F485451
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 910 | 682 | 517 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0029874|Ga0501032_0029874_1628_2608 |
| Length | 317 |
| Sequence | MKDWKYWLAEQRGTLLAFLTFIVMFTIYVSNHPAGFTANVTQTAANKGVLLAFVAMAQAMVIITAGIDLSVGMIFTLTNCLASWIVVGTPLETALGIVGVLLAGLACGALNGLIVIYGRLQPIVTTIATGAIYYGIALLLRPFPGGGVNEDLADMLTGRIAGIIPTSLIWVPFSRSVMGRAAYATGSSEAAAYMSAMPIRRAKFLTYALAGLLAGIGGLFLTFFTYTGEAALASGNAYTLFSIAAVVLGGVSLYGGTGSAIGAVFGALTFRAIGDLLFVFDLDPLWQPLFQGVVLMIAVSLGAFALLRVRNKLDWFT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 2 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 3 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 4 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 5 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 6 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 7 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 8 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 9 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 10 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 11 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 12 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 13 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 14 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 15 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 16 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 17 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 18 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 19 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 20 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 21 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 22 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 23 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 24 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 25 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 26 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 27 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 28 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 29 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 30 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 31 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 32 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 33 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 34 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 35 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 36 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 37 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 38 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 39 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 40 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 41 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 42 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 43 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 44 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 45 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 46 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 47 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 48 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 49 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 50 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 51 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 52 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 53 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 54 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 55 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 56 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 57 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 58 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 59 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 60 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 61 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 62 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 63 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 64 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 65 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 66 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 67 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 68 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 69 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 70 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 71 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 72 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 73 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 74 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 75 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 76 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 77 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 78 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 79 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 80 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 81 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 82 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 83 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 84 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 85 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 86 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 87 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 88 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 89 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 90 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 91 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 92 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 93 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 94 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 95 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 96 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 97 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 98 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 99 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 100 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 101 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 102 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 103 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 104 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 105 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 106 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 107 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 108 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 109 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 110 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 111 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 112 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 113 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 114 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 115 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 116 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 117 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 118 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 119 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 120 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 121 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 122 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 123 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 124 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 125 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 126 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 127 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 128 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 129 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 130 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 131 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 132 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 133 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 134 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 135 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 136 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 137 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 138 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 139 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 140 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 141 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 142 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 143 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 144 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 145 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 146 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 147 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 148 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 149 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 150 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 151 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 152 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 153 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 154 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 155 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 156 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 157 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 158 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 159 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 160 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 161 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 162 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 163 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 164 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 165 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 166 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 167 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 168 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 169 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 170 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 171 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 172 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 173 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 174 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 175 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 176 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 177 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 178 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 179 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 180 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 181 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 182 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 183 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 184 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 185 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 186 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 187 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 188 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 189 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 190 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 191 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 192 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 193 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 194 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 195 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 196 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 197 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 198 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 199 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 200 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 201 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 202 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 203 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 204 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 205 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 206 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 207 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 208 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 209 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 210 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 211 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 212 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 213 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 214 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 215 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 216 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 217 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 218 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 219 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 220 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 221 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 222 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 223 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 224 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 225 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 226 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 227 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 228 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 229 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 230 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 231 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 232 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 233 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 234 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 235 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 236 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 237 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 238 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 239 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 240 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 241 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 242 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 243 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 244 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 245 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 246 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 247 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 248 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 249 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 250 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 251 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 252 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 253 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 254 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 255 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 256 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 257 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 258 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 259 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 260 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 261 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 262 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 263 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 264 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 265 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 266 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 267 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 268 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 269 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 270 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 271 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 272 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 273 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 274 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 275 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 276 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 277 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 278 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 279 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 280 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 281 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 282 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 283 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 284 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 285 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 286 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 287 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 288 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 289 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 290 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 291 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 292 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 293 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 294 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 295 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 296 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 297 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 298 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 299 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 300 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 301 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 302 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 303 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 304 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 305 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 306 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 307 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 308 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 309 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 310 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 311 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 312 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 313 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 314 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 315 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 316 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 317 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 318 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 319 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 320 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 321 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 322 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 323 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 324 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 325 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 326 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 327 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 328 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 329 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 330 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 331 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 332 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 333 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 334 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 335 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 336 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 337 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 338 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 339 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 340 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 341 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 342 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 343 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 344 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 345 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 346 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 347 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 348 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 349 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 350 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 351 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 352 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 353 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 354 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 355 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 356 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 357 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 358 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 359 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 360 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 361 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 362 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 363 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 364 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 365 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 366 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 367 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 368 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 369 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 370 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 371 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 372 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 373 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 374 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 375 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 376 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 377 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 378 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 379 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 380 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 381 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 382 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 383 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 384 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 385 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 386 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 387 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 388 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 389 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 390 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 391 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 392 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 393 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 394 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 395 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 396 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 397 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 398 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 399 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 400 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 401 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 402 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 403 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 404 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 405 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 406 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 407 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 408 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 409 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 410 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 413 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 414 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 415 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 416 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 417 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 418 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 419 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 420 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 421 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 422 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 423 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 424 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 425 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 426 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 427 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 428 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 429 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 430 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 431 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 432 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 433 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 434 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 435 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 436 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 437 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 438 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 439 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 440 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 441 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 442 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 443 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 444 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 445 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 446 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 447 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 474 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 477 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 478 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 479 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 480 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 481 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 482 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 483 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 484 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 485 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 486 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 487 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 488 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 489 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 490 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 491 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 492 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 493 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 494 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 495 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 496 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 497 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 498 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 499 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 500 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 501 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 502 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 503 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 504 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 505 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 573 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 574 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 575 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 576 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 577 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 578 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 579 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 580 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 581 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 582 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 583 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 584 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 585 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 586 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 587 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 588 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 589 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 590 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 591 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 592 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 593 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 594 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 595 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 596 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 599 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 600 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 601 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 602 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 603 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 604 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 605 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 606 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 607 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 608 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 609 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 610 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 611 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 612 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 613 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 614 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 615 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 616 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 617 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 618 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 619 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 620 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 621 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 622 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 623 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 624 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 625 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 626 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 627 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 628 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 629 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 630 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 631 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 632 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 633 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 634 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 635 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 636 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 637 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 638 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 639 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 640 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 641 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 642 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 643 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 644 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 645 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 646 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 647 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 648 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 649 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 650 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 651 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 652 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 653 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 654 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 655 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 656 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 657 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 658 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 659 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 660 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 661 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 662 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 663 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 664 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 665 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 666 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 667 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 668 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 669 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 670 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 671 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 672 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 673 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 674 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 675 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 676 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 677 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 678 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 679 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 680 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 681 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 682 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 56.81 |
| Metatranscriptomes | 0 |
| Isolates | 43.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.43 |
| Nodule | 34.73 |
| Rhizoplane | 3.96 |
| Rhizosphere | 35.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10035530 | 3300001979 | Bacteria | 1557 |
| 2 | JGI25156J39149_1002921 | 3300002705 | Bacteria | 5820 |
| 3 | JGI25157J39369_1001242 | 3300002741 | Bacteria | 10519 |
| 4 | JGI25152J39213_1001583 | 3300002773 | Bacteria | 9555 |
| 5 | JGI25152J39213_1003036 | 3300002773 | Bacteria | 5918 |
| 6 | JGI25150J39212_1007820 | 3300002774 | Bacteria | 2128 |
| 7 | JGI25159J45721_1000301 | 3300002987 | Bacteria | 23207 |
| 8 | JGI25151J46595_10001032 | 3300003187 | Bacteria | 20828 |
| 9 | JGI25165J46597_1000015 | 3300003214 | Bacteria | 380891 |
| 10 | JGI25153J46596_10002998 | 3300003215 | Bacteria | 9555 |
| 11 | JGI25153J46596_10003010 | 3300003215 | Bacteria | 9533 |
| 12 | JGI25153J46596_10004827 | 3300003215 | Bacteria | 7180 |
| 13 | rootL2_10152327 | 3300003322 | Bacteria | 1409 |
| 14 | rootL2_10161869 | 3300003322 | Bacteria | 1351 |
| 15 | JGI25160J50197_1000014 | 3300003354 | Bacteria | 259862 |
| 16 | JGI25160J50197_1003650 | 3300003354 | Bacteria | 6827 |
| 17 | JGI25161J50226_1000061 | 3300003374 | Bacteria | 101391 |
| 18 | JGI25161J50226_1000093 | 3300003374 | Bacteria | 72639 |
| 19 | Ga0055542_1000406 | 3300003762 | Bacteria | 42163 |
| 20 | Ga0055526_1007241 | 3300003771 | Bacteria | 5820 |
| 21 | Ga0055526_1010797 | 3300003771 | Bacteria | 4202 |
| 22 | Ga0055524_1000446 | 3300003775 | Bacteria | 34169 |
| 23 | Ga0055524_1005694 | 3300003775 | Bacteria | 5521 |
| 24 | Ga0055524_1021068 | 3300003775 | Bacteria | 2173 |
| 25 | Ga0055536_1001554 | 3300003781 | Bacteria | 13762 |
| 26 | Ga0055528_1012309 | 3300003790 | Bacteria | 3330 |
| 27 | Ga0055530_10011721 | 3300003791 | Bacteria | 3124 |
| 28 | Ga0055540_1008130 | 3300003792 | Bacteria | 3823 |
| 29 | Ga0055540_1009579 | 3300003792 | Bacteria | 3330 |
| 30 | Ga0055531_10010519 | 3300003794 | Bacteria | 4586 |
| 31 | Ga0055543_1000005 | 3300004625 | Bacteria | 223621 |
| 32 | Ga0055543_1003163 | 3300004625 | Bacteria | 5025 |
| 33 | Ga0065165_1000126 | 3300005262 | Bacteria | 129946 |
| 34 | Ga0065165_1003297 | 3300005262 | Bacteria | 11605 |
| 35 | Ga0070671_100039567 | 3300005355 | Bacteria | 3914 |
| 36 | Ga0070709_10001298 | 3300005434 | Bacteria | 13630 |
| 37 | Ga0070714_100012337 | 3300005435 | Bacteria | 6820 |
| 38 | Ga0070713_100013346 | 3300005436 | Bacteria | 6064 |
| 39 | Ga0070710_10001248 | 3300005437 | Bacteria | 12065 |
| 40 | Ga0070711_100055605 | 3300005439 | Bacteria | 2735 |
| 41 | Ga0070708_100278341 | 3300005445 | Bacteria | 1575 |
| 42 | Ga0070663_100341655 | 3300005455 | Bacteria | 1210 |
| 43 | Ga0070698_100037207 | 3300005471 | Bacteria | 5019 |
| 44 | Ga0070698_100301071 | 3300005471 | Bacteria | 1534 |
| 45 | Ga0068853_100007895 | 3300005539 | Bacteria | 8534 |
| 46 | Ga0070665_100068867 | 3300005548 | Bacteria | 3547 |
| 47 | Ga0070665_100081540 | 3300005548 | Bacteria | 3241 |
| 48 | Ga0070665_100337068 | 3300005548 | Bacteria | 1513 |
| 49 | Ga0068860_100320751 | 3300005843 | Bacteria | 1521 |
| 50 | Ga0081455_10212778 | 3300005937 | Bacteria | 1439 |
| 51 | Ga0070717_10036823 | 3300006028 | Bacteria | 3971 |
| 52 | Ga0075365_10025104 | 3300006038 | Bacteria | 3770 |
| 53 | Ga0075365_10109624 | 3300006038 | Bacteria | 1896 |
| 54 | Ga0075363_100032957 | 3300006048 | Bacteria | 2694 |
| 55 | Ga0075363_100044639 | 3300006048 | Bacteria | 2348 |
| 56 | Ga0075364_10063897 | 3300006051 | Bacteria | 2416 |
| 57 | Ga0075364_10081676 | 3300006051 | Bacteria | 2137 |
| 58 | Ga0075364_10139662 | 3300006051 | Bacteria | 1629 |
| 59 | Ga0070716_100001599 | 3300006173 | Bacteria | 10197 |
| 60 | Ga0070712_100010986 | 3300006175 | Bacteria | 5730 |
| 61 | Ga0075362_10013216 | 3300006177 | Bacteria | 3300 |
| 62 | Ga0075367_10046217 | 3300006178 | Bacteria | 2557 |
| 63 | Ga0075366_10011414 | 3300006195 | Bacteria | 5017 |
| 64 | Ga0075370_10063318 | 3300006353 | Bacteria | 2108 |
| 65 | Ga0075428_100118153 | 3300006844 | Bacteria | 2888 |
| 66 | Ga0075430_100035538 | 3300006846 | Bacteria | 4227 |
| 67 | Ga0075431_100017415 | 3300006847 | Bacteria | 7301 |
| 68 | Ga0105251_10000807 | 3300009011 | Bacteria | 28358 |
| 69 | Ga0105244_10100190 | 3300009036 | Bacteria | 1418 |
| 70 | Ga0105240_10130898 | 3300009093 | Bacteria | 3009 |
| 71 | Ga0105240_10152960 | 3300009093 | Bacteria | 2746 |
| 72 | Ga0111539_10103817 | 3300009094 | Bacteria | 3335 |
| 73 | Ga0114129_10106567 | 3300009147 | Bacteria | 3872 |
| 74 | Ga0114129_10405083 | 3300009147 | Bacteria | 1797 |
| 75 | Ga0105243_10048259 | 3300009148 | Bacteria | 3356 |
| 76 | Ga0105241_10248742 | 3300009174 | Bacteria | 1506 |
| 77 | Ga0105248_10052559 | 3300009177 | Bacteria | 4572 |
| 78 | Ga0105248_10117549 | 3300009177 | Bacteria | 2999 |
| 79 | Ga0105237_10014473 | 3300009545 | Bacteria | 8246 |
| 80 | Ga0105237_10038932 | 3300009545 | Bacteria | 4801 |
| 81 | Ga0105238_10002443 | 3300009551 | Bacteria | 18648 |
| 82 | Ga0105238_10050388 | 3300009551 | Bacteria | 4192 |
| 83 | Ga0105238_10191038 | 3300009551 | Bacteria | 2024 |
| 84 | Ga0105238_10390321 | 3300009551 | Bacteria | 1384 |
| 85 | Ga0123342_1005172 | 3300009766 | Bacteria | 19226 |
| 86 | Ga0105239_10020917 | 3300010375 | Bacteria | 7219 |
| 87 | Ga0105239_10435724 | 3300010375 | Bacteria | 1486 |
| 88 | Ga0157374_10246628 | 3300013296 | Bacteria | 1757 |
| 89 | Ga0157378_10454685 | 3300013297 | Bacteria | 1271 |
| 90 | Ga0163162_10308635 | 3300013306 | Bacteria | 1714 |
| 91 | Ga0214544_1004166 | 3300021320 | Bacteria | 29216 |
| 92 | Ga0214542_1002658 | 3300021321 | Bacteria | 36789 |
| 93 | Ga0214542_1021332 | 3300021321 | Bacteria | 4486 |
| 94 | Ga0214543_1000018 | 3300021327 | Bacteria | 272335 |
| 95 | Ga0214543_1002392 | 3300021327 | Bacteria | 36788 |
| 96 | Ga0213872_10064124 | 3300021361 | Bacteria | 1660 |
| 97 | Ga0213876_10049374 | 3300021384 | Bacteria | 2223 |
| 98 | Ga0213876_10090977 | 3300021384 | Bacteria | 1616 |
| 99 | Ga0209436_100007 | 3300025208 | Bacteria | 149841 |
| 100 | Ga0209436_113046 | 3300025208 | Bacteria | 1378 |
| 101 | Ga0207425_1001729 | 3300025245 | Bacteria | 8623 |
| 102 | Ga0209646_1007537 | 3300025246 | Bacteria | 1774 |
| 103 | Ga0209026_1000025 | 3300025250 | Bacteria | 352548 |
| 104 | Ga0209677_101748 | 3300025253 | Bacteria | 9025 |
| 105 | Ga0209148_1000181 | 3300025254 | Bacteria | 124691 |
| 106 | Ga0209759_1000226 | 3300025256 | Bacteria | 84383 |
| 107 | Ga0209129_1000437 | 3300025258 | Bacteria | 31045 |
| 108 | Ga0209129_1000936 | 3300025258 | Bacteria | 17610 |
| 109 | Ga0209129_1003995 | 3300025258 | Bacteria | 6067 |
| 110 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 111 | Ga0209233_1024172 | 3300025261 | Bacteria | 1524 |
| 112 | Ga0209455_1000127 | 3300025272 | Bacteria | 162518 |
| 113 | Ga0209455_1002243 | 3300025272 | Bacteria | 7606 |
| 114 | Ga0209455_1003511 | 3300025272 | Bacteria | 5515 |
| 115 | Ga0209673_1002808 | 3300025273 | Bacteria | 11264 |
| 116 | Ga0209130_1000001 | 3300025284 | Bacteria | 831557 |
| 117 | Ga0209130_1000013 | 3300025284 | Bacteria | 412810 |
| 118 | Ga0209130_1014324 | 3300025284 | Bacteria | 1995 |
| 119 | Ga0209676_1001945 | 3300025292 | Bacteria | 16638 |
| 120 | Ga0209025_1002267 | 3300025294 | Bacteria | 21060 |
| 121 | Ga0209025_1003910 | 3300025294 | Bacteria | 13423 |
| 122 | Ga0209025_1055850 | 3300025294 | Bacteria | 1523 |
| 123 | Ga0209025_1059636 | 3300025294 | Bacteria | 1439 |
| 124 | Ga0209564_1000341 | 3300025295 | Bacteria | 89262 |
| 125 | Ga0209564_1001493 | 3300025295 | Bacteria | 23554 |
| 126 | Ga0209758_1000662 | 3300025297 | Bacteria | 51542 |
| 127 | Ga0209758_1000843 | 3300025297 | Bacteria | 42750 |
| 128 | Ga0209758_1008524 | 3300025297 | Bacteria | 6611 |
| 129 | Ga0209256_1000286 | 3300025299 | Bacteria | 88880 |
| 130 | Ga0209256_1000534 | 3300025299 | Bacteria | 55095 |
| 131 | Ga0209256_1005674 | 3300025299 | Bacteria | 7027 |
| 132 | Ga0207426_1000021 | 3300025302 | Bacteria | 556343 |
| 133 | Ga0207426_1000022 | 3300025302 | Bacteria | 547377 |
| 134 | Ga0207426_1000045 | 3300025302 | Bacteria | 422847 |
| 135 | Ga0207426_1001406 | 3300025302 | Bacteria | 20221 |
| 136 | Ga0207426_1006461 | 3300025302 | Bacteria | 5097 |
| 137 | Ga0209051_1005045 | 3300025303 | Bacteria | 7859 |
| 138 | Ga0209051_1033970 | 3300025303 | Bacteria | 1919 |
| 139 | Ga0209257_1004065 | 3300025304 | Bacteria | 11743 |
| 140 | Ga0209257_1030244 | 3300025304 | Bacteria | 1751 |
| 141 | Ga0207713_1001931 | 3300025735 | Bacteria | 15682 |
| 142 | Ga0207692_10001006 | 3300025898 | Bacteria | 10279 |
| 143 | Ga0207647_10020317 | 3300025904 | Bacteria | 4454 |
| 144 | Ga0207647_10056405 | 3300025904 | Bacteria | 2410 |
| 145 | Ga0207699_10001121 | 3300025906 | Bacteria | 12678 |
| 146 | Ga0207645_10053558 | 3300025907 | Bacteria | 2579 |
| 147 | Ga0207705_10229182 | 3300025909 | Bacteria | 1413 |
| 148 | Ga0207695_10117602 | 3300025913 | Bacteria | 2630 |
| 149 | Ga0207671_10016184 | 3300025914 | Bacteria | 5807 |
| 150 | Ga0207671_10030200 | 3300025914 | Bacteria | 4043 |
| 151 | Ga0207671_10043840 | 3300025914 | Bacteria | 3307 |
| 152 | Ga0207663_10036632 | 3300025916 | Bacteria | 2953 |
| 153 | Ga0207657_10088380 | 3300025919 | Bacteria | 2590 |
| 154 | Ga0207646_10076675 | 3300025922 | Bacteria | 2987 |
| 155 | Ga0207694_10023370 | 3300025924 | Bacteria | 4692 |
| 156 | Ga0207664_10008810 | 3300025929 | Bacteria | 7056 |
| 157 | Ga0207644_10062300 | 3300025931 | Bacteria | 2705 |
| 158 | Ga0207665_10001206 | 3300025939 | Bacteria | 17435 |
| 159 | Ga0207711_10072996 | 3300025941 | Bacteria | 2982 |
| 160 | Ga0207712_10444116 | 3300025961 | Bacteria | 1099 |
| 161 | Ga0207668_10267660 | 3300025972 | Bacteria | 1396 |
| 162 | Ga0207658_10177110 | 3300025986 | Bacteria | 1762 |
| 163 | Ga0207639_10015803 | 3300026041 | Bacteria | 5329 |
| 164 | Ga0207678_10178166 | 3300026067 | Bacteria | 1815 |
| 165 | Ga0207678_10283771 | 3300026067 | Bacteria | 1421 |
| 166 | Ga0207702_10115723 | 3300026078 | Bacteria | 2392 |
| 167 | Ga0207648_10079494 | 3300026089 | Bacteria | 2861 |
| 168 | Ga0207674_10173829 | 3300026116 | Bacteria | 2107 |
| 169 | Ga0207674_10321450 | 3300026116 | Bacteria | 1497 |
| 170 | Ga0207675_100397991 | 3300026118 | Bacteria | 1357 |
| 171 | Ga0207683_10446148 | 3300026121 | Bacteria | 1193 |
| 172 | Ga0207428_10170083 | 3300027907 | Bacteria | 1651 |
| 173 | Ga0268266_10046999 | 3300028379 | Bacteria | 3695 |
| 174 | Ga0268266_10177850 | 3300028379 | Bacteria | 1935 |
| 175 | Ga0268266_10224798 | 3300028379 | Bacteria | 1727 |
| 176 | Ga0268266_10294141 | 3300028379 | Bacteria | 1513 |
| 177 | Ga0268264_10394262 | 3300028381 | Bacteria | 1329 |
| 178 | Ga0307515_10001512 | 3300028794 | Bacteria | 52053 |
| 179 | Ga0265330_10029306 | 3300031235 | Bacteria | 2476 |
| 180 | Ga0265330_10054739 | 3300031235 | Bacteria | 1743 |
| 181 | Ga0265325_10009821 | 3300031241 | Bacteria | 5571 |
| 182 | Ga0265325_10084617 | 3300031241 | Bacteria | 1572 |
| 183 | Ga0265340_10001007 | 3300031247 | Bacteria | 16052 |
| 184 | Ga0265340_10074774 | 3300031247 | Bacteria | 1601 |
| 185 | Ga0265339_10004558 | 3300031249 | Bacteria | 9436 |
| 186 | Ga0265339_10008517 | 3300031249 | Bacteria | 6520 |
| 187 | Ga0265339_10063852 | 3300031249 | Bacteria | 1977 |
| 188 | Ga0265339_10147224 | 3300031249 | Bacteria | 1194 |
| 189 | Ga0265331_10022487 | 3300031250 | Bacteria | 3217 |
| 190 | Ga0265316_10025372 | 3300031344 | Bacteria | 4948 |
| 191 | Ga0265316_10051782 | 3300031344 | Bacteria | 3223 |
| 192 | Ga0265316_10058918 | 3300031344 | Bacteria | 2989 |
| 193 | Ga0265316_10147892 | 3300031344 | Bacteria | 1761 |
| 194 | Ga0307513_10034535 | 3300031456 | Bacteria | 5673 |
| 195 | Ga0307513_10206761 | 3300031456 | Bacteria | 1798 |
| 196 | Ga0265313_10000884 | 3300031595 | Bacteria | 30275 |
| 197 | Ga0265313_10043045 | 3300031595 | Bacteria | 2213 |
| 198 | Ga0265314_10025560 | 3300031711 | Bacteria | 4451 |
| 199 | Ga0265314_10063939 | 3300031711 | Bacteria | 2494 |
| 200 | Ga0265314_10068075 | 3300031711 | Bacteria | 2395 |
| 201 | Ga0265314_10179748 | 3300031711 | Bacteria | 1269 |
| 202 | Ga0265342_10018931 | 3300031712 | Bacteria | 4447 |
| 203 | Ga0307516_10148290 | 3300031730 | Bacteria | 2109 |
| 204 | Ga0395900_0095539 | 3300037418 | Bacteria | 3054 |
| 205 | Ga0395900_0167834 | 3300037418 | Bacteria | 2236 |
| 206 | Ga0395900_0241694 | 3300037418 | Bacteria | 1811 |
| 207 | Ga0395898_0033149 | 3300037466 | Bacteria | 5156 |
| 208 | Ga0395905_0351298 | 3300037471 | Bacteria | 1366 |
| 209 | Ga0395901_0127525 | 3300038443 | Bacteria | 2674 |
| 210 | Ga0436365_0891249 | 3300039437 | Bacteria | 4237 |
| 211 | Ga0436365_1516798 | 3300039437 | Bacteria | 1369 |
| 212 | Ga0436365_1638330 | 3300039437 | Bacteria | 6089 |
| 213 | Ga0439436_0019156 | 3300041404 | Bacteria | 2044 |
| 214 | Ga0439465_0011391 | 3300041413 | Bacteria | 2791 |
| 215 | Ga0439465_0021557 | 3300041413 | Bacteria | 2021 |
| 216 | Ga0439465_0027987 | 3300041413 | Bacteria | 1786 |
| 217 | Ga0451833_0190499 | 3300041491 | Bacteria | 7180 |
| 218 | Ga0451835_0839270 | 3300041492 | Bacteria | 3474 |
| 219 | Ga0451845_0771484 | 3300041501 | Bacteria | 6434 |
| 220 | Ga0451849_0057009 | 3300041505 | Bacteria | 9243 |
| 221 | Ga0439441_012417 | 3300042001 | Bacteria | 1462 |
| 222 | Ga0466972_0041632 | 3300044658 | Bacteria | 2236 |
| 223 | Ga0466965_0138660 | 3300044683 | Bacteria | 1265 |
| 224 | Ga0466961_0044357 | 3300044693 | Bacteria | 2845 |
| 225 | Ga0451576_0067552 | 3300045051 | Bacteria | 3722 |
| 226 | Ga0466958_0137936 | 3300045836 | Bacteria | 1535 |
| 227 | Ga0495603_0009535 | 3300046455 | Bacteria | 5864 |
| 228 | Ga0495590_0002598 | 3300046457 | Bacteria | 7465 |
| 229 | Ga0495590_0006492 | 3300046457 | Bacteria | 4563 |
| 230 | Ga0495638_0000580 | 3300046460 | Bacteria | 41356 |
| 231 | Ga0495638_0017368 | 3300046460 | Bacteria | 4799 |
| 232 | Ga0495638_0062432 | 3300046460 | Bacteria | 2300 |
| 233 | Ga0495641_0012713 | 3300046461 | Bacteria | 4685 |
| 234 | Ga0495651_0041165 | 3300046462 | Bacteria | 3589 |
| 235 | Ga0495653_0001978 | 3300046463 | Bacteria | 16117 |
| 236 | Ga0495650_0011754 | 3300046471 | Bacteria | 4762 |
| 237 | Ga0495580_0016851 | 3300046472 | Bacteria | 5479 |
| 238 | Ga0495582_0046198 | 3300046473 | Bacteria | 2398 |
| 239 | Ga0495605_0007739 | 3300046474 | Bacteria | 6089 |
| 240 | Ga0495605_0008940 | 3300046474 | Bacteria | 5647 |
| 241 | Ga0495662_0094965 | 3300046476 | Bacteria | 1456 |
| 242 | Ga0495594_0010751 | 3300046499 | Bacteria | 4750 |
| 243 | Ga0495596_0011361 | 3300046500 | Bacteria | 3844 |
| 244 | Ga0495607_0112162 | 3300046501 | Bacteria | 1444 |
| 245 | Ga0495583_0006562 | 3300046506 | Bacteria | 7574 |
| 246 | Ga0495583_0015646 | 3300046506 | Bacteria | 4113 |
| 247 | Ga0495606_0001215 | 3300046507 | Bacteria | 36112 |
| 248 | Ga0495606_0045705 | 3300046507 | Bacteria | 2900 |
| 249 | Ga0495606_0059193 | 3300046507 | Bacteria | 2458 |
| 250 | Ga0495606_0075586 | 3300046507 | Bacteria | 2107 |
| 251 | Ga0495608_0028021 | 3300046511 | Bacteria | 3829 |
| 252 | Ga0495610_0058188 | 3300046512 | Bacteria | 1850 |
| 253 | Ga0495616_0044950 | 3300046513 | Bacteria | 2238 |
| 254 | Ga0495618_0001793 | 3300046514 | Bacteria | 14240 |
| 255 | Ga0495620_0022574 | 3300046515 | Bacteria | 3028 |
| 256 | Ga0495628_0071859 | 3300046516 | Bacteria | 2696 |
| 257 | Ga0495630_0004430 | 3300046517 | Bacteria | 9855 |
| 258 | Ga0495630_0005470 | 3300046517 | Bacteria | 8969 |
| 259 | Ga0495630_0139823 | 3300046517 | Bacteria | 1841 |
| 260 | Ga0495643_0025168 | 3300046522 | Bacteria | 3370 |
| 261 | Ga0495643_0033096 | 3300046522 | Bacteria | 2863 |
| 262 | Ga0495644_0030164 | 3300046523 | Bacteria | 2048 |
| 263 | Ga0495648_0051518 | 3300046524 | Bacteria | 2507 |
| 264 | Ga0495648_0130629 | 3300046524 | Bacteria | 1336 |
| 265 | Ga0495642_0031682 | 3300046528 | Bacteria | 2120 |
| 266 | Ga0495652_0080194 | 3300046529 | Bacteria | 2696 |
| 267 | Ga0495665_0000742 | 3300046531 | Bacteria | 16872 |
| 268 | Ga0495665_0133085 | 3300046531 | Bacteria | 1301 |
| 269 | Ga0495640_0030496 | 3300046533 | Bacteria | 3859 |
| 270 | Ga0495586_0015435 | 3300046535 | Bacteria | 4063 |
| 271 | Ga0495609_0010836 | 3300046538 | Bacteria | 4358 |
| 272 | Ga0495597_0024173 | 3300046542 | Bacteria | 2806 |
| 273 | Ga0495597_0053044 | 3300046542 | Bacteria | 1784 |
| 274 | Ga0495645_0062183 | 3300046543 | Bacteria | 2704 |
| 275 | Ga0495622_0035352 | 3300046557 | Bacteria | 2330 |
| 276 | Ga0495622_0050538 | 3300046557 | Bacteria | 1929 |
| 277 | Ga0495668_0016098 | 3300046616 | Bacteria | 4351 |
| 278 | Ga0495668_0147801 | 3300046616 | Bacteria | 1287 |
| 279 | Ga0495634_0003234 | 3300046642 | Bacteria | 13161 |
| 280 | Ga0495611_0015685 | 3300046648 | Bacteria | 3238 |
| 281 | Ga0495635_0028167 | 3300046663 | Bacteria | 3904 |
| 282 | Ga0495661_0120376 | 3300046665 | Bacteria | 1451 |
| 283 | Ga0495599_0007107 | 3300046678 | Bacteria | 6778 |
| 284 | Ga0495623_0005615 | 3300046679 | Bacteria | 8189 |
| 285 | Ga0495669_0014845 | 3300046684 | Bacteria | 3332 |
| 286 | Ga0495669_0030605 | 3300046684 | Bacteria | 2363 |
| 287 | Ga0495613_0082318 | 3300046689 | Bacteria | 2337 |
| 288 | Ga0495624_0035451 | 3300046690 | Bacteria | 3221 |
| 289 | Ga0495624_0104216 | 3300046690 | Bacteria | 1745 |
| 290 | Ga0495671_0011184 | 3300046692 | Bacteria | 4951 |
| 291 | Ga0495671_0015440 | 3300046692 | Bacteria | 4090 |
| 292 | Ga0495649_0043805 | 3300046694 | Bacteria | 2443 |
| 293 | Ga0495649_0062390 | 3300046694 | Bacteria | 2003 |
| 294 | Ga0495589_0018230 | 3300046794 | Bacteria | 3601 |
| 295 | Ga0495589_0032701 | 3300046794 | Bacteria | 2615 |
| 296 | Ga0495600_0031883 | 3300046809 | Bacteria | 3416 |
| 297 | Ga0495600_0068374 | 3300046809 | Bacteria | 2321 |
| 298 | Ga0495660_0129956 | 3300046810 | Bacteria | 1264 |
| 299 | Ga0495604_0024225 | 3300047317 | Bacteria | 4843 |
| 300 | Ga0495604_0141884 | 3300047317 | Bacteria | 1715 |
| 301 | Ga0495636_0006527 | 3300047318 | Bacteria | 4587 |
| 302 | Ga0495674_0008782 | 3300047319 | Bacteria | 9614 |
| 303 | Ga0495674_0012103 | 3300047319 | Bacteria | 8130 |
| 304 | Ga0495672_0004772 | 3300047320 | Bacteria | 10933 |
| 305 | Ga0495672_0027200 | 3300047320 | Bacteria | 3637 |
| 306 | Ga0495672_0045454 | 3300047320 | Bacteria | 2627 |
| 307 | Ga0495672_0062366 | 3300047320 | Bacteria | 2144 |
| 308 | Ga0495680_0007970 | 3300047322 | Bacteria | 9659 |
| 309 | Ga0495683_0002142 | 3300047323 | Bacteria | 12165 |
| 310 | Ga0495687_009429 | 3300047443 | Bacteria | 5455 |
| 311 | Ga0495687_023740 | 3300047443 | Bacteria | 2926 |
| 312 | Ga0495687_066431 | 3300047443 | Bacteria | 1464 |
| 313 | Ga0495675_0028055 | 3300047444 | Bacteria | 3589 |
| 314 | Ga0495675_0034181 | 3300047444 | Bacteria | 3244 |
| 315 | Ga0495677_0037953 | 3300047445 | Bacteria | 1760 |
| 316 | Ga0495679_012349 | 3300047446 | Bacteria | 3255 |
| 317 | Ga0495679_020265 | 3300047446 | Bacteria | 2318 |
| 318 | Ga0495673_0054444 | 3300047469 | Bacteria | 1739 |
| 319 | Ga0495684_0011319 | 3300047471 | Bacteria | 6887 |
| 320 | Ga0495686_0003598 | 3300047472 | Bacteria | 13293 |
| 321 | Ga0495686_0007678 | 3300047472 | Bacteria | 8052 |
| 322 | Ga0495686_0092630 | 3300047472 | Bacteria | 1833 |
| 323 | Ga0495593_0002407 | 3300047673 | Bacteria | 11256 |
| 324 | Ga0495593_0073686 | 3300047673 | Bacteria | 1771 |
| 325 | Ga0495602_0002425 | 3300048088 | Bacteria | 18977 |
| 326 | Ga0495602_0028950 | 3300048088 | Bacteria | 5290 |
| 327 | Ga0495614_0012330 | 3300048089 | Bacteria | 3751 |
| 328 | Ga0495626_0007708 | 3300048091 | Bacteria | 5965 |
| 329 | Ga0495626_0042319 | 3300048091 | Bacteria | 2140 |
| 330 | Ga0496100_0000199 | 3300048903 | Bacteria | 32913 |
| 331 | Ga0496100_0013732 | 3300048903 | Bacteria | 4683 |
| 332 | Ga0496101_0000465 | 3300048904 | Bacteria | 25586 |
| 333 | Ga0496101_0004225 | 3300048904 | Bacteria | 9005 |
| 334 | Ga0496101_0049825 | 3300048904 | Bacteria | 3013 |
| 335 | Ga0496102_0001297 | 3300048905 | Bacteria | 22468 |
| 336 | Ga0496102_0009711 | 3300048905 | Bacteria | 8273 |
| 337 | Ga0496102_0035922 | 3300048905 | Bacteria | 4463 |
| 338 | Ga0496102_0159814 | 3300048905 | Bacteria | 2119 |
| 339 | Ga0496103_0000885 | 3300048906 | Bacteria | 21664 |
| 340 | Ga0496103_0068540 | 3300048906 | Bacteria | 2217 |
| 341 | Ga0496103_0078077 | 3300048906 | Bacteria | 2079 |
| 342 | Ga0496104_0020157 | 3300048907 | Bacteria | 6108 |
| 343 | Ga0496104_0034698 | 3300048907 | Bacteria | 4706 |
| 344 | Ga0496104_0136551 | 3300048907 | Bacteria | 2356 |
| 345 | Ga0496104_0247801 | 3300048907 | Bacteria | 1694 |
| 346 | Ga0496105_0001907 | 3300048908 | Bacteria | 14973 |
| 347 | Ga0496105_0074155 | 3300048908 | Bacteria | 2811 |
| 348 | Ga0496106_0000237 | 3300048909 | Bacteria | 38613 |
| 349 | Ga0496106_0000368 | 3300048909 | Bacteria | 31935 |
| 350 | Ga0496106_0050785 | 3300048909 | Bacteria | 3126 |
| 351 | Ga0496106_0079857 | 3300048909 | Bacteria | 2512 |
| 352 | Ga0496107_0003027 | 3300048910 | Bacteria | 11141 |
| 353 | Ga0496107_0089471 | 3300048910 | Bacteria | 2248 |
| 354 | Ga0496109_0355094 | 3300048912 | Bacteria | 1385 |
| 355 | Ga0496110_0000760 | 3300048913 | Bacteria | 22314 |
| 356 | Ga0496110_0288937 | 3300048913 | Bacteria | 1493 |
| 357 | Ga0496111_0001992 | 3300048914 | Bacteria | 12147 |
| 358 | Ga0496112_0013565 | 3300048915 | Bacteria | 7529 |
| 359 | Ga0496112_0097862 | 3300048915 | Bacteria | 2904 |
| 360 | Ga0496113_0000697 | 3300048916 | Bacteria | 17150 |
| 361 | Ga0496113_0007021 | 3300048916 | Bacteria | 7202 |
| 362 | Ga0496113_0061885 | 3300048916 | Bacteria | 2825 |
| 363 | Ga0496114_0361210 | 3300048917 | Bacteria | 1285 |
| 364 | Ga0496116_0042029 | 3300048919 | Bacteria | 3130 |
| 365 | Ga0496116_0083158 | 3300048919 | Bacteria | 1977 |
| 366 | Ga0496116_0093650 | 3300048919 | Bacteria | 1818 |
| 367 | Ga0496117_0002246 | 3300048920 | Bacteria | 24924 |
| 368 | Ga0496117_0005074 | 3300048920 | Bacteria | 14098 |
| 369 | Ga0496117_0011308 | 3300048920 | Bacteria | 8002 |
| 370 | Ga0496117_0015118 | 3300048920 | Bacteria | 6606 |
| 371 | Ga0496117_0090960 | 3300048920 | Bacteria | 1964 |
| 372 | Ga0496117_0167215 | 3300048920 | Bacteria | 1281 |
| 373 | Ga0496118_0008291 | 3300048921 | Bacteria | 10765 |
| 374 | Ga0496118_0010669 | 3300048921 | Bacteria | 9058 |
| 375 | Ga0496118_0011180 | 3300048921 | Bacteria | 8790 |
| 376 | Ga0496118_0011269 | 3300048921 | Bacteria | 8748 |
| 377 | Ga0496118_0014533 | 3300048921 | Bacteria | 7362 |
| 378 | Ga0496119_0009211 | 3300048922 | Bacteria | 8519 |
| 379 | Ga0496119_0028689 | 3300048922 | Bacteria | 3792 |
| 380 | Ga0496119_0064865 | 3300048922 | Bacteria | 2166 |
| 381 | Ga0496119_0112014 | 3300048922 | Bacteria | 1513 |
| 382 | Ga0496119_0173686 | 3300048922 | Bacteria | 1136 |
| 383 | Ga0496120_0010243 | 3300048923 | Bacteria | 6562 |
| 384 | Ga0496121_0007128 | 3300048924 | Bacteria | 13565 |
| 385 | Ga0496121_0009162 | 3300048924 | Bacteria | 11442 |
| 386 | Ga0496121_0023526 | 3300048924 | Bacteria | 5928 |
| 387 | Ga0496121_0024233 | 3300048924 | Bacteria | 5813 |
| 388 | Ga0496121_0047769 | 3300048924 | Bacteria | 3648 |
| 389 | Ga0496121_0192200 | 3300048924 | Bacteria | 1462 |
| 390 | Ga0496122_0000924 | 3300048925 | Bacteria | 53653 |
| 391 | Ga0496122_0004434 | 3300048925 | Bacteria | 17420 |
| 392 | Ga0496122_0005805 | 3300048925 | Bacteria | 14510 |
| 393 | Ga0496122_0044778 | 3300048925 | Bacteria | 3449 |
| 394 | Ga0496122_0053786 | 3300048925 | Bacteria | 3031 |
| 395 | Ga0496123_0001743 | 3300048926 | Bacteria | 28728 |
| 396 | Ga0496123_0008581 | 3300048926 | Bacteria | 9367 |
| 397 | Ga0496123_0020877 | 3300048926 | Bacteria | 5107 |
| 398 | Ga0496123_0115288 | 3300048926 | Bacteria | 1525 |
| 399 | Ga0496125_0026911 | 3300048928 | Bacteria | 5224 |
| 400 | Ga0496125_0027158 | 3300048928 | Bacteria | 5196 |
| 401 | Ga0496125_0035553 | 3300048928 | Bacteria | 4366 |
| 402 | Ga0496125_0137645 | 3300048928 | Bacteria | 1704 |
| 403 | Ga0496125_0243918 | 3300048928 | Bacteria | 1138 |
| 404 | Ga0496126_0000122 | 3300048929 | Bacteria | 182785 |
| 405 | Ga0496126_0000375 | 3300048929 | Bacteria | 92390 |
| 406 | Ga0496126_0206300 | 3300048929 | Bacteria | 1656 |
| 407 | Ga0495678_026091 | 3300049459 | Bacteria | 2500 |
| 408 | Ga0495682_0008896 | 3300049460 | Bacteria | 3940 |
| 409 | Ga0495682_0050724 | 3300049460 | Bacteria | 1509 |
| 410 | Ga0501031_0091783 | 3300049568 | Bacteria | 1981 |
| 411 | Ga0501032_0005850 | 3300049569 | Bacteria | 9096 |
| 412 | Ga0501032_0029874 | 3300049569 | Bacteria | 3739 |
| 413 | Ga0501033_0005840 | 3300049570 | Bacteria | 9679 |
| 414 | Ga0501033_0093861 | 3300049570 | Bacteria | 2194 |
| 415 | Ga0501033_0163446 | 3300049570 | Bacteria | 1602 |
| 416 | Ga0501034_0003055 | 3300049571 | Bacteria | 19328 |
| 417 | Ga0501034_0067956 | 3300049571 | Bacteria | 3575 |
| 418 | Ga0501034_0173369 | 3300049571 | Bacteria | 2123 |
| 419 | Ga0501036_0001315 | 3300049572 | Bacteria | 19056 |
| 420 | Ga0501036_0183905 | 3300049572 | Bacteria | 1759 |
| 421 | Ga0501037_0043516 | 3300049573 | Bacteria | 3299 |
| 422 | Ga0501037_0066567 | 3300049573 | Bacteria | 2624 |
| 423 | Ga0501038_0002280 | 3300049574 | Bacteria | 17849 |
| 424 | Ga0501038_0014344 | 3300049574 | Bacteria | 7221 |
| 425 | Ga0501039_0043720 | 3300049575 | Bacteria | 3459 |
| 426 | Ga0501039_0085754 | 3300049575 | Bacteria | 2453 |
| 427 | Ga0501040_0069893 | 3300049576 | Bacteria | 2422 |
| 428 | Ga0501041_0093886 | 3300049577 | Bacteria | 1853 |
| 429 | Ga0501042_0025359 | 3300049578 | Bacteria | 4163 |
| 430 | Ga0501042_0101786 | 3300049578 | Bacteria | 2066 |
| 431 | Ga0501043_0011422 | 3300049579 | Bacteria | 6953 |
| 432 | Ga0501043_0100837 | 3300049579 | Bacteria | 2270 |
| 433 | Ga0501043_0106370 | 3300049579 | Bacteria | 2203 |
| 434 | Ga0501046_0095561 | 3300049580 | Bacteria | 2283 |
| 435 | Ga0501046_0142406 | 3300049580 | Bacteria | 1813 |
| 436 | Ga0501046_0274327 | 3300049580 | Bacteria | 1236 |
| 437 | Ga0501047_0005903 | 3300049581 | Bacteria | 11518 |
| 438 | Ga0501047_0010342 | 3300049581 | Bacteria | 8824 |
| 439 | Ga0501047_0015757 | 3300049581 | Bacteria | 7204 |
| 440 | Ga0501047_0042322 | 3300049581 | Bacteria | 4402 |
| 441 | Ga0501047_0082990 | 3300049581 | Bacteria | 3080 |
| 442 | Ga0501047_0115398 | 3300049581 | Bacteria | 2567 |
| 443 | Ga0501048_0001333 | 3300049582 | Bacteria | 18714 |
| 444 | Ga0501048_0264877 | 3300049582 | Bacteria | 1221 |
| 445 | Ga0501067_0081808 | 3300049583 | Bacteria | 1790 |
| 446 | Ga0501067_0117217 | 3300049583 | Bacteria | 1481 |
| 447 | Ga0501068_0001778 | 3300049584 | Bacteria | 11465 |
| 448 | Ga0501068_0069719 | 3300049584 | Bacteria | 2144 |
| 449 | Ga0501068_0088769 | 3300049584 | Bacteria | 1905 |
| 450 | Ga0501069_0088145 | 3300049585 | Bacteria | 1753 |
| 451 | Ga0501069_0161259 | 3300049585 | Bacteria | 1291 |
| 452 | Ga0501069_0177783 | 3300049585 | Bacteria | 1230 |
| 453 | Ga0501070_0001529 | 3300049586 | Bacteria | 20585 |
| 454 | Ga0501070_0003036 | 3300049586 | Bacteria | 14622 |
| 455 | Ga0501070_0065379 | 3300049586 | Bacteria | 3011 |
| 456 | Ga0501071_0006332 | 3300049587 | Bacteria | 7676 |
| 457 | Ga0501072_0212312 | 3300049588 | Bacteria | 1542 |
| 458 | Ga0501073_0053062 | 3300049589 | Bacteria | 2838 |
| 459 | Ga0501074_0032494 | 3300049590 | Bacteria | 3780 |
| 460 | Ga0501074_0038204 | 3300049590 | Bacteria | 3479 |
| 461 | Ga0501076_0212479 | 3300049592 | Bacteria | 1581 |
| 462 | Ga0501079_0033467 | 3300049741 | Bacteria | 3954 |
| 463 | Ga0501079_0226189 | 3300049741 | Bacteria | 1462 |
| 464 | Ga0501079_0375479 | 3300049741 | Bacteria | 1115 |
| 465 | Ga0501080_0017115 | 3300049742 | Bacteria | 6696 |
| 466 | Ga0501080_0083445 | 3300049742 | Bacteria | 2968 |
| 467 | Ga0501080_0223531 | 3300049742 | Bacteria | 1722 |
| 468 | Ga0501083_0053441 | 3300049744 | Bacteria | 2712 |
| 469 | Ga0501083_0202276 | 3300049744 | Bacteria | 1295 |
| 470 | Ga0501035_0005001 | 3300049822 | Bacteria | 12559 |
| 471 | Ga0501035_0011568 | 3300049822 | Bacteria | 8179 |
| 472 | Ga0501035_0019757 | 3300049822 | Bacteria | 6188 |
| 473 | Ga0501035_0108564 | 3300049822 | Bacteria | 2433 |
| 474 | Ga0501035_0200544 | 3300049822 | Bacteria | 1711 |
| 475 | Ga0501035_0221648 | 3300049822 | Bacteria | 1615 |
| 476 | Ga0501035_0234656 | 3300049822 | Bacteria | 1562 |
| 477 | Ga0501044_0002860 | 3300049823 | Bacteria | 19649 |
| 478 | Ga0501044_0018290 | 3300049823 | Bacteria | 7510 |
| 479 | Ga0501044_0018495 | 3300049823 | Bacteria | 7466 |
| 480 | Ga0501044_0037064 | 3300049823 | Bacteria | 5098 |
| 481 | Ga0501044_0442965 | 3300049823 | Bacteria | 1206 |
| 482 | Ga0501045_0003149 | 3300049824 | Bacteria | 11282 |
| 483 | nmdc:mga03683_20268_c1 | 3300050489 | Bacteria | 2550 |
| 484 | nmdc:mga00v17_142054_c1 | 3300050491 | Bacteria | 1540 |
| 485 | nmdc:mga0yw44_20812_c1 | 3300050492 | Bacteria | 3648 |
| 486 | nmdc:mga0yw44_229572_c1 | 3300050492 | Bacteria | 1232 |
| 487 | nmdc:mga0yw44_51924_c1 | 3300050492 | Bacteria | 2484 |
| 488 | nmdc:mga0yw44_81146_c1 | 3300050492 | Bacteria | 2033 |
| 489 | nmdc:mga0k408_168465_c1 | 3300050493 | Bacteria | 1306 |
| 490 | nmdc:mga06z11_20630_c1 | 3300050494 | Bacteria | 3048 |
| 491 | nmdc:mga06z11_75741_c1 | 3300050494 | Bacteria | 1793 |
| 492 | nmdc:mga05p37_276842_c1 | 3300050507 | Bacteria | 2003 |
| 493 | nmdc:mga05p37_63275_c1 | 3300050507 | Bacteria | 4552 |
| 494 | nmdc:mga0qj67_2433_c1 | 3300050509 | Bacteria | 13256 |
| 495 | nmdc:mga06r32_3873_c1 | 3300050510 | Bacteria | 13398 |
| 496 | nmdc:mga08y16_223823_c1 | 3300050511 | Bacteria | 1947 |
| 497 | nmdc:mga08x19_154760_c1 | 3300050514 | Bacteria | 1554 |
| 498 | nmdc:mga0sz30_10602_c2 | 3300050516 | Bacteria | 2385 |
| 499 | nmdc:mga0sz30_25318_c1 | 3300050516 | Bacteria | 2426 |
| 500 | nmdc:mga0sz30_61835_c1 | 3300050516 | Bacteria | 1601 |
| 501 | Ga0500643_015374 | 3300053087 | Bacteria | 2628 |
| 502 | Ga0500595_047136 | 3300053119 | Bacteria | 1352 |
| 503 | Ga0500658_0013433 | 3300053134 | Bacteria | 3025 |
| 504 | Ga0500568_0000719 | 3300053139 | Bacteria | 23735 |
| 505 | Ga0500568_0000739 | 3300053139 | Bacteria | 23352 |
| 506 | Ga0500568_0001718 | 3300053139 | Bacteria | 13603 |
| 507 | Ga0500616_0002562 | 3300053153 | Bacteria | 14963 |
| 508 | Ga0500616_0032051 | 3300053153 | Bacteria | 2874 |
| 509 | Ga0500620_000059 | 3300053155 | Bacteria | 20299 |
| 510 | Ga0500620_005587 | 3300053155 | Bacteria | 2929 |
| 511 | Ga0500622_0000134 | 3300053156 | Bacteria | 78418 |
| 512 | Ga0500627_0003110 | 3300053158 | Bacteria | 5071 |
| 513 | Ga0500633_0000380 | 3300053160 | Bacteria | 6808 |
| 514 | Ga0501084_0228941 | 3300054114 | Bacteria | 1569 |
| 515 | Ga0501082_0132528 | 3300060353 | Bacteria | 2162 |
| 516 | Ga0501082_0146405 | 3300060353 | Bacteria | 2051 |
| 517 | Ga0501082_0199743 | 3300060353 | Bacteria | 1739 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2979772303 | 2979775468 | 280 |
| 2 | 3300050514 | nmdc:mga08x19_154760_c1 | nmdc:mga08x19_154760_c1_179_1159 | 283 |
| 3 | 3300005445 | Ga0070708_100278341 | Ga0070708_1002783412 | 284 |
| 4 | 3300021384 | Ga0213876_10049374 | Ga0213876_100493743 | 285 |
| 5 | 3300039437 | Ga0436365_1638330 | Ga0436365_1638330_54_1034 | 285 |
| 6 | 3300048929 | Ga0496126_0206300 | Ga0496126_0206300_413_1393 | 285 |
| 7 | 3300048919 | Ga0496116_0083158 | Ga0496116_0083158_35_895 | 286 |
| 8 | 3300048922 | Ga0496119_0173686 | Ga0496119_0173686_14_877 | 287 |
| 9 | iso_pu_bacteria | 2958108152 | 2958110087 | 288 |
| 10 | iso_pu_bacteria | 2965110997 | 2965112147 | 288 |
| 11 | 3300045051 | Ga0451576_0067552 | Ga0451576_0067552_1992_2972 | 290 |
| 12 | 3300049588 | Ga0501072_0212312 | Ga0501072_0212312_12_887 | 291 |
| 13 | 3300050492 | nmdc:mga0yw44_229572_c1 | nmdc:mga0yw44_229572_c1_309_1220 | 292 |
| 14 | 3300005471 | Ga0070698_100301071 | Ga0070698_1003010712 | 294 |
| 15 | 3300006195 | Ga0075366_10011414 | Ga0075366_100114142 | 295 |
| 16 | 3300050493 | nmdc:mga0k408_168465_c1 | nmdc:mga0k408_168465_c1_155_1141 | 295 |
| 17 | 3300049578 | Ga0501042_0101786 | Ga0501042_0101786_778_1761 | 297 |
| 18 | iso_pu_bacteria | 2878781027 | 2878784568 | 297 |
| 19 | 3300002773 | JGI25152J39213_1001583 | JGI25152J39213_10015834 | 298 |
| 20 | 3300003215 | JGI25153J46596_10002998 | JGI25153J46596_100029984 | 298 |
| 21 | 3300025258 | Ga0209129_1000936 | Ga0209129_10009367 | 298 |
| 22 | 3300025294 | Ga0209025_1003910 | Ga0209025_10039106 | 298 |
| 23 | 3300025297 | Ga0209758_1000662 | Ga0209758_100066217 | 298 |
| 24 | iso_pu_bacteria | 2958137437 | 2958143785 | 299 |
| 25 | 3300049568 | Ga0501031_0091783 | Ga0501031_0091783_85_1065 | 301 |
| 26 | 3300049581 | Ga0501047_0005903 | Ga0501047_0005903_8414_9394 | 301 |
| 27 | 3300049585 | Ga0501069_0088145 | Ga0501069_0088145_279_1259 | 301 |
| 28 | 3300049586 | Ga0501070_0003036 | Ga0501070_0003036_6535_7515 | 301 |
| 29 | 3300049822 | Ga0501035_0005001 | Ga0501035_0005001_1758_2738 | 301 |
| 30 | 3300049823 | Ga0501044_0018495 | Ga0501044_0018495_5719_6699 | 301 |
| 31 | 3300054114 | Ga0501084_0228941 | Ga0501084_0228941_427_1407 | 301 |
| 32 | 3300060353 | Ga0501082_0146405 | Ga0501082_0146405_785_1765 | 301 |
| 33 | 3300042001 | Ga0439441_012417 | Ga0439441_012417_18_929 | 303 |
| 34 | 3300046694 | Ga0495649_0062390 | Ga0495649_0062390_16_927 | 303 |
| 35 | 3300048913 | Ga0496110_0288937 | Ga0496110_0288937_13_924 | 303 |
| 36 | 3300053087 | Ga0500643_015374 | Ga0500643_015374_1294_2274 | 303 |
| 37 | 3300060353 | Ga0501082_0132528 | Ga0501082_0132528_1220_2131 | 303 |
| 38 | 3300046507 | Ga0495606_0001215 | Ga0495606_0001215_34919_35914 | 304 |
| 39 | 3300025304 | Ga0209257_1030244 | Ga0209257_10302442 | 305 |
| 40 | 3300041404 | Ga0439436_0019156 | Ga0439436_0019156_125_1105 | 305 |
| 41 | 3300037418 | Ga0395900_0095539 | Ga0395900_0095539_1072_2031 | 306 |
| 42 | 3300048909 | Ga0496106_0000237 | Ga0496106_0000237_35297_36292 | 306 |
| 43 | 3300006353 | Ga0075370_10063318 | Ga0075370_100633182 | 309 |
| 44 | 3300046616 | Ga0495668_0016098 | Ga0495668_0016098_2546_3526 | 309 |
| 45 | 3300050494 | nmdc:mga06z11_75741_c1 | nmdc:mga06z11_75741_c1_625_1605 | 309 |
| 46 | 3300047320 | Ga0495672_0045454 | Ga0495672_0045454_234_1214 | 310 |
| 47 | 3300003322 | rootL2_10152327 | rootL2_101523272 | 312 |
| 48 | 3300053134 | Ga0500658_0013433 | Ga0500658_0013433_1858_2853 | 312 |
| 49 | 3300053139 | Ga0500568_0000739 | Ga0500568_0000739_18546_19541 | 312 |
| 50 | 3300053160 | Ga0500633_0000380 | Ga0500633_0000380_1895_2890 | 312 |
| 51 | 3300009093 | Ga0105240_10152960 | Ga0105240_101529602 | 315 |
| 52 | 3300009545 | Ga0105237_10038932 | Ga0105237_100389322 | 315 |
| 53 | 3300009551 | Ga0105238_10390321 | Ga0105238_103903212 | 315 |
| 54 | 3300025914 | Ga0207671_10030200 | Ga0207671_100302003 | 315 |
| 55 | 3300050492 | nmdc:mga0yw44_81146_c1 | nmdc:mga0yw44_81146_c1_273_1253 | 315 |
| 56 | 3300050516 | nmdc:mga0sz30_61835_c1 | nmdc:mga0sz30_61835_c1_151_1131 | 315 |
| 57 | 3300006051 | Ga0075364_10081676 | Ga0075364_100816762 | 316 |
| 58 | 3300006177 | Ga0075362_10013216 | Ga0075362_100132163 | 316 |
| 59 | 3300046665 | Ga0495661_0120376 | Ga0495661_0120376_276_1256 | 316 |
| 60 | 3300047443 | Ga0495687_023740 | Ga0495687_023740_266_1246 | 316 |
| 61 | 3300050489 | nmdc:mga03683_20268_c1 | nmdc:mga03683_20268_c1_409_1389 | 316 |
| 62 | 3300050491 | nmdc:mga00v17_142054_c1 | nmdc:mga00v17_142054_c1_537_1517 | 316 |
| 63 | 3300006847 | Ga0075431_100017415 | Ga0075431_1000174154 | 317 |
| 64 | 3300031456 | Ga0307513_10034535 | Ga0307513_100345353 | 317 |
| 65 | 3300049569 | Ga0501032_0029874 | Ga0501032_0029874_1628_2608 | 317 |
| 66 | 3300049570 | Ga0501033_0093861 | Ga0501033_0093861_918_1898 | 317 |
| 67 | 3300049579 | Ga0501043_0011422 | Ga0501043_0011422_3277_4257 | 317 |
| 68 | 3300049581 | Ga0501047_0115398 | Ga0501047_0115398_1359_2339 | 317 |
| 69 | 3300049586 | Ga0501070_0065379 | Ga0501070_0065379_663_1643 | 317 |
| 70 | 3300049742 | Ga0501080_0223531 | Ga0501080_0223531_55_1035 | 317 |
| 71 | 3300049744 | Ga0501083_0053441 | Ga0501083_0053441_1633_2613 | 317 |
| 72 | 3300049822 | Ga0501035_0019757 | Ga0501035_0019757_1691_2671 | 317 |
| 73 | 3300049823 | Ga0501044_0037064 | Ga0501044_0037064_1382_2362 | 317 |
| 74 | 3300025904 | Ga0207647_10056405 | Ga0207647_100564052 | 318 |
| 75 | 3300026067 | Ga0207678_10283771 | Ga0207678_102837712 | 318 |
| 76 | 3300006844 | Ga0075428_100118153 | Ga0075428_1001181532 | 319 |
| 77 | 3300006846 | Ga0075430_100035538 | Ga0075430_1000355382 | 319 |
| 78 | 3300009147 | Ga0114129_10405083 | Ga0114129_104050832 | 319 |
| 79 | 3300037418 | Ga0395900_0167834 | Ga0395900_0167834_628_1587 | 319 |
| 80 | 3300050507 | nmdc:mga05p37_276842_c1 | nmdc:mga05p37_276842_c1_330_1310 | 319 |
| 81 | 3300050509 | nmdc:mga0qj67_2433_c1 | nmdc:mga0qj67_2433_c1_11665_12645 | 319 |
| 82 | iso_pu_bacteria | 2501025504 | 2501409696 | 322 |
| 83 | iso_pu_bacteria | 2503198000 | 2503201474 | 322 |
| 84 | iso_pu_bacteria | 2508501122 | 2509110039 | 322 |
| 85 | iso_pu_bacteria | 2508501123 | 2509113079 | 322 |
| 86 | iso_pu_bacteria | 2508501127 | 2509143946 | 322 |
| 87 | iso_pu_bacteria | 2509276018 | 2509367885 | 322 |
| 88 | iso_pu_bacteria | 2509276019 | 2509378339 | 322 |
| 89 | iso_pu_bacteria | 2509276022 | 2509396252 | 322 |
| 90 | iso_pu_bacteria | 2510065059 | 2510315567 | 322 |
| 91 | iso_pu_bacteria | 2510917014 | 2511099220 | 322 |
| 92 | iso_pu_bacteria | 2510917015 | 2511108676 | 322 |
| 93 | iso_pu_bacteria | 2512875016 | 2512931556 | 322 |
| 94 | iso_pu_bacteria | 2512875024 | 2512959390 | 322 |
| 95 | iso_pu_bacteria | 2513237082 | 2513558102 | 322 |
| 96 | iso_pu_bacteria | 2513237083 | 2513565752 | 322 |
| 97 | iso_pu_bacteria | 2513237090 | 2513611346 | 322 |
| 98 | iso_pu_bacteria | 2513237144 | 2513910800 | 322 |
| 99 | iso_pu_bacteria | 2513237146 | 2513927243 | 322 |
| 100 | iso_pu_bacteria | 2513237159 | 2514000013 | 322 |
| 101 | iso_pu_bacteria | 2513237164 | 2514033553 | 322 |
| 102 | iso_pu_bacteria | 2513237305 | 2514419693 | 322 |
| 103 | iso_pu_bacteria | 2513237351 | 2514589357 | 322 |
| 104 | iso_pu_bacteria | 2515154122 | 2515681372 | 322 |
| 105 | iso_pu_bacteria | 2516143018 | 2516207875 | 322 |
| 106 | iso_pu_bacteria | 2558860100 | 2558861723 | 322 |
| 107 | iso_pu_bacteria | 2562617112 | 2563056835 | 322 |
| 108 | iso_pu_bacteria | 2588253730 | 2588517395 | 322 |
| 109 | iso_pu_bacteria | 2597489875 | 2597813282 | 322 |
| 110 | iso_pu_bacteria | 2599185170 | 2599415316 | 322 |
| 111 | iso_pu_bacteria | 2599185301 | 2599936805 | 322 |
| 112 | iso_pu_bacteria | 2599185352 | 2600197740 | 322 |
| 113 | iso_pu_bacteria | 2600255067 | 2600813459 | 322 |
| 114 | iso_pu_bacteria | 2643221557 | 2643807878 | 322 |
| 115 | iso_pu_bacteria | 2643221595 | 2643986855 | 322 |
| 116 | iso_pu_bacteria | 2643221610 | 2644068030 | 322 |
| 117 | iso_pu_bacteria | 2643221618 | 2644106888 | 322 |
| 118 | iso_pu_bacteria | 2643221626 | 2644149670 | 322 |
| 119 | iso_pu_bacteria | 2643221627 | 2644157018 | 322 |
| 120 | iso_pu_bacteria | 2643221634 | 2644192410 | 322 |
| 121 | iso_pu_bacteria | 2643221655 | 2644311277 | 322 |
| 122 | iso_pu_bacteria | 2643221659 | 2644331885 | 322 |
| 123 | iso_pu_bacteria | 2643221668 | 2644378219 | 322 |
| 124 | iso_pu_bacteria | 2643221675 | 2644418893 | 322 |
| 125 | iso_pu_bacteria | 2643221680 | 2644452320 | 322 |
| 126 | iso_pu_bacteria | 2643221698 | 2644543641 | 322 |
| 127 | iso_pu_bacteria | 2643221712 | 2644615816 | 322 |
| 128 | iso_pu_bacteria | 2643221723 | 2644674550 | 322 |
| 129 | iso_pu_bacteria | 2643221726 | 2644687064 | 322 |
| 130 | iso_pu_bacteria | 2687453392 | 2688598386 | 322 |
| 131 | iso_pu_bacteria | 2690316117 | 2692319436 | 322 |
| 132 | iso_pu_bacteria | 2693429783 | 2694631022 | 322 |
| 133 | iso_pu_bacteria | 2693429784 | 2694636480 | 322 |
| 134 | iso_pu_bacteria | 2711768613 | 2713481153 | 322 |
| 135 | iso_pu_bacteria | 2718217882 | 2719184702 | 322 |
| 136 | iso_pu_bacteria | 2718217991 | 2719643575 | 322 |
| 137 | iso_pu_bacteria | 2718217997 | 2719669086 | 322 |
| 138 | iso_pu_bacteria | 2718218009 | 2719728722 | 322 |
| 139 | iso_pu_bacteria | 2718218199 | 2720489780 | 322 |
| 140 | iso_pu_bacteria | 2718218233 | 2720616902 | 322 |
| 141 | iso_pu_bacteria | 2718218235 | 2720629043 | 322 |
| 142 | iso_pu_bacteria | 2718218269 | 2720773117 | 322 |
| 143 | iso_pu_bacteria | 2718218363 | 2721144413 | 322 |
| 144 | iso_pu_bacteria | 2718218366 | 2721161783 | 322 |
| 145 | iso_pu_bacteria | 2721755514 | 2722842928 | 322 |
| 146 | iso_pu_bacteria | 2721755556 | 2723030545 | 322 |
| 147 | iso_pu_bacteria | 2721755684 | 2723564907 | 322 |
| 148 | iso_pu_bacteria | 2721755686 | 2723575324 | 322 |
| 149 | iso_pu_bacteria | 2721755810 | 2724041747 | 322 |
| 150 | iso_pu_bacteria | 2721755819 | 2724093146 | 322 |
| 151 | iso_pu_bacteria | 2728369352 | 2730111078 | 322 |
| 152 | iso_pu_bacteria | 2728369365 | 2730160817 | 322 |
| 153 | iso_pu_bacteria | 2751185821 | 2753460451 | 322 |
| 154 | iso_pu_bacteria | 2791355082 | 2792584588 | 322 |
| 155 | iso_pu_bacteria | 2791355091 | 2792619292 | 322 |
| 156 | iso_pu_bacteria | 2791355092 | 2792627065 | 322 |
| 157 | iso_pu_bacteria | 2791355094 | 2792643305 | 322 |
| 158 | iso_pu_bacteria | 2791355123 | 2792752734 | 322 |
| 159 | iso_pu_bacteria | 2791355264 | 2793345592 | 322 |
| 160 | iso_pu_bacteria | 2791355267 | 2793366593 | 322 |
| 161 | iso_pu_bacteria | 2838016132 | 2838016832 | 322 |
| 162 | iso_pu_bacteria | 2838022645 | 2838025286 | 322 |
| 163 | iso_pu_bacteria | 2838035591 | 2838038959 | 322 |
| 164 | iso_pu_bacteria | 2838074704 | 2838075994 | 322 |
| 165 | iso_pu_bacteria | 2841734538 | 2841739142 | 322 |
| 166 | iso_pu_bacteria | 2842198810 | 2842200852 | 322 |
| 167 | iso_pu_bacteria | 2842521101 | 2842523805 | 322 |
| 168 | iso_pu_bacteria | 2844009547 | 2844013639 | 322 |
| 169 | iso_pu_bacteria | 2844163670 | 2844169380 | 322 |
| 170 | iso_pu_bacteria | 2847417321 | 2847422061 | 322 |
| 171 | iso_pu_bacteria | 2847670302 | 2847675561 | 322 |
| 172 | iso_pu_bacteria | 2847686936 | 2847692202 | 322 |
| 173 | iso_pu_bacteria | 2848992105 | 2848997039 | 322 |
| 174 | iso_pu_bacteria | 2850079185 | 2850084231 | 322 |
| 175 | iso_pu_bacteria | 2855872281 | 2855875032 | 322 |
| 176 | iso_pu_bacteria | 2856314179 | 2856319447 | 322 |
| 177 | iso_pu_bacteria | 2856320880 | 2856327538 | 322 |
| 178 | iso_pu_bacteria | 2856328259 | 2856334505 | 322 |
| 179 | iso_pu_bacteria | 2856334872 | 2856340373 | 322 |
| 180 | iso_pu_bacteria | 2856342000 | 2856343899 | 322 |
| 181 | iso_pu_bacteria | 2856349417 | 2856352768 | 322 |
| 182 | iso_pu_bacteria | 2856356410 | 2856363010 | 322 |
| 183 | iso_pu_bacteria | 2856364286 | 2856369405 | 322 |
| 184 | iso_pu_bacteria | 2857349434 | 2857351203 | 322 |
| 185 | iso_pu_bacteria | 2857367948 | 2857372758 | 322 |
| 186 | iso_pu_bacteria | 2869162929 | 2869168250 | 322 |
| 187 | iso_pu_bacteria | 2869169390 | 2869171494 | 322 |
| 188 | iso_pu_bacteria | 2869242130 | 2869246901 | 322 |
| 189 | iso_pu_bacteria | 2869249662 | 2869251814 | 322 |
| 190 | iso_pu_bacteria | 2869256925 | 2869260810 | 322 |
| 191 | iso_pu_bacteria | 2869264136 | 2869269399 | 322 |
| 192 | iso_pu_bacteria | 2869271264 | 2869276472 | 322 |
| 193 | iso_pu_bacteria | 2869278585 | 2869280427 | 322 |
| 194 | iso_pu_bacteria | 2869285874 | 2869286522 | 322 |
| 195 | iso_pu_bacteria | 2871429161 | 2871434675 | 322 |
| 196 | iso_pu_bacteria | 2871435913 | 2871441531 | 322 |
| 197 | iso_pu_bacteria | 2871444079 | 2871447024 | 322 |
| 198 | iso_pu_bacteria | 2871451962 | 2871459517 | 322 |
| 199 | iso_pu_bacteria | 2871459585 | 2871463851 | 322 |
| 200 | iso_pu_bacteria | 2871474448 | 2871474631 | 322 |
| 201 | iso_pu_bacteria | 2871481445 | 2871481812 | 322 |
| 202 | iso_pu_bacteria | 2871488783 | 2871494596 | 322 |
| 203 | iso_pu_bacteria | 2871495908 | 2871501453 | 322 |
| 204 | iso_pu_bacteria | 2874102143 | 2874109167 | 322 |
| 205 | iso_pu_bacteria | 2874109183 | 2874113145 | 322 |
| 206 | iso_pu_bacteria | 2874116593 | 2874123005 | 322 |
| 207 | iso_pu_bacteria | 2874123672 | 2874130551 | 322 |
| 208 | iso_pu_bacteria | 2874139085 | 2874144161 | 322 |
| 209 | iso_pu_bacteria | 2874146452 | 2874149880 | 322 |
| 210 | iso_pu_bacteria | 2874155637 | 2874158138 | 322 |
| 211 | iso_pu_bacteria | 2874162495 | 2874164484 | 322 |
| 212 | iso_pu_bacteria | 2874168670 | 2874169795 | 322 |
| 213 | iso_pu_bacteria | 2876363079 | 2876368538 | 322 |
| 214 | iso_pu_bacteria | 2876369609 | 2876375325 | 322 |
| 215 | iso_pu_bacteria | 2876377896 | 2876385245 | 322 |
| 216 | iso_pu_bacteria | 2876386047 | 2876390875 | 322 |
| 217 | iso_pu_bacteria | 2876392853 | 2876398387 | 322 |
| 218 | iso_pu_bacteria | 2876399893 | 2876403669 | 322 |
| 219 | iso_pu_bacteria | 2876406927 | 2876411227 | 322 |
| 220 | iso_pu_bacteria | 2876413966 | 2876416342 | 322 |
| 221 | iso_pu_bacteria | 2876420981 | 2876427823 | 322 |
| 222 | iso_pu_bacteria | 2878035449 | 2878040682 | 322 |
| 223 | iso_pu_bacteria | 2878730984 | 2878732181 | 322 |
| 224 | iso_pu_bacteria | 2878738818 | 2878745156 | 322 |
| 225 | iso_pu_bacteria | 2878745973 | 2878751808 | 322 |
| 226 | iso_pu_bacteria | 2878753008 | 2878758822 | 322 |
| 227 | iso_pu_bacteria | 2878760144 | 2878765433 | 322 |
| 228 | iso_pu_bacteria | 2878767105 | 2878773141 | 322 |
| 229 | iso_pu_bacteria | 2878774303 | 2878775669 | 322 |
| 230 | iso_pu_bacteria | 2878788777 | 2878795933 | 322 |
| 231 | iso_pu_bacteria | 2881147464 | 2881151277 | 322 |
| 232 | iso_pu_bacteria | 2881155292 | 2881161750 | 322 |
| 233 | iso_pu_bacteria | 2881161766 | 2881167477 | 322 |
| 234 | iso_pu_bacteria | 2881845957 | 2881847777 | 322 |
| 235 | iso_pu_bacteria | 2881853255 | 2881855288 | 322 |
| 236 | iso_pu_bacteria | 2881861095 | 2881866651 | 322 |
| 237 | iso_pu_bacteria | 2882632389 | 2882636219 | 322 |
| 238 | iso_pu_bacteria | 2882912400 | 2882918516 | 322 |
| 239 | iso_pu_bacteria | 2883087390 | 2883087514 | 322 |
| 240 | iso_pu_bacteria | 2885270888 | 2885272684 | 322 |
| 241 | iso_pu_bacteria | 2885305155 | 2885309376 | 322 |
| 242 | iso_pu_bacteria | 2885312484 | 2885318037 | 322 |
| 243 | iso_pu_bacteria | 2885318864 | 2885320649 | 322 |
| 244 | iso_pu_bacteria | 2885326080 | 2885330038 | 322 |
| 245 | iso_pu_bacteria | 2885334103 | 2885342017 | 322 |
| 246 | iso_pu_bacteria | 2885342637 | 2885346959 | 322 |
| 247 | iso_pu_bacteria | 2888337043 | 2888339368 | 322 |
| 248 | iso_pu_bacteria | 2888343758 | 2888346745 | 322 |
| 249 | iso_pu_bacteria | 2888350351 | 2888355706 | 322 |
| 250 | iso_pu_bacteria | 2889010040 | 2889010641 | 322 |
| 251 | iso_pu_bacteria | 2889016732 | 2889017658 | 322 |
| 252 | iso_pu_bacteria | 2896384573 | 2896388373 | 322 |
| 253 | iso_pu_bacteria | 2902682994 | 2902686180 | 322 |
| 254 | iso_pu_bacteria | 2903448605 | 2903451256 | 322 |
| 255 | iso_pu_bacteria | 2903492973 | 2903503939 | 322 |
| 256 | iso_pu_bacteria | 2903492973 | 2903504754 | 322 |
| 257 | iso_pu_bacteria | 2903513507 | 2903520924 | 322 |
| 258 | iso_pu_bacteria | 2903521522 | 2903527537 | 322 |
| 259 | iso_pu_bacteria | 2903528002 | 2903533991 | 322 |
| 260 | iso_pu_bacteria | 2903540706 | 2903546264 | 322 |
| 261 | iso_pu_bacteria | 2904659560 | 2904664942 | 322 |
| 262 | iso_pu_bacteria | 2906308376 | 2906314206 | 322 |
| 263 | iso_pu_bacteria | 2906321335 | 2906327372 | 322 |
| 264 | iso_pu_bacteria | 2906328253 | 2906330062 | 322 |
| 265 | iso_pu_bacteria | 2906363423 | 2906364294 | 322 |
| 266 | iso_pu_bacteria | 2906370794 | 2906373016 | 322 |
| 267 | iso_pu_bacteria | 2906401398 | 2906401757 | 322 |
| 268 | iso_pu_bacteria | 2906408224 | 2906408844 | 322 |
| 269 | iso_pu_bacteria | 2906414383 | 2906420167 | 322 |
| 270 | iso_pu_bacteria | 2906427513 | 2906429456 | 322 |
| 271 | iso_pu_bacteria | 2920760137 | 2920764537 | 322 |
| 272 | iso_pu_bacteria | 2921643360 | 2921647264 | 322 |
| 273 | iso_pu_bacteria | 2922130491 | 2922130833 | 322 |
| 274 | iso_pu_bacteria | 2922151315 | 2922152240 | 322 |
| 275 | iso_pu_bacteria | 2922158528 | 2922161458 | 322 |
| 276 | iso_pu_bacteria | 2922172374 | 2922175294 | 322 |
| 277 | iso_pu_bacteria | 2922178524 | 2922183342 | 322 |
| 278 | iso_pu_bacteria | 2922185730 | 2922188235 | 322 |
| 279 | iso_pu_bacteria | 2924726620 | 2924727446 | 322 |
| 280 | iso_pu_bacteria | 2924733363 | 2924735878 | 322 |
| 281 | iso_pu_bacteria | 2924741084 | 2924747352 | 322 |
| 282 | iso_pu_bacteria | 2924748358 | 2924748368 | 322 |
| 283 | iso_pu_bacteria | 2924754689 | 2924755010 | 322 |
| 284 | iso_pu_bacteria | 2924762789 | 2924765064 | 322 |
| 285 | iso_pu_bacteria | 2924776078 | 2924783293 | 322 |
| 286 | iso_pu_bacteria | 2924784321 | 2924789024 | 322 |
| 287 | iso_pu_bacteria | 2933016740 | 2933023116 | 322 |
| 288 | iso_pu_bacteria | 2937813078 | 2937815684 | 322 |
| 289 | iso_pu_bacteria | 2937822353 | 2937824396 | 322 |
| 290 | iso_pu_bacteria | 2937836603 | 2937839329 | 322 |
| 291 | iso_pu_bacteria | 2937848649 | 2937851878 | 322 |
| 292 | iso_pu_bacteria | 2937861824 | 2937866627 | 322 |
| 293 | iso_pu_bacteria | 2937877337 | 2937882180 | 322 |
| 294 | iso_pu_bacteria | 2937891427 | 2937898045 | 322 |
| 295 | iso_pu_bacteria | 2937972304 | 2937978641 | 322 |
| 296 | iso_pu_bacteria | 2937994558 | 2938000122 | 322 |
| 297 | iso_pu_bacteria | 2938014810 | 2938019247 | 322 |
| 298 | iso_pu_bacteria | 2941499720 | 2941506886 | 322 |
| 299 | iso_pu_bacteria | 2958034702 | 2958036297 | 322 |
| 300 | iso_pu_bacteria | 2958041894 | 2958045661 | 322 |
| 301 | iso_pu_bacteria | 2958041894 | 2958051525 | 322 |
| 302 | iso_pu_bacteria | 2958064165 | 2958064428 | 322 |
| 303 | iso_pu_bacteria | 2958071322 | 2958072065 | 322 |
| 304 | iso_pu_bacteria | 2958084443 | 2958089302 | 322 |
| 305 | iso_pu_bacteria | 2958092219 | 2958092270 | 322 |
| 306 | iso_pu_bacteria | 2958100919 | 2958101825 | 322 |
| 307 | iso_pu_bacteria | 2958115193 | 2958118405 | 322 |
| 308 | iso_pu_bacteria | 2958122699 | 2958122765 | 322 |
| 309 | iso_pu_bacteria | 2958130278 | 2958130925 | 322 |
| 310 | iso_pu_bacteria | 2958144490 | 2958150430 | 322 |
| 311 | iso_pu_bacteria | 2958158011 | 2958161494 | 322 |
| 312 | iso_pu_bacteria | 2958165035 | 2958170586 | 322 |
| 313 | iso_pu_bacteria | 2958172287 | 2958179077 | 322 |
| 314 | iso_pu_bacteria | 2958179912 | 2958184846 | 322 |
| 315 | iso_pu_bacteria | 2961077736 | 2961083013 | 322 |
| 316 | iso_pu_bacteria | 2961114664 | 2961119941 | 322 |
| 317 | iso_pu_bacteria | 2961127735 | 2961134307 | 322 |
| 318 | iso_pu_bacteria | 2961163497 | 2961169041 | 322 |
| 319 | iso_pu_bacteria | 2961170736 | 2961176100 | 322 |
| 320 | iso_pu_bacteria | 2961183825 | 2961184334 | 322 |
| 321 | iso_pu_bacteria | 2963644680 | 2963647655 | 322 |
| 322 | iso_pu_bacteria | 2965018300 | 2965024328 | 322 |
| 323 | iso_pu_bacteria | 2965025482 | 2965031814 | 322 |
| 324 | iso_pu_bacteria | 2965032056 | 2965036903 | 322 |
| 325 | iso_pu_bacteria | 2965040258 | 2965045211 | 322 |
| 326 | iso_pu_bacteria | 2965047637 | 2965049798 | 322 |
| 327 | iso_pu_bacteria | 2965062239 | 2965064192 | 322 |
| 328 | iso_pu_bacteria | 2965089291 | 2965091546 | 322 |
| 329 | iso_pu_bacteria | 2965119406 | 2965122610 | 322 |
| 330 | iso_pu_bacteria | 2967996073 | 2968001987 | 322 |
| 331 | iso_pu_bacteria | 2968003550 | 2968008989 | 322 |
| 332 | iso_pu_bacteria | 2968016561 | 2968018508 | 322 |
| 333 | iso_pu_bacteria | 2968083720 | 2968090286 | 322 |
| 334 | iso_pu_bacteria | 2968091066 | 2968096313 | 322 |
| 335 | iso_pu_bacteria | 2968097103 | 2968098812 | 322 |
| 336 | iso_pu_bacteria | 2968110612 | 2968116298 | 322 |
| 337 | iso_pu_bacteria | 2968117919 | 2968119898 | 322 |
| 338 | iso_pu_bacteria | 2968128360 | 2968129133 | 322 |
| 339 | iso_pu_bacteria | 2968138860 | 2968139016 | 322 |
| 340 | iso_pu_bacteria | 2968171901 | 2968177435 | 322 |
| 341 | iso_pu_bacteria | 2970469710 | 2970471319 | 322 |
| 342 | iso_pu_bacteria | 2970489779 | 2970492942 | 322 |
| 343 | iso_pu_bacteria | 2970503327 | 2970508766 | 322 |
| 344 | iso_pu_bacteria | 2970510686 | 2970515568 | 322 |
| 345 | iso_pu_bacteria | 2970524798 | 2970528528 | 322 |
| 346 | iso_pu_bacteria | 2970532167 | 2970537740 | 322 |
| 347 | iso_pu_bacteria | 2970540015 | 2970540489 | 322 |
| 348 | iso_pu_bacteria | 2970547951 | 2970548946 | 322 |
| 349 | iso_pu_bacteria | 2970554993 | 2970560281 | 322 |
| 350 | iso_pu_bacteria | 2970593180 | 2970595024 | 322 |
| 351 | iso_pu_bacteria | 2970619444 | 2970621785 | 322 |
| 352 | iso_pu_bacteria | 2970627176 | 2970629065 | 322 |
| 353 | iso_pu_bacteria | 2977821940 | 2977827362 | 322 |
| 354 | iso_pu_bacteria | 2977828996 | 2977834214 | 322 |
| 355 | iso_pu_bacteria | 2977843712 | 2977845920 | 322 |
| 356 | iso_pu_bacteria | 2977851361 | 2977855856 | 322 |
| 357 | iso_pu_bacteria | 2977858184 | 2977864339 | 322 |
| 358 | iso_pu_bacteria | 2977864932 | 2977867137 | 322 |
| 359 | iso_pu_bacteria | 2977872689 | 2977873286 | 322 |
| 360 | iso_pu_bacteria | 2977907340 | 2977910268 | 322 |
| 361 | iso_pu_bacteria | 2977915119 | 2977916436 | 322 |
| 362 | iso_pu_bacteria | 2977922695 | 2977924164 | 322 |
| 363 | iso_pu_bacteria | 2977935797 | 2977936075 | 322 |
| 364 | iso_pu_bacteria | 2977942078 | 2977942698 | 322 |
| 365 | iso_pu_bacteria | 2977950692 | 2977954866 | 322 |
| 366 | iso_pu_bacteria | 2977957713 | 2977964179 | 322 |
| 367 | iso_pu_bacteria | 2977971508 | 2977978563 | 322 |
| 368 | iso_pu_bacteria | 2977986579 | 2977991734 | 322 |
| 369 | iso_pu_bacteria | 2979710463 | 2979713635 | 322 |
| 370 | iso_pu_bacteria | 2979742915 | 2979749454 | 322 |
| 371 | iso_pu_bacteria | 2979764755 | 2979770815 | 322 |
| 372 | iso_pu_bacteria | 2979779861 | 2979785548 | 322 |
| 373 | iso_pu_bacteria | 2979793036 | 2979796741 | 322 |
| 374 | iso_pu_bacteria | 2979808191 | 2979811586 | 322 |
| 375 | iso_pu_bacteria | 2987636660 | 2987638387 | 322 |
| 376 | iso_pu_bacteria | 2987645492 | 2987649567 | 322 |
| 377 | iso_pu_bacteria | 2987652177 | 2987657278 | 322 |
| 378 | iso_pu_bacteria | 2987659509 | 2987665072 | 322 |
| 379 | iso_pu_bacteria | 2987666974 | 2987667970 | 322 |
| 380 | iso_pu_bacteria | 2987673487 | 2987678144 | 322 |
| 381 | iso_pu_bacteria | 2989771324 | 2989776655 | 322 |
| 382 | iso_pu_bacteria | 2996336353 | 2996338041 | 322 |
| 383 | iso_pu_bacteria | 2996341866 | 2996342320 | 322 |
| 384 | iso_pu_bacteria | 2996348954 | 2996350111 | 322 |
| 385 | iso_pu_bacteria | 2996386984 | 2996392288 | 322 |
| 386 | iso_pu_bacteria | 3000135777 | 3000140719 | 322 |
| 387 | iso_pu_bacteria | 3003930520 | 3003935836 | 322 |
| 388 | iso_pu_bacteria | 3004167301 | 3004168834 | 322 |
| 389 | iso_pu_bacteria | 3004188549 | 3004194129 | 322 |
| 390 | iso_pu_bacteria | 3004195979 | 3004203773 | 322 |
| 391 | iso_pu_bacteria | 3004203850 | 3004205369 | 322 |
| 392 | iso_pu_bacteria | 3004211236 | 3004215899 | 322 |
| 393 | iso_pu_bacteria | 3004218560 | 3004221935 | 322 |
| 394 | iso_pu_bacteria | 3004232784 | 3004237074 | 322 |
| 395 | iso_pu_bacteria | 3004239961 | 3004247623 | 322 |
| 396 | iso_pu_bacteria | 3004248173 | 3004250875 | 322 |
| 397 | iso_pu_bacteria | 3004268573 | 3004274876 | 322 |
| 398 | iso_pu_bacteria | 3004275668 | 3004276810 | 322 |
| 399 | iso_pu_bacteria | 3004289098 | 3004289517 | 322 |
| 400 | iso_pu_bacteria | 3004334049 | 3004334422 | 322 |
| 401 | iso_pu_bacteria | 3005409236 | 3005413511 | 322 |
| 402 | iso_pu_bacteria | 637000159 | 637074656 | 322 |
| 403 | iso_pu_bacteria | 643692032 | 643824020 | 322 |
| 404 | iso_pu_bacteria | 649633066 | 649872914 | 322 |
| 405 | iso_pu_bacteria | 8003955200 | 8003962074 | 322 |
| 406 | iso_pu_bacteria | 8004300914 | 8004300968 | 322 |
| 407 | iso_pu_bacteria | 8004312739 | 8004320391 | 322 |
| 408 | iso_pu_bacteria | 8004361976 | 8004362408 | 322 |
| 409 | iso_pu_bacteria | 8004374579 | 8004380343 | 322 |
| 410 | iso_pu_bacteria | 8004387939 | 8004393696 | 322 |
| 411 | iso_pu_bacteria | 8004445564 | 8004451726 | 322 |
| 412 | iso_pu_bacteria | 8004633249 | 8004638635 | 322 |
| 413 | iso_pu_bacteria | 8004640170 | 8004640879 | 322 |
| 414 | iso_pu_bacteria | 8004695233 | 8004695468 | 322 |
| 415 | iso_pu_bacteria | 8004703790 | 8004709307 | 322 |
| 416 | iso_pu_bacteria | 8004714634 | 8004720464 | 322 |
| 417 | iso_pu_bacteria | 8004727605 | 8004728912 | 322 |
| 418 | iso_pu_bacteria | 8005282627 | 8005284205 | 322 |
| 419 | iso_pu_bacteria | 8005301065 | 8005307245 | 322 |
| 420 | iso_pu_bacteria | 8005619151 | 8005624652 | 322 |
| 421 | iso_pu_bacteria | 8005688590 | 8005695156 | 322 |
| 422 | iso_pu_bacteria | 8023680758 | 8023682202 | 322 |
| 423 | iso_pu_bacteria | 8049293176 | 8049296912 | 322 |
| 424 | iso_pu_bacteria | 8055617313 | 8055620722 | 322 |
| 425 | 3300003792 | Ga0055540_1008130 | Ga0055540_10081302 | 324 |
| 426 | 3300025294 | Ga0209025_1055850 | Ga0209025_10558502 | 324 |
| 427 | iso_pu_bacteria | 2510917030 | 2511195636 | 324 |
| 428 | iso_pu_bacteria | 2513237084 | 2513570178 | 324 |
| 429 | iso_pu_bacteria | 2513237088 | 2513600418 | 324 |
| 430 | iso_pu_bacteria | 2513237103 | 2513710402 | 324 |
| 431 | iso_pu_bacteria | 2513237138 | 2513867163 | 324 |
| 432 | iso_pu_bacteria | 2515075009 | 2515111670 | 324 |
| 433 | iso_pu_bacteria | 2516653077 | 2517040360 | 324 |
| 434 | iso_pu_bacteria | 2524023209 | 2524457044 | 324 |
| 435 | iso_pu_bacteria | 2534681796 | 2535520200 | 324 |
| 436 | iso_pu_bacteria | 2582581294 | 2585203938 | 324 |
| 437 | iso_pu_bacteria | 2582581298 | 2585222429 | 324 |
| 438 | iso_pu_bacteria | 2582581867 | 2585402655 | 324 |
| 439 | iso_pu_bacteria | 2585427529 | 2585544619 | 324 |
| 440 | iso_pu_bacteria | 2643221643 | 2644242320 | 324 |
| 441 | iso_pu_bacteria | 2791355260 | 2793321386 | 324 |
| 442 | iso_pu_bacteria | 2842217011 | 2842220425 | 324 |
| 443 | iso_pu_bacteria | 2842285085 | 2842287777 | 324 |
| 444 | iso_pu_bacteria | 2842298080 | 2842299403 | 324 |
| 445 | iso_pu_bacteria | 2842357229 | 2842362187 | 324 |
| 446 | iso_pu_bacteria | 2842402390 | 2842404694 | 324 |
| 447 | iso_pu_bacteria | 2842409023 | 2842411277 | 324 |
| 448 | iso_pu_bacteria | 2842415677 | 2842418272 | 324 |
| 449 | iso_pu_bacteria | 2842509118 | 2842512301 | 324 |
| 450 | iso_pu_bacteria | 2852387548 | 2852394424 | 324 |
| 451 | iso_pu_bacteria | 2919100787 | 2919103013 | 324 |
| 452 | iso_pu_bacteria | 2923556063 | 2923560067 | 324 |
| 453 | iso_pu_bacteria | 2936367885 | 2936373365 | 324 |
| 454 | iso_pu_bacteria | 2936375103 | 2936378634 | 324 |
| 455 | iso_pu_bacteria | 2996887358 | 2996887786 | 324 |
| 456 | iso_pu_bacteria | 3005416602 | 3005419209 | 324 |
| 457 | iso_pu_bacteria | 3005445848 | 3005450921 | 324 |
| 458 | iso_pu_bacteria | 639633055 | 639647881 | 324 |
| 459 | iso_pu_bacteria | 8005258706 | 8005264557 | 324 |
| 460 | iso_pu_bacteria | 8005314921 | 8005316707 | 324 |
| 461 | iso_pu_bacteria | 8005321885 | 8005322313 | 324 |
| 462 | iso_pu_bacteria | 8005376324 | 8005378605 | 324 |
| 463 | iso_pu_bacteria | 8005460587 | 8005462321 | 324 |
| 464 | iso_pu_bacteria | 8005542996 | 8005547932 | 324 |
| 465 | iso_pu_bacteria | 8024486573 | 8024487493 | 324 |
| 466 | iso_pu_bacteria | 8046767195 | 8046774750 | 324 |
| 467 | iso_pu_bacteria | 8057575449 | 8057578660 | 324 |
| 468 | 3300006048 | Ga0075363_100044639 | Ga0075363_1000446392 | 325 |
| 469 | 3300006051 | Ga0075364_10139662 | Ga0075364_101396622 | 325 |
| 470 | 3300031730 | Ga0307516_10148290 | Ga0307516_101482902 | 325 |
| 471 | 3300001979 | JGI24740J21852_10035530 | JGI24740J21852_100355301 | 326 |
| 472 | 3300002705 | JGI25156J39149_1002921 | JGI25156J39149_10029214 | 326 |
| 473 | 3300002741 | JGI25157J39369_1001242 | JGI25157J39369_10012429 | 326 |
| 474 | 3300002773 | JGI25152J39213_1003036 | JGI25152J39213_10030364 | 326 |
| 475 | 3300002774 | JGI25150J39212_1007820 | JGI25150J39212_10078203 | 326 |
| 476 | 3300002987 | JGI25159J45721_1000301 | JGI25159J45721_10003013 | 326 |
| 477 | 3300003187 | JGI25151J46595_10001032 | JGI25151J46595_1000103222 | 326 |
| 478 | 3300003214 | JGI25165J46597_1000015 | JGI25165J46597_1000015233 | 326 |
| 479 | 3300003215 | JGI25153J46596_10003010 | JGI25153J46596_100030104 | 326 |
| 480 | 3300003215 | JGI25153J46596_10004827 | JGI25153J46596_100048272 | 326 |
| 481 | 3300003322 | rootL2_10161869 | rootL2_101618692 | 326 |
| 482 | 3300003354 | JGI25160J50197_1000014 | JGI25160J50197_100001462 | 326 |
| 483 | 3300003354 | JGI25160J50197_1003650 | JGI25160J50197_10036503 | 326 |
| 484 | 3300003374 | JGI25161J50226_1000061 | JGI25161J50226_100006162 | 326 |
| 485 | 3300003374 | JGI25161J50226_1000093 | JGI25161J50226_100009317 | 326 |
| 486 | 3300003762 | Ga0055542_1000406 | Ga0055542_100040615 | 326 |
| 487 | 3300003771 | Ga0055526_1007241 | Ga0055526_10072413 | 326 |
| 488 | 3300003771 | Ga0055526_1010797 | Ga0055526_10107975 | 326 |
| 489 | 3300003775 | Ga0055524_1000446 | Ga0055524_100044629 | 326 |
| 490 | 3300003775 | Ga0055524_1005694 | Ga0055524_10056943 | 326 |
| 491 | 3300003775 | Ga0055524_1021068 | Ga0055524_10210682 | 326 |
| 492 | 3300003781 | Ga0055536_1001554 | Ga0055536_100155415 | 326 |
| 493 | 3300003790 | Ga0055528_1012309 | Ga0055528_10123093 | 326 |
| 494 | 3300003791 | Ga0055530_10011721 | Ga0055530_100117211 | 326 |
| 495 | 3300003792 | Ga0055540_1009579 | Ga0055540_10095792 | 326 |
| 496 | 3300003794 | Ga0055531_10010519 | Ga0055531_100105192 | 326 |
| 497 | 3300004625 | Ga0055543_1000005 | Ga0055543_1000005171 | 326 |
| 498 | 3300004625 | Ga0055543_1003163 | Ga0055543_10031633 | 326 |
| 499 | 3300005262 | Ga0065165_1000126 | Ga0065165_100012683 | 326 |
| 500 | 3300005262 | Ga0065165_1003297 | Ga0065165_10032978 | 326 |
| 501 | 3300005355 | Ga0070671_100039567 | Ga0070671_1000395673 | 326 |
| 502 | 3300005434 | Ga0070709_10001298 | Ga0070709_100012989 | 326 |
| 503 | 3300005435 | Ga0070714_100012337 | Ga0070714_1000123372 | 326 |
| 504 | 3300005436 | Ga0070713_100013346 | Ga0070713_1000133462 | 326 |
| 505 | 3300005437 | Ga0070710_10001248 | Ga0070710_100012489 | 326 |
| 506 | 3300005439 | Ga0070711_100055605 | Ga0070711_1000556052 | 326 |
| 507 | 3300005455 | Ga0070663_100341655 | Ga0070663_1003416552 | 326 |
| 508 | 3300005471 | Ga0070698_100037207 | Ga0070698_1000372073 | 326 |
| 509 | 3300005539 | Ga0068853_100007895 | Ga0068853_1000078953 | 326 |
| 510 | 3300005548 | Ga0070665_100068867 | Ga0070665_1000688673 | 326 |
| 511 | 3300005548 | Ga0070665_100081540 | Ga0070665_1000815403 | 326 |
| 512 | 3300005548 | Ga0070665_100337068 | Ga0070665_1003370681 | 326 |
| 513 | 3300005843 | Ga0068860_100320751 | Ga0068860_1003207512 | 326 |
| 514 | 3300005937 | Ga0081455_10212778 | Ga0081455_102127782 | 326 |
| 515 | 3300006028 | Ga0070717_10036823 | Ga0070717_100368232 | 326 |
| 516 | 3300006038 | Ga0075365_10025104 | Ga0075365_100251042 | 326 |
| 517 | 3300006038 | Ga0075365_10109624 | Ga0075365_101096242 | 326 |
| 518 | 3300006048 | Ga0075363_100032957 | Ga0075363_1000329572 | 326 |
| 519 | 3300006051 | Ga0075364_10063897 | Ga0075364_100638972 | 326 |
| 520 | 3300006173 | Ga0070716_100001599 | Ga0070716_1000015999 | 326 |
| 521 | 3300006175 | Ga0070712_100010986 | Ga0070712_1000109863 | 326 |
| 522 | 3300006178 | Ga0075367_10046217 | Ga0075367_100462172 | 326 |
| 523 | 3300009011 | Ga0105251_10000807 | Ga0105251_1000080714 | 326 |
| 524 | 3300009036 | Ga0105244_10100190 | Ga0105244_101001901 | 326 |
| 525 | 3300009093 | Ga0105240_10130898 | Ga0105240_101308982 | 326 |
| 526 | 3300009094 | Ga0111539_10103817 | Ga0111539_101038172 | 326 |
| 527 | 3300009147 | Ga0114129_10106567 | Ga0114129_101065672 | 326 |
| 528 | 3300009148 | Ga0105243_10048259 | Ga0105243_100482592 | 326 |
| 529 | 3300009174 | Ga0105241_10248742 | Ga0105241_102487422 | 326 |
| 530 | 3300009177 | Ga0105248_10052559 | Ga0105248_100525592 | 326 |
| 531 | 3300009177 | Ga0105248_10117549 | Ga0105248_101175493 | 326 |
| 532 | 3300009545 | Ga0105237_10014473 | Ga0105237_100144735 | 326 |
| 533 | 3300009551 | Ga0105238_10002443 | Ga0105238_100024438 | 326 |
| 534 | 3300009551 | Ga0105238_10050388 | Ga0105238_100503882 | 326 |
| 535 | 3300009551 | Ga0105238_10191038 | Ga0105238_101910382 | 326 |
| 536 | 3300009766 | Ga0123342_1005172 | Ga0123342_100517216 | 326 |
| 537 | 3300010375 | Ga0105239_10020917 | Ga0105239_100209176 | 326 |
| 538 | 3300010375 | Ga0105239_10435724 | Ga0105239_104357241 | 326 |
| 539 | 3300013296 | Ga0157374_10246628 | Ga0157374_102466282 | 326 |
| 540 | 3300013297 | Ga0157378_10454685 | Ga0157378_104546852 | 326 |
| 541 | 3300013306 | Ga0163162_10308635 | Ga0163162_103086352 | 326 |
| 542 | 3300021320 | Ga0214544_1004166 | Ga0214544_10041663 | 326 |
| 543 | 3300021321 | Ga0214542_1002658 | Ga0214542_10026583 | 326 |
| 544 | 3300021321 | Ga0214542_1021332 | Ga0214542_10213323 | 326 |
| 545 | 3300021327 | Ga0214543_1000018 | Ga0214543_100001834 | 326 |
| 546 | 3300021327 | Ga0214543_1002392 | Ga0214543_10023923 | 326 |
| 547 | 3300021361 | Ga0213872_10064124 | Ga0213872_100641242 | 326 |
| 548 | 3300021384 | Ga0213876_10090977 | Ga0213876_100909772 | 326 |
| 549 | 3300025208 | Ga0209436_100007 | Ga0209436_10000749 | 326 |
| 550 | 3300025208 | Ga0209436_113046 | Ga0209436_1130461 | 326 |
| 551 | 3300025245 | Ga0207425_1001729 | Ga0207425_10017296 | 326 |
| 552 | 3300025246 | Ga0209646_1007537 | Ga0209646_10075372 | 326 |
| 553 | 3300025250 | Ga0209026_1000025 | Ga0209026_100002579 | 326 |
| 554 | 3300025253 | Ga0209677_101748 | Ga0209677_1017488 | 326 |
| 555 | 3300025254 | Ga0209148_1000181 | Ga0209148_100018138 | 326 |
| 556 | 3300025256 | Ga0209759_1000226 | Ga0209759_100022623 | 326 |
| 557 | 3300025258 | Ga0209129_1000437 | Ga0209129_100043713 | 326 |
| 558 | 3300025258 | Ga0209129_1003995 | Ga0209129_10039955 | 326 |
| 559 | 3300025261 | Ga0209233_1000010 | Ga0209233_1000010331 | 326 |
| 560 | 3300025261 | Ga0209233_1024172 | Ga0209233_10241722 | 326 |
| 561 | 3300025272 | Ga0209455_1000127 | Ga0209455_100012738 | 326 |
| 562 | 3300025272 | Ga0209455_1002243 | Ga0209455_10022436 | 326 |
| 563 | 3300025272 | Ga0209455_1003511 | Ga0209455_10035114 | 326 |
| 564 | 3300025273 | Ga0209673_1002808 | Ga0209673_10028087 | 326 |
| 565 | 3300025284 | Ga0209130_1000001 | Ga0209130_1000001721 | 326 |
| 566 | 3300025284 | Ga0209130_1000013 | Ga0209130_1000013213 | 326 |
| 567 | 3300025284 | Ga0209130_1014324 | Ga0209130_10143242 | 326 |
| 568 | 3300025292 | Ga0209676_1001945 | Ga0209676_10019456 | 326 |
| 569 | 3300025294 | Ga0209025_1002267 | Ga0209025_10022674 | 326 |
| 570 | 3300025294 | Ga0209025_1059636 | Ga0209025_10596362 | 326 |
| 571 | 3300025295 | Ga0209564_1000341 | Ga0209564_100034196 | 326 |
| 572 | 3300025295 | Ga0209564_1001493 | Ga0209564_10014932 | 326 |
| 573 | 3300025297 | Ga0209758_1000843 | Ga0209758_100084326 | 326 |
| 574 | 3300025297 | Ga0209758_1008524 | Ga0209758_10085243 | 326 |
| 575 | 3300025299 | Ga0209256_1000286 | Ga0209256_100028662 | 326 |
| 576 | 3300025299 | Ga0209256_1000534 | Ga0209256_10005346 | 326 |
| 577 | 3300025299 | Ga0209256_1005674 | Ga0209256_10056742 | 326 |
| 578 | 3300025302 | Ga0207426_1000021 | Ga0207426_100002112 | 326 |
| 579 | 3300025302 | Ga0207426_1000022 | Ga0207426_1000022168 | 326 |
| 580 | 3300025302 | Ga0207426_1000045 | Ga0207426_1000045330 | 326 |
| 581 | 3300025302 | Ga0207426_1001406 | Ga0207426_100140617 | 326 |
| 582 | 3300025302 | Ga0207426_1006461 | Ga0207426_10064612 | 326 |
| 583 | 3300025303 | Ga0209051_1005045 | Ga0209051_10050453 | 326 |
| 584 | 3300025303 | Ga0209051_1033970 | Ga0209051_10339702 | 326 |
| 585 | 3300025304 | Ga0209257_1004065 | Ga0209257_10040659 | 326 |
| 586 | 3300025735 | Ga0207713_1001931 | Ga0207713_10019312 | 326 |
| 587 | 3300025898 | Ga0207692_10001006 | Ga0207692_100010067 | 326 |
| 588 | 3300025904 | Ga0207647_10020317 | Ga0207647_100203172 | 326 |
| 589 | 3300025906 | Ga0207699_10001121 | Ga0207699_100011214 | 326 |
| 590 | 3300025907 | Ga0207645_10053558 | Ga0207645_100535582 | 326 |
| 591 | 3300025909 | Ga0207705_10229182 | Ga0207705_102291822 | 326 |
| 592 | 3300025913 | Ga0207695_10117602 | Ga0207695_101176022 | 326 |
| 593 | 3300025914 | Ga0207671_10016184 | Ga0207671_100161843 | 326 |
| 594 | 3300025914 | Ga0207671_10043840 | Ga0207671_100438403 | 326 |
| 595 | 3300025916 | Ga0207663_10036632 | Ga0207663_100366322 | 326 |
| 596 | 3300025919 | Ga0207657_10088380 | Ga0207657_100883802 | 326 |
| 597 | 3300025922 | Ga0207646_10076675 | Ga0207646_100766752 | 326 |
| 598 | 3300025924 | Ga0207694_10023370 | Ga0207694_100233704 | 326 |
| 599 | 3300025929 | Ga0207664_10008810 | Ga0207664_100088104 | 326 |
| 600 | 3300025931 | Ga0207644_10062300 | Ga0207644_100623003 | 326 |
| 601 | 3300025939 | Ga0207665_10001206 | Ga0207665_1000120617 | 326 |
| 602 | 3300025941 | Ga0207711_10072996 | Ga0207711_100729962 | 326 |
| 603 | 3300025961 | Ga0207712_10444116 | Ga0207712_104441161 | 326 |
| 604 | 3300025972 | Ga0207668_10267660 | Ga0207668_102676601 | 326 |
| 605 | 3300025986 | Ga0207658_10177110 | Ga0207658_101771102 | 326 |
| 606 | 3300026041 | Ga0207639_10015803 | Ga0207639_100158033 | 326 |
| 607 | 3300026067 | Ga0207678_10178166 | Ga0207678_101781662 | 326 |
| 608 | 3300026078 | Ga0207702_10115723 | Ga0207702_101157232 | 326 |
| 609 | 3300026089 | Ga0207648_10079494 | Ga0207648_100794944 | 326 |
| 610 | 3300026116 | Ga0207674_10173829 | Ga0207674_101738292 | 326 |
| 611 | 3300026116 | Ga0207674_10321450 | Ga0207674_103214502 | 326 |
| 612 | 3300026118 | Ga0207675_100397991 | Ga0207675_1003979912 | 326 |
| 613 | 3300026121 | Ga0207683_10446148 | Ga0207683_104461482 | 326 |
| 614 | 3300027907 | Ga0207428_10170083 | Ga0207428_101700832 | 326 |
| 615 | 3300028379 | Ga0268266_10046999 | Ga0268266_100469992 | 326 |
| 616 | 3300028379 | Ga0268266_10177850 | Ga0268266_101778502 | 326 |
| 617 | 3300028379 | Ga0268266_10224798 | Ga0268266_102247982 | 326 |
| 618 | 3300028379 | Ga0268266_10294141 | Ga0268266_102941412 | 326 |
| 619 | 3300028381 | Ga0268264_10394262 | Ga0268264_103942621 | 326 |
| 620 | 3300028794 | Ga0307515_10001512 | Ga0307515_100015128 | 326 |
| 621 | 3300031235 | Ga0265330_10029306 | Ga0265330_100293062 | 326 |
| 622 | 3300031235 | Ga0265330_10054739 | Ga0265330_100547392 | 326 |
| 623 | 3300031241 | Ga0265325_10009821 | Ga0265325_100098213 | 326 |
| 624 | 3300031241 | Ga0265325_10084617 | Ga0265325_100846172 | 326 |
| 625 | 3300031247 | Ga0265340_10001007 | Ga0265340_100010078 | 326 |
| 626 | 3300031247 | Ga0265340_10074774 | Ga0265340_100747742 | 326 |
| 627 | 3300031249 | Ga0265339_10004558 | Ga0265339_100045586 | 326 |
| 628 | 3300031249 | Ga0265339_10008517 | Ga0265339_100085173 | 326 |
| 629 | 3300031249 | Ga0265339_10063852 | Ga0265339_100638522 | 326 |
| 630 | 3300031249 | Ga0265339_10147224 | Ga0265339_101472242 | 326 |
| 631 | 3300031250 | Ga0265331_10022487 | Ga0265331_100224873 | 326 |
| 632 | 3300031344 | Ga0265316_10025372 | Ga0265316_100253725 | 326 |
| 633 | 3300031344 | Ga0265316_10051782 | Ga0265316_100517822 | 326 |
| 634 | 3300031344 | Ga0265316_10058918 | Ga0265316_100589182 | 326 |
| 635 | 3300031344 | Ga0265316_10147892 | Ga0265316_101478922 | 326 |
| 636 | 3300031456 | Ga0307513_10206761 | Ga0307513_102067612 | 326 |
| 637 | 3300031595 | Ga0265313_10000884 | Ga0265313_1000088421 | 326 |
| 638 | 3300031595 | Ga0265313_10043045 | Ga0265313_100430452 | 326 |
| 639 | 3300031711 | Ga0265314_10025560 | Ga0265314_100255603 | 326 |
| 640 | 3300031711 | Ga0265314_10063939 | Ga0265314_100639392 | 326 |
| 641 | 3300031711 | Ga0265314_10068075 | Ga0265314_100680752 | 326 |
| 642 | 3300031711 | Ga0265314_10179748 | Ga0265314_101797482 | 326 |
| 643 | 3300031712 | Ga0265342_10018931 | Ga0265342_100189313 | 326 |
| 644 | 3300037418 | Ga0395900_0241694 | Ga0395900_0241694_47_1027 | 326 |
| 645 | 3300037466 | Ga0395898_0033149 | Ga0395898_0033149_255_1235 | 326 |
| 646 | 3300037471 | Ga0395905_0351298 | Ga0395905_0351298_40_1020 | 326 |
| 647 | 3300038443 | Ga0395901_0127525 | Ga0395901_0127525_440_1420 | 326 |
| 648 | 3300039437 | Ga0436365_0891249 | Ga0436365_0891249_2644_3624 | 326 |
| 649 | 3300039437 | Ga0436365_1516798 | Ga0436365_1516798_106_1086 | 326 |
| 650 | 3300041413 | Ga0439465_0011391 | Ga0439465_0011391_704_1699 | 326 |
| 651 | 3300041413 | Ga0439465_0021557 | Ga0439465_0021557_460_1440 | 326 |
| 652 | 3300041413 | Ga0439465_0027987 | Ga0439465_0027987_608_1603 | 326 |
| 653 | 3300041491 | Ga0451833_0190499 | Ga0451833_0190499_4175_5170 | 326 |
| 654 | 3300041492 | Ga0451835_0839270 | Ga0451835_0839270_1032_2027 | 326 |
| 655 | 3300041501 | Ga0451845_0771484 | Ga0451845_0771484_4175_5170 | 326 |
| 656 | 3300041505 | Ga0451849_0057009 | Ga0451849_0057009_4208_5203 | 326 |
| 657 | 3300044658 | Ga0466972_0041632 | Ga0466972_0041632_1062_2042 | 326 |
| 658 | 3300044683 | Ga0466965_0138660 | Ga0466965_0138660_20_1000 | 326 |
| 659 | 3300044693 | Ga0466961_0044357 | Ga0466961_0044357_1664_2644 | 326 |
| 660 | 3300045836 | Ga0466958_0137936 | Ga0466958_0137936_205_1185 | 326 |
| 661 | 3300046455 | Ga0495603_0009535 | Ga0495603_0009535_1068_2048 | 326 |
| 662 | 3300046457 | Ga0495590_0002598 | Ga0495590_0002598_5698_6678 | 326 |
| 663 | 3300046457 | Ga0495590_0006492 | Ga0495590_0006492_2905_3885 | 326 |
| 664 | 3300046460 | Ga0495638_0000580 | Ga0495638_0000580_5931_6926 | 326 |
| 665 | 3300046460 | Ga0495638_0017368 | Ga0495638_0017368_3007_3987 | 326 |
| 666 | 3300046460 | Ga0495638_0062432 | Ga0495638_0062432_447_1427 | 326 |
| 667 | 3300046461 | Ga0495641_0012713 | Ga0495641_0012713_2003_2983 | 326 |
| 668 | 3300046462 | Ga0495651_0041165 | Ga0495651_0041165_216_1196 | 326 |
| 669 | 3300046463 | Ga0495653_0001978 | Ga0495653_0001978_6859_7839 | 326 |
| 670 | 3300046471 | Ga0495650_0011754 | Ga0495650_0011754_483_1463 | 326 |
| 671 | 3300046472 | Ga0495580_0016851 | Ga0495580_0016851_4401_5381 | 326 |
| 672 | 3300046473 | Ga0495582_0046198 | Ga0495582_0046198_1030_2010 | 326 |
| 673 | 3300046474 | Ga0495605_0007739 | Ga0495605_0007739_4109_5089 | 326 |
| 674 | 3300046474 | Ga0495605_0008940 | Ga0495605_0008940_4152_5132 | 326 |
| 675 | 3300046476 | Ga0495662_0094965 | Ga0495662_0094965_88_1068 | 326 |
| 676 | 3300046499 | Ga0495594_0010751 | Ga0495594_0010751_3529_4509 | 326 |
| 677 | 3300046500 | Ga0495596_0011361 | Ga0495596_0011361_999_1979 | 326 |
| 678 | 3300046501 | Ga0495607_0112162 | Ga0495607_0112162_76_1056 | 326 |
| 679 | 3300046506 | Ga0495583_0006562 | Ga0495583_0006562_4104_5084 | 326 |
| 680 | 3300046506 | Ga0495583_0015646 | Ga0495583_0015646_2541_3521 | 326 |
| 681 | 3300046507 | Ga0495606_0045705 | Ga0495606_0045705_397_1392 | 326 |
| 682 | 3300046507 | Ga0495606_0059193 | Ga0495606_0059193_140_1120 | 326 |
| 683 | 3300046507 | Ga0495606_0075586 | Ga0495606_0075586_484_1464 | 326 |
| 684 | 3300046511 | Ga0495608_0028021 | Ga0495608_0028021_389_1369 | 326 |
| 685 | 3300046512 | Ga0495610_0058188 | Ga0495610_0058188_513_1493 | 326 |
| 686 | 3300046513 | Ga0495616_0044950 | Ga0495616_0044950_104_1084 | 326 |
| 687 | 3300046514 | Ga0495618_0001793 | Ga0495618_0001793_12440_13420 | 326 |
| 688 | 3300046515 | Ga0495620_0022574 | Ga0495620_0022574_702_1682 | 326 |
| 689 | 3300046516 | Ga0495628_0071859 | Ga0495628_0071859_695_1675 | 326 |
| 690 | 3300046517 | Ga0495630_0004430 | Ga0495630_0004430_1997_2977 | 326 |
| 691 | 3300046517 | Ga0495630_0005470 | Ga0495630_0005470_6224_7204 | 326 |
| 692 | 3300046517 | Ga0495630_0139823 | Ga0495630_0139823_307_1287 | 326 |
| 693 | 3300046522 | Ga0495643_0025168 | Ga0495643_0025168_1821_2801 | 326 |
| 694 | 3300046522 | Ga0495643_0033096 | Ga0495643_0033096_500_1495 | 326 |
| 695 | 3300046523 | Ga0495644_0030164 | Ga0495644_0030164_1052_2032 | 326 |
| 696 | 3300046524 | Ga0495648_0051518 | Ga0495648_0051518_833_1813 | 326 |
| 697 | 3300046524 | Ga0495648_0130629 | Ga0495648_0130629_30_1010 | 326 |
| 698 | 3300046528 | Ga0495642_0031682 | Ga0495642_0031682_646_1626 | 326 |
| 699 | 3300046529 | Ga0495652_0080194 | Ga0495652_0080194_695_1675 | 326 |
| 700 | 3300046531 | Ga0495665_0000742 | Ga0495665_0000742_8325_9305 | 326 |
| 701 | 3300046531 | Ga0495665_0133085 | Ga0495665_0133085_132_1112 | 326 |
| 702 | 3300046533 | Ga0495640_0030496 | Ga0495640_0030496_1480_2460 | 326 |
| 703 | 3300046535 | Ga0495586_0015435 | Ga0495586_0015435_695_1675 | 326 |
| 704 | 3300046538 | Ga0495609_0010836 | Ga0495609_0010836_386_1366 | 326 |
| 705 | 3300046542 | Ga0495597_0024173 | Ga0495597_0024173_866_1846 | 326 |
| 706 | 3300046542 | Ga0495597_0053044 | Ga0495597_0053044_547_1527 | 326 |
| 707 | 3300046543 | Ga0495645_0062183 | Ga0495645_0062183_507_1487 | 326 |
| 708 | 3300046557 | Ga0495622_0035352 | Ga0495622_0035352_281_1261 | 326 |
| 709 | 3300046557 | Ga0495622_0050538 | Ga0495622_0050538_276_1256 | 326 |
| 710 | 3300046616 | Ga0495668_0147801 | Ga0495668_0147801_43_1023 | 326 |
| 711 | 3300046642 | Ga0495634_0003234 | Ga0495634_0003234_12155_13135 | 326 |
| 712 | 3300046648 | Ga0495611_0015685 | Ga0495611_0015685_2077_3057 | 326 |
| 713 | 3300046663 | Ga0495635_0028167 | Ga0495635_0028167_2286_3266 | 326 |
| 714 | 3300046678 | Ga0495599_0007107 | Ga0495599_0007107_2358_3338 | 326 |
| 715 | 3300046679 | Ga0495623_0005615 | Ga0495623_0005615_5301_6281 | 326 |
| 716 | 3300046684 | Ga0495669_0014845 | Ga0495669_0014845_184_1164 | 326 |
| 717 | 3300046684 | Ga0495669_0030605 | Ga0495669_0030605_483_1463 | 326 |
| 718 | 3300046689 | Ga0495613_0082318 | Ga0495613_0082318_336_1316 | 326 |
| 719 | 3300046690 | Ga0495624_0035451 | Ga0495624_0035451_478_1458 | 326 |
| 720 | 3300046690 | Ga0495624_0104216 | Ga0495624_0104216_377_1357 | 326 |
| 721 | 3300046692 | Ga0495671_0011184 | Ga0495671_0011184_24_1004 | 326 |
| 722 | 3300046692 | Ga0495671_0015440 | Ga0495671_0015440_824_1804 | 326 |
| 723 | 3300046694 | Ga0495649_0043805 | Ga0495649_0043805_1224_2204 | 326 |
| 724 | 3300046794 | Ga0495589_0018230 | Ga0495589_0018230_516_1496 | 326 |
| 725 | 3300046794 | Ga0495589_0032701 | Ga0495589_0032701_749_1729 | 326 |
| 726 | 3300046809 | Ga0495600_0031883 | Ga0495600_0031883_1098_2078 | 326 |
| 727 | 3300046809 | Ga0495600_0068374 | Ga0495600_0068374_1014_1994 | 326 |
| 728 | 3300046810 | Ga0495660_0129956 | Ga0495660_0129956_10_990 | 326 |
| 729 | 3300047317 | Ga0495604_0024225 | Ga0495604_0024225_2150_3130 | 326 |
| 730 | 3300047317 | Ga0495604_0141884 | Ga0495604_0141884_201_1181 | 326 |
| 731 | 3300047318 | Ga0495636_0006527 | Ga0495636_0006527_1685_2680 | 326 |
| 732 | 3300047319 | Ga0495674_0008782 | Ga0495674_0008782_6071_7051 | 326 |
| 733 | 3300047319 | Ga0495674_0012103 | Ga0495674_0012103_6551_7531 | 326 |
| 734 | 3300047320 | Ga0495672_0004772 | Ga0495672_0004772_4883_5878 | 326 |
| 735 | 3300047320 | Ga0495672_0027200 | Ga0495672_0027200_1730_2710 | 326 |
| 736 | 3300047320 | Ga0495672_0062366 | Ga0495672_0062366_204_1184 | 326 |
| 737 | 3300047322 | Ga0495680_0007970 | Ga0495680_0007970_8252_9232 | 326 |
| 738 | 3300047323 | Ga0495683_0002142 | Ga0495683_0002142_4054_5034 | 326 |
| 739 | 3300047443 | Ga0495687_009429 | Ga0495687_009429_1654_2634 | 326 |
| 740 | 3300047443 | Ga0495687_066431 | Ga0495687_066431_393_1388 | 326 |
| 741 | 3300047444 | Ga0495675_0028055 | Ga0495675_0028055_1707_2687 | 326 |
| 742 | 3300047444 | Ga0495675_0034181 | Ga0495675_0034181_1149_2129 | 326 |
| 743 | 3300047445 | Ga0495677_0037953 | Ga0495677_0037953_676_1656 | 326 |
| 744 | 3300047446 | Ga0495679_012349 | Ga0495679_012349_1542_2522 | 326 |
| 745 | 3300047446 | Ga0495679_020265 | Ga0495679_020265_644_1624 | 326 |
| 746 | 3300047469 | Ga0495673_0054444 | Ga0495673_0054444_236_1216 | 326 |
| 747 | 3300047471 | Ga0495684_0011319 | Ga0495684_0011319_3733_4713 | 326 |
| 748 | 3300047472 | Ga0495686_0003598 | Ga0495686_0003598_7751_8746 | 326 |
| 749 | 3300047472 | Ga0495686_0007678 | Ga0495686_0007678_5311_6306 | 326 |
| 750 | 3300047472 | Ga0495686_0092630 | Ga0495686_0092630_320_1300 | 326 |
| 751 | 3300047673 | Ga0495593_0002407 | Ga0495593_0002407_6436_7416 | 326 |
| 752 | 3300047673 | Ga0495593_0073686 | Ga0495593_0073686_510_1490 | 326 |
| 753 | 3300048088 | Ga0495602_0002425 | Ga0495602_0002425_7859_8839 | 326 |
| 754 | 3300048088 | Ga0495602_0028950 | Ga0495602_0028950_3289_4269 | 326 |
| 755 | 3300048089 | Ga0495614_0012330 | Ga0495614_0012330_438_1418 | 326 |
| 756 | 3300048091 | Ga0495626_0007708 | Ga0495626_0007708_3767_4747 | 326 |
| 757 | 3300048091 | Ga0495626_0042319 | Ga0495626_0042319_692_1672 | 326 |
| 758 | 3300048903 | Ga0496100_0000199 | Ga0496100_0000199_28600_29580 | 326 |
| 759 | 3300048903 | Ga0496100_0013732 | Ga0496100_0013732_171_1151 | 326 |
| 760 | 3300048904 | Ga0496101_0000465 | Ga0496101_0000465_16827_17807 | 326 |
| 761 | 3300048904 | Ga0496101_0004225 | Ga0496101_0004225_1909_2889 | 326 |
| 762 | 3300048904 | Ga0496101_0049825 | Ga0496101_0049825_543_1523 | 326 |
| 763 | 3300048905 | Ga0496102_0001297 | Ga0496102_0001297_17805_18785 | 326 |
| 764 | 3300048905 | Ga0496102_0009711 | Ga0496102_0009711_1036_2016 | 326 |
| 765 | 3300048905 | Ga0496102_0035922 | Ga0496102_0035922_1842_2822 | 326 |
| 766 | 3300048905 | Ga0496102_0159814 | Ga0496102_0159814_738_1733 | 326 |
| 767 | 3300048906 | Ga0496103_0000885 | Ga0496103_0000885_16064_17044 | 326 |
| 768 | 3300048906 | Ga0496103_0068540 | Ga0496103_0068540_144_1124 | 326 |
| 769 | 3300048906 | Ga0496103_0078077 | Ga0496103_0078077_360_1355 | 326 |
| 770 | 3300048907 | Ga0496104_0020157 | Ga0496104_0020157_4631_5611 | 326 |
| 771 | 3300048907 | Ga0496104_0034698 | Ga0496104_0034698_2692_3687 | 326 |
| 772 | 3300048907 | Ga0496104_0136551 | Ga0496104_0136551_1273_2253 | 326 |
| 773 | 3300048907 | Ga0496104_0247801 | Ga0496104_0247801_651_1631 | 326 |
| 774 | 3300048908 | Ga0496105_0001907 | Ga0496105_0001907_12356_13351 | 326 |
| 775 | 3300048908 | Ga0496105_0074155 | Ga0496105_0074155_1504_2484 | 326 |
| 776 | 3300048909 | Ga0496106_0000368 | Ga0496106_0000368_17925_18905 | 326 |
| 777 | 3300048909 | Ga0496106_0050785 | Ga0496106_0050785_1590_2570 | 326 |
| 778 | 3300048909 | Ga0496106_0079857 | Ga0496106_0079857_180_1175 | 326 |
| 779 | 3300048910 | Ga0496107_0003027 | Ga0496107_0003027_3020_4000 | 326 |
| 780 | 3300048910 | Ga0496107_0089471 | Ga0496107_0089471_282_1262 | 326 |
| 781 | 3300048912 | Ga0496109_0355094 | Ga0496109_0355094_262_1242 | 326 |
| 782 | 3300048913 | Ga0496110_0000760 | Ga0496110_0000760_2169_3149 | 326 |
| 783 | 3300048914 | Ga0496111_0001992 | Ga0496111_0001992_6453_7433 | 326 |
| 784 | 3300048915 | Ga0496112_0013565 | Ga0496112_0013565_2523_3503 | 326 |
| 785 | 3300048915 | Ga0496112_0097862 | Ga0496112_0097862_1007_1987 | 326 |
| 786 | 3300048916 | Ga0496113_0000697 | Ga0496113_0000697_5389_6369 | 326 |
| 787 | 3300048916 | Ga0496113_0007021 | Ga0496113_0007021_1569_2549 | 326 |
| 788 | 3300048916 | Ga0496113_0061885 | Ga0496113_0061885_1288_2283 | 326 |
| 789 | 3300048917 | Ga0496114_0361210 | Ga0496114_0361210_172_1152 | 326 |
| 790 | 3300048919 | Ga0496116_0042029 | Ga0496116_0042029_1663_2643 | 326 |
| 791 | 3300048919 | Ga0496116_0093650 | Ga0496116_0093650_73_1053 | 326 |
| 792 | 3300048920 | Ga0496117_0002246 | Ga0496117_0002246_6652_7632 | 326 |
| 793 | 3300048920 | Ga0496117_0005074 | Ga0496117_0005074_1818_2798 | 326 |
| 794 | 3300048920 | Ga0496117_0011308 | Ga0496117_0011308_4821_5816 | 326 |
| 795 | 3300048920 | Ga0496117_0015118 | Ga0496117_0015118_331_1311 | 326 |
| 796 | 3300048920 | Ga0496117_0090960 | Ga0496117_0090960_117_1097 | 326 |
| 797 | 3300048920 | Ga0496117_0167215 | Ga0496117_0167215_270_1250 | 326 |
| 798 | 3300048921 | Ga0496118_0008291 | Ga0496118_0008291_2006_2986 | 326 |
| 799 | 3300048921 | Ga0496118_0010669 | Ga0496118_0010669_1786_2766 | 326 |
| 800 | 3300048921 | Ga0496118_0011180 | Ga0496118_0011180_1490_2485 | 326 |
| 801 | 3300048921 | Ga0496118_0011269 | Ga0496118_0011269_4204_5184 | 326 |
| 802 | 3300048921 | Ga0496118_0014533 | Ga0496118_0014533_5233_6213 | 326 |
| 803 | 3300048922 | Ga0496119_0009211 | Ga0496119_0009211_3230_4225 | 326 |
| 804 | 3300048922 | Ga0496119_0028689 | Ga0496119_0028689_1696_2676 | 326 |
| 805 | 3300048922 | Ga0496119_0064865 | Ga0496119_0064865_614_1594 | 326 |
| 806 | 3300048922 | Ga0496119_0112014 | Ga0496119_0112014_240_1220 | 326 |
| 807 | 3300048923 | Ga0496120_0010243 | Ga0496120_0010243_3881_4861 | 326 |
| 808 | 3300048924 | Ga0496121_0007128 | Ga0496121_0007128_12417_13397 | 326 |
| 809 | 3300048924 | Ga0496121_0009162 | Ga0496121_0009162_430_1410 | 326 |
| 810 | 3300048924 | Ga0496121_0023526 | Ga0496121_0023526_2347_3327 | 326 |
| 811 | 3300048924 | Ga0496121_0024233 | Ga0496121_0024233_1100_2080 | 326 |
| 812 | 3300048924 | Ga0496121_0047769 | Ga0496121_0047769_2076_3071 | 326 |
| 813 | 3300048924 | Ga0496121_0192200 | Ga0496121_0192200_314_1294 | 326 |
| 814 | 3300048925 | Ga0496122_0000924 | Ga0496122_0000924_31245_32240 | 326 |
| 815 | 3300048925 | Ga0496122_0004434 | Ga0496122_0004434_963_1943 | 326 |
| 816 | 3300048925 | Ga0496122_0005805 | Ga0496122_0005805_6102_7097 | 326 |
| 817 | 3300048925 | Ga0496122_0044778 | Ga0496122_0044778_1806_2801 | 326 |
| 818 | 3300048925 | Ga0496122_0053786 | Ga0496122_0053786_1511_2491 | 326 |
| 819 | 3300048926 | Ga0496123_0001743 | Ga0496123_0001743_13437_14432 | 326 |
| 820 | 3300048926 | Ga0496123_0008581 | Ga0496123_0008581_8299_9294 | 326 |
| 821 | 3300048926 | Ga0496123_0020877 | Ga0496123_0020877_2805_3785 | 326 |
| 822 | 3300048926 | Ga0496123_0115288 | Ga0496123_0115288_375_1355 | 326 |
| 823 | 3300048928 | Ga0496125_0026911 | Ga0496125_0026911_2373_3368 | 326 |
| 824 | 3300048928 | Ga0496125_0027158 | Ga0496125_0027158_321_1316 | 326 |
| 825 | 3300048928 | Ga0496125_0035553 | Ga0496125_0035553_2015_3010 | 326 |
| 826 | 3300048928 | Ga0496125_0137645 | Ga0496125_0137645_492_1472 | 326 |
| 827 | 3300048928 | Ga0496125_0243918 | Ga0496125_0243918_25_1005 | 326 |
| 828 | 3300048929 | Ga0496126_0000122 | Ga0496126_0000122_43230_44210 | 326 |
| 829 | 3300048929 | Ga0496126_0000375 | Ga0496126_0000375_31062_32042 | 326 |
| 830 | 3300049459 | Ga0495678_026091 | Ga0495678_026091_605_1585 | 326 |
| 831 | 3300049460 | Ga0495682_0008896 | Ga0495682_0008896_2893_3873 | 326 |
| 832 | 3300049460 | Ga0495682_0050724 | Ga0495682_0050724_368_1348 | 326 |
| 833 | 3300049569 | Ga0501032_0005850 | Ga0501032_0005850_991_1971 | 326 |
| 834 | 3300049570 | Ga0501033_0005840 | Ga0501033_0005840_7709_8689 | 326 |
| 835 | 3300049570 | Ga0501033_0163446 | Ga0501033_0163446_359_1354 | 326 |
| 836 | 3300049571 | Ga0501034_0003055 | Ga0501034_0003055_991_1971 | 326 |
| 837 | 3300049571 | Ga0501034_0067956 | Ga0501034_0067956_110_1114 | 326 |
| 838 | 3300049571 | Ga0501034_0173369 | Ga0501034_0173369_783_1787 | 326 |
| 839 | 3300049572 | Ga0501036_0001315 | Ga0501036_0001315_17358_18338 | 326 |
| 840 | 3300049572 | Ga0501036_0183905 | Ga0501036_0183905_27_1007 | 326 |
| 841 | 3300049573 | Ga0501037_0043516 | Ga0501037_0043516_501_1481 | 326 |
| 842 | 3300049573 | Ga0501037_0066567 | Ga0501037_0066567_1225_2229 | 326 |
| 843 | 3300049574 | Ga0501038_0002280 | Ga0501038_0002280_991_1971 | 326 |
| 844 | 3300049574 | Ga0501038_0014344 | Ga0501038_0014344_4955_5959 | 326 |
| 845 | 3300049575 | Ga0501039_0043720 | Ga0501039_0043720_2223_3203 | 326 |
| 846 | 3300049575 | Ga0501039_0085754 | Ga0501039_0085754_337_1317 | 326 |
| 847 | 3300049576 | Ga0501040_0069893 | Ga0501040_0069893_878_1858 | 326 |
| 848 | 3300049577 | Ga0501041_0093886 | Ga0501041_0093886_160_1140 | 326 |
| 849 | 3300049578 | Ga0501042_0025359 | Ga0501042_0025359_2330_3310 | 326 |
| 850 | 3300049579 | Ga0501043_0100837 | Ga0501043_0100837_1053_2057 | 326 |
| 851 | 3300049579 | Ga0501043_0106370 | Ga0501043_0106370_851_1831 | 326 |
| 852 | 3300049580 | Ga0501046_0095561 | Ga0501046_0095561_1232_2236 | 326 |
| 853 | 3300049580 | Ga0501046_0142406 | Ga0501046_0142406_577_1557 | 326 |
| 854 | 3300049580 | Ga0501046_0274327 | Ga0501046_0274327_90_1085 | 326 |
| 855 | 3300049581 | Ga0501047_0010342 | Ga0501047_0010342_719_1699 | 326 |
| 856 | 3300049581 | Ga0501047_0015757 | Ga0501047_0015757_5750_6754 | 326 |
| 857 | 3300049581 | Ga0501047_0042322 | Ga0501047_0042322_840_1835 | 326 |
| 858 | 3300049581 | Ga0501047_0082990 | Ga0501047_0082990_1687_2691 | 326 |
| 859 | 3300049582 | Ga0501048_0001333 | Ga0501048_0001333_17478_18458 | 326 |
| 860 | 3300049582 | Ga0501048_0264877 | Ga0501048_0264877_87_1067 | 326 |
| 861 | 3300049583 | Ga0501067_0081808 | Ga0501067_0081808_121_1101 | 326 |
| 862 | 3300049583 | Ga0501067_0117217 | Ga0501067_0117217_382_1377 | 326 |
| 863 | 3300049584 | Ga0501068_0001778 | Ga0501068_0001778_4445_5425 | 326 |
| 864 | 3300049584 | Ga0501068_0069719 | Ga0501068_0069719_828_1832 | 326 |
| 865 | 3300049584 | Ga0501068_0088769 | Ga0501068_0088769_735_1730 | 326 |
| 866 | 3300049585 | Ga0501069_0161259 | Ga0501069_0161259_50_1030 | 326 |
| 867 | 3300049585 | Ga0501069_0177783 | Ga0501069_0177783_149_1129 | 326 |
| 868 | 3300049586 | Ga0501070_0001529 | Ga0501070_0001529_18119_19099 | 326 |
| 869 | 3300049587 | Ga0501071_0006332 | Ga0501071_0006332_4048_5028 | 326 |
| 870 | 3300049589 | Ga0501073_0053062 | Ga0501073_0053062_432_1436 | 326 |
| 871 | 3300049590 | Ga0501074_0032494 | Ga0501074_0032494_1073_2053 | 326 |
| 872 | 3300049590 | Ga0501074_0038204 | Ga0501074_0038204_1461_2465 | 326 |
| 873 | 3300049592 | Ga0501076_0212479 | Ga0501076_0212479_367_1371 | 326 |
| 874 | 3300049741 | Ga0501079_0033467 | Ga0501079_0033467_1373_2353 | 326 |
| 875 | 3300049741 | Ga0501079_0226189 | Ga0501079_0226189_449_1429 | 326 |
| 876 | 3300049741 | Ga0501079_0375479 | Ga0501079_0375479_120_1100 | 326 |
| 877 | 3300049742 | Ga0501080_0017115 | Ga0501080_0017115_2799_3779 | 326 |
| 878 | 3300049742 | Ga0501080_0083445 | Ga0501080_0083445_619_1623 | 326 |
| 879 | 3300049744 | Ga0501083_0202276 | Ga0501083_0202276_294_1274 | 326 |
| 880 | 3300049822 | Ga0501035_0011568 | Ga0501035_0011568_991_1971 | 326 |
| 881 | 3300049822 | Ga0501035_0108564 | Ga0501035_0108564_665_1669 | 326 |
| 882 | 3300049822 | Ga0501035_0200544 | Ga0501035_0200544_384_1364 | 326 |
| 883 | 3300049822 | Ga0501035_0221648 | Ga0501035_0221648_377_1372 | 326 |
| 884 | 3300049822 | Ga0501035_0234656 | Ga0501035_0234656_285_1289 | 326 |
| 885 | 3300049823 | Ga0501044_0002860 | Ga0501044_0002860_3328_4308 | 326 |
| 886 | 3300049823 | Ga0501044_0018290 | Ga0501044_0018290_1688_2692 | 326 |
| 887 | 3300049823 | Ga0501044_0442965 | Ga0501044_0442965_80_1060 | 326 |
| 888 | 3300049824 | Ga0501045_0003149 | Ga0501045_0003149_4086_5066 | 326 |
| 889 | 3300050492 | nmdc:mga0yw44_20812_c1 | nmdc:mga0yw44_20812_c1_1406_2386 | 326 |
| 890 | 3300050492 | nmdc:mga0yw44_51924_c1 | nmdc:mga0yw44_51924_c1_1202_2182 | 326 |
| 891 | 3300050494 | nmdc:mga06z11_20630_c1 | nmdc:mga06z11_20630_c1_264_1244 | 326 |
| 892 | 3300050507 | nmdc:mga05p37_63275_c1 | nmdc:mga05p37_63275_c1_506_1486 | 326 |
| 893 | 3300050510 | nmdc:mga06r32_3873_c1 | nmdc:mga06r32_3873_c1_2967_3947 | 326 |
| 894 | 3300050511 | nmdc:mga08y16_223823_c1 | nmdc:mga08y16_223823_c1_811_1791 | 326 |
| 895 | 3300050516 | nmdc:mga0sz30_10602_c2 | nmdc:mga0sz30_10602_c2_297_1277 | 326 |
| 896 | 3300050516 | nmdc:mga0sz30_25318_c1 | nmdc:mga0sz30_25318_c1_62_1057 | 326 |
| 897 | 3300053119 | Ga0500595_047136 | Ga0500595_047136_208_1188 | 326 |
| 898 | 3300053139 | Ga0500568_0000719 | Ga0500568_0000719_16842_17837 | 326 |
| 899 | 3300053139 | Ga0500568_0001718 | Ga0500568_0001718_1595_2575 | 326 |
| 900 | 3300053153 | Ga0500616_0002562 | Ga0500616_0002562_6104_7099 | 326 |
| 901 | 3300053153 | Ga0500616_0032051 | Ga0500616_0032051_678_1658 | 326 |
| 902 | 3300053155 | Ga0500620_000059 | Ga0500620_000059_11327_12307 | 326 |
| 903 | 3300053155 | Ga0500620_005587 | Ga0500620_005587_1679_2659 | 326 |
| 904 | 3300053156 | Ga0500622_0000134 | Ga0500622_0000134_68068_69063 | 326 |
| 905 | 3300053158 | Ga0500627_0003110 | Ga0500627_0003110_2550_3530 | 326 |
| 906 | 3300060353 | Ga0501082_0199743 | Ga0501082_0199743_577_1581 | 326 |
| 907 | iso_pu_bacteria | 2756170246 | 2756672547 | 326 |
| 908 | iso_pu_bacteria | 2844002411 | 2844007492 | 326 |
| 909 | iso_pu_bacteria | 2871466892 | 2871468586 | 326 |
| 910 | iso_pu_bacteria | 2906378014 | 2906386381 | 326 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5407 | 10 | 309 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.5365 | 42 | 313 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.535 | 10 | 309 |
| 2nq2-assembly1.cif.gz_A | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5327 | 16 | 318 |
| 2nq2-assembly1.cif.gz_A | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5254 | 16 | 318 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P39328_55_321_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8576 | 42 | 307 | 1.10.3470.10 |
| af_P39328_55_321_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8456 | 42 | 307 | 1.10.3470.10 |
| af_P32720_52_318_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.828 | 41 | 307 | 1.10.3470.10 |
| af_P0AE26_50_315_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8246 | 41 | 307 | 1.10.3470.10 |
| af_P32720_52_318_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8195 | 41 | 307 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A434LBS3-F1-model_v4 | ABC transporter permease | 0.9953 | 47 | 231 |
GO:0005886
GO:0022857 |
| AF-A0A434LBS3-F1-model_v4 | ABC transporter permease | 0.9899 | 47 | 231 |
GO:0005886
GO:0022857 |
| AF-A0A436L4Z4-F1-model_v4 | deleted | 0.9615 | 24 | 239 |
|
| AF-A0A436L4Z4-F1-model_v4 | deleted | 0.9486 | 24 | 239 |
|
| AF-A0A659YKQ7-F1-model_v4 | deleted | 0.9134 | 1 | 295 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar