ga0495672_0098582 3300047320 Bacteria 1589
798 Ga0495676_0116498 3300047321 Bacteria 1951
799 Ga0495680_0012800 3300047322 Bacteria 7354
800 Ga0495680_0016980 3300047322 Bacteria 6231
801 Ga0495680_0038154 3300047322 Bacteria 3841
802 Ga0495680_0188335 3300047322 Bacteria 1485
803 Ga0495680_0709401 3300047322 Bacteria 664
804 Ga0495683_0018275 3300047323 Bacteria 3627
805 Ga0495683_0046991 3300047323 Bacteria 2166
806 Ga0495683_0092386 3300047323 Bacteria 1464
807 Ga0495683_0481074 3300047323 Bacteria 506
808 Ga0495675_0062455 3300047444 Bacteria 2358
809 Ga0495675_0152476 3300047444 Bacteria 1427
810 Ga0495677_0167631 3300047445 Bacteria 849
811 Ga0495679_045479 3300047446 Bacteria 1341
812 Ga0495673_0000262 3300047469 Bacteria 73125
813 Ga0495681_0004971 3300047470 Bacteria 8969
814 Ga0495681_0236540 3300047470 Bacteria 727
815 Ga0495684_0033903 3300047471 Bacteria 3917
816 Ga0495684_0044396 3300047471 Bacteria 3403
817 Ga0495686_0006486 3300047472 Bacteria 8942
818 Ga0495686_0085480 3300047472 Bacteria 1921
819 Ga0495593_0002353 3300047673 Bacteria 11354
820 Ga0495615_0019909 3300048090 Bacteria 1496
821 Ga0495615_0084000 3300048090 Bacteria 877
822 Ga0495615_0236461 3300048090 Bacteria 575
823 Ga0495626_0157633 3300048091 Bacteria 953
824 Ga0496102_0026104 3300048905 Bacteria 5207
825 Ga0496102_0187948 3300048905 Bacteria 1947
826 Ga0496102_0630746 3300048905 Bacteria 995
827 Ga0496103_0056013 3300048906 Bacteria 2446
828 Ga0496103_0670736 3300048906 Bacteria 658
829 Ga0496104_0060918 3300048907 Bacteria 3576
830 Ga0496105_0099713 3300048908 Bacteria 2399
831 Ga0496105_0519911 3300048908 Bacteria 932
832 Ga0496106_0267418 3300048909 Bacteria 1369
833 Ga0496106_0417687 3300048909 Bacteria 1078
834 Ga0496106_0766376 3300048909 Bacteria 766
835 Ga0496107_0938634 3300048910 Bacteria 630
836 Ga0496108_0456662 3300048911 Bacteria 1116
837 Ga0496108_0475775 3300048911 Bacteria 1091
838 Ga0496109_0113500 3300048912 Bacteria 2520
839 Ga0496109_0161697 3300048912 Bacteria 2098
840 Ga0496109_0238574 3300048912 Bacteria 1711
841 Ga0496109_0675759 3300048912 Bacteria 970
842 Ga0496110_0392239 3300048913 Bacteria 1265
843 Ga0496110_0438318 3300048913 Bacteria 1191
844 Ga0496110_0506645 3300048913 Bacteria 1099
845 Ga0496111_0529126 3300048914 Bacteria 866
846 Ga0496112_0109854 3300048915 Bacteria 2728
847 Ga0496112_0232236 3300048915 Bacteria 1799
848 Ga0496113_0318338 3300048916 Bacteria 1247
849 Ga0496114_0004770 3300048917 Bacteria 10553
850 Ga0496114_0062562 3300048917 Bacteria 3115
851 Ga0496114_0867682 3300048917 Unclassified 783
852 Ga0496121_0270066 3300048924 Bacteria 1169
853 Ga0496122_0047722 3300048925 Bacteria 3303
854 Ga0496126_0015124 3300048929 Bacteria 7772
855 Ga0495682_0000326 3300049460 Bacteria 35389
856 Ga0495682_0099259 3300049460 Bacteria 1044
857 Ga0501033_0075985 3300049570 Bacteria 2466
858 Ga0501034_0005625 3300049571 Bacteria 13649
859 Ga0501034_0078424 3300049571 Bacteria 3307
860 Ga0501042_0214114 3300049578 Bacteria 1390
861 Ga0501046_0039375 3300049580 Bacteria 3786
862 Ga0501046_0481942 3300049580 Bacteria 890
863 Ga0501067_0212362 3300049583 Bacteria 1078
864 Ga0501070_0014171 3300049586 Bacteria 6709
865 Ga0501070_0052313 3300049586 Bacteria 3390
866 Ga0501076_1065046 3300049592 Bacteria 666
867 Ga0501080_0025798 3300049742 Bacteria 5460
868 Ga0501035_0392170 3300049822 Bacteria 1156
869 Ga0501035_0409813 3300049822 Bacteria 1126
870 Ga0501044_0299399 3300049823 Unclassified 1537
871 Ga0501044_0540016 3300049823 Bacteria 1064
872 nmdc:mga06z11_645550_c1 3300050494 Bacteria 644
873 nmdc:mga07m45_498581_c1 3300050496 Bacteria 705
874 nmdc:mga05p37_1111828_c1 3300050507 Bacteria 826
875 nmdc:mga05p37_18810_c2 3300050507 Bacteria 2328
876 nmdc:mga05p37_2010921_c1 3300050507 Bacteria 546
877 nmdc:mga09592_1493334_c1 3300050508 Bacteria 550
878 nmdc:mga09592_205941_c1 3300050508 Bacteria 1704
879 nmdc:mga0qj67_58412_c1 3300050509 Bacteria 3059
880 nmdc:mga06r32_1530312_c1 3300050510 Bacteria 607
881 nmdc:mga06r32_1553754_c1 3300050510 Bacteria 601
882 nmdc:mga06r32_284728_c1 3300050510 Bacteria 1640
883 nmdc:mga06r32_973622_c1 3300050510 Bacteria 802
884 nmdc:mga08y16_1465637_c1 3300050511 Bacteria 644
885 nmdc:mga08y16_168644_c2 3300050511 Bacteria 1589
886 nmdc:mga08y16_532409_c1 3300050511 Bacteria 1190
887 nmdc:mga0n895_27394_c1 3300050512 Bacteria 5414
888 nmdc:mga0n895_497335_c1 3300050512 Bacteria 1229
889 nmdc:mga0n895_700242_c1 3300050512 Bacteria 1009
890 nmdc:mga0n895_843399_c1 3300050512 Bacteria 905
891 nmdc:mga08x19_385170_c1 3300050514 Bacteria 982
892 nmdc:mga08x19_88773_c1 3300050514 Bacteria 2038
893 nmdc:mga0a205_1006403_c1 3300050515 Bacteria 680
894 nmdc:mga0a205_127685_c1 3300050515 Bacteria 2443
895 nmdc:mga0a205_215176_c1 3300050515 Bacteria 1808
896 nmdc:mga0a205_5396_c1 3300050515 Bacteria 11530
897 Ga0495619_0413198 3300053085 Bacteria 931
898 Ga0500643_132434 3300053087 Bacteria 670
899 Ga0500644_0017328 3300053088 Bacteria 2090
900 Ga0500644_0158542 3300053088 Bacteria 913
901 Ga0500651_0028542 3300053093 Bacteria 3508
902 Ga0500566_0077911 3300053094 Bacteria 1850
903 Ga0500650_0106382 3300053098 Bacteria 1311
904 Ga0500623_050407 3300053127 Bacteria 2096
905 Ga0500628_000974 3300053129 Bacteria 5030
906 Ga0500642_0031538 3300053130 Bacteria 2215
907 Ga0500652_000076 3300053131 Bacteria 42942
908 Ga0500568_0039241 3300053139 Bacteria 1912
909 Ga0500577_0141093 3300053142 Bacteria 1016
910 Ga0500586_040071 3300053145 Bacteria 1585
911 Ga0500589_138771 3300053147 Bacteria 1005
912 Ga0500604_0007120 3300053151 Bacteria 2960
913 Ga0500622_0000236 3300053156 Bacteria 57393
914 Ga0068869_100688636
915 SwRhRL2b_contig_1041543
916 ARcpr5oldR_c016840
917 rootL2_10000415
918 Ga0065715_10013988
919 Ga0065715_10140931
920 Ga0070658_10157300
921 Ga0070658_10526545
922 Ga0070658_10536424
923 Ga0070658_11414876
924 Ga0070676_10968853
925 Ga0070683_100123594
926 Ga0070683_100146292
927 Ga0070683_100235318
928 Ga0070683_100686450
929 Ga0070690_100001170
930 Ga0070690_100011978
931 Ga0070670_100003894
932 Ga0070670_100005698
933 Ga0070670_100035529
934 Ga0070670_100173155
935 Ga0070670_100328211
936 Ga0070670_100434785
937 Ga0070670_101611927
938 Ga0070677_10092614
939 Ga0070677_10524321
940 Ga0070677_10707856
941 Ga0070666_10008526
942 Ga0070680_100134706
943 Ga0070680_100243649
944 Ga0070680_100331935
945 Ga0070680_100974814
946 Ga0070682_100857650
947 Ga0068868_100014926
948 Ga0068868_100237433
949 Ga0068868_102381742
950 Ga0070660_100003994
951 Ga0070660_100110289
952 Ga0070660_100247166
953 Ga0070660_100641026
954 Ga0070660_101457113
955 Ga0070689_100489510
956 Ga0070689_100659325
957 Ga0070691_10568825
958 Ga0070687_100013469
959 Ga0070661_100012304
960 Ga0070661_100044413
961 Ga0070661_100096892
962 Ga0070661_100633371
963 Ga0070661_100817374
964 Ga0070668_100010288
965 Ga0070668_100228665
966 Ga0070669_100000130
967 Ga0070669_100026278
968 Ga0070669_100029392
969 Ga0070675_100002617
970 Ga0070675_100922424
971 Ga0070671_100023372
972 Ga0070671_100115523
973 Ga0070671_100299398
974 Ga0070671_100935699
975 Ga0070673_100020448
976 Ga0070673_100040400
977 Ga0070673_100689019
978 Ga0070673_101317248
979 Ga0070673_101411230
980 Ga0070688_100058391
981 Ga0070688_100506081
982 Ga0070659_100480068
983 Ga0070659_100578164
984 Ga0070667_100002126
985 Ga0070667_100037440
986 Ga0070667_100054780
987 Ga0070667_100796079
988 Ga0070667_101493537
989 Ga0070714_100006729
990 Ga0070714_100717021
991 Ga0070713_100068119
992 Ga0070713_100513486
993 Ga0070701_10852229
994 Ga0070711_100281133
995 Ga0070711_101352739
996 Ga0070705_100328073
997 Ga0070705_100997214
998 Ga0070700_100341360
999 Ga0070700_100637859
1000 Ga0070694_100615837
1001 Ga0070694_100983098
1002 Ga0070708_100259133
1003 Ga0070663_100080859
1004 Ga0070663_100106380
1005 Ga0070663_100613112
1006 Ga0070663_100811887
1007 Ga0070678_100014617
1008 Ga0070678_100021272
1009 Ga0070678_100586509
1010 Ga0070662_101265213
1011 Ga0070681_10114497
1012 Ga0070681_10611118
1013 Ga0068867_100227684
1014 Ga0070706_100000729
1015 Ga0070706_100047532
1016 Ga0070706_101714926
1017 Ga0070698_101160265
1018 Ga0070679_100783261
1019 Ga0070684_100150140
1020 Ga0070684_100369463
1021 Ga0070684_100759059
1022 Ga0070697_101443162
1023 Ga0070697_101710854
1024 Ga0068853_100248746
1025 Ga0068853_100317455
1026 Ga0068853_100368092
1027 Ga0068853_100835843
1028 Ga0068853_101406138
1029 Ga0070672_100002530
1030 Ga0070672_100039524
1031 Ga0070672_100064285
1032 Ga0070672_100101633
1033 Ga0070672_100544189
1034 Ga0070686_100019085
1035 Ga0070686_100105927
1036 Ga0070695_100390892
1037 Ga0070696_100005507
1038 Ga0070696_100302947
1039 Ga0070696_100794332
1040 Ga0070696_100909317
1041 Ga0070693_100299818
1042 Ga0070665_100000379
1043 Ga0070665_100122874
1044 Ga0070665_100366825
1045 Ga0070704_101020893
1046 Ga0068855_100083099
1047 Ga0068855_100331680
1048 Ga0068855_100556863
1049 Ga0068855_100878136
1050 Ga0068855_101342331
1051 Ga0068855_101936058
1052 Ga0068855_102173936
1053 Ga0068855_102453644
1054 Ga0070664_100004320
1055 Ga0070664_100088327
1056 Ga0070664_100536568
1057 Ga0070664_100555721
1058 Ga0070664_100634818
1059 Ga0068857_100097924
1060 Ga0068857_100349253
1061 Ga0068854_100143543
1062 Ga0068854_100231588
1063 Ga0068854_101403126
1064 Ga0068856_100194539
1065 Ga0068856_100204457
1066 Ga0068856_100280232
1067 Ga0070702_100093248
1068 Ga0070702_100282826
1069 Ga0070702_100973503
1070 Ga0068852_100077154
1071 Ga0068852_100100210
1072 Ga0068852_100186574
1073 Ga0068852_100754166
1074 Ga0068852_101092467
1075 Ga0068859_100294972
1076 Ga0068859_100587159
1077 Ga0068859_101281396
1078 Ga0068864_100008915
1079 Ga0068864_100024725
1080 Ga0068864_100025724
1081 Ga0068864_100669350
1082 Ga0068864_100911167
1083 Ga0068866_10401728
1084 Ga0068866_11020470
1085 Ga0068861_101182868
1086 Ga0068861_102552042
1087 Ga0068870_10086820
1088 Ga0068870_10799111
1089 Ga0068870_11006631
1090 Ga0068863_100014714
1091 Ga0068863_100219709
1092 Ga0068863_100257501
1093 Ga0068863_100276083
1094 Ga0068863_101172534
1095 Ga0068858_100029892
1096 Ga0068858_100192548
1097 Ga0068858_100362841
1098 Ga0068858_101573336
1099 Ga0068860_100104417
1100 Ga0068860_100228868
1101 Ga0068862_100207801
1102 Ga0068862_100536010
1103 Ga0068862_100588621
1104 Ga0068862_102487726
1105 Ga0081455_10077025
1106 Ga0081455_10093586
1107 Ga0081455_10191655
1108 Ga0081455_10291334
1109 Ga0081538_10360341
1110 Ga0081539_10375654
1111 Ga0070717_10175129
1112 Ga0070717_10180503
1113 Ga0075363_100728229
1114 Ga0070715_10687425
1115 Ga0070712_100224924
1116 Ga0075366_10291877
1117 Ga0097621_100005815
1118 Ga0097621_100042892
1119 Ga0097621_100044054
1120 Ga0097621_100065709
1121 Ga0097621_100944407
1122 Ga0068871_100010010
1123 Ga0068871_100016550
1124 Ga0068871_100321055
1125 Ga0068871_100449655
1126 Ga0068871_100791363
1127 Ga0075428_100060232
1128 Ga0075428_100223563
1129 Ga0075430_100000352
1130 Ga0075431_100007157
1131 Ga0075431_100763738
1132 Ga0075431_101155989
1133 Ga0075433_10095096
1134 Ga0075433_10584906
1135 Ga0075434_100371759
1136 Ga0075434_100814684
1137 Ga0075429_100558959
1138 Ga0075429_100682760
1139 Ga0068865_100124433
1140 Ga0075436_100045137
1141 Ga0075436_100274952
1142 Ga0097620_100294971
1143 Ga0097620_100587164
1144 Ga0097620_101281407
1145 Ga0075435_100434265
1146 Ga0075435_100761274
1147 Ga0075435_100966103
1148 Ga0075435_101073227
1149 Ga0075435_101491826
1150 Ga0105240_10000021
1151 Ga0105240_10053328
1152 Ga0111539_10447008
1153 Ga0111539_10717773
1154 Ga0111539_11578416
1155 Ga0111539_12166703
1156 Ga0105245_10281476
1157 Ga0105245_10336910
1158 Ga0105247_10281501
1159 Ga0105247_10940113
1160 Ga0114129_10019046
1161 Ga0114129_10190806
1162 Ga0114129_11962185
1163 Ga0114129_11993030
1164 Ga0114129_12782406
1165 Ga0105243_10072635
1166 Ga0105241_10046494
1167 Ga0105241_10339458
1168 Ga0105241_12025246
1169 Ga0105242_10311609
1170 Ga0105242_11516168
1171 Ga0105242_11567996
1172 Ga0105242_11687708
1173 Ga0105248_10025897
1174 Ga0105248_10043113
1175 Ga0105248_10168423
1176 Ga0105248_10221509
1177 Ga0105248_11006689
1178 Ga0105237_12685228
1179 Ga0105238_10174733
1180 Ga0105249_10391429
1181 Ga0105249_10414821
1182 Ga0105249_12581977
1183 Ga0105032_103903
1184 Ga0105239_10021770
1185 Ga0105239_10196982
1186 Ga0105239_10514222
1187 Ga0105239_11883343
1188 Ga0105239_12844325
1189 Ga0105246_10218168
1190 Ga0105246_11109744
1191 Ga0105246_11409753
1192 Ga0157335_1014612
1193 Ga0157319_1012508
1194 Ga0157347_1042685
1195 Ga0157342_1073801
1196 Ga0157373_10073638
1197 Ga0157373_10156287
1198 Ga0157373_10303758
1199 Ga0157371_10026042
1200 Ga0157371_10035768
1201 Ga0157371_10036528
1202 Ga0157371_10058946
1203 Ga0157371_10204510
1204 Ga0157370_10129725
1205 Ga0157370_10335579
1206 Ga0157370_11094884
1207 Ga0157369_10110956
1208 Ga0157369_10325471
1209 Ga0157369_10702500
1210 Ga0157369_11293556
1211 Ga0157369_12529258
1212 Ga0157374_10034347
1213 Ga0157374_10063082
1214 Ga0157374_10104853
1215 Ga0157374_10824950
1216 Ga0157374_11067666
1217 Ga0157378_10179830
1218 Ga0157378_10281090
1219 Ga0163162_10027387
1220 Ga0163162_10269353
1221 Ga0163162_11712274
1222 Ga0157372_10014677
1223 Ga0157372_10047545
1224 Ga0157372_10047686
1225 Ga0157372_10258185
1226 Ga0157372_10898378
1227 Ga0157375_10011174
1228 Ga0157375_10022253
1229 Ga0157375_10286152
1230 Ga0157375_11251950
1231 Ga0157375_11896288
1232 Ga0163163_10011474
1233 Ga0163163_10037699
1234 Ga0163163_10089840
1235 Ga0163163_10220910
1236 Ga0163163_11008927
1237 Ga0157380_10145216
1238 Ga0157380_12148488
1239 Ga0182008_10209936
1240 Ga0157377_10246268
1241 Ga0157377_10827929
1242 Ga0157377_11022368
1243 Ga0157377_11771945
1244 Ga0157379_10028109
1245 Ga0157379_10853364
1246 Ga0157379_11201331
1247 Ga0157376_10031005
1248 Ga0157376_10039819
1249 Ga0157376_10078433
1250 Ga0182007_10376596
1251 Ga0163161_10057804
1252 Ga0163161_10153903
1253 Ga0163161_10868392
1254 Ga0163161_11229822
1255 Ga0209564_1002653
1256 Ga0207697_10109575
1257 Ga0207656_10010952
1258 Ga0207682_10068262
1259 Ga0207688_10428423
1260 Ga0207680_10009139
1261 Ga0207680_10009229
1262 Ga0207647_10420116
1263 Ga0207645_10210813
1264 Ga0207645_10566674
1265 Ga0207643_10199950
1266 Ga0207643_10276110
1267 Ga0207643_10665954
1268 Ga0207705_10037708
1269 Ga0207705_10108757
1270 Ga0207705_10204926
1271 Ga0207705_10343488
1272 Ga0207705_10390512
1273 Ga0207705_10655060
1274 Ga0207705_10715348
1275 Ga0207684_10000249
1276 Ga0207684_10223701
1277 Ga0207684_10544532
1278 Ga0207654_10010307
1279 Ga0207654_10315278
1280 Ga0207707_10044820
1281 Ga0207707_10088216
1282 Ga0207707_10205933
1283 Ga0207707_10307854
1284 Ga0207695_10000083
1285 Ga0207695_10059179
1286 Ga0207695_10260454
1287 Ga0207695_10650366
1288 Ga0207671_10626462
1289 Ga0207693_10201824
1290 Ga0207663_10241903
1291 Ga0207660_10012842
1292 Ga0207660_10054791
1293 Ga0207660_10448899
1294 Ga0207662_10052316
1295 Ga0207662_10191522
1296 Ga0207662_10231576
1297 Ga0207662_10410490
1298 Ga0207662_10440262
1299 Ga0207662_11356857
1300 Ga0207657_10001588
1301 Ga0207657_10187948
1302 Ga0207657_10190059
1303 Ga0207657_10200662
1304 Ga0207657_10639054
1305 Ga0207649_10027084
1306 Ga0207649_10208044
1307 Ga0207652_10037996
1308 Ga0207652_10303941
1309 Ga0207652_10438935
1310 Ga0207646_10136081
1311 Ga0207681_10000016
1312 Ga0207681_10046394
1313 Ga0207650_10034428
1314 Ga0207650_10081275
1315 Ga0207650_10136265
1316 Ga0207650_10579457
1317 Ga0207659_10054587
1318 Ga0207659_10126345
1319 Ga0207659_10185873
1320 Ga0207659_10796233
1321 Ga0207700_11596250
1322 Ga0207664_10005143
1323 Ga0207664_10173135
1324 Ga0207644_10296179
1325 Ga0207644_10400008
1326 Ga0207644_10585852
1327 Ga0207690_10005180
1328 Ga0207690_10135515
1329 Ga0207706_10407697
1330 Ga0207706_10756820
1331 Ga0207686_10263409
1332 Ga0207686_10880063
1333 Ga0207709_10130906
1334 Ga0207709_10519590
1335 Ga0207709_11737107
1336 Ga0207670_10027837
1337 Ga0207670_10285608
1338 Ga0207670_11006518
1339 Ga0207704_10041837
1340 Ga0207704_10900821
1341 Ga0207704_11322676
1342 Ga0207665_11219906
1343 Ga0207691_10004663
1344 Ga0207691_10005035
1345 Ga0207691_10025419
1346 Ga0207691_10047731
1347 Ga0207691_10278649
1348 Ga0207711_10012890
1349 Ga0207711_10146171
1350 Ga0207711_10277669
1351 Ga0207711_10474310
1352 Ga0207689_10646900
1353 Ga0207661_10018076
1354 Ga0207661_10763142
1355 Ga0207661_11702383
1356 Ga0207679_10061976
1357 Ga0207679_10127745
1358 Ga0207679_10227907
1359 Ga0207679_10253149
1360 Ga0207679_10417623
1361 Ga0207667_10029168
1362 Ga0207667_10136162
1363 Ga0207667_10393835
1364 Ga0207667_10481544
1365 Ga0207651_10001224
1366 Ga0207651_10023284
1367 Ga0207651_11142497
1368 Ga0207651_11386514
1369 Ga0207712_10363735
1370 Ga0207712_11707358
1371 Ga0207668_10034105
1372 Ga0207668_11050188
1373 Ga0207640_10058752
1374 Ga0207640_10299088
1375 Ga0207640_12082144
1376 Ga0207658_10014761
1377 Ga0207658_10061197
1378 Ga0207658_10152961
1379 Ga0207658_11117742
1380 Ga0207677_10012057
1381 Ga0207677_10043998
1382 Ga0207677_10200874
1383 Ga0207677_10727811
1384 Ga0207703_10005239
1385 Ga0207703_10237684
1386 Ga0207703_11689799
1387 Ga0207703_11853842
1388 Ga0207639_10027797
1389 Ga0207639_11548031
1390 Ga0207639_12057286
1391 Ga0207678_10009602
1392 Ga0207678_10157190
1393 Ga0207678_10544583
1394 Ga0207678_10696371
1395 Ga0207708_10267143
1396 Ga0207708_11119712
1397 Ga0207702_10002552
1398 Ga0207702_10081871
1399 Ga0207702_10690995
1400 Ga0207641_10177914
1401 Ga0207641_10724211
1402 Ga0207641_10740860
1403 Ga0207641_10817003
1404 Ga0207641_11087184
1405 Ga0207641_11344944
1406 Ga0207676_10012598
1407 Ga0207676_10027601
1408 Ga0207676_10055718
1409 Ga0207676_10068779
1410 Ga0207676_10390469
1411 Ga0207676_11827947
1412 Ga0207674_10134342
1413 Ga0207674_10177073
1414 Ga0207674_10376001
1415 Ga0207674_10536082
1416 Ga0207674_10536527
1417 Ga0207674_10844617
1418 Ga0207675_100361783
1419 Ga0207675_100429846
1420 Ga0207683_10005718
1421 Ga0207683_10026945
1422 Ga0207683_10073855
1423 Ga0207683_11666465
1424 Ga0207698_10252960
1425 Ga0207698_11608155
1426 Ga0207698_12001694
1427 Ga0207698_12187843
1428 Ga0209179_1070594
1429 Ga0209999_1105469
1430 Ga0209966_1174317
1431 Ga0209974_10062839
1432 Ga0207428_10681706
1433 Ga0268266_10001791
1434 Ga0268266_10226801
1435 Ga0268265_10393768
1436 Ga0268265_10641947
1437 Ga0268265_11279356
1438 Ga0268265_12030748
1439 Ga0268264_10237617
1440 Ga0268264_12338099
1441 Ga0265334_10000014
1442 Ga0307517_10526453
1443 Ga0307515_10000425
1444 Ga0265338_10052097
1445 Ga0265338_10749334
1446 Ga0316177_1195276
1447 Ga0316176_1102781
1448 Ga0265330_10192074
1449 Ga0265332_10015259
1450 Ga0265320_10000059
1451 Ga0265325_10094637
1452 Ga0265329_10218647
1453 Ga0265339_10003360
1454 Ga0265331_10537510
1455 Ga0307513_10240832
1456 Ga0307408_100000052
1457 Ga0307408_100098004
1458 Ga0307408_101966886
1459 Ga0307508_10882745
1460 Ga0265314_10003562
1461 Ga0265342_10006487
1462 Ga0316576_10512581
1463 Ga0307405_10510149
1464 Ga0307413_10805325
1465 Ga0307410_10270054
1466 Ga0307410_11336868
1467 Ga0307406_10327176
1468 Ga0307406_11476034
1469 Ga0307409_100910129
1470 Ga0307409_102652824
1471 Ga0307416_100360411
1472 Ga0307416_100979215
1473 Ga0307414_10063524
1474 Ga0307414_10242935
1475 Ga0307414_10346490
1476 Ga0307507_10665227
1477 Ga0373926_0295938
1478 Ga0373928_0142079
1479 Ga0373934_0157249
1480 Ga0373934_0475480
1481 Ga0373944_0165770
1482 Ga0373944_0342546
1483 Ga0373951_0042417
1484 Ga0373952_0120837
1485 Ga0373923_0501240
1486 Ga0373936_0142408
1487 Ga0373953_0017990
1488 Ga0373953_0234838
1489 Ga0373954_0013929
1490 Ga0373954_0206420
1491 Ga0373956_0211101
1492 Ga0373956_0267906
1493 Ga0373956_0309453
1494 Ga0373957_0005424
1495 Ga0373943_0609647
1496 Ga0373946_0366536
1497 Ga0373955_0003055
1498 Ga0373955_0636768
1499 Ga0373961_0222504
1500 Ga0373962_0292142
1501 Ga0373962_0363660
1502 Ga0373924_0004612
1503 Ga0373931_0140256
1504 Ga0373931_0260611
1505 Ga0373935_0207026
1506 Ga0373927_0052911
1507 Ga0373927_0285315
1508 Ga0373933_0037359
1509 Ga0373933_0607233
1510 Ga0373933_0715413
1511 Ga0373947_0792037
1512 Ga0373937_0018590
1513 Ga0373937_0019935
1514 Ga0373937_0064977
1515 Ga0373937_0559847
1516 Ga0373937_1206883
1517 Ga0373925_0027485
1518 Ga0373925_0503320
1519 Ga0395900_0067903
1520 Ga0395900_0517009
1521 Ga0395900_0541064
1522 Ga0395898_0190041
1523 Ga0395905_0271690
1524 Ga0395901_0009319
1525 Ga0395901_0161195
1526 Ga0395901_0970882
1527 Ga0395901_1811897
1528 Ga0439436_0005108
1529 Ga0439465_0015534
1530 Ga0439465_0319919
1531 Ga0451789_1086300
1532 Ga0451791_1321094
1533 Ga0451791_1887272
1534 Ga0451793_0846499
1535 Ga0451793_1467702
1536 Ga0451797_0445999
1537 Ga0451797_0574674
1538 Ga0451795_1028350
1539 Ga0451807_1167832
1540 Ga0451837_0257342
1541 Ga0451837_1290614
1542 Ga0451851_0846263
1543 Ga0451843_1004066
1544 Ga0451843_1133094
1545 Ga0451843_1185491
1546 Ga0439448_0146638
1547 Ga0439432_013383
1548 Ga0439449_0025820
1549 Ga0439449_0064453
1550 Ga0439449_0078310
1551 Ga0439452_041619
1552 Ga0439463_026210
1553 Ga0450903_000545
1554 Ga0439460_0000280
1555 Ga0451577_0002859
1556 Ga0451577_0004094
1557 Ga0451577_0009700
1558 Ga0451577_0065649
1559 Ga0451577_0454410
1560 Ga0451577_1123844
1561 Ga0466972_0001665
1562 Ga0453683_0150477
1563 Ga0453683_0232215
1564 Ga0453684_0003650
1565 Ga0453684_0021892
1566 Ga0453684_0052400
1567 Ga0453684_0190552
1568 Ga0453684_1066375
1569 Ga0453684_1477321
1570 Ga0466971_0445615
1571 Ga0466957_0021327
1572 Ga0451576_0002452
1573 Ga0451576_0048474
1574 Ga0451576_1652928
1575 Ga0495617_000079
1576 Ga0495617_000116
1577 Ga0495592_0041360
1578 Ga0495592_0270100
1579 Ga0495603_0082571
1580 Ga0495591_157102
1581 Ga0495629_0000001
1582 Ga0495629_0240617
1583 Ga0495629_0433091
1584 Ga0495638_0011638
1585 Ga0495638_0020583
1586 Ga0495638_0301295
1587 Ga0495651_0078940
1588 Ga0495650_0001832
1589 Ga0495650_0013892
1590 Ga0495580_0679130
1591 Ga0495582_0042920
1592 Ga0495582_0092048
1593 Ga0495582_0357034
1594 Ga0495639_0020584
1595 Ga0495639_0365331
1596 Ga0495639_0413149
1597 Ga0495662_0156924
1598 Ga0495662_0180209
1599 Ga0495664_0024325
1600 Ga0495584_0001736
1601 Ga0495584_0112702
1602 Ga0495584_0373140
1603 Ga0495585_0000061
1604 Ga0495585_0000160
1605 Ga0495585_0591037
1606 Ga0495594_0042264
1607 Ga0495594_0290552
1608 Ga0495607_0192643
1609 Ga0495607_0511111
1610 Ga0495583_0154257
1611 Ga0495606_0014804
1612 Ga0495606_0427338
1613 Ga0495608_0007588
1614 Ga0495610_0023717
1615 Ga0495616_0002979
1616 Ga0495616_0332940
1617 Ga0495618_0012395
1618 Ga0495618_0384017
1619 Ga0495620_0002249
1620 Ga0495620_0156166
1621 Ga0495628_0093367
1622 Ga0495628_0261091
1623 Ga0495630_0007364
1624 Ga0495630_0020127
1625 Ga0495630_0410395
1626 Ga0495631_0002296
1627 Ga0495631_0437528
1628 Ga0495632_0007217
1629 Ga0495632_0009517
1630 Ga0495632_0053139
1631 Ga0495637_0009441
1632 Ga0495637_0190461
1633 Ga0495643_0013859
1634 Ga0495643_0109676
1635 Ga0495644_0286199
1636 Ga0495648_0000096
1637 Ga0495648_0000190
1638 Ga0495648_0036045
1639 Ga0495663_0011931
1640 Ga0495663_0275906
1641 Ga0495666_0020379
1642 Ga0495666_0203983
1643 Ga0495642_0027969
1644 Ga0495642_0155740
1645 Ga0495652_0911630
1646 Ga0495654_0004069
1647 Ga0495654_0013444
1648 Ga0495640_0298160
1649 Ga0495586_0008890
1650 Ga0495586_0040693
1651 Ga0495587_0183756
1652 Ga0495587_0489851
1653 Ga0495598_0075539
1654 Ga0495609_0010652
1655 Ga0495621_0003852
1656 Ga0495621_0007120
1657 Ga0495622_0062906
1658 Ga0495633_0008418
1659 Ga0495633_0110334
1660 Ga0495633_0180883
1661 Ga0495633_0375669
1662 Ga0495667_0030361
1663 Ga0495667_0152974
1664 Ga0495667_0367040
1665 Ga0495656_0027581
1666 Ga0495656_0248104
1667 Ga0495668_0001741
1668 Ga0495668_0191049
1669 Ga0495668_0327296
1670 Ga0495634_0008655
1671 Ga0495634_0010808
1672 Ga0495634_0193841
1673 Ga0495611_0242929
1674 Ga0495611_0423990
1675 Ga0495625_0027264
1676 Ga0495625_0214514
1677 Ga0495635_0082284
1678 Ga0495635_1009559
1679 Ga0495659_0012303
1680 Ga0495661_0045483
1681 Ga0495661_0056138
1682 Ga0495661_0204293
1683 Ga0495661_0207861
1684 Ga0495657_0239406
1685 Ga0495599_0333858
1686 Ga0495623_0605674
1687 Ga0495647_0004407
1688 Ga0495647_0083102
1689 Ga0495647_0130652
1690 Ga0495658_0247585
1691 Ga0495669_0035457
1692 Ga0495613_0001726
1693 Ga0495613_0853728
1694 Ga0495624_0362269
1695 Ga0495670_0002973
1696 Ga0495670_0085546
1697 Ga0495671_0007520
1698 Ga0495671_0377304
1699 Ga0495649_0316452
1700 Ga0495589_0001915
1701 Ga0495589_0369562
1702 Ga0495600_0629562
1703 Ga0495660_0002227
1704 Ga0495660_0041542
1705 Ga0495581_0824462
1706 Ga0495604_0452256
1707 Ga0495636_0047654
1708 Ga0495674_0245325
1709 Ga0495674_0309700
1710 Ga0495672_0098582
1711 Ga0495676_0116498
1712 Ga0495680_0012800
1713 Ga0495680_0016980
1714 Ga0495680_0038154
1715 Ga0495680_0188335
1716 Ga0495680_0709401
1717 Ga0495683_0018275
1718 Ga0495683_0046991
1719 Ga0495683_0092386
1720 Ga0495683_0481074
1721 Ga0495675_0062455
1722 Ga0495675_0152476
1723 Ga0495677_0167631
1724 Ga0495679_045479
1725 Ga0495673_0000262
1726 Ga0495681_0004971
1727 Ga0495681_0236540
1728 Ga0495684_0033903
1729 Ga0495684_0044396
1730 Ga0495686_0006486
1731 Ga0495686_0085480
1732 Ga0495593_0002353
1733 Ga0495615_0019909
1734 Ga0495615_0084000
1735 Ga0495615_0236461
1736 Ga0495626_0157633
1737 Ga0496102_0026104
1738 Ga0496102_0187948
1739 Ga0496102_0630746
1740 Ga0496103_0056013
1741 Ga0496103_0670736
1742 Ga0496104_0060918
1743 Ga0496105_0099713
1744 Ga0496105_0519911
1745 Ga0496106_0267418
1746 Ga0496106_0417687
1747 Ga0496106_0766376
1748 Ga0496107_0938634
1749 Ga0496108_0456662
1750 Ga0496108_0475775
1751 Ga0496109_0113500
1752 Ga0496109_0161697
1753 Ga0496109_0238574
1754 Ga0496109_0675759
1755 Ga0496110_0392239
1756 Ga0496110_0438318
1757 Ga0496110_0506645
1758 Ga0496111_0529126
1759 Ga0496112_0109854
1760 Ga0496112_0232236
1761 Ga0496113_0318338
1762 Ga0496114_0004770
1763 Ga0496114_0062562
1764 Ga0496114_0867682
1765 Ga0496121_0270066
1766 Ga0496122_0047722
1767 Ga0496126_0015124
1768 Ga0495682_0000326
1769 Ga0495682_0099259
1770 Ga0501033_0075985
1771 Ga0501034_0005625
1772 Ga0501034_0078424
1773 Ga0501042_0214114
1774 Ga0501046_0039375
1775 Ga0501046_0481942
1776 Ga0501067_0212362
1777 Ga0501070_0014171
1778 Ga0501070_0052313
1779 Ga0501076_1065046
1780 Ga0501080_0025798
1781 Ga0501035_0392170
1782 Ga0501035_0409813
1783 Ga0501044_0299399
1784 Ga0501044_0540016
1785 nmdc:mga06z11_645550_c1
1786 nmdc:mga07m45_498581_c1
1787 nmdc:mga05p37_1111828_c1
1788 nmdc:mga05p37_18810_c2
1789 nmdc:mga05p37_2010921_c1
1790 nmdc:mga09592_1493334_c1
1791 nmdc:mga09592_205941_c1
1792 nmdc:mga0qj67_58412_c1
1793 nmdc:mga06r32_1530312_c1
1794 nmdc:mga06r32_1553754_c1
1795 nmdc:mga06r32_284728_c1
1796 nmdc:mga06r32_973622_c1
1797 nmdc:mga08y16_1465637_c1
1798 nmdc:mga08y16_168644_c2
1799 nmdc:mga08y16_532409_c1
1800 nmdc:mga0n895_27394_c1
1801 nmdc:mga0n895_497335_c1
1802 nmdc:mga0n895_700242_c1
1803 nmdc:mga0n895_843399_c1
1804 nmdc:mga08x19_385170_c1
1805 nmdc:mga08x19_88773_c1
1806 nmdc:mga0a205_1006403_c1
1807 nmdc:mga0a205_127685_c1
1808 nmdc:mga0a205_215176_c1
1809 nmdc:mga0a205_5396_c1
1810 Ga0495619_0413198
1811 Ga0500643_132434
1812 Ga0500644_0017328
1813 Ga0500644_0158542
1814 Ga0500651_0028542
1815 Ga0500566_0077911
1816 Ga0500650_0106382
1817 Ga0500623_050407
1818 Ga0500628_000974
1819 Ga0500642_0031538
1820 Ga0500652_000076
1821 Ga0500568_0039241
1822 Ga0500577_0141093
1823 Ga0500586_040071
1824 Ga0500589_138771
1825 Ga0500604_0007120
1826 Ga0500622_0000236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qe5-assembly2.cif.gz_B structure of hcv ns5b bound to an anthranilic acid inhibitor 0.7057 72 104
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.697 1 104
5xnx-assembly2.cif.gz_C crystallographic structure of the enzymatically active n-terminal domain of the rel protein from mycobacterium tuberculosis 0.6631 17 47
5xnx-assembly1.cif.gz_D-2 crystallographic structure of the enzymatically active n-terminal domain of the rel protein from mycobacterium tuberculosis 0.6602 17 47
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6495 1 104
ID Description Score Start End Superfamily
af_Q4DUF4_752_869_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7278 75 100 2.30.29.30
4x4pE02 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7129 14 42 3.30.460.10
2p0hA00 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7111 73 98 2.30.29.30
af_Q4DSH6_2_156_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7098 72 100 2.30.29.30
3a8pC01 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6977 72 98 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A3N7EG78-F1-model_v4 Transcription initiation protein 0.8692 2 112
AF-A0A4V3IRX3-F1-model_v4 Transcription initiation protein 0.8637 2 112
AF-A0A0D8HTJ5-F1-model_v4 Transcription initiation protein 0.8637 2 112
AF-A0A158BDI1-F1-model_v4 YCII-related domain-containing protein 0.8619 2 112
AF-A0A7Y5YBJ9-F1-model_v4 Transcription initiation protein 0.8617 2 112

Map