F485451

General Info

Members Datasets Scaffolds Average Seq Length
910 682 517 324

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0029874|Ga0501032_0029874_1628_2608
Length 317
Sequence MKDWKYWLAEQRGTLLAFLTFIVMFTIYVSNHPAGFTANVTQTAANKGVLLAFVAMAQAMVIITAGIDLSVGMIFTLTNCLASWIVVGTPLETALGIVGVLLAGLACGALNGLIVIYGRLQPIVTTIATGAIYYGIALLLRPFPGGGVNEDLADMLTGRIAGIIPTSLIWVPFSRSVMGRAAYATGSSEAAAYMSAMPIRRAKFLTYALAGLLAGIGGLFLTFFTYTGEAALASGNAYTLFSIAAVVLGGVSLYGGTGSAIGAVFGALTFRAIGDLLFVFDLDPLWQPLFQGVVLMIAVSLGAFALLRVRNKLDWFT

Samples

Sample ID Description Type Environment
1 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
5 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
6 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
7 2509276019 Ensifer aridi TW10 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
10 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
11 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
14 2512875024 Mesorhizobium loti R88b Isolate Nodule
15 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
16 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
17 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
18 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
19 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
20 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
21 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
22 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
23 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
24 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
25 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
26 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
27 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
28 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
29 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
30 2516143018 Ensifer sp. BR816 Isolate Nodule
31 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
32 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
33 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
34 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
35 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
36 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
37 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
38 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
39 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
40 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
41 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
42 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
43 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
44 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
45 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
46 2643221557 Ensifer sp. Root558 Isolate Unclassified
47 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
48 2643221610 Ensifer sp. Root74 Isolate Unclassified
49 2643221618 Ensifer sp. Root231 Isolate Unclassified
50 2643221626 Ensifer sp. Root31 Isolate Unclassified
51 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
52 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
53 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
54 2643221655 Ensifer sp. Root1252 Isolate Unclassified
55 2643221659 Ensifer sp. Root127 Isolate Unclassified
56 2643221668 Ensifer sp. Root423 Isolate Unclassified
57 2643221675 Ensifer sp. Root1298 Isolate Unclassified
58 2643221680 Ensifer sp. Root1312 Isolate Unclassified
59 2643221698 Ensifer sp. Root142 Isolate Unclassified
60 2643221712 Ensifer sp. Root258 Isolate Unclassified
61 2643221723 Ensifer sp. Root278 Isolate Unclassified
62 2643221726 Ensifer sp. Root954 Isolate Unclassified
63 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
64 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
65 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
66 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
67 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
68 2718217882 Rhizobium sp. N741 Isolate Nodule
69 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
70 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
71 2718218009 Rhizobium sp. N561 Isolate Nodule
72 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
73 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
74 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
75 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
76 2718218363 Rhizobium sp. N113 Isolate Nodule
77 2718218366 Rhizobium sp. N621 Isolate Nodule
78 2721755514 Rhizobium sp. N6212 Isolate Nodule
79 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
80 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
81 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
82 2721755810 Rhizobium sp. N871 Isolate Nodule
83 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
84 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
85 2728369365 Rhizobium sp. N1341 Isolate Nodule
86 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
87 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
88 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
89 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
90 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
91 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
92 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
93 2791355260 Rhizobium sp. L9 Isolate Nodule
94 2791355264 Rhizobium sp. S9 Isolate Nodule
95 2791355267 Rhizobium sp. L18 Isolate Nodule
96 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
97 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
98 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
99 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
100 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
101 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
102 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
103 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
104 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
105 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
106 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
107 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
108 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
109 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
110 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
111 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
112 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
113 2844163670 Ensifer sp. 1H6 Isolate Unclassified
114 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
115 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
116 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
117 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
118 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
119 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
120 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
121 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
122 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
123 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
124 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
125 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
126 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
127 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
128 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
129 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
130 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
131 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
132 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
133 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
134 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
135 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
136 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
137 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
138 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
139 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
140 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
141 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
142 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
143 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
144 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
145 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
146 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
147 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
148 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
149 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
150 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
151 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
152 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
153 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
154 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
155 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
156 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
157 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
158 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
159 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
160 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
161 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
162 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
163 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
164 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
165 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
166 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
167 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
168 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
169 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
170 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
171 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
172 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
173 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
174 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
175 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
176 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
177 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
178 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
179 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
180 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
181 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
182 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
183 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
184 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
185 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
186 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
187 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
188 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
189 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
190 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
191 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
192 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
193 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
194 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
195 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
196 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
197 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
198 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
199 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
200 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
201 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
202 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
203 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
204 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
205 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
206 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
207 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
208 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
209 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
210 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
211 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
212 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
213 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
214 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
215 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
216 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
217 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
218 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
219 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
220 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
221 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
222 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
223 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
224 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
225 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
226 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
227 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
228 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
229 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
230 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
231 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
232 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
233 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
234 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
235 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
236 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
237 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
238 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
239 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
240 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
241 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
242 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
243 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
244 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
245 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
246 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
247 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
248 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
249 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
250 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
251 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
252 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
253 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
254 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
255 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
256 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
257 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
258 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
259 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
260 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
261 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
262 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
263 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
264 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
265 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
266 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
267 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
268 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
269 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
270 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
271 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
272 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
273 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
274 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
275 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
276 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
277 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
278 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
279 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
280 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
281 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
282 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
283 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
284 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
285 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
286 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
287 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
288 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
289 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
290 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
291 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
292 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
293 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
294 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
295 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
296 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
297 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
298 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
299 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
300 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
301 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
302 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
303 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
304 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
305 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
306 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
307 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
308 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
309 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
310 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
311 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
312 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
313 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
314 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
315 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
316 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
317 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
318 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
319 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
320 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
321 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
322 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
323 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
324 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
325 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
326 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
327 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
328 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
329 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
330 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
331 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
332 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
333 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
334 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
335 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
336 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
337 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
338 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
339 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
340 2996887358 Rhizobium sp. R711 Isolate Nodule
341 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
342 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
343 3004167301 Mesorhizobium loti 582 Isolate Unclassified
344 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
345 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
346 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
347 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
348 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
349 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
350 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
351 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
352 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
353 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
354 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
355 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
356 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
357 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
358 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
359 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
360 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
361 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
362 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
363 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
364 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
365 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
366 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
367 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
368 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
369 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
370 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
371 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
372 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
373 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
374 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
375 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
376 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
377 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
378 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
379 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
380 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
381 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
382 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
383 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
384 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
385 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
386 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
387 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
388 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
389 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
390 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
391 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
392 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
393 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
394 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
395 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
396 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
397 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
398 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
399 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
400 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
401 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
402 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
403 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
404 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
405 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
406 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
407 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
408 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
409 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
410 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
411 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
412 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
413 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
414 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
415 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
416 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
417 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
418 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
419 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
420 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
421 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
422 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
423 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
424 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
425 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
426 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
427 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
428 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
429 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
430 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
431 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
432 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
433 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
434 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
435 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
436 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
437 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
438 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
439 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
440 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
441 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
442 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
443 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
444 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
445 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
446 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
447 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
467 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
468 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
469 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
470 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
471 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
472 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
474 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
476 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
477 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
478 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
479 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
480 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
481 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
482 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
483 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
484 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
485 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
486 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
487 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
488 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
489 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
490 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
491 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
492 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
493 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
494 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
495 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
496 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
497 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
498 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
499 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
500 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
501 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
502 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
503 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
504 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
505 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
506 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
507 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
508 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
509 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
510 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
511 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
512 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
513 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
514 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
515 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
516 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
517 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
518 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
519 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
520 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
521 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
522 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
523 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
524 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
525 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
526 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
527 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
528 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
529 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
530 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
531 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
532 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
533 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
534 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
535 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
536 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
537 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
538 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
539 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
540 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
541 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
542 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
543 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
544 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
545 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
546 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
547 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
548 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
549 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
550 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
551 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
552 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
553 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
554 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
555 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
556 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
557 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
558 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
559 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
560 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
561 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
562 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
563 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
564 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
565 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
566 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
567 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
568 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
569 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
570 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
571 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
572 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
573 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
574 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
575 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
576 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
577 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
578 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
579 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
580 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
581 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
582 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
583 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
584 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
585 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
586 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
587 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
588 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
589 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
590 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
591 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
592 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
593 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
594 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
595 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
596 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
597 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
598 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
599 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
600 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
601 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
602 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
603 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
604 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
605 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
606 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
607 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
608 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
609 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
610 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
611 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
612 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
613 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
614 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
615 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
616 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
617 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
618 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
619 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
620 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
621 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
622 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
623 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
624 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
625 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
626 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
627 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
628 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
629 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
630 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
631 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
632 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
633 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
634 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
635 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
636 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
637 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
638 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
639 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
640 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
641 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
642 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
643 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
644 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
645 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
646 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
647 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
648 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
649 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
650 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
651 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
652 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
653 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
654 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
655 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
656 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
657 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
658 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
659 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
660 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
661 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
662 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
663 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
664 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
665 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
666 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
667 8005258706 Rhizobium sp. R693 Isolate Nodule
668 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
669 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
670 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
671 8005321885 Rhizobium sp. R72 Isolate Nodule
672 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
673 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
674 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
675 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
676 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
677 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
678 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
679 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
680 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
681 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
682 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.81
Metatranscriptomes 0
Isolates 43.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.43
Nodule 34.73
Rhizoplane 3.96
Rhizosphere 35.82
Stem 0
Stem Tuber 0
Unclassified 14.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10035530 3300001979 Bacteria 1557
2 JGI25156J39149_1002921 3300002705 Bacteria 5820
3 JGI25157J39369_1001242 3300002741 Bacteria 10519
4 JGI25152J39213_1001583 3300002773 Bacteria 9555
5 JGI25152J39213_1003036 3300002773 Bacteria 5918
6 JGI25150J39212_1007820 3300002774 Bacteria 2128
7 JGI25159J45721_1000301 3300002987 Bacteria 23207
8 JGI25151J46595_10001032 3300003187 Bacteria 20828
9 JGI25165J46597_1000015 3300003214 Bacteria 380891
10 JGI25153J46596_10002998 3300003215 Bacteria 9555
11 JGI25153J46596_10003010 3300003215 Bacteria 9533
12 JGI25153J46596_10004827 3300003215 Bacteria 7180
13 rootL2_10152327 3300003322 Bacteria 1409
14 rootL2_10161869 3300003322 Bacteria 1351
15 JGI25160J50197_1000014 3300003354 Bacteria 259862
16 JGI25160J50197_1003650 3300003354 Bacteria 6827
17 JGI25161J50226_1000061 3300003374 Bacteria 101391
18 JGI25161J50226_1000093 3300003374 Bacteria 72639
19 Ga0055542_1000406 3300003762 Bacteria 42163
20 Ga0055526_1007241 3300003771 Bacteria 5820
21 Ga0055526_1010797 3300003771 Bacteria 4202
22 Ga0055524_1000446 3300003775 Bacteria 34169
23 Ga0055524_1005694 3300003775 Bacteria 5521
24 Ga0055524_1021068 3300003775 Bacteria 2173
25 Ga0055536_1001554 3300003781 Bacteria 13762
26 Ga0055528_1012309 3300003790 Bacteria 3330
27 Ga0055530_10011721 3300003791 Bacteria 3124
28 Ga0055540_1008130 3300003792 Bacteria 3823
29 Ga0055540_1009579 3300003792 Bacteria 3330
30 Ga0055531_10010519 3300003794 Bacteria 4586
31 Ga0055543_1000005 3300004625 Bacteria 223621
32 Ga0055543_1003163 3300004625 Bacteria 5025
33 Ga0065165_1000126 3300005262 Bacteria 129946
34 Ga0065165_1003297 3300005262 Bacteria 11605
35 Ga0070671_100039567 3300005355 Bacteria 3914
36 Ga0070709_10001298 3300005434 Bacteria 13630
37 Ga0070714_100012337 3300005435 Bacteria 6820
38 Ga0070713_100013346 3300005436 Bacteria 6064
39 Ga0070710_10001248 3300005437 Bacteria 12065
40 Ga0070711_100055605 3300005439 Bacteria 2735
41 Ga0070708_100278341 3300005445 Bacteria 1575
42 Ga0070663_100341655 3300005455 Bacteria 1210
43 Ga0070698_100037207 3300005471 Bacteria 5019
44 Ga0070698_100301071 3300005471 Bacteria 1534
45 Ga0068853_100007895 3300005539 Bacteria 8534
46 Ga0070665_100068867 3300005548 Bacteria 3547
47 Ga0070665_100081540 3300005548 Bacteria 3241
48 Ga0070665_100337068 3300005548 Bacteria 1513
49 Ga0068860_100320751 3300005843 Bacteria 1521
50 Ga0081455_10212778 3300005937 Bacteria 1439
51 Ga0070717_10036823 3300006028 Bacteria 3971
52 Ga0075365_10025104 3300006038 Bacteria 3770
53 Ga0075365_10109624 3300006038 Bacteria 1896
54 Ga0075363_100032957 3300006048 Bacteria 2694
55 Ga0075363_100044639 3300006048 Bacteria 2348
56 Ga0075364_10063897 3300006051 Bacteria 2416
57 Ga0075364_10081676 3300006051 Bacteria 2137
58 Ga0075364_10139662 3300006051 Bacteria 1629
59 Ga0070716_100001599 3300006173 Bacteria 10197
60 Ga0070712_100010986 3300006175 Bacteria 5730
61 Ga0075362_10013216 3300006177 Bacteria 3300
62 Ga0075367_10046217 3300006178 Bacteria 2557
63 Ga0075366_10011414 3300006195 Bacteria 5017
64 Ga0075370_10063318 3300006353 Bacteria 2108
65 Ga0075428_100118153 3300006844 Bacteria 2888
66 Ga0075430_100035538 3300006846 Bacteria 4227
67 Ga0075431_100017415 3300006847 Bacteria 7301
68 Ga0105251_10000807 3300009011 Bacteria 28358
69 Ga0105244_10100190 3300009036 Bacteria 1418
70 Ga0105240_10130898 3300009093 Bacteria 3009
71 Ga0105240_10152960 3300009093 Bacteria 2746
72 Ga0111539_10103817 3300009094 Bacteria 3335
73 Ga0114129_10106567 3300009147 Bacteria 3872
74 Ga0114129_10405083 3300009147 Bacteria 1797
75 Ga0105243_10048259 3300009148 Bacteria 3356
76 Ga0105241_10248742 3300009174 Bacteria 1506
77 Ga0105248_10052559 3300009177 Bacteria 4572
78 Ga0105248_10117549 3300009177 Bacteria 2999
79 Ga0105237_10014473 3300009545 Bacteria 8246
80 Ga0105237_10038932 3300009545 Bacteria 4801
81 Ga0105238_10002443 3300009551 Bacteria 18648
82 Ga0105238_10050388 3300009551 Bacteria 4192
83 Ga0105238_10191038 3300009551 Bacteria 2024
84 Ga0105238_10390321 3300009551 Bacteria 1384
85 Ga0123342_1005172 3300009766 Bacteria 19226
86 Ga0105239_10020917 3300010375 Bacteria 7219
87 Ga0105239_10435724 3300010375 Bacteria 1486
88 Ga0157374_10246628 3300013296 Bacteria 1757
89 Ga0157378_10454685 3300013297 Bacteria 1271
90 Ga0163162_10308635 3300013306 Bacteria 1714
91 Ga0214544_1004166 3300021320 Bacteria 29216
92 Ga0214542_1002658 3300021321 Bacteria 36789
93 Ga0214542_1021332 3300021321 Bacteria 4486
94 Ga0214543_1000018 3300021327 Bacteria 272335
95 Ga0214543_1002392 3300021327 Bacteria 36788
96 Ga0213872_10064124 3300021361 Bacteria 1660
97 Ga0213876_10049374 3300021384 Bacteria 2223
98 Ga0213876_10090977 3300021384 Bacteria 1616
99 Ga0209436_100007 3300025208 Bacteria 149841
100 Ga0209436_113046 3300025208 Bacteria 1378
101 Ga0207425_1001729 3300025245 Bacteria 8623
102 Ga0209646_1007537 3300025246 Bacteria 1774
103 Ga0209026_1000025 3300025250 Bacteria 352548
104 Ga0209677_101748 3300025253 Bacteria 9025
105 Ga0209148_1000181 3300025254 Bacteria 124691
106 Ga0209759_1000226 3300025256 Bacteria 84383
107 Ga0209129_1000437 3300025258 Bacteria 31045
108 Ga0209129_1000936 3300025258 Bacteria 17610
109 Ga0209129_1003995 3300025258 Bacteria 6067
110 Ga0209233_1000010 3300025261 Bacteria 1194329
111 Ga0209233_1024172 3300025261 Bacteria 1524
112 Ga0209455_1000127 3300025272 Bacteria 162518
113 Ga0209455_1002243 3300025272 Bacteria 7606
114 Ga0209455_1003511 3300025272 Bacteria 5515
115 Ga0209673_1002808 3300025273 Bacteria 11264
116 Ga0209130_1000001 3300025284 Bacteria 831557
117 Ga0209130_1000013 3300025284 Bacteria 412810
118 Ga0209130_1014324 3300025284 Bacteria 1995
119 Ga0209676_1001945 3300025292 Bacteria 16638
120 Ga0209025_1002267 3300025294 Bacteria 21060
121 Ga0209025_1003910 3300025294 Bacteria 13423
122 Ga0209025_1055850 3300025294 Bacteria 1523
123 Ga0209025_1059636 3300025294 Bacteria 1439
124 Ga0209564_1000341 3300025295 Bacteria 89262
125 Ga0209564_1001493 3300025295 Bacteria 23554
126 Ga0209758_1000662 3300025297 Bacteria 51542
127 Ga0209758_1000843 3300025297 Bacteria 42750
128 Ga0209758_1008524 3300025297 Bacteria 6611
129 Ga0209256_1000286 3300025299 Bacteria 88880
130 Ga0209256_1000534 3300025299 Bacteria 55095
131 Ga0209256_1005674 3300025299 Bacteria 7027
132 Ga0207426_1000021 3300025302 Bacteria 556343
133 Ga0207426_1000022 3300025302 Bacteria 547377
134 Ga0207426_1000045 3300025302 Bacteria 422847
135 Ga0207426_1001406 3300025302 Bacteria 20221
136 Ga0207426_1006461 3300025302 Bacteria 5097
137 Ga0209051_1005045 3300025303 Bacteria 7859
138 Ga0209051_1033970 3300025303 Bacteria 1919
139 Ga0209257_1004065 3300025304 Bacteria 11743
140 Ga0209257_1030244 3300025304 Bacteria 1751
141 Ga0207713_1001931 3300025735 Bacteria 15682
142 Ga0207692_10001006 3300025898 Bacteria 10279
143 Ga0207647_10020317 3300025904 Bacteria 4454
144 Ga0207647_10056405 3300025904 Bacteria 2410
145 Ga0207699_10001121 3300025906 Bacteria 12678
146 Ga0207645_10053558 3300025907 Bacteria 2579
147 Ga0207705_10229182 3300025909 Bacteria 1413
148 Ga0207695_10117602 3300025913 Bacteria 2630
149 Ga0207671_10016184 3300025914 Bacteria 5807
150 Ga0207671_10030200 3300025914 Bacteria 4043
151 Ga0207671_10043840 3300025914 Bacteria 3307
152 Ga0207663_10036632 3300025916 Bacteria 2953
153 Ga0207657_10088380 3300025919 Bacteria 2590
154 Ga0207646_10076675 3300025922 Bacteria 2987
155 Ga0207694_10023370 3300025924 Bacteria 4692
156 Ga0207664_10008810 3300025929 Bacteria 7056
157 Ga0207644_10062300 3300025931 Bacteria 2705
158 Ga0207665_10001206 3300025939 Bacteria 17435
159 Ga0207711_10072996 3300025941 Bacteria 2982
160 Ga0207712_10444116 3300025961 Bacteria 1099
161 Ga0207668_10267660 3300025972 Bacteria 1396
162 Ga0207658_10177110 3300025986 Bacteria 1762
163 Ga0207639_10015803 3300026041 Bacteria 5329
164 Ga0207678_10178166 3300026067 Bacteria 1815
165 Ga0207678_10283771 3300026067 Bacteria 1421
166 Ga0207702_10115723 3300026078 Bacteria 2392
167 Ga0207648_10079494 3300026089 Bacteria 2861
168 Ga0207674_10173829 3300026116 Bacteria 2107
169 Ga0207674_10321450 3300026116 Bacteria 1497
170 Ga0207675_100397991 3300026118 Bacteria 1357
171 Ga0207683_10446148 3300026121 Bacteria 1193
172 Ga0207428_10170083 3300027907 Bacteria 1651
173 Ga0268266_10046999 3300028379 Bacteria 3695
174 Ga0268266_10177850 3300028379 Bacteria 1935
175 Ga0268266_10224798 3300028379 Bacteria 1727
176 Ga0268266_10294141 3300028379 Bacteria 1513
177 Ga0268264_10394262 3300028381 Bacteria 1329
178 Ga0307515_10001512 3300028794 Bacteria 52053
179 Ga0265330_10029306 3300031235 Bacteria 2476
180 Ga0265330_10054739 3300031235 Bacteria 1743
181 Ga0265325_10009821 3300031241 Bacteria 5571
182 Ga0265325_10084617 3300031241 Bacteria 1572
183 Ga0265340_10001007 3300031247 Bacteria 16052
184 Ga0265340_10074774 3300031247 Bacteria 1601
185 Ga0265339_10004558 3300031249 Bacteria 9436
186 Ga0265339_10008517 3300031249 Bacteria 6520
187 Ga0265339_10063852 3300031249 Bacteria 1977
188 Ga0265339_10147224 3300031249 Bacteria 1194
189 Ga0265331_10022487 3300031250 Bacteria 3217
190 Ga0265316_10025372 3300031344 Bacteria 4948
191 Ga0265316_10051782 3300031344 Bacteria 3223
192 Ga0265316_10058918 3300031344 Bacteria 2989
193 Ga0265316_10147892 3300031344 Bacteria 1761
194 Ga0307513_10034535 3300031456 Bacteria 5673
195 Ga0307513_10206761 3300031456 Bacteria 1798
196 Ga0265313_10000884 3300031595 Bacteria 30275
197 Ga0265313_10043045 3300031595 Bacteria 2213
198 Ga0265314_10025560 3300031711 Bacteria 4451
199 Ga0265314_10063939 3300031711 Bacteria 2494
200 Ga0265314_10068075 3300031711 Bacteria 2395
201 Ga0265314_10179748 3300031711 Bacteria 1269
202 Ga0265342_10018931 3300031712 Bacteria 4447
203 Ga0307516_10148290 3300031730 Bacteria 2109
204 Ga0395900_0095539 3300037418 Bacteria 3054
205 Ga0395900_0167834 3300037418 Bacteria 2236
206 Ga0395900_0241694 3300037418 Bacteria 1811
207 Ga0395898_0033149 3300037466 Bacteria 5156
208 Ga0395905_0351298 3300037471 Bacteria 1366
209 Ga0395901_0127525 3300038443 Bacteria 2674
210 Ga0436365_0891249 3300039437 Bacteria 4237
211 Ga0436365_1516798 3300039437 Bacteria 1369
212 Ga0436365_1638330 3300039437 Bacteria 6089
213 Ga0439436_0019156 3300041404 Bacteria 2044
214 Ga0439465_0011391 3300041413 Bacteria 2791
215 Ga0439465_0021557 3300041413 Bacteria 2021
216 Ga0439465_0027987 3300041413 Bacteria 1786
217 Ga0451833_0190499 3300041491 Bacteria 7180
218 Ga0451835_0839270 3300041492 Bacteria 3474
219 Ga0451845_0771484 3300041501 Bacteria 6434
220 Ga0451849_0057009 3300041505 Bacteria 9243
221 Ga0439441_012417 3300042001 Bacteria 1462
222 Ga0466972_0041632 3300044658 Bacteria 2236
223 Ga0466965_0138660 3300044683 Bacteria 1265
224 Ga0466961_0044357 3300044693 Bacteria 2845
225 Ga0451576_0067552 3300045051 Bacteria 3722
226 Ga0466958_0137936 3300045836 Bacteria 1535
227 Ga0495603_0009535 3300046455 Bacteria 5864
228 Ga0495590_0002598 3300046457 Bacteria 7465
229 Ga0495590_0006492 3300046457 Bacteria 4563
230 Ga0495638_0000580 3300046460 Bacteria 41356
231 Ga0495638_0017368 3300046460 Bacteria 4799
232 Ga0495638_0062432 3300046460 Bacteria 2300
233 Ga0495641_0012713 3300046461 Bacteria 4685
234 Ga0495651_0041165 3300046462 Bacteria 3589
235 Ga0495653_0001978 3300046463 Bacteria 16117
236 Ga0495650_0011754 3300046471 Bacteria 4762
237 Ga0495580_0016851 3300046472 Bacteria 5479
238 Ga0495582_0046198 3300046473 Bacteria 2398
239 Ga0495605_0007739 3300046474 Bacteria 6089
240 Ga0495605_0008940 3300046474 Bacteria 5647
241 Ga0495662_0094965 3300046476 Bacteria 1456
242 Ga0495594_0010751 3300046499 Bacteria 4750
243 Ga0495596_0011361 3300046500 Bacteria 3844
244 Ga0495607_0112162 3300046501 Bacteria 1444
245 Ga0495583_0006562 3300046506 Bacteria 7574
246 Ga0495583_0015646 3300046506 Bacteria 4113
247 Ga0495606_0001215 3300046507 Bacteria 36112
248 Ga0495606_0045705 3300046507 Bacteria 2900
249 Ga0495606_0059193 3300046507 Bacteria 2458
250 Ga0495606_0075586 3300046507 Bacteria 2107
251 Ga0495608_0028021 3300046511 Bacteria 3829
252 Ga0495610_0058188 3300046512 Bacteria 1850
253 Ga0495616_0044950 3300046513 Bacteria 2238
254 Ga0495618_0001793 3300046514 Bacteria 14240
255 Ga0495620_0022574 3300046515 Bacteria 3028
256 Ga0495628_0071859 3300046516 Bacteria 2696
257 Ga0495630_0004430 3300046517 Bacteria 9855
258 Ga0495630_0005470 3300046517 Bacteria 8969
259 Ga0495630_0139823 3300046517 Bacteria 1841
260 Ga0495643_0025168 3300046522 Bacteria 3370
261 Ga0495643_0033096 3300046522 Bacteria 2863
262 Ga0495644_0030164 3300046523 Bacteria 2048
263 Ga0495648_0051518 3300046524 Bacteria 2507
264 Ga0495648_0130629 3300046524 Bacteria 1336
265 Ga0495642_0031682 3300046528 Bacteria 2120
266 Ga0495652_0080194 3300046529 Bacteria 2696
267 Ga0495665_0000742 3300046531 Bacteria 16872
268 Ga0495665_0133085 3300046531 Bacteria 1301
269 Ga0495640_0030496 3300046533 Bacteria 3859
270 Ga0495586_0015435 3300046535 Bacteria 4063
271 Ga0495609_0010836 3300046538 Bacteria 4358
272 Ga0495597_0024173 3300046542 Bacteria 2806
273 Ga0495597_0053044 3300046542 Bacteria 1784
274 Ga0495645_0062183 3300046543 Bacteria 2704
275 Ga0495622_0035352 3300046557 Bacteria 2330
276 Ga0495622_0050538 3300046557 Bacteria 1929
277 Ga0495668_0016098 3300046616 Bacteria 4351
278 Ga0495668_0147801 3300046616 Bacteria 1287
279 Ga0495634_0003234 3300046642 Bacteria 13161
280 Ga0495611_0015685 3300046648 Bacteria 3238
281 Ga0495635_0028167 3300046663 Bacteria 3904
282 Ga0495661_0120376 3300046665 Bacteria 1451
283 Ga0495599_0007107 3300046678 Bacteria 6778
284 Ga0495623_0005615 3300046679 Bacteria 8189
285 Ga0495669_0014845 3300046684 Bacteria 3332
286 Ga0495669_0030605 3300046684 Bacteria 2363
287 Ga0495613_0082318 3300046689 Bacteria 2337
288 Ga0495624_0035451 3300046690 Bacteria 3221
289 Ga0495624_0104216 3300046690 Bacteria 1745
290 Ga0495671_0011184 3300046692 Bacteria 4951
291 Ga0495671_0015440 3300046692 Bacteria 4090
292 Ga0495649_0043805 3300046694 Bacteria 2443
293 Ga0495649_0062390 3300046694 Bacteria 2003
294 Ga0495589_0018230 3300046794 Bacteria 3601
295 Ga0495589_0032701 3300046794 Bacteria 2615
296 Ga0495600_0031883 3300046809 Bacteria 3416
297 Ga0495600_0068374 3300046809 Bacteria 2321
298 Ga0495660_0129956 3300046810 Bacteria 1264
299 Ga0495604_0024225 3300047317 Bacteria 4843
300 Ga0495604_0141884 3300047317 Bacteria 1715
301 Ga0495636_0006527 3300047318 Bacteria 4587
302 Ga0495674_0008782 3300047319 Bacteria 9614
303 Ga0495674_0012103 3300047319 Bacteria 8130
304 Ga0495672_0004772 3300047320 Bacteria 10933
305 Ga0495672_0027200 3300047320 Bacteria 3637
306 Ga0495672_0045454 3300047320 Bacteria 2627
307 Ga0495672_0062366 3300047320 Bacteria 2144
308 Ga0495680_0007970 3300047322 Bacteria 9659
309 Ga0495683_0002142 3300047323 Bacteria 12165
310 Ga0495687_009429 3300047443 Bacteria 5455
311 Ga0495687_023740 3300047443 Bacteria 2926
312 Ga0495687_066431 3300047443 Bacteria 1464
313 Ga0495675_0028055 3300047444 Bacteria 3589
314 Ga0495675_0034181 3300047444 Bacteria 3244
315 Ga0495677_0037953 3300047445 Bacteria 1760
316 Ga0495679_012349 3300047446 Bacteria 3255
317 Ga0495679_020265 3300047446 Bacteria 2318
318 Ga0495673_0054444 3300047469 Bacteria 1739
319 Ga0495684_0011319 3300047471 Bacteria 6887
320 Ga0495686_0003598 3300047472 Bacteria 13293
321 Ga0495686_0007678 3300047472 Bacteria 8052
322 Ga0495686_0092630 3300047472 Bacteria 1833
323 Ga0495593_0002407 3300047673 Bacteria 11256
324 Ga0495593_0073686 3300047673 Bacteria 1771
325 Ga0495602_0002425 3300048088 Bacteria 18977
326 Ga0495602_0028950 3300048088 Bacteria 5290
327 Ga0495614_0012330 3300048089 Bacteria 3751
328 Ga0495626_0007708 3300048091 Bacteria 5965
329 Ga0495626_0042319 3300048091 Bacteria 2140
330 Ga0496100_0000199 3300048903 Bacteria 32913
331 Ga0496100_0013732 3300048903 Bacteria 4683
332 Ga0496101_0000465 3300048904 Bacteria 25586
333 Ga0496101_0004225 3300048904 Bacteria 9005
334 Ga0496101_0049825 3300048904 Bacteria 3013
335 Ga0496102_0001297 3300048905 Bacteria 22468
336 Ga0496102_0009711 3300048905 Bacteria 8273
337 Ga0496102_0035922 3300048905 Bacteria 4463
338 Ga0496102_0159814 3300048905 Bacteria 2119
339 Ga0496103_0000885 3300048906 Bacteria 21664
340 Ga0496103_0068540 3300048906 Bacteria 2217
341 Ga0496103_0078077 3300048906 Bacteria 2079
342 Ga0496104_0020157 3300048907 Bacteria 6108
343 Ga0496104_0034698 3300048907 Bacteria 4706
344 Ga0496104_0136551 3300048907 Bacteria 2356
345 Ga0496104_0247801 3300048907 Bacteria 1694
346 Ga0496105_0001907 3300048908 Bacteria 14973
347 Ga0496105_0074155 3300048908 Bacteria 2811
348 Ga0496106_0000237 3300048909 Bacteria 38613
349 Ga0496106_0000368 3300048909 Bacteria 31935
350 Ga0496106_0050785 3300048909 Bacteria 3126
351 Ga0496106_0079857 3300048909 Bacteria 2512
352 Ga0496107_0003027 3300048910 Bacteria 11141
353 Ga0496107_0089471 3300048910 Bacteria 2248
354 Ga0496109_0355094 3300048912 Bacteria 1385
355 Ga0496110_0000760 3300048913 Bacteria 22314
356 Ga0496110_0288937 3300048913 Bacteria 1493
357 Ga0496111_0001992 3300048914 Bacteria 12147
358 Ga0496112_0013565 3300048915 Bacteria 7529
359 Ga0496112_0097862 3300048915 Bacteria 2904
360 Ga0496113_0000697 3300048916 Bacteria 17150
361 Ga0496113_0007021 3300048916 Bacteria 7202
362 Ga0496113_0061885 3300048916 Bacteria 2825
363 Ga0496114_0361210 3300048917 Bacteria 1285
364 Ga0496116_0042029 3300048919 Bacteria 3130
365 Ga0496116_0083158 3300048919 Bacteria 1977
366 Ga0496116_0093650 3300048919 Bacteria 1818
367 Ga0496117_0002246 3300048920 Bacteria 24924
368 Ga0496117_0005074 3300048920 Bacteria 14098
369 Ga0496117_0011308 3300048920 Bacteria 8002
370 Ga0496117_0015118 3300048920 Bacteria 6606
371 Ga0496117_0090960 3300048920 Bacteria 1964
372 Ga0496117_0167215 3300048920 Bacteria 1281
373 Ga0496118_0008291 3300048921 Bacteria 10765
374 Ga0496118_0010669 3300048921 Bacteria 9058
375 Ga0496118_0011180 3300048921 Bacteria 8790
376 Ga0496118_0011269 3300048921 Bacteria 8748
377 Ga0496118_0014533 3300048921 Bacteria 7362
378 Ga0496119_0009211 3300048922 Bacteria 8519
379 Ga0496119_0028689 3300048922 Bacteria 3792
380 Ga0496119_0064865 3300048922 Bacteria 2166
381 Ga0496119_0112014 3300048922 Bacteria 1513
382 Ga0496119_0173686 3300048922 Bacteria 1136
383 Ga0496120_0010243 3300048923 Bacteria 6562
384 Ga0496121_0007128 3300048924 Bacteria 13565
385 Ga0496121_0009162 3300048924 Bacteria 11442
386 Ga0496121_0023526 3300048924 Bacteria 5928
387 Ga0496121_0024233 3300048924 Bacteria 5813
388 Ga0496121_0047769 3300048924 Bacteria 3648
389 Ga0496121_0192200 3300048924 Bacteria 1462
390 Ga0496122_0000924 3300048925 Bacteria 53653
391 Ga0496122_0004434 3300048925 Bacteria 17420
392 Ga0496122_0005805 3300048925 Bacteria 14510
393 Ga0496122_0044778 3300048925 Bacteria 3449
394 Ga0496122_0053786 3300048925 Bacteria 3031
395 Ga0496123_0001743 3300048926 Bacteria 28728
396 Ga0496123_0008581 3300048926 Bacteria 9367
397 Ga0496123_0020877 3300048926 Bacteria 5107
398 Ga0496123_0115288 3300048926 Bacteria 1525
399 Ga0496125_0026911 3300048928 Bacteria 5224
400 Ga0496125_0027158 3300048928 Bacteria 5196
401 Ga0496125_0035553 3300048928 Bacteria 4366
402 Ga0496125_0137645 3300048928 Bacteria 1704
403 Ga0496125_0243918 3300048928 Bacteria 1138
404 Ga0496126_0000122 3300048929 Bacteria 182785
405 Ga0496126_0000375 3300048929 Bacteria 92390
406 Ga0496126_0206300 3300048929 Bacteria 1656
407 Ga0495678_026091 3300049459 Bacteria 2500
408 Ga0495682_0008896 3300049460 Bacteria 3940
409 Ga0495682_0050724 3300049460 Bacteria 1509
410 Ga0501031_0091783 3300049568 Bacteria 1981
411 Ga0501032_0005850 3300049569 Bacteria 9096
412 Ga0501032_0029874 3300049569 Bacteria 3739
413 Ga0501033_0005840 3300049570 Bacteria 9679
414 Ga0501033_0093861 3300049570 Bacteria 2194
415 Ga0501033_0163446 3300049570 Bacteria 1602
416 Ga0501034_0003055 3300049571 Bacteria 19328
417 Ga0501034_0067956 3300049571 Bacteria 3575
418 Ga0501034_0173369 3300049571 Bacteria 2123
419 Ga0501036_0001315 3300049572 Bacteria 19056
420 Ga0501036_0183905 3300049572 Bacteria 1759
421 Ga0501037_0043516 3300049573 Bacteria 3299
422 Ga0501037_0066567 3300049573 Bacteria 2624
423 Ga0501038_0002280 3300049574 Bacteria 17849
424 Ga0501038_0014344 3300049574 Bacteria 7221
425 Ga0501039_0043720 3300049575 Bacteria 3459
426 Ga0501039_0085754 3300049575 Bacteria 2453
427 Ga0501040_0069893 3300049576 Bacteria 2422
428 Ga0501041_0093886 3300049577 Bacteria 1853
429 Ga0501042_0025359 3300049578 Bacteria 4163
430 Ga0501042_0101786 3300049578 Bacteria 2066
431 Ga0501043_0011422 3300049579 Bacteria 6953
432 Ga0501043_0100837 3300049579 Bacteria 2270
433 Ga0501043_0106370 3300049579 Bacteria 2203
434 Ga0501046_0095561 3300049580 Bacteria 2283
435 Ga0501046_0142406 3300049580 Bacteria 1813
436 Ga0501046_0274327 3300049580 Bacteria 1236
437 Ga0501047_0005903 3300049581 Bacteria 11518
438 Ga0501047_0010342 3300049581 Bacteria 8824
439 Ga0501047_0015757 3300049581 Bacteria 7204
440 Ga0501047_0042322 3300049581 Bacteria 4402
441 Ga0501047_0082990 3300049581 Bacteria 3080
442 Ga0501047_0115398 3300049581 Bacteria 2567
443 Ga0501048_0001333 3300049582 Bacteria 18714
444 Ga0501048_0264877 3300049582 Bacteria 1221
445 Ga0501067_0081808 3300049583 Bacteria 1790
446 Ga0501067_0117217 3300049583 Bacteria 1481
447 Ga0501068_0001778 3300049584 Bacteria 11465
448 Ga0501068_0069719 3300049584 Bacteria 2144
449 Ga0501068_0088769 3300049584 Bacteria 1905
450 Ga0501069_0088145 3300049585 Bacteria 1753
451 Ga0501069_0161259 3300049585 Bacteria 1291
452 Ga0501069_0177783 3300049585 Bacteria 1230
453 Ga0501070_0001529 3300049586 Bacteria 20585
454 Ga0501070_0003036 3300049586 Bacteria 14622
455 Ga0501070_0065379 3300049586 Bacteria 3011
456 Ga0501071_0006332 3300049587 Bacteria 7676
457 Ga0501072_0212312 3300049588 Bacteria 1542
458 Ga0501073_0053062 3300049589 Bacteria 2838
459 Ga0501074_0032494 3300049590 Bacteria 3780
460 Ga0501074_0038204 3300049590 Bacteria 3479
461 Ga0501076_0212479 3300049592 Bacteria 1581
462 Ga0501079_0033467 3300049741 Bacteria 3954
463 Ga0501079_0226189 3300049741 Bacteria 1462
464 Ga0501079_0375479 3300049741 Bacteria 1115
465 Ga0501080_0017115 3300049742 Bacteria 6696
466 Ga0501080_0083445 3300049742 Bacteria 2968
467 Ga0501080_0223531 3300049742 Bacteria 1722
468 Ga0501083_0053441 3300049744 Bacteria 2712
469 Ga0501083_0202276 3300049744 Bacteria 1295
470 Ga0501035_0005001 3300049822 Bacteria 12559
471 Ga0501035_0011568 3300049822 Bacteria 8179
472 Ga0501035_0019757 3300049822 Bacteria 6188
473 Ga0501035_0108564 3300049822 Bacteria 2433
474 Ga0501035_0200544 3300049822 Bacteria 1711
475 Ga0501035_0221648 3300049822 Bacteria 1615
476 Ga0501035_0234656 3300049822 Bacteria 1562
477 Ga0501044_0002860 3300049823 Bacteria 19649
478 Ga0501044_0018290 3300049823 Bacteria 7510
479 Ga0501044_0018495 3300049823 Bacteria 7466
480 Ga0501044_0037064 3300049823 Bacteria 5098
481 Ga0501044_0442965 3300049823 Bacteria 1206
482 Ga0501045_0003149 3300049824 Bacteria 11282
483 nmdc:mga03683_20268_c1 3300050489 Bacteria 2550
484 nmdc:mga00v17_142054_c1 3300050491 Bacteria 1540
485 nmdc:mga0yw44_20812_c1 3300050492 Bacteria 3648
486 nmdc:mga0yw44_229572_c1 3300050492 Bacteria 1232
487 nmdc:mga0yw44_51924_c1 3300050492 Bacteria 2484
488 nmdc:mga0yw44_81146_c1 3300050492 Bacteria 2033
489 nmdc:mga0k408_168465_c1 3300050493 Bacteria 1306
490 nmdc:mga06z11_20630_c1 3300050494 Bacteria 3048
491 nmdc:mga06z11_75741_c1 3300050494 Bacteria 1793
492 nmdc:mga05p37_276842_c1 3300050507 Bacteria 2003
493 nmdc:mga05p37_63275_c1 3300050507 Bacteria 4552
494 nmdc:mga0qj67_2433_c1 3300050509 Bacteria 13256
495 nmdc:mga06r32_3873_c1 3300050510 Bacteria 13398
496 nmdc:mga08y16_223823_c1 3300050511 Bacteria 1947
497 nmdc:mga08x19_154760_c1 3300050514 Bacteria 1554
498 nmdc:mga0sz30_10602_c2 3300050516 Bacteria 2385
499 nmdc:mga0sz30_25318_c1 3300050516 Bacteria 2426
500 nmdc:mga0sz30_61835_c1 3300050516 Bacteria 1601
501 Ga0500643_015374 3300053087 Bacteria 2628
502 Ga0500595_047136 3300053119 Bacteria 1352
503 Ga0500658_0013433 3300053134 Bacteria 3025
504 Ga0500568_0000719 3300053139 Bacteria 23735
505 Ga0500568_0000739 3300053139 Bacteria 23352
506 Ga0500568_0001718 3300053139 Bacteria 13603
507 Ga0500616_0002562 3300053153 Bacteria 14963
508 Ga0500616_0032051 3300053153 Bacteria 2874
509 Ga0500620_000059 3300053155 Bacteria 20299
510 Ga0500620_005587 3300053155 Bacteria 2929
511 Ga0500622_0000134 3300053156 Bacteria 78418
512 Ga0500627_0003110 3300053158 Bacteria 5071
513 Ga0500633_0000380 3300053160 Bacteria 6808
514 Ga0501084_0228941 3300054114 Bacteria 1569
515 Ga0501082_0132528 3300060353 Bacteria 2162
516 Ga0501082_0146405 3300060353 Bacteria 2051
517 Ga0501082_0199743 3300060353 Bacteria 1739

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2979772303 2979775468 280
2 3300050514 nmdc:mga08x19_154760_c1 nmdc:mga08x19_154760_c1_179_1159 283
3 3300005445 Ga0070708_100278341 Ga0070708_1002783412 284
4 3300021384 Ga0213876_10049374 Ga0213876_100493743 285
5 3300039437 Ga0436365_1638330 Ga0436365_1638330_54_1034 285
6 3300048929 Ga0496126_0206300 Ga0496126_0206300_413_1393 285
7 3300048919 Ga0496116_0083158 Ga0496116_0083158_35_895 286
8 3300048922 Ga0496119_0173686 Ga0496119_0173686_14_877 287
9 iso_pu_bacteria 2958108152 2958110087 288
10 iso_pu_bacteria 2965110997 2965112147 288
11 3300045051 Ga0451576_0067552 Ga0451576_0067552_1992_2972 290
12 3300049588 Ga0501072_0212312 Ga0501072_0212312_12_887 291
13 3300050492 nmdc:mga0yw44_229572_c1 nmdc:mga0yw44_229572_c1_309_1220 292
14 3300005471 Ga0070698_100301071 Ga0070698_1003010712 294
15 3300006195 Ga0075366_10011414 Ga0075366_100114142 295
16 3300050493 nmdc:mga0k408_168465_c1 nmdc:mga0k408_168465_c1_155_1141 295
17 3300049578 Ga0501042_0101786 Ga0501042_0101786_778_1761 297
18 iso_pu_bacteria 2878781027 2878784568 297
19 3300002773 JGI25152J39213_1001583 JGI25152J39213_10015834 298
20 3300003215 JGI25153J46596_10002998 JGI25153J46596_100029984 298
21 3300025258 Ga0209129_1000936 Ga0209129_10009367 298
22 3300025294 Ga0209025_1003910 Ga0209025_10039106 298
23 3300025297 Ga0209758_1000662 Ga0209758_100066217 298
24 iso_pu_bacteria 2958137437 2958143785 299
25 3300049568 Ga0501031_0091783 Ga0501031_0091783_85_1065 301
26 3300049581 Ga0501047_0005903 Ga0501047_0005903_8414_9394 301
27 3300049585 Ga0501069_0088145 Ga0501069_0088145_279_1259 301
28 3300049586 Ga0501070_0003036 Ga0501070_0003036_6535_7515 301
29 3300049822 Ga0501035_0005001 Ga0501035_0005001_1758_2738 301
30 3300049823 Ga0501044_0018495 Ga0501044_0018495_5719_6699 301
31 3300054114 Ga0501084_0228941 Ga0501084_0228941_427_1407 301
32 3300060353 Ga0501082_0146405 Ga0501082_0146405_785_1765 301
33 3300042001 Ga0439441_012417 Ga0439441_012417_18_929 303
34 3300046694 Ga0495649_0062390 Ga0495649_0062390_16_927 303
35 3300048913 Ga0496110_0288937 Ga0496110_0288937_13_924 303
36 3300053087 Ga0500643_015374 Ga0500643_015374_1294_2274 303
37 3300060353 Ga0501082_0132528 Ga0501082_0132528_1220_2131 303
38 3300046507 Ga0495606_0001215 Ga0495606_0001215_34919_35914 304
39 3300025304 Ga0209257_1030244 Ga0209257_10302442 305
40 3300041404 Ga0439436_0019156 Ga0439436_0019156_125_1105 305
41 3300037418 Ga0395900_0095539 Ga0395900_0095539_1072_2031 306
42 3300048909 Ga0496106_0000237 Ga0496106_0000237_35297_36292 306
43 3300006353 Ga0075370_10063318 Ga0075370_100633182 309
44 3300046616 Ga0495668_0016098 Ga0495668_0016098_2546_3526 309
45 3300050494 nmdc:mga06z11_75741_c1 nmdc:mga06z11_75741_c1_625_1605 309
46 3300047320 Ga0495672_0045454 Ga0495672_0045454_234_1214 310
47 3300003322 rootL2_10152327 rootL2_101523272 312
48 3300053134 Ga0500658_0013433 Ga0500658_0013433_1858_2853 312
49 3300053139 Ga0500568_0000739 Ga0500568_0000739_18546_19541 312
50 3300053160 Ga0500633_0000380 Ga0500633_0000380_1895_2890 312
51 3300009093 Ga0105240_10152960 Ga0105240_101529602 315
52 3300009545 Ga0105237_10038932 Ga0105237_100389322 315
53 3300009551 Ga0105238_10390321 Ga0105238_103903212 315
54 3300025914 Ga0207671_10030200 Ga0207671_100302003 315
55 3300050492 nmdc:mga0yw44_81146_c1 nmdc:mga0yw44_81146_c1_273_1253 315
56 3300050516 nmdc:mga0sz30_61835_c1 nmdc:mga0sz30_61835_c1_151_1131 315
57 3300006051 Ga0075364_10081676 Ga0075364_100816762 316
58 3300006177 Ga0075362_10013216 Ga0075362_100132163 316
59 3300046665 Ga0495661_0120376 Ga0495661_0120376_276_1256 316
60 3300047443 Ga0495687_023740 Ga0495687_023740_266_1246 316
61 3300050489 nmdc:mga03683_20268_c1 nmdc:mga03683_20268_c1_409_1389 316
62 3300050491 nmdc:mga00v17_142054_c1 nmdc:mga00v17_142054_c1_537_1517 316
63 3300006847 Ga0075431_100017415 Ga0075431_1000174154 317
64 3300031456 Ga0307513_10034535 Ga0307513_100345353 317
65 3300049569 Ga0501032_0029874 Ga0501032_0029874_1628_2608 317
66 3300049570 Ga0501033_0093861 Ga0501033_0093861_918_1898 317
67 3300049579 Ga0501043_0011422 Ga0501043_0011422_3277_4257 317
68 3300049581 Ga0501047_0115398 Ga0501047_0115398_1359_2339 317
69 3300049586 Ga0501070_0065379 Ga0501070_0065379_663_1643 317
70 3300049742 Ga0501080_0223531 Ga0501080_0223531_55_1035 317
71 3300049744 Ga0501083_0053441 Ga0501083_0053441_1633_2613 317
72 3300049822 Ga0501035_0019757 Ga0501035_0019757_1691_2671 317
73 3300049823 Ga0501044_0037064 Ga0501044_0037064_1382_2362 317
74 3300025904 Ga0207647_10056405 Ga0207647_100564052 318
75 3300026067 Ga0207678_10283771 Ga0207678_102837712 318
76 3300006844 Ga0075428_100118153 Ga0075428_1001181532 319
77 3300006846 Ga0075430_100035538 Ga0075430_1000355382 319
78 3300009147 Ga0114129_10405083 Ga0114129_104050832 319
79 3300037418 Ga0395900_0167834 Ga0395900_0167834_628_1587 319
80 3300050507 nmdc:mga05p37_276842_c1 nmdc:mga05p37_276842_c1_330_1310 319
81 3300050509 nmdc:mga0qj67_2433_c1 nmdc:mga0qj67_2433_c1_11665_12645 319
82 iso_pu_bacteria 2501025504 2501409696 322
83 iso_pu_bacteria 2503198000 2503201474 322
84 iso_pu_bacteria 2508501122 2509110039 322
85 iso_pu_bacteria 2508501123 2509113079 322
86 iso_pu_bacteria 2508501127 2509143946 322
87 iso_pu_bacteria 2509276018 2509367885 322
88 iso_pu_bacteria 2509276019 2509378339 322
89 iso_pu_bacteria 2509276022 2509396252 322
90 iso_pu_bacteria 2510065059 2510315567 322
91 iso_pu_bacteria 2510917014 2511099220 322
92 iso_pu_bacteria 2510917015 2511108676 322
93 iso_pu_bacteria 2512875016 2512931556 322
94 iso_pu_bacteria 2512875024 2512959390 322
95 iso_pu_bacteria 2513237082 2513558102 322
96 iso_pu_bacteria 2513237083 2513565752 322
97 iso_pu_bacteria 2513237090 2513611346 322
98 iso_pu_bacteria 2513237144 2513910800 322
99 iso_pu_bacteria 2513237146 2513927243 322
100 iso_pu_bacteria 2513237159 2514000013 322
101 iso_pu_bacteria 2513237164 2514033553 322
102 iso_pu_bacteria 2513237305 2514419693 322
103 iso_pu_bacteria 2513237351 2514589357 322
104 iso_pu_bacteria 2515154122 2515681372 322
105 iso_pu_bacteria 2516143018 2516207875 322
106 iso_pu_bacteria 2558860100 2558861723 322
107 iso_pu_bacteria 2562617112 2563056835 322
108 iso_pu_bacteria 2588253730 2588517395 322
109 iso_pu_bacteria 2597489875 2597813282 322
110 iso_pu_bacteria 2599185170 2599415316 322
111 iso_pu_bacteria 2599185301 2599936805 322
112 iso_pu_bacteria 2599185352 2600197740 322
113 iso_pu_bacteria 2600255067 2600813459 322
114 iso_pu_bacteria 2643221557 2643807878 322
115 iso_pu_bacteria 2643221595 2643986855 322
116 iso_pu_bacteria 2643221610 2644068030 322
117 iso_pu_bacteria 2643221618 2644106888 322
118 iso_pu_bacteria 2643221626 2644149670 322
119 iso_pu_bacteria 2643221627 2644157018 322
120 iso_pu_bacteria 2643221634 2644192410 322
121 iso_pu_bacteria 2643221655 2644311277 322
122 iso_pu_bacteria 2643221659 2644331885 322
123 iso_pu_bacteria 2643221668 2644378219 322
124 iso_pu_bacteria 2643221675 2644418893 322
125 iso_pu_bacteria 2643221680 2644452320 322
126 iso_pu_bacteria 2643221698 2644543641 322
127 iso_pu_bacteria 2643221712 2644615816 322
128 iso_pu_bacteria 2643221723 2644674550 322
129 iso_pu_bacteria 2643221726 2644687064 322
130 iso_pu_bacteria 2687453392 2688598386 322
131 iso_pu_bacteria 2690316117 2692319436 322
132 iso_pu_bacteria 2693429783 2694631022 322
133 iso_pu_bacteria 2693429784 2694636480 322
134 iso_pu_bacteria 2711768613 2713481153 322
135 iso_pu_bacteria 2718217882 2719184702 322
136 iso_pu_bacteria 2718217991 2719643575 322
137 iso_pu_bacteria 2718217997 2719669086 322
138 iso_pu_bacteria 2718218009 2719728722 322
139 iso_pu_bacteria 2718218199 2720489780 322
140 iso_pu_bacteria 2718218233 2720616902 322
141 iso_pu_bacteria 2718218235 2720629043 322
142 iso_pu_bacteria 2718218269 2720773117 322
143 iso_pu_bacteria 2718218363 2721144413 322
144 iso_pu_bacteria 2718218366 2721161783 322
145 iso_pu_bacteria 2721755514 2722842928 322
146 iso_pu_bacteria 2721755556 2723030545 322
147 iso_pu_bacteria 2721755684 2723564907 322
148 iso_pu_bacteria 2721755686 2723575324 322
149 iso_pu_bacteria 2721755810 2724041747 322
150 iso_pu_bacteria 2721755819 2724093146 322
151 iso_pu_bacteria 2728369352 2730111078 322
152 iso_pu_bacteria 2728369365 2730160817 322
153 iso_pu_bacteria 2751185821 2753460451 322
154 iso_pu_bacteria 2791355082 2792584588 322
155 iso_pu_bacteria 2791355091 2792619292 322
156 iso_pu_bacteria 2791355092 2792627065 322
157 iso_pu_bacteria 2791355094 2792643305 322
158 iso_pu_bacteria 2791355123 2792752734 322
159 iso_pu_bacteria 2791355264 2793345592 322
160 iso_pu_bacteria 2791355267 2793366593 322
161 iso_pu_bacteria 2838016132 2838016832 322
162 iso_pu_bacteria 2838022645 2838025286 322
163 iso_pu_bacteria 2838035591 2838038959 322
164 iso_pu_bacteria 2838074704 2838075994 322
165 iso_pu_bacteria 2841734538 2841739142 322
166 iso_pu_bacteria 2842198810 2842200852 322
167 iso_pu_bacteria 2842521101 2842523805 322
168 iso_pu_bacteria 2844009547 2844013639 322
169 iso_pu_bacteria 2844163670 2844169380 322
170 iso_pu_bacteria 2847417321 2847422061 322
171 iso_pu_bacteria 2847670302 2847675561 322
172 iso_pu_bacteria 2847686936 2847692202 322
173 iso_pu_bacteria 2848992105 2848997039 322
174 iso_pu_bacteria 2850079185 2850084231 322
175 iso_pu_bacteria 2855872281 2855875032 322
176 iso_pu_bacteria 2856314179 2856319447 322
177 iso_pu_bacteria 2856320880 2856327538 322
178 iso_pu_bacteria 2856328259 2856334505 322
179 iso_pu_bacteria 2856334872 2856340373 322
180 iso_pu_bacteria 2856342000 2856343899 322
181 iso_pu_bacteria 2856349417 2856352768 322
182 iso_pu_bacteria 2856356410 2856363010 322
183 iso_pu_bacteria 2856364286 2856369405 322
184 iso_pu_bacteria 2857349434 2857351203 322
185 iso_pu_bacteria 2857367948 2857372758 322
186 iso_pu_bacteria 2869162929 2869168250 322
187 iso_pu_bacteria 2869169390 2869171494 322
188 iso_pu_bacteria 2869242130 2869246901 322
189 iso_pu_bacteria 2869249662 2869251814 322
190 iso_pu_bacteria 2869256925 2869260810 322
191 iso_pu_bacteria 2869264136 2869269399 322
192 iso_pu_bacteria 2869271264 2869276472 322
193 iso_pu_bacteria 2869278585 2869280427 322
194 iso_pu_bacteria 2869285874 2869286522 322
195 iso_pu_bacteria 2871429161 2871434675 322
196 iso_pu_bacteria 2871435913 2871441531 322
197 iso_pu_bacteria 2871444079 2871447024 322
198 iso_pu_bacteria 2871451962 2871459517 322
199 iso_pu_bacteria 2871459585 2871463851 322
200 iso_pu_bacteria 2871474448 2871474631 322
201 iso_pu_bacteria 2871481445 2871481812 322
202 iso_pu_bacteria 2871488783 2871494596 322
203 iso_pu_bacteria 2871495908 2871501453 322
204 iso_pu_bacteria 2874102143 2874109167 322
205 iso_pu_bacteria 2874109183 2874113145 322
206 iso_pu_bacteria 2874116593 2874123005 322
207 iso_pu_bacteria 2874123672 2874130551 322
208 iso_pu_bacteria 2874139085 2874144161 322
209 iso_pu_bacteria 2874146452 2874149880 322
210 iso_pu_bacteria 2874155637 2874158138 322
211 iso_pu_bacteria 2874162495 2874164484 322
212 iso_pu_bacteria 2874168670 2874169795 322
213 iso_pu_bacteria 2876363079 2876368538 322
214 iso_pu_bacteria 2876369609 2876375325 322
215 iso_pu_bacteria 2876377896 2876385245 322
216 iso_pu_bacteria 2876386047 2876390875 322
217 iso_pu_bacteria 2876392853 2876398387 322
218 iso_pu_bacteria 2876399893 2876403669 322
219 iso_pu_bacteria 2876406927 2876411227 322
220 iso_pu_bacteria 2876413966 2876416342 322
221 iso_pu_bacteria 2876420981 2876427823 322
222 iso_pu_bacteria 2878035449 2878040682 322
223 iso_pu_bacteria 2878730984 2878732181 322
224 iso_pu_bacteria 2878738818 2878745156 322
225 iso_pu_bacteria 2878745973 2878751808 322
226 iso_pu_bacteria 2878753008 2878758822 322
227 iso_pu_bacteria 2878760144 2878765433 322
228 iso_pu_bacteria 2878767105 2878773141 322
229 iso_pu_bacteria 2878774303 2878775669 322
230 iso_pu_bacteria 2878788777 2878795933 322
231 iso_pu_bacteria 2881147464 2881151277 322
232 iso_pu_bacteria 2881155292 2881161750 322
233 iso_pu_bacteria 2881161766 2881167477 322
234 iso_pu_bacteria 2881845957 2881847777 322
235 iso_pu_bacteria 2881853255 2881855288 322
236 iso_pu_bacteria 2881861095 2881866651 322
237 iso_pu_bacteria 2882632389 2882636219 322
238 iso_pu_bacteria 2882912400 2882918516 322
239 iso_pu_bacteria 2883087390 2883087514 322
240 iso_pu_bacteria 2885270888 2885272684 322
241 iso_pu_bacteria 2885305155 2885309376 322
242 iso_pu_bacteria 2885312484 2885318037 322
243 iso_pu_bacteria 2885318864 2885320649 322
244 iso_pu_bacteria 2885326080 2885330038 322
245 iso_pu_bacteria 2885334103 2885342017 322
246 iso_pu_bacteria 2885342637 2885346959 322
247 iso_pu_bacteria 2888337043 2888339368 322
248 iso_pu_bacteria 2888343758 2888346745 322
249 iso_pu_bacteria 2888350351 2888355706 322
250 iso_pu_bacteria 2889010040 2889010641 322
251 iso_pu_bacteria 2889016732 2889017658 322
252 iso_pu_bacteria 2896384573 2896388373 322
253 iso_pu_bacteria 2902682994 2902686180 322
254 iso_pu_bacteria 2903448605 2903451256 322
255 iso_pu_bacteria 2903492973 2903503939 322
256 iso_pu_bacteria 2903492973 2903504754 322
257 iso_pu_bacteria 2903513507 2903520924 322
258 iso_pu_bacteria 2903521522 2903527537 322
259 iso_pu_bacteria 2903528002 2903533991 322
260 iso_pu_bacteria 2903540706 2903546264 322
261 iso_pu_bacteria 2904659560 2904664942 322
262 iso_pu_bacteria 2906308376 2906314206 322
263 iso_pu_bacteria 2906321335 2906327372 322
264 iso_pu_bacteria 2906328253 2906330062 322
265 iso_pu_bacteria 2906363423 2906364294 322
266 iso_pu_bacteria 2906370794 2906373016 322
267 iso_pu_bacteria 2906401398 2906401757 322
268 iso_pu_bacteria 2906408224 2906408844 322
269 iso_pu_bacteria 2906414383 2906420167 322
270 iso_pu_bacteria 2906427513 2906429456 322
271 iso_pu_bacteria 2920760137 2920764537 322
272 iso_pu_bacteria 2921643360 2921647264 322
273 iso_pu_bacteria 2922130491 2922130833 322
274 iso_pu_bacteria 2922151315 2922152240 322
275 iso_pu_bacteria 2922158528 2922161458 322
276 iso_pu_bacteria 2922172374 2922175294 322
277 iso_pu_bacteria 2922178524 2922183342 322
278 iso_pu_bacteria 2922185730 2922188235 322
279 iso_pu_bacteria 2924726620 2924727446 322
280 iso_pu_bacteria 2924733363 2924735878 322
281 iso_pu_bacteria 2924741084 2924747352 322
282 iso_pu_bacteria 2924748358 2924748368 322
283 iso_pu_bacteria 2924754689 2924755010 322
284 iso_pu_bacteria 2924762789 2924765064 322
285 iso_pu_bacteria 2924776078 2924783293 322
286 iso_pu_bacteria 2924784321 2924789024 322
287 iso_pu_bacteria 2933016740 2933023116 322
288 iso_pu_bacteria 2937813078 2937815684 322
289 iso_pu_bacteria 2937822353 2937824396 322
290 iso_pu_bacteria 2937836603 2937839329 322
291 iso_pu_bacteria 2937848649 2937851878 322
292 iso_pu_bacteria 2937861824 2937866627 322
293 iso_pu_bacteria 2937877337 2937882180 322
294 iso_pu_bacteria 2937891427 2937898045 322
295 iso_pu_bacteria 2937972304 2937978641 322
296 iso_pu_bacteria 2937994558 2938000122 322
297 iso_pu_bacteria 2938014810 2938019247 322
298 iso_pu_bacteria 2941499720 2941506886 322
299 iso_pu_bacteria 2958034702 2958036297 322
300 iso_pu_bacteria 2958041894 2958045661 322
301 iso_pu_bacteria 2958041894 2958051525 322
302 iso_pu_bacteria 2958064165 2958064428 322
303 iso_pu_bacteria 2958071322 2958072065 322
304 iso_pu_bacteria 2958084443 2958089302 322
305 iso_pu_bacteria 2958092219 2958092270 322
306 iso_pu_bacteria 2958100919 2958101825 322
307 iso_pu_bacteria 2958115193 2958118405 322
308 iso_pu_bacteria 2958122699 2958122765 322
309 iso_pu_bacteria 2958130278 2958130925 322
310 iso_pu_bacteria 2958144490 2958150430 322
311 iso_pu_bacteria 2958158011 2958161494 322
312 iso_pu_bacteria 2958165035 2958170586 322
313 iso_pu_bacteria 2958172287 2958179077 322
314 iso_pu_bacteria 2958179912 2958184846 322
315 iso_pu_bacteria 2961077736 2961083013 322
316 iso_pu_bacteria 2961114664 2961119941 322
317 iso_pu_bacteria 2961127735 2961134307 322
318 iso_pu_bacteria 2961163497 2961169041 322
319 iso_pu_bacteria 2961170736 2961176100 322
320 iso_pu_bacteria 2961183825 2961184334 322
321 iso_pu_bacteria 2963644680 2963647655 322
322 iso_pu_bacteria 2965018300 2965024328 322
323 iso_pu_bacteria 2965025482 2965031814 322
324 iso_pu_bacteria 2965032056 2965036903 322
325 iso_pu_bacteria 2965040258 2965045211 322
326 iso_pu_bacteria 2965047637 2965049798 322
327 iso_pu_bacteria 2965062239 2965064192 322
328 iso_pu_bacteria 2965089291 2965091546 322
329 iso_pu_bacteria 2965119406 2965122610 322
330 iso_pu_bacteria 2967996073 2968001987 322
331 iso_pu_bacteria 2968003550 2968008989 322
332 iso_pu_bacteria 2968016561 2968018508 322
333 iso_pu_bacteria 2968083720 2968090286 322
334 iso_pu_bacteria 2968091066 2968096313 322
335 iso_pu_bacteria 2968097103 2968098812 322
336 iso_pu_bacteria 2968110612 2968116298 322
337 iso_pu_bacteria 2968117919 2968119898 322
338 iso_pu_bacteria 2968128360 2968129133 322
339 iso_pu_bacteria 2968138860 2968139016 322
340 iso_pu_bacteria 2968171901 2968177435 322
341 iso_pu_bacteria 2970469710 2970471319 322
342 iso_pu_bacteria 2970489779 2970492942 322
343 iso_pu_bacteria 2970503327 2970508766 322
344 iso_pu_bacteria 2970510686 2970515568 322
345 iso_pu_bacteria 2970524798 2970528528 322
346 iso_pu_bacteria 2970532167 2970537740 322
347 iso_pu_bacteria 2970540015 2970540489 322
348 iso_pu_bacteria 2970547951 2970548946 322
349 iso_pu_bacteria 2970554993 2970560281 322
350 iso_pu_bacteria 2970593180 2970595024 322
351 iso_pu_bacteria 2970619444 2970621785 322
352 iso_pu_bacteria 2970627176 2970629065 322
353 iso_pu_bacteria 2977821940 2977827362 322
354 iso_pu_bacteria 2977828996 2977834214 322
355 iso_pu_bacteria 2977843712 2977845920 322
356 iso_pu_bacteria 2977851361 2977855856 322
357 iso_pu_bacteria 2977858184 2977864339 322
358 iso_pu_bacteria 2977864932 2977867137 322
359 iso_pu_bacteria 2977872689 2977873286 322
360 iso_pu_bacteria 2977907340 2977910268 322
361 iso_pu_bacteria 2977915119 2977916436 322
362 iso_pu_bacteria 2977922695 2977924164 322
363 iso_pu_bacteria 2977935797 2977936075 322
364 iso_pu_bacteria 2977942078 2977942698 322
365 iso_pu_bacteria 2977950692 2977954866 322
366 iso_pu_bacteria 2977957713 2977964179 322
367 iso_pu_bacteria 2977971508 2977978563 322
368 iso_pu_bacteria 2977986579 2977991734 322
369 iso_pu_bacteria 2979710463 2979713635 322
370 iso_pu_bacteria 2979742915 2979749454 322
371 iso_pu_bacteria 2979764755 2979770815 322
372 iso_pu_bacteria 2979779861 2979785548 322
373 iso_pu_bacteria 2979793036 2979796741 322
374 iso_pu_bacteria 2979808191 2979811586 322
375 iso_pu_bacteria 2987636660 2987638387 322
376 iso_pu_bacteria 2987645492 2987649567 322
377 iso_pu_bacteria 2987652177 2987657278 322
378 iso_pu_bacteria 2987659509 2987665072 322
379 iso_pu_bacteria 2987666974 2987667970 322
380 iso_pu_bacteria 2987673487 2987678144 322
381 iso_pu_bacteria 2989771324 2989776655 322
382 iso_pu_bacteria 2996336353 2996338041 322
383 iso_pu_bacteria 2996341866 2996342320 322
384 iso_pu_bacteria 2996348954 2996350111 322
385 iso_pu_bacteria 2996386984 2996392288 322
386 iso_pu_bacteria 3000135777 3000140719 322
387 iso_pu_bacteria 3003930520 3003935836 322
388 iso_pu_bacteria 3004167301 3004168834 322
389 iso_pu_bacteria 3004188549 3004194129 322
390 iso_pu_bacteria 3004195979 3004203773 322
391 iso_pu_bacteria 3004203850 3004205369 322
392 iso_pu_bacteria 3004211236 3004215899 322
393 iso_pu_bacteria 3004218560 3004221935 322
394 iso_pu_bacteria 3004232784 3004237074 322
395 iso_pu_bacteria 3004239961 3004247623 322
396 iso_pu_bacteria 3004248173 3004250875 322
397 iso_pu_bacteria 3004268573 3004274876 322
398 iso_pu_bacteria 3004275668 3004276810 322
399 iso_pu_bacteria 3004289098 3004289517 322
400 iso_pu_bacteria 3004334049 3004334422 322
401 iso_pu_bacteria 3005409236 3005413511 322
402 iso_pu_bacteria 637000159 637074656 322
403 iso_pu_bacteria 643692032 643824020 322
404 iso_pu_bacteria 649633066 649872914 322
405 iso_pu_bacteria 8003955200 8003962074 322
406 iso_pu_bacteria 8004300914 8004300968 322
407 iso_pu_bacteria 8004312739 8004320391 322
408 iso_pu_bacteria 8004361976 8004362408 322
409 iso_pu_bacteria 8004374579 8004380343 322
410 iso_pu_bacteria 8004387939 8004393696 322
411 iso_pu_bacteria 8004445564 8004451726 322
412 iso_pu_bacteria 8004633249 8004638635 322
413 iso_pu_bacteria 8004640170 8004640879 322
414 iso_pu_bacteria 8004695233 8004695468 322
415 iso_pu_bacteria 8004703790 8004709307 322
416 iso_pu_bacteria 8004714634 8004720464 322
417 iso_pu_bacteria 8004727605 8004728912 322
418 iso_pu_bacteria 8005282627 8005284205 322
419 iso_pu_bacteria 8005301065 8005307245 322
420 iso_pu_bacteria 8005619151 8005624652 322
421 iso_pu_bacteria 8005688590 8005695156 322
422 iso_pu_bacteria 8023680758 8023682202 322
423 iso_pu_bacteria 8049293176 8049296912 322
424 iso_pu_bacteria 8055617313 8055620722 322
425 3300003792 Ga0055540_1008130 Ga0055540_10081302 324
426 3300025294 Ga0209025_1055850 Ga0209025_10558502 324
427 iso_pu_bacteria 2510917030 2511195636 324
428 iso_pu_bacteria 2513237084 2513570178 324
429 iso_pu_bacteria 2513237088 2513600418 324
430 iso_pu_bacteria 2513237103 2513710402 324
431 iso_pu_bacteria 2513237138 2513867163 324
432 iso_pu_bacteria 2515075009 2515111670 324
433 iso_pu_bacteria 2516653077 2517040360 324
434 iso_pu_bacteria 2524023209 2524457044 324
435 iso_pu_bacteria 2534681796 2535520200 324
436 iso_pu_bacteria 2582581294 2585203938 324
437 iso_pu_bacteria 2582581298 2585222429 324
438 iso_pu_bacteria 2582581867 2585402655 324
439 iso_pu_bacteria 2585427529 2585544619 324
440 iso_pu_bacteria 2643221643 2644242320 324
441 iso_pu_bacteria 2791355260 2793321386 324
442 iso_pu_bacteria 2842217011 2842220425 324
443 iso_pu_bacteria 2842285085 2842287777 324
444 iso_pu_bacteria 2842298080 2842299403 324
445 iso_pu_bacteria 2842357229 2842362187 324
446 iso_pu_bacteria 2842402390 2842404694 324
447 iso_pu_bacteria 2842409023 2842411277 324
448 iso_pu_bacteria 2842415677 2842418272 324
449 iso_pu_bacteria 2842509118 2842512301 324
450 iso_pu_bacteria 2852387548 2852394424 324
451 iso_pu_bacteria 2919100787 2919103013 324
452 iso_pu_bacteria 2923556063 2923560067 324
453 iso_pu_bacteria 2936367885 2936373365 324
454 iso_pu_bacteria 2936375103 2936378634 324
455 iso_pu_bacteria 2996887358 2996887786 324
456 iso_pu_bacteria 3005416602 3005419209 324
457 iso_pu_bacteria 3005445848 3005450921 324
458 iso_pu_bacteria 639633055 639647881 324
459 iso_pu_bacteria 8005258706 8005264557 324
460 iso_pu_bacteria 8005314921 8005316707 324
461 iso_pu_bacteria 8005321885 8005322313 324
462 iso_pu_bacteria 8005376324 8005378605 324
463 iso_pu_bacteria 8005460587 8005462321 324
464 iso_pu_bacteria 8005542996 8005547932 324
465 iso_pu_bacteria 8024486573 8024487493 324
466 iso_pu_bacteria 8046767195 8046774750 324
467 iso_pu_bacteria 8057575449 8057578660 324
468 3300006048 Ga0075363_100044639 Ga0075363_1000446392 325
469 3300006051 Ga0075364_10139662 Ga0075364_101396622 325
470 3300031730 Ga0307516_10148290 Ga0307516_101482902 325
471 3300001979 JGI24740J21852_10035530 JGI24740J21852_100355301 326
472 3300002705 JGI25156J39149_1002921 JGI25156J39149_10029214 326
473 3300002741 JGI25157J39369_1001242 JGI25157J39369_10012429 326
474 3300002773 JGI25152J39213_1003036 JGI25152J39213_10030364 326
475 3300002774 JGI25150J39212_1007820 JGI25150J39212_10078203 326
476 3300002987 JGI25159J45721_1000301 JGI25159J45721_10003013 326
477 3300003187 JGI25151J46595_10001032 JGI25151J46595_1000103222 326
478 3300003214 JGI25165J46597_1000015 JGI25165J46597_1000015233 326
479 3300003215 JGI25153J46596_10003010 JGI25153J46596_100030104 326
480 3300003215 JGI25153J46596_10004827 JGI25153J46596_100048272 326
481 3300003322 rootL2_10161869 rootL2_101618692 326
482 3300003354 JGI25160J50197_1000014 JGI25160J50197_100001462 326
483 3300003354 JGI25160J50197_1003650 JGI25160J50197_10036503 326
484 3300003374 JGI25161J50226_1000061 JGI25161J50226_100006162 326
485 3300003374 JGI25161J50226_1000093 JGI25161J50226_100009317 326
486 3300003762 Ga0055542_1000406 Ga0055542_100040615 326
487 3300003771 Ga0055526_1007241 Ga0055526_10072413 326
488 3300003771 Ga0055526_1010797 Ga0055526_10107975 326
489 3300003775 Ga0055524_1000446 Ga0055524_100044629 326
490 3300003775 Ga0055524_1005694 Ga0055524_10056943 326
491 3300003775 Ga0055524_1021068 Ga0055524_10210682 326
492 3300003781 Ga0055536_1001554 Ga0055536_100155415 326
493 3300003790 Ga0055528_1012309 Ga0055528_10123093 326
494 3300003791 Ga0055530_10011721 Ga0055530_100117211 326
495 3300003792 Ga0055540_1009579 Ga0055540_10095792 326
496 3300003794 Ga0055531_10010519 Ga0055531_100105192 326
497 3300004625 Ga0055543_1000005 Ga0055543_1000005171 326
498 3300004625 Ga0055543_1003163 Ga0055543_10031633 326
499 3300005262 Ga0065165_1000126 Ga0065165_100012683 326
500 3300005262 Ga0065165_1003297 Ga0065165_10032978 326
501 3300005355 Ga0070671_100039567 Ga0070671_1000395673 326
502 3300005434 Ga0070709_10001298 Ga0070709_100012989 326
503 3300005435 Ga0070714_100012337 Ga0070714_1000123372 326
504 3300005436 Ga0070713_100013346 Ga0070713_1000133462 326
505 3300005437 Ga0070710_10001248 Ga0070710_100012489 326
506 3300005439 Ga0070711_100055605 Ga0070711_1000556052 326
507 3300005455 Ga0070663_100341655 Ga0070663_1003416552 326
508 3300005471 Ga0070698_100037207 Ga0070698_1000372073 326
509 3300005539 Ga0068853_100007895 Ga0068853_1000078953 326
510 3300005548 Ga0070665_100068867 Ga0070665_1000688673 326
511 3300005548 Ga0070665_100081540 Ga0070665_1000815403 326
512 3300005548 Ga0070665_100337068 Ga0070665_1003370681 326
513 3300005843 Ga0068860_100320751 Ga0068860_1003207512 326
514 3300005937 Ga0081455_10212778 Ga0081455_102127782 326
515 3300006028 Ga0070717_10036823 Ga0070717_100368232 326
516 3300006038 Ga0075365_10025104 Ga0075365_100251042 326
517 3300006038 Ga0075365_10109624 Ga0075365_101096242 326
518 3300006048 Ga0075363_100032957 Ga0075363_1000329572 326
519 3300006051 Ga0075364_10063897 Ga0075364_100638972 326
520 3300006173 Ga0070716_100001599 Ga0070716_1000015999 326
521 3300006175 Ga0070712_100010986 Ga0070712_1000109863 326
522 3300006178 Ga0075367_10046217 Ga0075367_100462172 326
523 3300009011 Ga0105251_10000807 Ga0105251_1000080714 326
524 3300009036 Ga0105244_10100190 Ga0105244_101001901 326
525 3300009093 Ga0105240_10130898 Ga0105240_101308982 326
526 3300009094 Ga0111539_10103817 Ga0111539_101038172 326
527 3300009147 Ga0114129_10106567 Ga0114129_101065672 326
528 3300009148 Ga0105243_10048259 Ga0105243_100482592 326
529 3300009174 Ga0105241_10248742 Ga0105241_102487422 326
530 3300009177 Ga0105248_10052559 Ga0105248_100525592 326
531 3300009177 Ga0105248_10117549 Ga0105248_101175493 326
532 3300009545 Ga0105237_10014473 Ga0105237_100144735 326
533 3300009551 Ga0105238_10002443 Ga0105238_100024438 326
534 3300009551 Ga0105238_10050388 Ga0105238_100503882 326
535 3300009551 Ga0105238_10191038 Ga0105238_101910382 326
536 3300009766 Ga0123342_1005172 Ga0123342_100517216 326
537 3300010375 Ga0105239_10020917 Ga0105239_100209176 326
538 3300010375 Ga0105239_10435724 Ga0105239_104357241 326
539 3300013296 Ga0157374_10246628 Ga0157374_102466282 326
540 3300013297 Ga0157378_10454685 Ga0157378_104546852 326
541 3300013306 Ga0163162_10308635 Ga0163162_103086352 326
542 3300021320 Ga0214544_1004166 Ga0214544_10041663 326
543 3300021321 Ga0214542_1002658 Ga0214542_10026583 326
544 3300021321 Ga0214542_1021332 Ga0214542_10213323 326
545 3300021327 Ga0214543_1000018 Ga0214543_100001834 326
546 3300021327 Ga0214543_1002392 Ga0214543_10023923 326
547 3300021361 Ga0213872_10064124 Ga0213872_100641242 326
548 3300021384 Ga0213876_10090977 Ga0213876_100909772 326
549 3300025208 Ga0209436_100007 Ga0209436_10000749 326
550 3300025208 Ga0209436_113046 Ga0209436_1130461 326
551 3300025245 Ga0207425_1001729 Ga0207425_10017296 326
552 3300025246 Ga0209646_1007537 Ga0209646_10075372 326
553 3300025250 Ga0209026_1000025 Ga0209026_100002579 326
554 3300025253 Ga0209677_101748 Ga0209677_1017488 326
555 3300025254 Ga0209148_1000181 Ga0209148_100018138 326
556 3300025256 Ga0209759_1000226 Ga0209759_100022623 326
557 3300025258 Ga0209129_1000437 Ga0209129_100043713 326
558 3300025258 Ga0209129_1003995 Ga0209129_10039955 326
559 3300025261 Ga0209233_1000010 Ga0209233_1000010331 326
560 3300025261 Ga0209233_1024172 Ga0209233_10241722 326
561 3300025272 Ga0209455_1000127 Ga0209455_100012738 326
562 3300025272 Ga0209455_1002243 Ga0209455_10022436 326
563 3300025272 Ga0209455_1003511 Ga0209455_10035114 326
564 3300025273 Ga0209673_1002808 Ga0209673_10028087 326
565 3300025284 Ga0209130_1000001 Ga0209130_1000001721 326
566 3300025284 Ga0209130_1000013 Ga0209130_1000013213 326
567 3300025284 Ga0209130_1014324 Ga0209130_10143242 326
568 3300025292 Ga0209676_1001945 Ga0209676_10019456 326
569 3300025294 Ga0209025_1002267 Ga0209025_10022674 326
570 3300025294 Ga0209025_1059636 Ga0209025_10596362 326
571 3300025295 Ga0209564_1000341 Ga0209564_100034196 326
572 3300025295 Ga0209564_1001493 Ga0209564_10014932 326
573 3300025297 Ga0209758_1000843 Ga0209758_100084326 326
574 3300025297 Ga0209758_1008524 Ga0209758_10085243 326
575 3300025299 Ga0209256_1000286 Ga0209256_100028662 326
576 3300025299 Ga0209256_1000534 Ga0209256_10005346 326
577 3300025299 Ga0209256_1005674 Ga0209256_10056742 326
578 3300025302 Ga0207426_1000021 Ga0207426_100002112 326
579 3300025302 Ga0207426_1000022 Ga0207426_1000022168 326
580 3300025302 Ga0207426_1000045 Ga0207426_1000045330 326
581 3300025302 Ga0207426_1001406 Ga0207426_100140617 326
582 3300025302 Ga0207426_1006461 Ga0207426_10064612 326
583 3300025303 Ga0209051_1005045 Ga0209051_10050453 326
584 3300025303 Ga0209051_1033970 Ga0209051_10339702 326
585 3300025304 Ga0209257_1004065 Ga0209257_10040659 326
586 3300025735 Ga0207713_1001931 Ga0207713_10019312 326
587 3300025898 Ga0207692_10001006 Ga0207692_100010067 326
588 3300025904 Ga0207647_10020317 Ga0207647_100203172 326
589 3300025906 Ga0207699_10001121 Ga0207699_100011214 326
590 3300025907 Ga0207645_10053558 Ga0207645_100535582 326
591 3300025909 Ga0207705_10229182 Ga0207705_102291822 326
592 3300025913 Ga0207695_10117602 Ga0207695_101176022 326
593 3300025914 Ga0207671_10016184 Ga0207671_100161843 326
594 3300025914 Ga0207671_10043840 Ga0207671_100438403 326
595 3300025916 Ga0207663_10036632 Ga0207663_100366322 326
596 3300025919 Ga0207657_10088380 Ga0207657_100883802 326
597 3300025922 Ga0207646_10076675 Ga0207646_100766752 326
598 3300025924 Ga0207694_10023370 Ga0207694_100233704 326
599 3300025929 Ga0207664_10008810 Ga0207664_100088104 326
600 3300025931 Ga0207644_10062300 Ga0207644_100623003 326
601 3300025939 Ga0207665_10001206 Ga0207665_1000120617 326
602 3300025941 Ga0207711_10072996 Ga0207711_100729962 326
603 3300025961 Ga0207712_10444116 Ga0207712_104441161 326
604 3300025972 Ga0207668_10267660 Ga0207668_102676601 326
605 3300025986 Ga0207658_10177110 Ga0207658_101771102 326
606 3300026041 Ga0207639_10015803 Ga0207639_100158033 326
607 3300026067 Ga0207678_10178166 Ga0207678_101781662 326
608 3300026078 Ga0207702_10115723 Ga0207702_101157232 326
609 3300026089 Ga0207648_10079494 Ga0207648_100794944 326
610 3300026116 Ga0207674_10173829 Ga0207674_101738292 326
611 3300026116 Ga0207674_10321450 Ga0207674_103214502 326
612 3300026118 Ga0207675_100397991 Ga0207675_1003979912 326
613 3300026121 Ga0207683_10446148 Ga0207683_104461482 326
614 3300027907 Ga0207428_10170083 Ga0207428_101700832 326
615 3300028379 Ga0268266_10046999 Ga0268266_100469992 326
616 3300028379 Ga0268266_10177850 Ga0268266_101778502 326
617 3300028379 Ga0268266_10224798 Ga0268266_102247982 326
618 3300028379 Ga0268266_10294141 Ga0268266_102941412 326
619 3300028381 Ga0268264_10394262 Ga0268264_103942621 326
620 3300028794 Ga0307515_10001512 Ga0307515_100015128 326
621 3300031235 Ga0265330_10029306 Ga0265330_100293062 326
622 3300031235 Ga0265330_10054739 Ga0265330_100547392 326
623 3300031241 Ga0265325_10009821 Ga0265325_100098213 326
624 3300031241 Ga0265325_10084617 Ga0265325_100846172 326
625 3300031247 Ga0265340_10001007 Ga0265340_100010078 326
626 3300031247 Ga0265340_10074774 Ga0265340_100747742 326
627 3300031249 Ga0265339_10004558 Ga0265339_100045586 326
628 3300031249 Ga0265339_10008517 Ga0265339_100085173 326
629 3300031249 Ga0265339_10063852 Ga0265339_100638522 326
630 3300031249 Ga0265339_10147224 Ga0265339_101472242 326
631 3300031250 Ga0265331_10022487 Ga0265331_100224873 326
632 3300031344 Ga0265316_10025372 Ga0265316_100253725 326
633 3300031344 Ga0265316_10051782 Ga0265316_100517822 326
634 3300031344 Ga0265316_10058918 Ga0265316_100589182 326
635 3300031344 Ga0265316_10147892 Ga0265316_101478922 326
636 3300031456 Ga0307513_10206761 Ga0307513_102067612 326
637 3300031595 Ga0265313_10000884 Ga0265313_1000088421 326
638 3300031595 Ga0265313_10043045 Ga0265313_100430452 326
639 3300031711 Ga0265314_10025560 Ga0265314_100255603 326
640 3300031711 Ga0265314_10063939 Ga0265314_100639392 326
641 3300031711 Ga0265314_10068075 Ga0265314_100680752 326
642 3300031711 Ga0265314_10179748 Ga0265314_101797482 326
643 3300031712 Ga0265342_10018931 Ga0265342_100189313 326
644 3300037418 Ga0395900_0241694 Ga0395900_0241694_47_1027 326
645 3300037466 Ga0395898_0033149 Ga0395898_0033149_255_1235 326
646 3300037471 Ga0395905_0351298 Ga0395905_0351298_40_1020 326
647 3300038443 Ga0395901_0127525 Ga0395901_0127525_440_1420 326
648 3300039437 Ga0436365_0891249 Ga0436365_0891249_2644_3624 326
649 3300039437 Ga0436365_1516798 Ga0436365_1516798_106_1086 326
650 3300041413 Ga0439465_0011391 Ga0439465_0011391_704_1699 326
651 3300041413 Ga0439465_0021557 Ga0439465_0021557_460_1440 326
652 3300041413 Ga0439465_0027987 Ga0439465_0027987_608_1603 326
653 3300041491 Ga0451833_0190499 Ga0451833_0190499_4175_5170 326
654 3300041492 Ga0451835_0839270 Ga0451835_0839270_1032_2027 326
655 3300041501 Ga0451845_0771484 Ga0451845_0771484_4175_5170 326
656 3300041505 Ga0451849_0057009 Ga0451849_0057009_4208_5203 326
657 3300044658 Ga0466972_0041632 Ga0466972_0041632_1062_2042 326
658 3300044683 Ga0466965_0138660 Ga0466965_0138660_20_1000 326
659 3300044693 Ga0466961_0044357 Ga0466961_0044357_1664_2644 326
660 3300045836 Ga0466958_0137936 Ga0466958_0137936_205_1185 326
661 3300046455 Ga0495603_0009535 Ga0495603_0009535_1068_2048 326
662 3300046457 Ga0495590_0002598 Ga0495590_0002598_5698_6678 326
663 3300046457 Ga0495590_0006492 Ga0495590_0006492_2905_3885 326
664 3300046460 Ga0495638_0000580 Ga0495638_0000580_5931_6926 326
665 3300046460 Ga0495638_0017368 Ga0495638_0017368_3007_3987 326
666 3300046460 Ga0495638_0062432 Ga0495638_0062432_447_1427 326
667 3300046461 Ga0495641_0012713 Ga0495641_0012713_2003_2983 326
668 3300046462 Ga0495651_0041165 Ga0495651_0041165_216_1196 326
669 3300046463 Ga0495653_0001978 Ga0495653_0001978_6859_7839 326
670 3300046471 Ga0495650_0011754 Ga0495650_0011754_483_1463 326
671 3300046472 Ga0495580_0016851 Ga0495580_0016851_4401_5381 326
672 3300046473 Ga0495582_0046198 Ga0495582_0046198_1030_2010 326
673 3300046474 Ga0495605_0007739 Ga0495605_0007739_4109_5089 326
674 3300046474 Ga0495605_0008940 Ga0495605_0008940_4152_5132 326
675 3300046476 Ga0495662_0094965 Ga0495662_0094965_88_1068 326
676 3300046499 Ga0495594_0010751 Ga0495594_0010751_3529_4509 326
677 3300046500 Ga0495596_0011361 Ga0495596_0011361_999_1979 326
678 3300046501 Ga0495607_0112162 Ga0495607_0112162_76_1056 326
679 3300046506 Ga0495583_0006562 Ga0495583_0006562_4104_5084 326
680 3300046506 Ga0495583_0015646 Ga0495583_0015646_2541_3521 326
681 3300046507 Ga0495606_0045705 Ga0495606_0045705_397_1392 326
682 3300046507 Ga0495606_0059193 Ga0495606_0059193_140_1120 326
683 3300046507 Ga0495606_0075586 Ga0495606_0075586_484_1464 326
684 3300046511 Ga0495608_0028021 Ga0495608_0028021_389_1369 326
685 3300046512 Ga0495610_0058188 Ga0495610_0058188_513_1493 326
686 3300046513 Ga0495616_0044950 Ga0495616_0044950_104_1084 326
687 3300046514 Ga0495618_0001793 Ga0495618_0001793_12440_13420 326
688 3300046515 Ga0495620_0022574 Ga0495620_0022574_702_1682 326
689 3300046516 Ga0495628_0071859 Ga0495628_0071859_695_1675 326
690 3300046517 Ga0495630_0004430 Ga0495630_0004430_1997_2977 326
691 3300046517 Ga0495630_0005470 Ga0495630_0005470_6224_7204 326
692 3300046517 Ga0495630_0139823 Ga0495630_0139823_307_1287 326
693 3300046522 Ga0495643_0025168 Ga0495643_0025168_1821_2801 326
694 3300046522 Ga0495643_0033096 Ga0495643_0033096_500_1495 326
695 3300046523 Ga0495644_0030164 Ga0495644_0030164_1052_2032 326
696 3300046524 Ga0495648_0051518 Ga0495648_0051518_833_1813 326
697 3300046524 Ga0495648_0130629 Ga0495648_0130629_30_1010 326
698 3300046528 Ga0495642_0031682 Ga0495642_0031682_646_1626 326
699 3300046529 Ga0495652_0080194 Ga0495652_0080194_695_1675 326
700 3300046531 Ga0495665_0000742 Ga0495665_0000742_8325_9305 326
701 3300046531 Ga0495665_0133085 Ga0495665_0133085_132_1112 326
702 3300046533 Ga0495640_0030496 Ga0495640_0030496_1480_2460 326
703 3300046535 Ga0495586_0015435 Ga0495586_0015435_695_1675 326
704 3300046538 Ga0495609_0010836 Ga0495609_0010836_386_1366 326
705 3300046542 Ga0495597_0024173 Ga0495597_0024173_866_1846 326
706 3300046542 Ga0495597_0053044 Ga0495597_0053044_547_1527 326
707 3300046543 Ga0495645_0062183 Ga0495645_0062183_507_1487 326
708 3300046557 Ga0495622_0035352 Ga0495622_0035352_281_1261 326
709 3300046557 Ga0495622_0050538 Ga0495622_0050538_276_1256 326
710 3300046616 Ga0495668_0147801 Ga0495668_0147801_43_1023 326
711 3300046642 Ga0495634_0003234 Ga0495634_0003234_12155_13135 326
712 3300046648 Ga0495611_0015685 Ga0495611_0015685_2077_3057 326
713 3300046663 Ga0495635_0028167 Ga0495635_0028167_2286_3266 326
714 3300046678 Ga0495599_0007107 Ga0495599_0007107_2358_3338 326
715 3300046679 Ga0495623_0005615 Ga0495623_0005615_5301_6281 326
716 3300046684 Ga0495669_0014845 Ga0495669_0014845_184_1164 326
717 3300046684 Ga0495669_0030605 Ga0495669_0030605_483_1463 326
718 3300046689 Ga0495613_0082318 Ga0495613_0082318_336_1316 326
719 3300046690 Ga0495624_0035451 Ga0495624_0035451_478_1458 326
720 3300046690 Ga0495624_0104216 Ga0495624_0104216_377_1357 326
721 3300046692 Ga0495671_0011184 Ga0495671_0011184_24_1004 326
722 3300046692 Ga0495671_0015440 Ga0495671_0015440_824_1804 326
723 3300046694 Ga0495649_0043805 Ga0495649_0043805_1224_2204 326
724 3300046794 Ga0495589_0018230 Ga0495589_0018230_516_1496 326
725 3300046794 Ga0495589_0032701 Ga0495589_0032701_749_1729 326
726 3300046809 Ga0495600_0031883 Ga0495600_0031883_1098_2078 326
727 3300046809 Ga0495600_0068374 Ga0495600_0068374_1014_1994 326
728 3300046810 Ga0495660_0129956 Ga0495660_0129956_10_990 326
729 3300047317 Ga0495604_0024225 Ga0495604_0024225_2150_3130 326
730 3300047317 Ga0495604_0141884 Ga0495604_0141884_201_1181 326
731 3300047318 Ga0495636_0006527 Ga0495636_0006527_1685_2680 326
732 3300047319 Ga0495674_0008782 Ga0495674_0008782_6071_7051 326
733 3300047319 Ga0495674_0012103 Ga0495674_0012103_6551_7531 326
734 3300047320 Ga0495672_0004772 Ga0495672_0004772_4883_5878 326
735 3300047320 Ga0495672_0027200 Ga0495672_0027200_1730_2710 326
736 3300047320 Ga0495672_0062366 Ga0495672_0062366_204_1184 326
737 3300047322 Ga0495680_0007970 Ga0495680_0007970_8252_9232 326
738 3300047323 Ga0495683_0002142 Ga0495683_0002142_4054_5034 326
739 3300047443 Ga0495687_009429 Ga0495687_009429_1654_2634 326
740 3300047443 Ga0495687_066431 Ga0495687_066431_393_1388 326
741 3300047444 Ga0495675_0028055 Ga0495675_0028055_1707_2687 326
742 3300047444 Ga0495675_0034181 Ga0495675_0034181_1149_2129 326
743 3300047445 Ga0495677_0037953 Ga0495677_0037953_676_1656 326
744 3300047446 Ga0495679_012349 Ga0495679_012349_1542_2522 326
745 3300047446 Ga0495679_020265 Ga0495679_020265_644_1624 326
746 3300047469 Ga0495673_0054444 Ga0495673_0054444_236_1216 326
747 3300047471 Ga0495684_0011319 Ga0495684_0011319_3733_4713 326
748 3300047472 Ga0495686_0003598 Ga0495686_0003598_7751_8746 326
749 3300047472 Ga0495686_0007678 Ga0495686_0007678_5311_6306 326
750 3300047472 Ga0495686_0092630 Ga0495686_0092630_320_1300 326
751 3300047673 Ga0495593_0002407 Ga0495593_0002407_6436_7416 326
752 3300047673 Ga0495593_0073686 Ga0495593_0073686_510_1490 326
753 3300048088 Ga0495602_0002425 Ga0495602_0002425_7859_8839 326
754 3300048088 Ga0495602_0028950 Ga0495602_0028950_3289_4269 326
755 3300048089 Ga0495614_0012330 Ga0495614_0012330_438_1418 326
756 3300048091 Ga0495626_0007708 Ga0495626_0007708_3767_4747 326
757 3300048091 Ga0495626_0042319 Ga0495626_0042319_692_1672 326
758 3300048903 Ga0496100_0000199 Ga0496100_0000199_28600_29580 326
759 3300048903 Ga0496100_0013732 Ga0496100_0013732_171_1151 326
760 3300048904 Ga0496101_0000465 Ga0496101_0000465_16827_17807 326
761 3300048904 Ga0496101_0004225 Ga0496101_0004225_1909_2889 326
762 3300048904 Ga0496101_0049825 Ga0496101_0049825_543_1523 326
763 3300048905 Ga0496102_0001297 Ga0496102_0001297_17805_18785 326
764 3300048905 Ga0496102_0009711 Ga0496102_0009711_1036_2016 326
765 3300048905 Ga0496102_0035922 Ga0496102_0035922_1842_2822 326
766 3300048905 Ga0496102_0159814 Ga0496102_0159814_738_1733 326
767 3300048906 Ga0496103_0000885 Ga0496103_0000885_16064_17044 326
768 3300048906 Ga0496103_0068540 Ga0496103_0068540_144_1124 326
769 3300048906 Ga0496103_0078077 Ga0496103_0078077_360_1355 326
770 3300048907 Ga0496104_0020157 Ga0496104_0020157_4631_5611 326
771 3300048907 Ga0496104_0034698 Ga0496104_0034698_2692_3687 326
772 3300048907 Ga0496104_0136551 Ga0496104_0136551_1273_2253 326
773 3300048907 Ga0496104_0247801 Ga0496104_0247801_651_1631 326
774 3300048908 Ga0496105_0001907 Ga0496105_0001907_12356_13351 326
775 3300048908 Ga0496105_0074155 Ga0496105_0074155_1504_2484 326
776 3300048909 Ga0496106_0000368 Ga0496106_0000368_17925_18905 326
777 3300048909 Ga0496106_0050785 Ga0496106_0050785_1590_2570 326
778 3300048909 Ga0496106_0079857 Ga0496106_0079857_180_1175 326
779 3300048910 Ga0496107_0003027 Ga0496107_0003027_3020_4000 326
780 3300048910 Ga0496107_0089471 Ga0496107_0089471_282_1262 326
781 3300048912 Ga0496109_0355094 Ga0496109_0355094_262_1242 326
782 3300048913 Ga0496110_0000760 Ga0496110_0000760_2169_3149 326
783 3300048914 Ga0496111_0001992 Ga0496111_0001992_6453_7433 326
784 3300048915 Ga0496112_0013565 Ga0496112_0013565_2523_3503 326
785 3300048915 Ga0496112_0097862 Ga0496112_0097862_1007_1987 326
786 3300048916 Ga0496113_0000697 Ga0496113_0000697_5389_6369 326
787 3300048916 Ga0496113_0007021 Ga0496113_0007021_1569_2549 326
788 3300048916 Ga0496113_0061885 Ga0496113_0061885_1288_2283 326
789 3300048917 Ga0496114_0361210 Ga0496114_0361210_172_1152 326
790 3300048919 Ga0496116_0042029 Ga0496116_0042029_1663_2643 326
791 3300048919 Ga0496116_0093650 Ga0496116_0093650_73_1053 326
792 3300048920 Ga0496117_0002246 Ga0496117_0002246_6652_7632 326
793 3300048920 Ga0496117_0005074 Ga0496117_0005074_1818_2798 326
794 3300048920 Ga0496117_0011308 Ga0496117_0011308_4821_5816 326
795 3300048920 Ga0496117_0015118 Ga0496117_0015118_331_1311 326
796 3300048920 Ga0496117_0090960 Ga0496117_0090960_117_1097 326
797 3300048920 Ga0496117_0167215 Ga0496117_0167215_270_1250 326
798 3300048921 Ga0496118_0008291 Ga0496118_0008291_2006_2986 326
799 3300048921 Ga0496118_0010669 Ga0496118_0010669_1786_2766 326
800 3300048921 Ga0496118_0011180 Ga0496118_0011180_1490_2485 326
801 3300048921 Ga0496118_0011269 Ga0496118_0011269_4204_5184 326
802 3300048921 Ga0496118_0014533 Ga0496118_0014533_5233_6213 326
803 3300048922 Ga0496119_0009211 Ga0496119_0009211_3230_4225 326
804 3300048922 Ga0496119_0028689 Ga0496119_0028689_1696_2676 326
805 3300048922 Ga0496119_0064865 Ga0496119_0064865_614_1594 326
806 3300048922 Ga0496119_0112014 Ga0496119_0112014_240_1220 326
807 3300048923 Ga0496120_0010243 Ga0496120_0010243_3881_4861 326
808 3300048924 Ga0496121_0007128 Ga0496121_0007128_12417_13397 326
809 3300048924 Ga0496121_0009162 Ga0496121_0009162_430_1410 326
810 3300048924 Ga0496121_0023526 Ga0496121_0023526_2347_3327 326
811 3300048924 Ga0496121_0024233 Ga0496121_0024233_1100_2080 326
812 3300048924 Ga0496121_0047769 Ga0496121_0047769_2076_3071 326
813 3300048924 Ga0496121_0192200 Ga0496121_0192200_314_1294 326
814 3300048925 Ga0496122_0000924 Ga0496122_0000924_31245_32240 326
815 3300048925 Ga0496122_0004434 Ga0496122_0004434_963_1943 326
816 3300048925 Ga0496122_0005805 Ga0496122_0005805_6102_7097 326
817 3300048925 Ga0496122_0044778 Ga0496122_0044778_1806_2801 326
818 3300048925 Ga0496122_0053786 Ga0496122_0053786_1511_2491 326
819 3300048926 Ga0496123_0001743 Ga0496123_0001743_13437_14432 326
820 3300048926 Ga0496123_0008581 Ga0496123_0008581_8299_9294 326
821 3300048926 Ga0496123_0020877 Ga0496123_0020877_2805_3785 326
822 3300048926 Ga0496123_0115288 Ga0496123_0115288_375_1355 326
823 3300048928 Ga0496125_0026911 Ga0496125_0026911_2373_3368 326
824 3300048928 Ga0496125_0027158 Ga0496125_0027158_321_1316 326
825 3300048928 Ga0496125_0035553 Ga0496125_0035553_2015_3010 326
826 3300048928 Ga0496125_0137645 Ga0496125_0137645_492_1472 326
827 3300048928 Ga0496125_0243918 Ga0496125_0243918_25_1005 326
828 3300048929 Ga0496126_0000122 Ga0496126_0000122_43230_44210 326
829 3300048929 Ga0496126_0000375 Ga0496126_0000375_31062_32042 326
830 3300049459 Ga0495678_026091 Ga0495678_026091_605_1585 326
831 3300049460 Ga0495682_0008896 Ga0495682_0008896_2893_3873 326
832 3300049460 Ga0495682_0050724 Ga0495682_0050724_368_1348 326
833 3300049569 Ga0501032_0005850 Ga0501032_0005850_991_1971 326
834 3300049570 Ga0501033_0005840 Ga0501033_0005840_7709_8689 326
835 3300049570 Ga0501033_0163446 Ga0501033_0163446_359_1354 326
836 3300049571 Ga0501034_0003055 Ga0501034_0003055_991_1971 326
837 3300049571 Ga0501034_0067956 Ga0501034_0067956_110_1114 326
838 3300049571 Ga0501034_0173369 Ga0501034_0173369_783_1787 326
839 3300049572 Ga0501036_0001315 Ga0501036_0001315_17358_18338 326
840 3300049572 Ga0501036_0183905 Ga0501036_0183905_27_1007 326
841 3300049573 Ga0501037_0043516 Ga0501037_0043516_501_1481 326
842 3300049573 Ga0501037_0066567 Ga0501037_0066567_1225_2229 326
843 3300049574 Ga0501038_0002280 Ga0501038_0002280_991_1971 326
844 3300049574 Ga0501038_0014344 Ga0501038_0014344_4955_5959 326
845 3300049575 Ga0501039_0043720 Ga0501039_0043720_2223_3203 326
846 3300049575 Ga0501039_0085754 Ga0501039_0085754_337_1317 326
847 3300049576 Ga0501040_0069893 Ga0501040_0069893_878_1858 326
848 3300049577 Ga0501041_0093886 Ga0501041_0093886_160_1140 326
849 3300049578 Ga0501042_0025359 Ga0501042_0025359_2330_3310 326
850 3300049579 Ga0501043_0100837 Ga0501043_0100837_1053_2057 326
851 3300049579 Ga0501043_0106370 Ga0501043_0106370_851_1831 326
852 3300049580 Ga0501046_0095561 Ga0501046_0095561_1232_2236 326
853 3300049580 Ga0501046_0142406 Ga0501046_0142406_577_1557 326
854 3300049580 Ga0501046_0274327 Ga0501046_0274327_90_1085 326
855 3300049581 Ga0501047_0010342 Ga0501047_0010342_719_1699 326
856 3300049581 Ga0501047_0015757 Ga0501047_0015757_5750_6754 326
857 3300049581 Ga0501047_0042322 Ga0501047_0042322_840_1835 326
858 3300049581 Ga0501047_0082990 Ga0501047_0082990_1687_2691 326
859 3300049582 Ga0501048_0001333 Ga0501048_0001333_17478_18458 326
860 3300049582 Ga0501048_0264877 Ga0501048_0264877_87_1067 326
861 3300049583 Ga0501067_0081808 Ga0501067_0081808_121_1101 326
862 3300049583 Ga0501067_0117217 Ga0501067_0117217_382_1377 326
863 3300049584 Ga0501068_0001778 Ga0501068_0001778_4445_5425 326
864 3300049584 Ga0501068_0069719 Ga0501068_0069719_828_1832 326
865 3300049584 Ga0501068_0088769 Ga0501068_0088769_735_1730 326
866 3300049585 Ga0501069_0161259 Ga0501069_0161259_50_1030 326
867 3300049585 Ga0501069_0177783 Ga0501069_0177783_149_1129 326
868 3300049586 Ga0501070_0001529 Ga0501070_0001529_18119_19099 326
869 3300049587 Ga0501071_0006332 Ga0501071_0006332_4048_5028 326
870 3300049589 Ga0501073_0053062 Ga0501073_0053062_432_1436 326
871 3300049590 Ga0501074_0032494 Ga0501074_0032494_1073_2053 326
872 3300049590 Ga0501074_0038204 Ga0501074_0038204_1461_2465 326
873 3300049592 Ga0501076_0212479 Ga0501076_0212479_367_1371 326
874 3300049741 Ga0501079_0033467 Ga0501079_0033467_1373_2353 326
875 3300049741 Ga0501079_0226189 Ga0501079_0226189_449_1429 326
876 3300049741 Ga0501079_0375479 Ga0501079_0375479_120_1100 326
877 3300049742 Ga0501080_0017115 Ga0501080_0017115_2799_3779 326
878 3300049742 Ga0501080_0083445 Ga0501080_0083445_619_1623 326
879 3300049744 Ga0501083_0202276 Ga0501083_0202276_294_1274 326
880 3300049822 Ga0501035_0011568 Ga0501035_0011568_991_1971 326
881 3300049822 Ga0501035_0108564 Ga0501035_0108564_665_1669 326
882 3300049822 Ga0501035_0200544 Ga0501035_0200544_384_1364 326
883 3300049822 Ga0501035_0221648 Ga0501035_0221648_377_1372 326
884 3300049822 Ga0501035_0234656 Ga0501035_0234656_285_1289 326
885 3300049823 Ga0501044_0002860 Ga0501044_0002860_3328_4308 326
886 3300049823 Ga0501044_0018290 Ga0501044_0018290_1688_2692 326
887 3300049823 Ga0501044_0442965 Ga0501044_0442965_80_1060 326
888 3300049824 Ga0501045_0003149 Ga0501045_0003149_4086_5066 326
889 3300050492 nmdc:mga0yw44_20812_c1 nmdc:mga0yw44_20812_c1_1406_2386 326
890 3300050492 nmdc:mga0yw44_51924_c1 nmdc:mga0yw44_51924_c1_1202_2182 326
891 3300050494 nmdc:mga06z11_20630_c1 nmdc:mga06z11_20630_c1_264_1244 326
892 3300050507 nmdc:mga05p37_63275_c1 nmdc:mga05p37_63275_c1_506_1486 326
893 3300050510 nmdc:mga06r32_3873_c1 nmdc:mga06r32_3873_c1_2967_3947 326
894 3300050511 nmdc:mga08y16_223823_c1 nmdc:mga08y16_223823_c1_811_1791 326
895 3300050516 nmdc:mga0sz30_10602_c2 nmdc:mga0sz30_10602_c2_297_1277 326
896 3300050516 nmdc:mga0sz30_25318_c1 nmdc:mga0sz30_25318_c1_62_1057 326
897 3300053119 Ga0500595_047136 Ga0500595_047136_208_1188 326
898 3300053139 Ga0500568_0000719 Ga0500568_0000719_16842_17837 326
899 3300053139 Ga0500568_0001718 Ga0500568_0001718_1595_2575 326
900 3300053153 Ga0500616_0002562 Ga0500616_0002562_6104_7099 326
901 3300053153 Ga0500616_0032051 Ga0500616_0032051_678_1658 326
902 3300053155 Ga0500620_000059 Ga0500620_000059_11327_12307 326
903 3300053155 Ga0500620_005587 Ga0500620_005587_1679_2659 326
904 3300053156 Ga0500622_0000134 Ga0500622_0000134_68068_69063 326
905 3300053158 Ga0500627_0003110 Ga0500627_0003110_2550_3530 326
906 3300060353 Ga0501082_0199743 Ga0501082_0199743_577_1581 326
907 iso_pu_bacteria 2756170246 2756672547 326
908 iso_pu_bacteria 2844002411 2844007492 326
909 iso_pu_bacteria 2871466892 2871468586 326
910 iso_pu_bacteria 2906378014 2906386381 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

40

299

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5407 10 309
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5365 42 313
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.535 10 309
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5327 16 318
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5254 16 318
ID Description Score Start End Superfamily
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8576 42 307 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8456 42 307 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.828 41 307 1.10.3470.10
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8246 41 307 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8195 41 307 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A434LBS3-F1-model_v4 ABC transporter permease 0.9953 47 231 GO:0005886
GO:0022857
AF-A0A434LBS3-F1-model_v4 ABC transporter permease 0.9899 47 231 GO:0005886
GO:0022857
AF-A0A436L4Z4-F1-model_v4 deleted 0.9615 24 239
AF-A0A436L4Z4-F1-model_v4 deleted 0.9486 24 239
AF-A0A659YKQ7-F1-model_v4 deleted 0.9134 1 295

Feature Viewer

pLDDT pTM Quality
80.72 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map