F485434
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 910 | 391 | 909 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300005842|Ga0068858_100004346|Ga0068858_1000043462 |
| Length | 198 |
| Sequence | MTDTTTAPTAKAVANGSKPSGSRWRYFVPLAIFVVVLIFLGVGLKLDPREVPSPFIGKPAPAFSLPRLERPESPISKADMQGKVWLLNVWASWCVTCREEHPVLLSLSKTGVVPIVGLNYKDERNEGLRWLNQFGNPYQTSAYDHEGKTGIDYGVYGVPETFVIDKQGVVRYKQIGAVTEEALNKKILPLVKQLNAES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 190 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 191 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 193 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 199 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 200 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 201 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 202 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 206 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 207 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 210 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 211 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 213 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 214 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 217 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 218 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 219 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 225 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 227 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 238 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 239 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 242 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 244 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 246 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 251 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 252 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 253 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 254 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 255 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 256 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 257 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 258 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 259 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 260 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 263 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 264 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 265 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 266 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 267 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 268 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 269 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 270 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 271 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 319 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 320 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 321 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 322 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 323 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 326 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 327 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 328 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 329 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 330 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 331 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 332 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 333 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 334 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 335 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 348 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 349 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 350 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 354 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 359 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 374 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 376 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 377 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 378 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 379 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 381 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 382 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 383 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 385 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 386 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 388 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 389 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 391 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.34 |
| Metatranscriptomes | 0.55 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.85 |
| Nodule | 0 |
| Rhizoplane | 3.63 |
| Rhizosphere | 88.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10025878 | 3300003215 | Bacteria | 2088 |
| 2 | Ga0065715_10174637 | 3300005293 | Bacteria | 1521 |
| 3 | Ga0065707_10229911 | 3300005295 | Bacteria | 1192 |
| 4 | Ga0070658_10085898 | 3300005327 | Bacteria | 2588 |
| 5 | Ga0070658_10959302 | 3300005327 | Bacteria | 744 |
| 6 | Ga0070676_10010065 | 3300005328 | Bacteria | 5122 |
| 7 | Ga0070676_10135391 | 3300005328 | Bacteria | 1562 |
| 8 | Ga0070676_10238731 | 3300005328 | Bacteria | 1208 |
| 9 | Ga0070676_10375122 | 3300005328 | Bacteria | 984 |
| 10 | Ga0070683_100778780 | 3300005329 | Bacteria | 917 |
| 11 | Ga0070690_100114705 | 3300005330 | Bacteria | 1802 |
| 12 | Ga0070690_100506979 | 3300005330 | Bacteria | 904 |
| 13 | Ga0070670_100001774 | 3300005331 | Bacteria | 17573 |
| 14 | Ga0070670_100008874 | 3300005331 | Bacteria | 8581 |
| 15 | Ga0070670_100037091 | 3300005331 | Bacteria | 4194 |
| 16 | Ga0070670_100081717 | 3300005331 | Bacteria | 2776 |
| 17 | Ga0070670_100126728 | 3300005331 | Bacteria | 2204 |
| 18 | Ga0070670_100134714 | 3300005331 | Bacteria | 2134 |
| 19 | Ga0070670_100200183 | 3300005331 | Bacteria | 1735 |
| 20 | Ga0070670_100278084 | 3300005331 | Bacteria | 1462 |
| 21 | Ga0070670_100625434 | 3300005331 | Bacteria | 964 |
| 22 | Ga0070677_10007318 | 3300005333 | Bacteria | 3683 |
| 23 | Ga0070677_10089341 | 3300005333 | Bacteria | 1337 |
| 24 | Ga0070677_10335462 | 3300005333 | Bacteria | 779 |
| 25 | Ga0068869_100008578 | 3300005334 | Bacteria | 6598 |
| 26 | Ga0068869_100009021 | 3300005334 | Bacteria | 6463 |
| 27 | Ga0070666_10005482 | 3300005335 | Bacteria | 7780 |
| 28 | Ga0070666_10008568 | 3300005335 | Bacteria | 6353 |
| 29 | Ga0070666_10300134 | 3300005335 | Bacteria | 1144 |
| 30 | Ga0070666_10323814 | 3300005335 | Bacteria | 1100 |
| 31 | Ga0070666_10377329 | 3300005335 | Bacteria | 1017 |
| 32 | Ga0070680_100120410 | 3300005336 | Bacteria | 2191 |
| 33 | Ga0070682_100029929 | 3300005337 | Bacteria | 3282 |
| 34 | Ga0070682_100824307 | 3300005337 | Bacteria | 756 |
| 35 | Ga0068868_100016008 | 3300005338 | Bacteria | 5561 |
| 36 | Ga0068868_100043629 | 3300005338 | Bacteria | 3503 |
| 37 | Ga0068868_100142537 | 3300005338 | Bacteria | 1968 |
| 38 | Ga0068868_100614279 | 3300005338 | Bacteria | 964 |
| 39 | Ga0070660_100200407 | 3300005339 | Bacteria | 1619 |
| 40 | Ga0070689_100051421 | 3300005340 | Bacteria | 3186 |
| 41 | Ga0070687_100034731 | 3300005343 | Bacteria | 2498 |
| 42 | Ga0070687_100350461 | 3300005343 | Bacteria | 953 |
| 43 | Ga0070661_100128221 | 3300005344 | Bacteria | 1904 |
| 44 | Ga0070661_100217152 | 3300005344 | Bacteria | 1465 |
| 45 | Ga0070661_100395025 | 3300005344 | Bacteria | 1092 |
| 46 | Ga0070661_100669562 | 3300005344 | Bacteria | 844 |
| 47 | Ga0070692_10188529 | 3300005345 | Bacteria | 1200 |
| 48 | Ga0070692_10196477 | 3300005345 | Bacteria | 1179 |
| 49 | Ga0070668_100007130 | 3300005347 | Bacteria | 8283 |
| 50 | Ga0070668_100008167 | 3300005347 | Bacteria | 7773 |
| 51 | Ga0070668_101174839 | 3300005347 | Bacteria | 695 |
| 52 | Ga0070669_100001340 | 3300005353 | Bacteria | 17754 |
| 53 | Ga0070669_100077959 | 3300005353 | Bacteria | 2462 |
| 54 | Ga0070669_100082105 | 3300005353 | Bacteria | 2402 |
| 55 | Ga0070669_100106163 | 3300005353 | Bacteria | 2125 |
| 56 | Ga0070669_100877121 | 3300005353 | Bacteria | 766 |
| 57 | Ga0070675_100002913 | 3300005354 | Bacteria | 12900 |
| 58 | Ga0070675_100014979 | 3300005354 | Bacteria | 6124 |
| 59 | Ga0070675_100045658 | 3300005354 | Bacteria | 3585 |
| 60 | Ga0070675_100061046 | 3300005354 | Bacteria | 3112 |
| 61 | Ga0070675_100061075 | 3300005354 | Bacteria | 3112 |
| 62 | Ga0070675_100245133 | 3300005354 | Bacteria | 1566 |
| 63 | Ga0070675_100368617 | 3300005354 | Bacteria | 1276 |
| 64 | Ga0070671_100009693 | 3300005355 | Bacteria | 7738 |
| 65 | Ga0070671_100039335 | 3300005355 | Bacteria | 3926 |
| 66 | Ga0070671_100049845 | 3300005355 | Bacteria | 3484 |
| 67 | Ga0070671_100066223 | 3300005355 | Bacteria | 3010 |
| 68 | Ga0070671_100099621 | 3300005355 | Bacteria | 2438 |
| 69 | Ga0070671_100533158 | 3300005355 | Bacteria | 1011 |
| 70 | Ga0070674_100013491 | 3300005356 | Bacteria | 5053 |
| 71 | Ga0070674_100210755 | 3300005356 | Bacteria | 1506 |
| 72 | Ga0070674_100222853 | 3300005356 | Bacteria | 1468 |
| 73 | Ga0070673_100000512 | 3300005364 | Bacteria | 20784 |
| 74 | Ga0070673_100075466 | 3300005364 | Bacteria | 2719 |
| 75 | Ga0070673_100138585 | 3300005364 | Bacteria | 2050 |
| 76 | Ga0070673_100186331 | 3300005364 | Bacteria | 1779 |
| 77 | Ga0070673_100582630 | 3300005364 | Bacteria | 1019 |
| 78 | Ga0070673_101321070 | 3300005364 | Bacteria | 677 |
| 79 | Ga0070688_100092460 | 3300005365 | Bacteria | 1979 |
| 80 | Ga0070688_100312538 | 3300005365 | Bacteria | 1139 |
| 81 | Ga0070659_100089809 | 3300005366 | Bacteria | 2462 |
| 82 | Ga0070659_100234621 | 3300005366 | Bacteria | 1517 |
| 83 | Ga0070667_100000219 | 3300005367 | Bacteria | 66264 |
| 84 | Ga0070667_100004388 | 3300005367 | Bacteria | 11903 |
| 85 | Ga0070667_100006263 | 3300005367 | Bacteria | 9893 |
| 86 | Ga0070667_100116780 | 3300005367 | Bacteria | 2317 |
| 87 | Ga0070667_100407910 | 3300005367 | Bacteria | 1237 |
| 88 | Ga0070714_100713512 | 3300005435 | Bacteria | 968 |
| 89 | Ga0070713_100000028 | 3300005436 | Bacteria | 93227 |
| 90 | Ga0070713_100026620 | 3300005436 | Bacteria | 4543 |
| 91 | Ga0070713_100070549 | 3300005436 | Bacteria | 2950 |
| 92 | Ga0070701_10110217 | 3300005438 | Bacteria | 1537 |
| 93 | Ga0070705_101430343 | 3300005440 | Unclassified | 577 |
| 94 | Ga0070694_100721490 | 3300005444 | Bacteria | 812 |
| 95 | Ga0070694_100960509 | 3300005444 | Bacteria | 708 |
| 96 | Ga0070708_100054134 | 3300005445 | Bacteria | 3563 |
| 97 | Ga0070663_100144025 | 3300005455 | Bacteria | 1822 |
| 98 | Ga0070663_100596414 | 3300005455 | Bacteria | 928 |
| 99 | Ga0070678_100004036 | 3300005456 | Bacteria | 8264 |
| 100 | Ga0070678_100015086 | 3300005456 | Bacteria | 4898 |
| 101 | Ga0070678_100165208 | 3300005456 | Bacteria | 1797 |
| 102 | Ga0070678_100216738 | 3300005456 | Bacteria | 1589 |
| 103 | Ga0070678_100488605 | 3300005456 | Bacteria | 1084 |
| 104 | Ga0070678_100661813 | 3300005456 | Bacteria | 938 |
| 105 | Ga0070662_100008433 | 3300005457 | Bacteria | 6718 |
| 106 | Ga0070662_100016652 | 3300005457 | Bacteria | 4939 |
| 107 | Ga0070662_100172931 | 3300005457 | Bacteria | 1697 |
| 108 | Ga0070662_100225535 | 3300005457 | Bacteria | 1497 |
| 109 | Ga0070662_100575486 | 3300005457 | Bacteria | 945 |
| 110 | Ga0070681_10063643 | 3300005458 | Bacteria | 3660 |
| 111 | Ga0070681_10522094 | 3300005458 | Bacteria | 1101 |
| 112 | Ga0070681_10975496 | 3300005458 | Bacteria | 767 |
| 113 | Ga0068867_100011339 | 3300005459 | Bacteria | 6288 |
| 114 | Ga0068867_100015106 | 3300005459 | Bacteria | 5475 |
| 115 | Ga0068867_100292330 | 3300005459 | Bacteria | 1340 |
| 116 | Ga0068867_100774755 | 3300005459 | Bacteria | 853 |
| 117 | Ga0070685_10705933 | 3300005466 | Bacteria | 736 |
| 118 | Ga0070706_100001448 | 3300005467 | Bacteria | 24954 |
| 119 | Ga0070706_100326532 | 3300005467 | Bacteria | 1431 |
| 120 | Ga0070706_100508506 | 3300005467 | Bacteria | 1121 |
| 121 | Ga0070707_100323745 | 3300005468 | Bacteria | 1498 |
| 122 | Ga0070707_100704259 | 3300005468 | Bacteria | 973 |
| 123 | Ga0070698_100030267 | 3300005471 | Bacteria | 5614 |
| 124 | Ga0070699_100136837 | 3300005518 | Bacteria | 2161 |
| 125 | Ga0070699_100810224 | 3300005518 | Bacteria | 857 |
| 126 | Ga0070679_100058970 | 3300005530 | Bacteria | 3825 |
| 127 | Ga0070684_100009252 | 3300005535 | Bacteria | 7753 |
| 128 | Ga0070684_100191604 | 3300005535 | Bacteria | 1860 |
| 129 | Ga0070697_100014972 | 3300005536 | Bacteria | 6087 |
| 130 | Ga0068853_100082726 | 3300005539 | Bacteria | 2812 |
| 131 | Ga0068853_100377273 | 3300005539 | Bacteria | 1324 |
| 132 | Ga0068853_100495111 | 3300005539 | Bacteria | 1153 |
| 133 | Ga0068853_101111483 | 3300005539 | Bacteria | 762 |
| 134 | Ga0068853_101276310 | 3300005539 | Bacteria | 710 |
| 135 | Ga0068853_101637011 | 3300005539 | Bacteria | 624 |
| 136 | Ga0070672_100002366 | 3300005543 | Bacteria | 11936 |
| 137 | Ga0070672_100025703 | 3300005543 | Bacteria | 4371 |
| 138 | Ga0070672_100029191 | 3300005543 | Bacteria | 4134 |
| 139 | Ga0070672_100066644 | 3300005543 | Bacteria | 2851 |
| 140 | Ga0070672_100128821 | 3300005543 | Bacteria | 2078 |
| 141 | Ga0070686_100152088 | 3300005544 | Bacteria | 1622 |
| 142 | Ga0070695_100255375 | 3300005545 | Bacteria | 1278 |
| 143 | Ga0070693_100070359 | 3300005547 | Bacteria | 2059 |
| 144 | Ga0070693_100151701 | 3300005547 | Bacteria | 1468 |
| 145 | Ga0070693_100660652 | 3300005547 | Bacteria | 761 |
| 146 | Ga0070665_100108558 | 3300005548 | Bacteria | 2777 |
| 147 | Ga0070665_100245877 | 3300005548 | Bacteria | 1789 |
| 148 | Ga0070704_100239853 | 3300005549 | Bacteria | 1483 |
| 149 | Ga0068855_100019481 | 3300005563 | Bacteria | 8153 |
| 150 | Ga0068855_100050674 | 3300005563 | Bacteria | 4891 |
| 151 | Ga0068855_100187330 | 3300005563 | Bacteria | 2336 |
| 152 | Ga0070664_100099293 | 3300005564 | Bacteria | 2530 |
| 153 | Ga0070664_100200527 | 3300005564 | Bacteria | 1780 |
| 154 | Ga0070664_100232282 | 3300005564 | Bacteria | 1653 |
| 155 | Ga0070664_100322726 | 3300005564 | Bacteria | 1399 |
| 156 | Ga0070664_100388722 | 3300005564 | Bacteria | 1274 |
| 157 | Ga0070664_100826180 | 3300005564 | Bacteria | 867 |
| 158 | Ga0068857_100061526 | 3300005577 | Bacteria | 3335 |
| 159 | Ga0068857_100272538 | 3300005577 | Bacteria | 1555 |
| 160 | Ga0068857_100611362 | 3300005577 | Bacteria | 1031 |
| 161 | Ga0068854_100022758 | 3300005578 | Bacteria | 4275 |
| 162 | Ga0068854_100071773 | 3300005578 | Bacteria | 2534 |
| 163 | Ga0070702_100152382 | 3300005615 | Bacteria | 1485 |
| 164 | Ga0068852_100047446 | 3300005616 | Bacteria | 3664 |
| 165 | Ga0068852_100049622 | 3300005616 | Bacteria | 3591 |
| 166 | Ga0068852_100114805 | 3300005616 | Bacteria | 2454 |
| 167 | Ga0068852_100131355 | 3300005616 | Bacteria | 2306 |
| 168 | Ga0068852_100137485 | 3300005616 | Bacteria | 2257 |
| 169 | Ga0068852_100146060 | 3300005616 | Bacteria | 2194 |
| 170 | Ga0068852_100176780 | 3300005616 | Bacteria | 2005 |
| 171 | Ga0068852_100471228 | 3300005616 | Bacteria | 1246 |
| 172 | Ga0068859_100032866 | 3300005617 | Bacteria | 5212 |
| 173 | Ga0068859_100052964 | 3300005617 | Bacteria | 4081 |
| 174 | Ga0068859_100325184 | 3300005617 | Bacteria | 1632 |
| 175 | Ga0068864_100006724 | 3300005618 | Bacteria | 9420 |
| 176 | Ga0068864_100009050 | 3300005618 | Bacteria | 8209 |
| 177 | Ga0068864_100016929 | 3300005618 | Bacteria | 6074 |
| 178 | Ga0068864_100024031 | 3300005618 | Bacteria | 5123 |
| 179 | Ga0068864_100028258 | 3300005618 | Bacteria | 4739 |
| 180 | Ga0068864_100032800 | 3300005618 | Bacteria | 4414 |
| 181 | Ga0068864_100051430 | 3300005618 | Bacteria | 3549 |
| 182 | Ga0068864_100095552 | 3300005618 | Bacteria | 2628 |
| 183 | Ga0068864_100180700 | 3300005618 | Bacteria | 1929 |
| 184 | Ga0068864_100312486 | 3300005618 | Bacteria | 1473 |
| 185 | Ga0068864_100830578 | 3300005618 | Bacteria | 909 |
| 186 | Ga0068866_10004159 | 3300005718 | Bacteria | 5934 |
| 187 | Ga0068861_100000757 | 3300005719 | Bacteria | 19364 |
| 188 | Ga0068861_100016694 | 3300005719 | Bacteria | 5200 |
| 189 | Ga0068861_100055464 | 3300005719 | Bacteria | 3021 |
| 190 | Ga0068861_100305984 | 3300005719 | Bacteria | 1379 |
| 191 | Ga0068851_10012597 | 3300005834 | Bacteria | 3990 |
| 192 | Ga0068851_10150229 | 3300005834 | Bacteria | 1273 |
| 193 | Ga0068870_10305377 | 3300005840 | Bacteria | 1006 |
| 194 | Ga0068863_100000585 | 3300005841 | Bacteria | 37128 |
| 195 | Ga0068863_100030558 | 3300005841 | Bacteria | 5143 |
| 196 | Ga0068863_100042606 | 3300005841 | Bacteria | 4313 |
| 197 | Ga0068863_100115425 | 3300005841 | Bacteria | 2558 |
| 198 | Ga0068863_100144088 | 3300005841 | Bacteria | 2278 |
| 199 | Ga0068863_100691333 | 3300005841 | Bacteria | 1013 |
| 200 | Ga0068858_100002981 | 3300005842 | Bacteria | 16991 |
| 201 | Ga0068858_100003791 | 3300005842 | Bacteria | 14951 |
| 202 | Ga0068858_100004338 | 3300005842 | Bacteria | 13920 |
| 203 | Ga0068858_100004346 | 3300005842 | Bacteria | 13910 |
| 204 | Ga0068860_100009426 | 3300005843 | Bacteria | 9703 |
| 205 | Ga0068860_100052427 | 3300005843 | Bacteria | 3880 |
| 206 | Ga0068860_100412436 | 3300005843 | Bacteria | 1338 |
| 207 | Ga0068860_101333212 | 3300005843 | Bacteria | 739 |
| 208 | Ga0068862_100010864 | 3300005844 | Bacteria | 7518 |
| 209 | Ga0068862_100017376 | 3300005844 | Bacteria | 5990 |
| 210 | Ga0068862_100065393 | 3300005844 | Bacteria | 3132 |
| 211 | Ga0068862_100093051 | 3300005844 | Bacteria | 2628 |
| 212 | Ga0081539_10048422 | 3300005985 | Bacteria | 2418 |
| 213 | Ga0075368_10105044 | 3300006042 | Bacteria | 1162 |
| 214 | Ga0070715_10019021 | 3300006163 | Bacteria | 2627 |
| 215 | Ga0070716_100008353 | 3300006173 | Bacteria | 5135 |
| 216 | Ga0070716_100143199 | 3300006173 | Bacteria | 1528 |
| 217 | Ga0070716_100413934 | 3300006173 | Bacteria | 973 |
| 218 | Ga0070716_100766110 | 3300006173 | Bacteria | 744 |
| 219 | Ga0070712_100231807 | 3300006175 | Bacteria | 1467 |
| 220 | Ga0075367_10007169 | 3300006178 | Bacteria | 5690 |
| 221 | Ga0075369_10057690 | 3300006186 | Bacteria | 1689 |
| 222 | Ga0075369_10318089 | 3300006186 | Bacteria | 728 |
| 223 | Ga0075366_10057252 | 3300006195 | Bacteria | 2317 |
| 224 | Ga0075366_10149429 | 3300006195 | Bacteria | 1414 |
| 225 | Ga0097621_100049628 | 3300006237 | Bacteria | 3410 |
| 226 | Ga0097621_100060666 | 3300006237 | Bacteria | 3101 |
| 227 | Ga0097621_100090975 | 3300006237 | Bacteria | 2554 |
| 228 | Ga0097621_100097413 | 3300006237 | Bacteria | 2470 |
| 229 | Ga0097621_100104799 | 3300006237 | Bacteria | 2383 |
| 230 | Ga0097621_100110135 | 3300006237 | Bacteria | 2326 |
| 231 | Ga0097621_100132153 | 3300006237 | Bacteria | 2126 |
| 232 | Ga0097621_100214730 | 3300006237 | Bacteria | 1674 |
| 233 | Ga0097621_100786467 | 3300006237 | Bacteria | 881 |
| 234 | Ga0075370_10040382 | 3300006353 | Bacteria | 2631 |
| 235 | Ga0068871_100024895 | 3300006358 | Bacteria | 4648 |
| 236 | Ga0068871_100032966 | 3300006358 | Bacteria | 4096 |
| 237 | Ga0068871_100046861 | 3300006358 | Bacteria | 3483 |
| 238 | Ga0068871_100111728 | 3300006358 | Bacteria | 2299 |
| 239 | Ga0068871_100177785 | 3300006358 | Bacteria | 1827 |
| 240 | Ga0068871_100205149 | 3300006358 | Bacteria | 1703 |
| 241 | Ga0068871_100352208 | 3300006358 | Bacteria | 1302 |
| 242 | Ga0075428_100009252 | 3300006844 | Bacteria | 10926 |
| 243 | Ga0075430_100100678 | 3300006846 | Bacteria | 2413 |
| 244 | Ga0075431_100010552 | 3300006847 | Bacteria | 9287 |
| 245 | Ga0075433_10138514 | 3300006852 | Bacteria | 2163 |
| 246 | Ga0075433_10243015 | 3300006852 | Bacteria | 1598 |
| 247 | Ga0075433_10281894 | 3300006852 | Bacteria | 1472 |
| 248 | Ga0075429_100006162 | 3300006880 | Bacteria | 10369 |
| 249 | Ga0075429_100752140 | 3300006880 | Bacteria | 854 |
| 250 | Ga0097620_100032866 | 3300006931 | Bacteria | 5212 |
| 251 | Ga0097620_100052964 | 3300006931 | Bacteria | 4081 |
| 252 | Ga0097620_100325184 | 3300006931 | Bacteria | 1632 |
| 253 | Ga0099794_10011178 | 3300007265 | Bacteria | 3838 |
| 254 | Ga0105244_10000891 | 3300009036 | Bacteria | 25233 |
| 255 | Ga0111539_10027065 | 3300009094 | Bacteria | 7004 |
| 256 | Ga0111539_10047083 | 3300009094 | Bacteria | 5156 |
| 257 | Ga0111539_10289361 | 3300009094 | Bacteria | 1906 |
| 258 | Ga0111539_10543011 | 3300009094 | Bacteria | 1354 |
| 259 | Ga0111539_11552050 | 3300009094 | Bacteria | 768 |
| 260 | Ga0105245_10011246 | 3300009098 | Bacteria | 7792 |
| 261 | Ga0105245_10104852 | 3300009098 | Bacteria | 2622 |
| 262 | Ga0105245_10114708 | 3300009098 | Bacteria | 2509 |
| 263 | Ga0105245_10911358 | 3300009098 | Bacteria | 921 |
| 264 | Ga0114129_10000826 | 3300009147 | Bacteria | 39997 |
| 265 | Ga0105243_10007729 | 3300009148 | Bacteria | 8267 |
| 266 | Ga0105243_10074803 | 3300009148 | Bacteria | 2748 |
| 267 | Ga0105243_10173612 | 3300009148 | Bacteria | 1869 |
| 268 | Ga0105243_10843319 | 3300009148 | Bacteria | 907 |
| 269 | Ga0105241_10042664 | 3300009174 | Bacteria | 3434 |
| 270 | Ga0105241_10450054 | 3300009174 | Bacteria | 1139 |
| 271 | Ga0105241_10527663 | 3300009174 | Unclassified | 1057 |
| 272 | Ga0105242_10066268 | 3300009176 | Bacteria | 2981 |
| 273 | Ga0105242_10269659 | 3300009176 | Bacteria | 1541 |
| 274 | Ga0105248_10043019 | 3300009177 | Bacteria | 5065 |
| 275 | Ga0105248_10114677 | 3300009177 | Bacteria | 3039 |
| 276 | Ga0105248_10154030 | 3300009177 | Bacteria | 2593 |
| 277 | Ga0105248_10306196 | 3300009177 | Bacteria | 1789 |
| 278 | Ga0105248_10450138 | 3300009177 | Bacteria | 1451 |
| 279 | Ga0105248_10545997 | 3300009177 | Bacteria | 1307 |
| 280 | Ga0105248_10922451 | 3300009177 | Bacteria | 986 |
| 281 | Ga0105248_10964573 | 3300009177 | Bacteria | 963 |
| 282 | Ga0105248_11157073 | 3300009177 | Bacteria | 874 |
| 283 | Ga0105238_10002565 | 3300009551 | Bacteria | 18148 |
| 284 | Ga0105238_10023451 | 3300009551 | Bacteria | 6291 |
| 285 | Ga0105238_10133924 | 3300009551 | Bacteria | 2456 |
| 286 | Ga0105238_10177742 | 3300009551 | Bacteria | 2105 |
| 287 | Ga0105249_10442469 | 3300009553 | Bacteria | 1337 |
| 288 | Ga0105249_11137211 | 3300009553 | Bacteria | 851 |
| 289 | Ga0099796_10190695 | 3300010159 | Bacteria | 827 |
| 290 | Ga0105239_10121481 | 3300010375 | Bacteria | 2901 |
| 291 | Ga0105239_10981397 | 3300010375 | Bacteria | 971 |
| 292 | Ga0105246_10114536 | 3300011119 | Bacteria | 1987 |
| 293 | Ga0105246_10590374 | 3300011119 | Bacteria | 958 |
| 294 | Ga0157373_10101389 | 3300013100 | Bacteria | 2026 |
| 295 | Ga0157371_10207088 | 3300013102 | Bacteria | 1407 |
| 296 | Ga0157371_10553072 | 3300013102 | Bacteria | 853 |
| 297 | Ga0157370_10020147 | 3300013104 | Bacteria | 6666 |
| 298 | Ga0157370_10089256 | 3300013104 | Bacteria | 2896 |
| 299 | Ga0157369_10001417 | 3300013105 | Bacteria | 29468 |
| 300 | Ga0157374_10073038 | 3300013296 | Bacteria | 3238 |
| 301 | Ga0157374_10130476 | 3300013296 | Bacteria | 2432 |
| 302 | Ga0157374_10142912 | 3300013296 | Bacteria | 2323 |
| 303 | Ga0157374_10548325 | 3300013296 | Bacteria | 1164 |
| 304 | Ga0157374_10765194 | 3300013296 | Bacteria | 981 |
| 305 | Ga0157374_11189143 | 3300013296 | Bacteria | 784 |
| 306 | Ga0157378_10077664 | 3300013297 | Bacteria | 2993 |
| 307 | Ga0157378_11676571 | 3300013297 | Bacteria | 682 |
| 308 | Ga0163162_10004424 | 3300013306 | Bacteria | 13529 |
| 309 | Ga0163162_10038505 | 3300013306 | Bacteria | 4771 |
| 310 | Ga0163162_10493901 | 3300013306 | Bacteria | 1355 |
| 311 | Ga0163162_10657033 | 3300013306 | Bacteria | 1172 |
| 312 | Ga0163162_12071778 | 3300013306 | Bacteria | 652 |
| 313 | Ga0157372_10003179 | 3300013307 | Bacteria | 17712 |
| 314 | Ga0157372_10067327 | 3300013307 | Bacteria | 4024 |
| 315 | Ga0157372_10159008 | 3300013307 | Bacteria | 2610 |
| 316 | Ga0157372_11245422 | 3300013307 | Bacteria | 859 |
| 317 | Ga0157375_10006387 | 3300013308 | Bacteria | 10274 |
| 318 | Ga0157375_10019641 | 3300013308 | Bacteria | 6152 |
| 319 | Ga0157375_10080914 | 3300013308 | Bacteria | 3287 |
| 320 | Ga0157375_10151633 | 3300013308 | Bacteria | 2454 |
| 321 | Ga0157375_10405343 | 3300013308 | Bacteria | 1530 |
| 322 | Ga0157375_10983620 | 3300013308 | Bacteria | 984 |
| 323 | Ga0163163_10021119 | 3300014325 | Bacteria | 6142 |
| 324 | Ga0163163_10031254 | 3300014325 | Bacteria | 5138 |
| 325 | Ga0163163_10034015 | 3300014325 | Bacteria | 4933 |
| 326 | Ga0163163_10164237 | 3300014325 | Bacteria | 2266 |
| 327 | Ga0163163_10555810 | 3300014325 | Bacteria | 1210 |
| 328 | Ga0157380_10012973 | 3300014326 | Bacteria | 6057 |
| 329 | Ga0157380_10022945 | 3300014326 | Bacteria | 4706 |
| 330 | Ga0157380_10027585 | 3300014326 | Bacteria | 4319 |
| 331 | Ga0157380_10133142 | 3300014326 | Bacteria | 2124 |
| 332 | Ga0157380_10233090 | 3300014326 | Bacteria | 1655 |
| 333 | Ga0157377_10063867 | 3300014745 | Bacteria | 2110 |
| 334 | Ga0157377_10267001 | 3300014745 | Bacteria | 1116 |
| 335 | Ga0157379_10004462 | 3300014968 | Bacteria | 12005 |
| 336 | Ga0157379_10024218 | 3300014968 | Bacteria | 5388 |
| 337 | Ga0157379_10061522 | 3300014968 | Bacteria | 3357 |
| 338 | Ga0157379_10092686 | 3300014968 | Bacteria | 2710 |
| 339 | Ga0157379_10099305 | 3300014968 | Bacteria | 2613 |
| 340 | Ga0157379_12186961 | 3300014968 | Bacteria | 549 |
| 341 | Ga0157376_10085585 | 3300014969 | Bacteria | 2716 |
| 342 | Ga0157376_10127747 | 3300014969 | Bacteria | 2264 |
| 343 | Ga0157376_10200701 | 3300014969 | Bacteria | 1835 |
| 344 | Ga0157376_10329469 | 3300014969 | Bacteria | 1454 |
| 345 | Ga0157376_11544961 | 3300014969 | Bacteria | 697 |
| 346 | Ga0163161_10016140 | 3300017792 | Bacteria | 5213 |
| 347 | Ga0163161_10035830 | 3300017792 | Bacteria | 3552 |
| 348 | Ga0163161_10350625 | 3300017792 | Bacteria | 1173 |
| 349 | Ga0213874_10054231 | 3300021377 | Bacteria | 1239 |
| 350 | Ga0213876_10075065 | 3300021384 | Bacteria | 1786 |
| 351 | Ga0213876_10166433 | 3300021384 | Bacteria | 1173 |
| 352 | Ga0207425_1000433 | 3300025245 | Bacteria | 27674 |
| 353 | Ga0209026_1003689 | 3300025250 | Bacteria | 4901 |
| 354 | Ga0209025_1006993 | 3300025294 | Bacteria | 8562 |
| 355 | Ga0209564_1000027 | 3300025295 | Bacteria | 518458 |
| 356 | Ga0209758_1000436 | 3300025297 | Bacteria | 70342 |
| 357 | Ga0207656_10007890 | 3300025321 | Bacteria | 3898 |
| 358 | Ga0207656_10057945 | 3300025321 | Bacteria | 1691 |
| 359 | Ga0207656_10114144 | 3300025321 | Bacteria | 1251 |
| 360 | Ga0207656_10128368 | 3300025321 | Bacteria | 1186 |
| 361 | Ga0207656_10198568 | 3300025321 | Bacteria | 968 |
| 362 | Ga0207655_1006687 | 3300025728 | Bacteria | 7598 |
| 363 | Ga0207682_10002971 | 3300025893 | Bacteria | 7440 |
| 364 | Ga0207682_10028879 | 3300025893 | Bacteria | 2216 |
| 365 | Ga0207682_10052091 | 3300025893 | Bacteria | 1696 |
| 366 | Ga0207682_10267892 | 3300025893 | Bacteria | 797 |
| 367 | Ga0207642_10002689 | 3300025899 | Bacteria | 5544 |
| 368 | Ga0207688_10177615 | 3300025901 | Bacteria | 1268 |
| 369 | Ga0207680_10015539 | 3300025903 | Bacteria | 3974 |
| 370 | Ga0207680_10016326 | 3300025903 | Bacteria | 3896 |
| 371 | Ga0207680_10123465 | 3300025903 | Bacteria | 1697 |
| 372 | Ga0207680_10502161 | 3300025903 | Bacteria | 864 |
| 373 | Ga0207680_10540025 | 3300025903 | Bacteria | 832 |
| 374 | Ga0207645_10005283 | 3300025907 | Bacteria | 9402 |
| 375 | Ga0207645_10031798 | 3300025907 | Bacteria | 3393 |
| 376 | Ga0207645_10046537 | 3300025907 | Bacteria | 2771 |
| 377 | Ga0207645_10051897 | 3300025907 | Bacteria | 2620 |
| 378 | Ga0207643_10095554 | 3300025908 | Bacteria | 1737 |
| 379 | Ga0207705_10019896 | 3300025909 | Bacteria | 4801 |
| 380 | Ga0207705_10057954 | 3300025909 | Bacteria | 2795 |
| 381 | Ga0207705_10068798 | 3300025909 | Bacteria | 2564 |
| 382 | Ga0207705_10106325 | 3300025909 | Bacteria | 2070 |
| 383 | Ga0207705_10482950 | 3300025909 | Bacteria | 962 |
| 384 | Ga0207684_10002129 | 3300025910 | Bacteria | 20290 |
| 385 | Ga0207707_10432043 | 3300025912 | Bacteria | 1128 |
| 386 | Ga0207693_10075058 | 3300025915 | Bacteria | 2648 |
| 387 | Ga0207660_11166078 | 3300025917 | Bacteria | 627 |
| 388 | Ga0207662_10007292 | 3300025918 | Bacteria | 6011 |
| 389 | Ga0207657_10140060 | 3300025919 | Bacteria | 1977 |
| 390 | Ga0207657_10178023 | 3300025919 | Bacteria | 1720 |
| 391 | Ga0207649_10183781 | 3300025920 | Bacteria | 1465 |
| 392 | Ga0207649_10321977 | 3300025920 | Bacteria | 1136 |
| 393 | Ga0207649_10562741 | 3300025920 | Bacteria | 873 |
| 394 | Ga0207652_10172838 | 3300025921 | Bacteria | 1939 |
| 395 | Ga0207652_10646759 | 3300025921 | Bacteria | 946 |
| 396 | Ga0207646_10593066 | 3300025922 | Bacteria | 995 |
| 397 | Ga0207681_10002043 | 3300025923 | Bacteria | 12940 |
| 398 | Ga0207681_10013149 | 3300025923 | Bacteria | 5117 |
| 399 | Ga0207681_10015363 | 3300025923 | Bacteria | 4774 |
| 400 | Ga0207681_10136582 | 3300025923 | Bacteria | 1820 |
| 401 | Ga0207681_10251984 | 3300025923 | Bacteria | 1379 |
| 402 | Ga0207694_10096401 | 3300025924 | Bacteria | 2339 |
| 403 | Ga0207694_10328464 | 3300025924 | Bacteria | 1263 |
| 404 | Ga0207650_10011876 | 3300025925 | Bacteria | 6001 |
| 405 | Ga0207650_10054905 | 3300025925 | Bacteria | 2956 |
| 406 | Ga0207650_10099174 | 3300025925 | Bacteria | 2239 |
| 407 | Ga0207650_10099858 | 3300025925 | Bacteria | 2232 |
| 408 | Ga0207650_10169221 | 3300025925 | Bacteria | 1736 |
| 409 | Ga0207650_10426241 | 3300025925 | Bacteria | 1101 |
| 410 | Ga0207650_10963429 | 3300025925 | Bacteria | 725 |
| 411 | Ga0207659_10000313 | 3300025926 | Bacteria | 29491 |
| 412 | Ga0207659_10055225 | 3300025926 | Bacteria | 2839 |
| 413 | Ga0207659_10108670 | 3300025926 | Bacteria | 2104 |
| 414 | Ga0207659_10132320 | 3300025926 | Bacteria | 1927 |
| 415 | Ga0207659_10267502 | 3300025926 | Bacteria | 1393 |
| 416 | Ga0207659_10456552 | 3300025926 | Bacteria | 1077 |
| 417 | Ga0207687_10046846 | 3300025927 | Bacteria | 2995 |
| 418 | Ga0207687_10222735 | 3300025927 | Bacteria | 1486 |
| 419 | Ga0207687_10296428 | 3300025927 | Bacteria | 1301 |
| 420 | Ga0207700_10000338 | 3300025928 | Bacteria | 27628 |
| 421 | Ga0207700_10032912 | 3300025928 | Bacteria | 3704 |
| 422 | Ga0207700_10100864 | 3300025928 | Bacteria | 2302 |
| 423 | Ga0207664_10942764 | 3300025929 | Bacteria | 774 |
| 424 | Ga0207644_10000517 | 3300025931 | Bacteria | 24952 |
| 425 | Ga0207644_10005549 | 3300025931 | Bacteria | 8209 |
| 426 | Ga0207644_10116617 | 3300025931 | Bacteria | 2027 |
| 427 | Ga0207644_10123428 | 3300025931 | Bacteria | 1974 |
| 428 | Ga0207644_10204918 | 3300025931 | Bacteria | 1557 |
| 429 | Ga0207690_10069010 | 3300025932 | Bacteria | 2431 |
| 430 | Ga0207690_10292890 | 3300025932 | Bacteria | 1271 |
| 431 | Ga0207690_10856079 | 3300025932 | Bacteria | 753 |
| 432 | Ga0207706_10003551 | 3300025933 | Bacteria | 14887 |
| 433 | Ga0207706_10015438 | 3300025933 | Bacteria | 6899 |
| 434 | Ga0207706_10073877 | 3300025933 | Bacteria | 2998 |
| 435 | Ga0207706_10078917 | 3300025933 | Bacteria | 2895 |
| 436 | Ga0207706_10301466 | 3300025933 | Bacteria | 1396 |
| 437 | Ga0207706_10306354 | 3300025933 | Bacteria | 1383 |
| 438 | Ga0207686_10013046 | 3300025934 | Bacteria | 4588 |
| 439 | Ga0207686_10035577 | 3300025934 | Bacteria | 2991 |
| 440 | Ga0207709_10148989 | 3300025935 | Bacteria | 1618 |
| 441 | Ga0207709_10150709 | 3300025935 | Bacteria | 1610 |
| 442 | Ga0207670_10030009 | 3300025936 | Bacteria | 3471 |
| 443 | Ga0207670_10989918 | 3300025936 | Bacteria | 707 |
| 444 | Ga0207669_10015520 | 3300025937 | Bacteria | 3843 |
| 445 | Ga0207669_10167644 | 3300025937 | Bacteria | 1559 |
| 446 | Ga0207669_10434363 | 3300025937 | Bacteria | 1036 |
| 447 | Ga0207669_11028543 | 3300025937 | Bacteria | 693 |
| 448 | Ga0207704_10018901 | 3300025938 | Bacteria | 3608 |
| 449 | Ga0207704_11194656 | 3300025938 | Bacteria | 648 |
| 450 | Ga0207665_10002235 | 3300025939 | Bacteria | 13061 |
| 451 | Ga0207665_10197673 | 3300025939 | Bacteria | 1464 |
| 452 | Ga0207665_10251355 | 3300025939 | Bacteria | 1306 |
| 453 | Ga0207691_10007603 | 3300025940 | Bacteria | 10430 |
| 454 | Ga0207691_10008416 | 3300025940 | Bacteria | 9910 |
| 455 | Ga0207691_10033898 | 3300025940 | Bacteria | 4753 |
| 456 | Ga0207691_10130481 | 3300025940 | Bacteria | 2221 |
| 457 | Ga0207691_10225796 | 3300025940 | Bacteria | 1623 |
| 458 | Ga0207691_10296005 | 3300025940 | Bacteria | 1391 |
| 459 | Ga0207711_10029584 | 3300025941 | Bacteria | 4622 |
| 460 | Ga0207711_10060708 | 3300025941 | Bacteria | 3258 |
| 461 | Ga0207711_10087670 | 3300025941 | Bacteria | 2731 |
| 462 | Ga0207711_10104118 | 3300025941 | Bacteria | 2514 |
| 463 | Ga0207689_10002034 | 3300025942 | Bacteria | 19106 |
| 464 | Ga0207689_10013647 | 3300025942 | Bacteria | 6928 |
| 465 | Ga0207689_10021025 | 3300025942 | Bacteria | 5485 |
| 466 | Ga0207689_10347648 | 3300025942 | Bacteria | 1232 |
| 467 | Ga0207661_10028878 | 3300025944 | Bacteria | 4252 |
| 468 | Ga0207661_10112969 | 3300025944 | Bacteria | 2301 |
| 469 | Ga0207679_10182092 | 3300025945 | Bacteria | 1739 |
| 470 | Ga0207679_10361937 | 3300025945 | Bacteria | 1267 |
| 471 | Ga0207679_10517003 | 3300025945 | Bacteria | 1067 |
| 472 | Ga0207679_11346316 | 3300025945 | Bacteria | 655 |
| 473 | Ga0207667_10015924 | 3300025949 | Bacteria | 8515 |
| 474 | Ga0207667_10017769 | 3300025949 | Bacteria | 7999 |
| 475 | Ga0207667_10040469 | 3300025949 | Bacteria | 4963 |
| 476 | Ga0207667_10232482 | 3300025949 | Bacteria | 1887 |
| 477 | Ga0207651_10000600 | 3300025960 | Bacteria | 15181 |
| 478 | Ga0207651_10196662 | 3300025960 | Bacteria | 1612 |
| 479 | Ga0207651_10264450 | 3300025960 | Bacteria | 1414 |
| 480 | Ga0207651_10787442 | 3300025960 | Bacteria | 842 |
| 481 | Ga0207712_10610010 | 3300025961 | Bacteria | 945 |
| 482 | Ga0207668_10005847 | 3300025972 | Bacteria | 7243 |
| 483 | Ga0207668_10022312 | 3300025972 | Bacteria | 4050 |
| 484 | Ga0207668_10259948 | 3300025972 | Bacteria | 1414 |
| 485 | Ga0207668_10463986 | 3300025972 | Bacteria | 1083 |
| 486 | Ga0207640_10065937 | 3300025981 | Bacteria | 2417 |
| 487 | Ga0207640_10093962 | 3300025981 | Bacteria | 2085 |
| 488 | Ga0207640_10416881 | 3300025981 | Bacteria | 1098 |
| 489 | Ga0207640_10555566 | 3300025981 | Bacteria | 965 |
| 490 | Ga0207658_10000812 | 3300025986 | Bacteria | 26147 |
| 491 | Ga0207658_10004524 | 3300025986 | Bacteria | 9661 |
| 492 | Ga0207658_10008395 | 3300025986 | Bacteria | 7030 |
| 493 | Ga0207658_10104711 | 3300025986 | Bacteria | 2224 |
| 494 | Ga0207658_10365385 | 3300025986 | Bacteria | 1260 |
| 495 | Ga0207658_10425975 | 3300025986 | Bacteria | 1171 |
| 496 | Ga0207677_10004232 | 3300026023 | Bacteria | 7684 |
| 497 | Ga0207677_10012506 | 3300026023 | Bacteria | 4883 |
| 498 | Ga0207677_10203650 | 3300026023 | Bacteria | 1575 |
| 499 | Ga0207677_10521385 | 3300026023 | Bacteria | 1031 |
| 500 | Ga0207703_10000929 | 3300026035 | Bacteria | 28489 |
| 501 | Ga0207703_10001541 | 3300026035 | Bacteria | 20913 |
| 502 | Ga0207703_10050619 | 3300026035 | Bacteria | 3363 |
| 503 | Ga0207703_10374599 | 3300026035 | Bacteria | 1315 |
| 504 | Ga0207703_11196395 | 3300026035 | Bacteria | 731 |
| 505 | Ga0207639_10045094 | 3300026041 | Bacteria | 3319 |
| 506 | Ga0207639_10064502 | 3300026041 | Bacteria | 2840 |
| 507 | Ga0207639_10369350 | 3300026041 | Bacteria | 1286 |
| 508 | Ga0207639_10620505 | 3300026041 | Bacteria | 998 |
| 509 | Ga0207639_11195829 | 3300026041 | Bacteria | 713 |
| 510 | Ga0207639_11325285 | 3300026041 | Bacteria | 676 |
| 511 | Ga0207678_10121386 | 3300026067 | Bacteria | 2230 |
| 512 | Ga0207678_10323622 | 3300026067 | Bacteria | 1327 |
| 513 | Ga0207678_10622106 | 3300026067 | Bacteria | 947 |
| 514 | Ga0207708_10548800 | 3300026075 | Bacteria | 974 |
| 515 | Ga0207641_10000655 | 3300026088 | Bacteria | 37743 |
| 516 | Ga0207641_10041985 | 3300026088 | Bacteria | 3835 |
| 517 | Ga0207641_10083989 | 3300026088 | Bacteria | 2771 |
| 518 | Ga0207641_10100664 | 3300026088 | Bacteria | 2545 |
| 519 | Ga0207641_10263864 | 3300026088 | Bacteria | 1614 |
| 520 | Ga0207641_10808793 | 3300026088 | Bacteria | 927 |
| 521 | Ga0207641_11003515 | 3300026088 | Bacteria | 831 |
| 522 | Ga0207648_10006616 | 3300026089 | Bacteria | 11512 |
| 523 | Ga0207648_10831348 | 3300026089 | Bacteria | 861 |
| 524 | Ga0207676_10002990 | 3300026095 | Bacteria | 12054 |
| 525 | Ga0207676_10008396 | 3300026095 | Bacteria | 7341 |
| 526 | Ga0207676_10017575 | 3300026095 | Bacteria | 5185 |
| 527 | Ga0207676_10019288 | 3300026095 | Bacteria | 4972 |
| 528 | Ga0207676_10040215 | 3300026095 | Bacteria | 3582 |
| 529 | Ga0207676_10045925 | 3300026095 | Bacteria | 3377 |
| 530 | Ga0207676_10197511 | 3300026095 | Bacteria | 1775 |
| 531 | Ga0207676_10357517 | 3300026095 | Bacteria | 1352 |
| 532 | Ga0207676_10472438 | 3300026095 | Bacteria | 1186 |
| 533 | Ga0207676_10474911 | 3300026095 | Bacteria | 1183 |
| 534 | Ga0207676_10539494 | 3300026095 | Bacteria | 1113 |
| 535 | Ga0207676_10871663 | 3300026095 | Bacteria | 881 |
| 536 | Ga0207674_10161382 | 3300026116 | Bacteria | 2196 |
| 537 | Ga0207674_10532567 | 3300026116 | Bacteria | 1135 |
| 538 | Ga0207674_10998576 | 3300026116 | Bacteria | 806 |
| 539 | Ga0207675_100000956 | 3300026118 | Bacteria | 28809 |
| 540 | Ga0207675_100052681 | 3300026118 | Bacteria | 3797 |
| 541 | Ga0207683_10001877 | 3300026121 | Bacteria | 18588 |
| 542 | Ga0207683_10030845 | 3300026121 | Bacteria | 4648 |
| 543 | Ga0207683_10091526 | 3300026121 | Bacteria | 2710 |
| 544 | Ga0207683_10104582 | 3300026121 | Bacteria | 2530 |
| 545 | Ga0207683_10236721 | 3300026121 | Bacteria | 1665 |
| 546 | Ga0207683_10297475 | 3300026121 | Bacteria | 1476 |
| 547 | Ga0207698_10051451 | 3300026142 | Bacteria | 3149 |
| 548 | Ga0207698_10061514 | 3300026142 | Bacteria | 2927 |
| 549 | Ga0207698_10063805 | 3300026142 | Bacteria | 2885 |
| 550 | Ga0207698_10082727 | 3300026142 | Bacteria | 2596 |
| 551 | Ga0207698_10084881 | 3300026142 | Bacteria | 2569 |
| 552 | Ga0207698_10108058 | 3300026142 | Bacteria | 2324 |
| 553 | Ga0207698_10147223 | 3300026142 | Bacteria | 2038 |
| 554 | Ga0207698_10152334 | 3300026142 | Bacteria | 2009 |
| 555 | Ga0207698_10490085 | 3300026142 | Bacteria | 1194 |
| 556 | Ga0207698_11073289 | 3300026142 | Bacteria | 817 |
| 557 | Ga0207698_11279611 | 3300026142 | Bacteria | 748 |
| 558 | Ga0209588_1026138 | 3300027671 | Bacteria | 1852 |
| 559 | Ga0209588_1092718 | 3300027671 | Bacteria | 973 |
| 560 | Ga0209813_10100218 | 3300027866 | Bacteria | 985 |
| 561 | Ga0207428_10002089 | 3300027907 | Bacteria | 20124 |
| 562 | Ga0207428_10002537 | 3300027907 | Bacteria | 18227 |
| 563 | Ga0268266_10047759 | 3300028379 | Bacteria | 3668 |
| 564 | Ga0268266_10199372 | 3300028379 | Bacteria | 1831 |
| 565 | Ga0268266_10217974 | 3300028379 | Bacteria | 1753 |
| 566 | Ga0268266_11382983 | 3300028379 | Bacteria | 679 |
| 567 | Ga0268265_10008601 | 3300028380 | Bacteria | 6899 |
| 568 | Ga0268265_10031887 | 3300028380 | Bacteria | 3810 |
| 569 | Ga0268264_10002170 | 3300028381 | Bacteria | 17490 |
| 570 | Ga0268264_10072300 | 3300028381 | Unclassified | 2925 |
| 571 | Ga0268264_10175313 | 3300028381 | Bacteria | 1943 |
| 572 | Ga0268264_11331446 | 3300028381 | Bacteria | 728 |
| 573 | Ga0265336_10000129 | 3300028666 | Bacteria | 55515 |
| 574 | Ga0265336_10021839 | 3300028666 | Bacteria | 2043 |
| 575 | Ga0307517_10044883 | 3300028786 | Bacteria | 4660 |
| 576 | Ga0307517_10134835 | 3300028786 | Bacteria | 1760 |
| 577 | Ga0307515_10000026 | 3300028794 | Bacteria | 382411 |
| 578 | Ga0307515_10059241 | 3300028794 | Bacteria | 5491 |
| 579 | Ga0307515_10203361 | 3300028794 | Bacteria | 1849 |
| 580 | Ga0265324_10000029 | 3300029957 | Bacteria | 132963 |
| 581 | Ga0265324_10018935 | 3300029957 | Bacteria | 2482 |
| 582 | Ga0307512_10076021 | 3300030522 | Bacteria | 2452 |
| 583 | Ga0307512_10078766 | 3300030522 | Bacteria | 2386 |
| 584 | Ga0265325_10000207 | 3300031241 | Bacteria | 41657 |
| 585 | Ga0265325_10209885 | 3300031241 | Bacteria | 895 |
| 586 | Ga0265331_10022387 | 3300031250 | Bacteria | 3225 |
| 587 | Ga0265327_10001736 | 3300031251 | Bacteria | 25815 |
| 588 | Ga0265327_10010729 | 3300031251 | Bacteria | 6398 |
| 589 | Ga0265327_10063857 | 3300031251 | Bacteria | 1868 |
| 590 | Ga0265327_10262958 | 3300031251 | Bacteria | 766 |
| 591 | Ga0265316_10001407 | 3300031344 | Bacteria | 25872 |
| 592 | Ga0265316_10124535 | 3300031344 | Bacteria | 1945 |
| 593 | Ga0307509_10001002 | 3300031507 | Bacteria | 48561 |
| 594 | Ga0307509_10001260 | 3300031507 | Bacteria | 42936 |
| 595 | Ga0307509_10004767 | 3300031507 | Bacteria | 19334 |
| 596 | Ga0307509_10187105 | 3300031507 | Bacteria | 1927 |
| 597 | Ga0307508_10000280 | 3300031616 | Bacteria | 62637 |
| 598 | Ga0307508_10105300 | 3300031616 | Bacteria | 2418 |
| 599 | Ga0307514_10195648 | 3300031649 | Bacteria | 1280 |
| 600 | Ga0316575_10013115 | 3300031665 | Bacteria | 3090 |
| 601 | Ga0316575_10121945 | 3300031665 | Bacteria | 1066 |
| 602 | Ga0316575_10176598 | 3300031665 | Bacteria | 886 |
| 603 | Ga0316579_10006968 | 3300031691 | Bacteria | 4642 |
| 604 | Ga0316579_10016583 | 3300031691 | Bacteria | 3220 |
| 605 | Ga0316579_10018004 | 3300031691 | Bacteria | 3105 |
| 606 | Ga0316579_10087313 | 3300031691 | Bacteria | 1488 |
| 607 | Ga0265314_10025679 | 3300031711 | Bacteria | 4439 |
| 608 | Ga0316578_10003640 | 3300031728 | Bacteria | 7107 |
| 609 | Ga0307405_10247785 | 3300031731 | Bacteria | 1324 |
| 610 | Ga0316577_10073697 | 3300031733 | Bacteria | 1906 |
| 611 | Ga0316577_10118272 | 3300031733 | Bacteria | 1489 |
| 612 | Ga0307518_10338600 | 3300031838 | Bacteria | 885 |
| 613 | Ga0307412_10659572 | 3300031911 | Bacteria | 893 |
| 614 | Ga0307416_100106326 | 3300032002 | Bacteria | 2459 |
| 615 | Ga0307416_100229178 | 3300032002 | Bacteria | 1789 |
| 616 | Ga0307416_100410429 | 3300032002 | Bacteria | 1395 |
| 617 | Ga0316583_10071211 | 3300032133 | Unclassified | 1216 |
| 618 | Ga0316585_10033270 | 3300032137 | Bacteria | 1626 |
| 619 | Ga0316593_10006586 | 3300032168 | Bacteria | 3144 |
| 620 | Ga0316593_10013817 | 3300032168 | Bacteria | 2397 |
| 621 | Ga0316593_10041091 | 3300032168 | Unclassified | 1538 |
| 622 | Ga0316593_10086986 | 3300032168 | Bacteria | 1097 |
| 623 | Ga0307507_10251428 | 3300033179 | Bacteria | 1141 |
| 624 | Ga0307510_10004362 | 3300033180 | Bacteria | 16655 |
| 625 | Ga0307510_10007103 | 3300033180 | Bacteria | 13338 |
| 626 | Ga0307510_10170337 | 3300033180 | Bacteria | 1757 |
| 627 | Ga0316587_1002653 | 3300033529 | Bacteria | 2416 |
| 628 | Ga0373930_0005560 | 3300034816 | Bacteria | 2101 |
| 629 | Ga0373950_0010626 | 3300034818 | Bacteria | 1491 |
| 630 | Ga0373950_0106964 | 3300034818 | Bacteria | 607 |
| 631 | Ga0373958_0043208 | 3300034819 | Bacteria | 928 |
| 632 | Ga0373938_0081421 | 3300034957 | Bacteria | 789 |
| 633 | Ga0373928_0006702 | 3300035084 | Bacteria | 2217 |
| 634 | Ga0373928_0014117 | 3300035084 | Bacteria | 1611 |
| 635 | Ga0373934_0231771 | 3300035086 | Bacteria | 762 |
| 636 | Ga0373940_0020375 | 3300035088 | Bacteria | 1684 |
| 637 | Ga0373940_0058359 | 3300035088 | Bacteria | 1098 |
| 638 | Ga0373944_0054881 | 3300035089 | Bacteria | 1265 |
| 639 | Ga0373949_0012100 | 3300035090 | Bacteria | 1906 |
| 640 | Ga0373952_0035000 | 3300035092 | Bacteria | 1135 |
| 641 | Ga0373932_0005424 | 3300035112 | Bacteria | 2999 |
| 642 | Ga0373939_0060359 | 3300035114 | Bacteria | 1205 |
| 643 | Ga0373939_0060793 | 3300035114 | Bacteria | 1202 |
| 644 | Ga0373939_0111111 | 3300035114 | Bacteria | 954 |
| 645 | Ga0373945_0054060 | 3300035116 | Bacteria | 1484 |
| 646 | Ga0373953_0092485 | 3300035117 | Bacteria | 1266 |
| 647 | Ga0373954_0006461 | 3300035118 | Bacteria | 5112 |
| 648 | Ga0373954_0022248 | 3300035118 | Bacteria | 2874 |
| 649 | Ga0373954_0270649 | 3300035118 | Bacteria | 837 |
| 650 | Ga0373956_0502738 | 3300035119 | Bacteria | 578 |
| 651 | Ga0373960_0164703 | 3300035121 | Bacteria | 765 |
| 652 | Ga0373943_0051985 | 3300035170 | Bacteria | 2019 |
| 653 | Ga0373946_0289354 | 3300035171 | Bacteria | 808 |
| 654 | Ga0373955_0113976 | 3300035172 | Bacteria | 1565 |
| 655 | Ga0373942_0000734 | 3300035207 | Bacteria | 9045 |
| 656 | Ga0373942_0001974 | 3300035207 | Bacteria | 5122 |
| 657 | Ga0373942_0071824 | 3300035207 | Bacteria | 1012 |
| 658 | Ga0373961_0017929 | 3300035241 | Bacteria | 1843 |
| 659 | Ga0373961_0059455 | 3300035241 | Bacteria | 1156 |
| 660 | Ga0373962_0084741 | 3300035242 | Bacteria | 967 |
| 661 | Ga0316574_0047043 | 3300035398 | Bacteria | 2677 |
| 662 | Ga0373924_0018981 | 3300035410 | Bacteria | 2659 |
| 663 | Ga0373924_0071339 | 3300035410 | Bacteria | 1466 |
| 664 | Ga0373931_0001134 | 3300035691 | Bacteria | 11315 |
| 665 | Ga0373931_0021651 | 3300035691 | Bacteria | 3226 |
| 666 | Ga0373931_0027208 | 3300035691 | Bacteria | 2918 |
| 667 | Ga0373931_0181112 | 3300035691 | Bacteria | 1248 |
| 668 | Ga0373931_0204860 | 3300035691 | Bacteria | 1180 |
| 669 | Ga0373927_0597852 | 3300035695 | Bacteria | 729 |
| 670 | Ga0373933_0058049 | 3300035724 | Bacteria | 2327 |
| 671 | Ga0373933_0434936 | 3300035724 | Bacteria | 857 |
| 672 | Ga0373947_0121761 | 3300035725 | Bacteria | 1658 |
| 673 | Ga0373947_0499542 | 3300035725 | Bacteria | 826 |
| 674 | Ga0373947_0653299 | 3300035725 | Bacteria | 717 |
| 675 | Ga0373937_0059039 | 3300036401 | Bacteria | 3525 |
| 676 | Ga0373937_0133691 | 3300036401 | Bacteria | 2318 |
| 677 | Ga0373937_0335080 | 3300036401 | Bacteria | 1432 |
| 678 | Ga0373937_0677445 | 3300036401 | Bacteria | 977 |
| 679 | Ga0373937_1717498 | 3300036401 | Bacteria | 574 |
| 680 | Ga0316582_0001711 | 3300036647 | Bacteria | 9862 |
| 681 | Ga0316582_0027613 | 3300036647 | Bacteria | 3430 |
| 682 | Ga0316582_0028351 | 3300036647 | Bacteria | 3391 |
| 683 | Ga0316582_0762528 | 3300036647 | Bacteria | 664 |
| 684 | Ga0316584_0058622 | 3300036712 | Bacteria | 2882 |
| 685 | Ga0373925_0014054 | 3300037068 | Bacteria | 5795 |
| 686 | Ga0373925_0067472 | 3300037068 | Bacteria | 2698 |
| 687 | Ga0395898_0397175 | 3300037466 | Bacteria | 1315 |
| 688 | Ga0395905_0003363 | 3300037471 | Bacteria | 17143 |
| 689 | Ga0395905_0053119 | 3300037471 | Bacteria | 3793 |
| 690 | Ga0316581_0003897 | 3300037588 | Bacteria | 3760 |
| 691 | Ga0316581_0006691 | 3300037588 | Bacteria | 3063 |
| 692 | Ga0316581_0012161 | 3300037588 | Unclassified | 2420 |
| 693 | Ga0395901_0120274 | 3300038443 | Bacteria | 2760 |
| 694 | Ga0395901_0143025 | 3300038443 | Unclassified | 2514 |
| 695 | Ga0400487_14684 | 3300039110 | Bacteria | 7573 |
| 696 | Ga0436365_0033031 | 3300039437 | Bacteria | 1437 |
| 697 | Ga0436365_0697613 | 3300039437 | Bacteria | 3925 |
| 698 | Ga0436365_1034743 | 3300039437 | Bacteria | 797 |
| 699 | Ga0436363_0285240 | 3300039450 | Bacteria | 5060 |
| 700 | Ga0451839_1414179 | 3300041496 | Bacteria | 1104 |
| 701 | Ga0451851_1082858 | 3300041507 | Bacteria | 893 |
| 702 | Ga0451843_0111968 | 3300041509 | Bacteria | 648 |
| 703 | Ga0450891_019829 | 3300042129 | Bacteria | 656 |
| 704 | Ga0439464_0003009 | 3300042439 | Bacteria | 4216 |
| 705 | Ga0439460_0071839 | 3300042461 | Bacteria | 1073 |
| 706 | Ga0451577_0006056 | 3300042876 | Bacteria | 12164 |
| 707 | Ga0451577_0057264 | 3300042876 | Bacteria | 3475 |
| 708 | Ga0451577_0085436 | 3300042876 | Bacteria | 2815 |
| 709 | Ga0451577_0665218 | 3300042876 | Bacteria | 944 |
| 710 | Ga0466972_0007540 | 3300044658 | Bacteria | 5461 |
| 711 | Ga0453683_0002919 | 3300044673 | Bacteria | 12916 |
| 712 | Ga0466965_0003754 | 3300044683 | Bacteria | 6704 |
| 713 | Ga0466966_0095143 | 3300044684 | Bacteria | 1846 |
| 714 | Ga0466964_0012646 | 3300044706 | Bacteria | 3196 |
| 715 | Ga0453684_0023590 | 3300044712 | Bacteria | 9046 |
| 716 | Ga0453684_0745692 | 3300044712 | Bacteria | 1060 |
| 717 | Ga0466968_0038679 | 3300044735 | Bacteria | 2005 |
| 718 | Ga0466957_0092227 | 3300044842 | Bacteria | 1899 |
| 719 | Ga0466960_0353715 | 3300044901 | Bacteria | 838 |
| 720 | Ga0466959_0235540 | 3300045049 | Bacteria | 1266 |
| 721 | Ga0451576_0002906 | 3300045051 | Bacteria | 24460 |
| 722 | Ga0451576_0009861 | 3300045051 | Bacteria | 11034 |
| 723 | Ga0451576_0085191 | 3300045051 | Bacteria | 3287 |
| 724 | Ga0451576_0092916 | 3300045051 | Bacteria | 3137 |
| 725 | Ga0451576_0094792 | 3300045051 | Bacteria | 3104 |
| 726 | Ga0451576_0107944 | 3300045051 | Bacteria | 2896 |
| 727 | Ga0495617_015763 | 3300046452 | Bacteria | 2558 |
| 728 | Ga0495592_0000441 | 3300046454 | Bacteria | 31137 |
| 729 | Ga0495592_0043831 | 3300046454 | Bacteria | 3345 |
| 730 | Ga0495592_0213900 | 3300046454 | Bacteria | 1293 |
| 731 | Ga0495592_0306907 | 3300046454 | Bacteria | 1030 |
| 732 | Ga0495592_0505759 | 3300046454 | Bacteria | 749 |
| 733 | Ga0495603_0148969 | 3300046455 | Bacteria | 1360 |
| 734 | Ga0495629_0037403 | 3300046459 | Bacteria | 3421 |
| 735 | Ga0495629_0519138 | 3300046459 | Bacteria | 802 |
| 736 | Ga0495638_0098481 | 3300046460 | Bacteria | 1752 |
| 737 | Ga0495641_0413046 | 3300046461 | Bacteria | 613 |
| 738 | Ga0495650_0000100 | 3300046471 | Bacteria | 213752 |
| 739 | Ga0495650_0005611 | 3300046471 | Bacteria | 8081 |
| 740 | Ga0495650_0009592 | 3300046471 | Bacteria | 5492 |
| 741 | Ga0495580_0118662 | 3300046472 | Bacteria | 1837 |
| 742 | Ga0495580_0130877 | 3300046472 | Bacteria | 1740 |
| 743 | Ga0495664_0188941 | 3300046477 | Bacteria | 1249 |
| 744 | Ga0495664_0321182 | 3300046477 | Bacteria | 934 |
| 745 | Ga0495607_0010628 | 3300046501 | Bacteria | 6175 |
| 746 | Ga0495583_0223199 | 3300046506 | Bacteria | 761 |
| 747 | Ga0495610_0002542 | 3300046512 | Bacteria | 15193 |
| 748 | Ga0495610_0148713 | 3300046512 | Bacteria | 1001 |
| 749 | Ga0495620_0056590 | 3300046515 | Bacteria | 1649 |
| 750 | Ga0495620_0151272 | 3300046515 | Bacteria | 905 |
| 751 | Ga0495630_0185078 | 3300046517 | Bacteria | 1589 |
| 752 | Ga0495630_0270923 | 3300046517 | Bacteria | 1297 |
| 753 | Ga0495630_0442430 | 3300046517 | Bacteria | 996 |
| 754 | Ga0495648_0050687 | 3300046524 | Bacteria | 2534 |
| 755 | Ga0495648_0138814 | 3300046524 | Bacteria | 1282 |
| 756 | Ga0495648_0224127 | 3300046524 | Bacteria | 925 |
| 757 | Ga0495666_0048287 | 3300046526 | Bacteria | 2050 |
| 758 | Ga0495666_0176388 | 3300046526 | Bacteria | 988 |
| 759 | Ga0495587_0095102 | 3300046536 | Bacteria | 1720 |
| 760 | Ga0495598_0109114 | 3300046537 | Bacteria | 925 |
| 761 | Ga0495621_0010584 | 3300046539 | Bacteria | 2827 |
| 762 | Ga0495621_0084548 | 3300046539 | Bacteria | 1188 |
| 763 | Ga0495621_0218102 | 3300046539 | Bacteria | 771 |
| 764 | Ga0495621_0261997 | 3300046539 | Bacteria | 708 |
| 765 | Ga0495645_0060913 | 3300046543 | Bacteria | 2735 |
| 766 | Ga0495645_0217869 | 3300046543 | Bacteria | 1285 |
| 767 | Ga0495633_0005786 | 3300046558 | Bacteria | 7459 |
| 768 | Ga0495667_0247374 | 3300046559 | Bacteria | 1135 |
| 769 | Ga0495667_0286252 | 3300046559 | Bacteria | 1046 |
| 770 | Ga0495667_0341937 | 3300046559 | Bacteria | 946 |
| 771 | Ga0495656_0129656 | 3300046615 | Bacteria | 1199 |
| 772 | Ga0495668_0000286 | 3300046616 | Bacteria | 69771 |
| 773 | Ga0495668_0002018 | 3300046616 | Bacteria | 17721 |
| 774 | Ga0495625_0082170 | 3300046660 | Bacteria | 2241 |
| 775 | Ga0495635_0148354 | 3300046663 | Bacteria | 1597 |
| 776 | Ga0495599_0032970 | 3300046678 | Bacteria | 3253 |
| 777 | Ga0495623_0322318 | 3300046679 | Bacteria | 848 |
| 778 | Ga0495647_0028086 | 3300046681 | Bacteria | 2073 |
| 779 | Ga0495658_0047962 | 3300046683 | Bacteria | 2407 |
| 780 | Ga0495658_0060024 | 3300046683 | Bacteria | 2180 |
| 781 | Ga0495658_0107937 | 3300046683 | Bacteria | 1670 |
| 782 | Ga0495658_0123515 | 3300046683 | Bacteria | 1568 |
| 783 | Ga0495658_0218137 | 3300046683 | Bacteria | 1193 |
| 784 | Ga0495613_0448882 | 3300046689 | Bacteria | 874 |
| 785 | Ga0495624_0005244 | 3300046690 | Bacteria | 9361 |
| 786 | Ga0495649_0118313 | 3300046694 | Bacteria | 1402 |
| 787 | Ga0495649_0153993 | 3300046694 | Bacteria | 1207 |
| 788 | Ga0495649_0276938 | 3300046694 | Bacteria | 858 |
| 789 | Ga0495600_0167314 | 3300046809 | Bacteria | 1420 |
| 790 | Ga0495600_0349362 | 3300046809 | Bacteria | 926 |
| 791 | Ga0495674_0312052 | 3300047319 | Bacteria | 1283 |
| 792 | Ga0495674_0703450 | 3300047319 | Bacteria | 793 |
| 793 | Ga0495676_0071019 | 3300047321 | Bacteria | 2678 |
| 794 | Ga0495676_0429143 | 3300047321 | Bacteria | 874 |
| 795 | Ga0495680_0126817 | 3300047322 | Bacteria | 1879 |
| 796 | Ga0495680_0394147 | 3300047322 | Bacteria | 957 |
| 797 | Ga0495673_0000080 | 3300047469 | Bacteria | 201831 |
| 798 | Ga0495673_0066497 | 3300047469 | Bacteria | 1528 |
| 799 | Ga0495684_0214199 | 3300047471 | Bacteria | 1415 |
| 800 | Ga0495684_0763164 | 3300047471 | Bacteria | 635 |
| 801 | Ga0495686_0005098 | 3300047472 | Bacteria | 10503 |
| 802 | Ga0495593_0052778 | 3300047673 | Bacteria | 2147 |
| 803 | Ga0495626_0048760 | 3300048091 | Bacteria | 1964 |
| 804 | Ga0496100_0605059 | 3300048903 | Bacteria | 851 |
| 805 | Ga0496101_0019596 | 3300048904 | Bacteria | 4621 |
| 806 | Ga0496101_0103838 | 3300048904 | Bacteria | 2131 |
| 807 | Ga0496102_0011369 | 3300048905 | Bacteria | 7671 |
| 808 | Ga0496102_0037417 | 3300048905 | Bacteria | 4378 |
| 809 | Ga0496103_0378785 | 3300048906 | Bacteria | 909 |
| 810 | Ga0496104_0051283 | 3300048907 | Bacteria | 3894 |
| 811 | Ga0496104_0768246 | 3300048907 | Bacteria | 870 |
| 812 | Ga0496105_0108099 | 3300048908 | Bacteria | 2296 |
| 813 | Ga0496105_0300546 | 3300048908 | Bacteria | 1290 |
| 814 | Ga0496105_0833301 | 3300048908 | Bacteria | 699 |
| 815 | Ga0496106_0042882 | 3300048909 | Bacteria | 3393 |
| 816 | Ga0496106_0693557 | 3300048909 | Bacteria | 812 |
| 817 | Ga0496106_1275042 | 3300048909 | Bacteria | 571 |
| 818 | Ga0496107_0015263 | 3300048910 | Bacteria | 5383 |
| 819 | Ga0496107_0164021 | 3300048910 | Bacteria | 1647 |
| 820 | Ga0496108_0071263 | 3300048911 | Bacteria | 2932 |
| 821 | Ga0496108_0497998 | 3300048911 | Bacteria | 1064 |
| 822 | Ga0496109_0122624 | 3300048912 | Bacteria | 2421 |
| 823 | Ga0496109_0130713 | 3300048912 | Bacteria | 2343 |
| 824 | Ga0496110_0098506 | 3300048913 | Bacteria | 2620 |
| 825 | Ga0496110_0342255 | 3300048913 | Bacteria | 1362 |
| 826 | Ga0496110_0535288 | 3300048913 | Bacteria | 1065 |
| 827 | Ga0496110_1364294 | 3300048913 | Bacteria | 618 |
| 828 | Ga0496111_0046517 | 3300048914 | Bacteria | 3124 |
| 829 | Ga0496112_0111756 | 3300048915 | Bacteria | 2702 |
| 830 | Ga0496112_0285050 | 3300048915 | Bacteria | 1598 |
| 831 | Ga0496112_0490455 | 3300048915 | Bacteria | 1165 |
| 832 | Ga0496113_0022247 | 3300048916 | Bacteria | 4482 |
| 833 | Ga0496113_0104759 | 3300048916 | Bacteria | 2195 |
| 834 | Ga0496114_0023038 | 3300048917 | Bacteria | 5077 |
| 835 | Ga0496114_0189226 | 3300048917 | Bacteria | 1800 |
| 836 | Ga0496115_0056268 | 3300048918 | Bacteria | 3161 |
| 837 | Ga0496116_0007031 | 3300048919 | Bacteria | 10075 |
| 838 | Ga0496124_0090236 | 3300048927 | Bacteria | 2500 |
| 839 | Ga0496124_0146409 | 3300048927 | Bacteria | 1858 |
| 840 | Ga0496125_0105200 | 3300048928 | Bacteria | 2063 |
| 841 | Ga0501300_008030 | 3300049523 | Bacteria | 1547 |
| 842 | Ga0501031_0018528 | 3300049568 | Bacteria | 4532 |
| 843 | Ga0501034_0623081 | 3300049571 | Bacteria | 983 |
| 844 | Ga0501036_0040574 | 3300049572 | Bacteria | 3937 |
| 845 | Ga0501037_0109148 | 3300049573 | Bacteria | 1994 |
| 846 | Ga0501046_0161765 | 3300049580 | Bacteria | 1683 |
| 847 | Ga0501047_0006119 | 3300049581 | Bacteria | 11307 |
| 848 | Ga0501048_0035242 | 3300049582 | Bacteria | 3603 |
| 849 | Ga0501048_0327910 | 3300049582 | Bacteria | 1091 |
| 850 | Ga0501069_0004773 | 3300049585 | Bacteria | 7015 |
| 851 | Ga0501070_0070069 | 3300049586 | Bacteria | 2903 |
| 852 | Ga0501072_0247331 | 3300049588 | Bacteria | 1420 |
| 853 | Ga0501073_0006933 | 3300049589 | Bacteria | 8435 |
| 854 | Ga0501074_0000154 | 3300049590 | Bacteria | 35857 |
| 855 | Ga0501228_005417 | 3300049666 | Unclassified | 1132 |
| 856 | Ga0501239_007686 | 3300049672 | Bacteria | 1135 |
| 857 | Ga0501225_0110888 | 3300049705 | Bacteria | 809 |
| 858 | Ga0501079_0064641 | 3300049741 | Bacteria | 2822 |
| 859 | Ga0501080_0005032 | 3300049742 | Bacteria | 11775 |
| 860 | Ga0501083_0000323 | 3300049744 | Bacteria | 30331 |
| 861 | Ga0501265_002194 | 3300049762 | Bacteria | 2218 |
| 862 | Ga0501280_002828 | 3300049776 | Bacteria | 2793 |
| 863 | Ga0501035_0605827 | 3300049822 | Bacteria | 892 |
| 864 | Ga0501044_0028237 | 3300049823 | Bacteria | 5923 |
| 865 | Ga0501045_0666890 | 3300049824 | Bacteria | 768 |
| 866 | nmdc:mga0k408_20345_c2 | 3300050493 | Bacteria | 3304 |
| 867 | nmdc:mga0k408_71394_c1 | 3300050493 | Bacteria | 2027 |
| 868 | nmdc:mga06z11_24806_c1 | 3300050494 | Bacteria | 2834 |
| 869 | nmdc:mga04h51_118168_c1 | 3300050495 | Bacteria | 985 |
| 870 | nmdc:mga07m45_114227_c1 | 3300050496 | Bacteria | 1557 |
| 871 | nmdc:mga05p37_3648_c1 | 3300050507 | Bacteria | 18007 |
| 872 | nmdc:mga09592_6251_c1 | 3300050508 | Bacteria | 9700 |
| 873 | nmdc:mga09592_970944_c1 | 3300050508 | Bacteria | 711 |
| 874 | nmdc:mga06r32_1508637_c1 | 3300050510 | Bacteria | 612 |
| 875 | nmdc:mga06r32_37367_c1 | 3300050510 | Bacteria | 4593 |
| 876 | nmdc:mga08y16_10350_c1 | 3300050511 | Bacteria | 9791 |
| 877 | nmdc:mga08y16_386_c1 | 3300050511 | Bacteria | 40374 |
| 878 | nmdc:mga08y16_396818_c1 | 3300050511 | Bacteria | 1412 |
| 879 | nmdc:mga0rr50_443265_c1 | 3300050513 | Bacteria | 1100 |
| 880 | nmdc:mga08x19_148984_c1 | 3300050514 | Bacteria | 1583 |
| 881 | nmdc:mga0a205_238006_c1 | 3300050515 | Bacteria | 1702 |
| 882 | nmdc:mga0a205_366208_c1 | 3300050515 | Bacteria | 1307 |
| 883 | nmdc:mga0a205_597109_c1 | 3300050515 | Bacteria | 957 |
| 884 | Ga0495601_0171470 | 3300053077 | Bacteria | 1418 |
| 885 | Ga0495601_0345695 | 3300053077 | Bacteria | 967 |
| 886 | Ga0495612_0111179 | 3300053078 | Bacteria | 1173 |
| 887 | Ga0495595_0364007 | 3300053084 | Bacteria | 731 |
| 888 | Ga0495619_0089451 | 3300053085 | Bacteria | 2083 |
| 889 | Ga0495619_0152669 | 3300053085 | Bacteria | 1593 |
| 890 | Ga0500578_0173163 | 3300053086 | Bacteria | 1334 |
| 891 | Ga0500644_0040479 | 3300053088 | Bacteria | 1542 |
| 892 | Ga0500583_0140249 | 3300053092 | Bacteria | 1201 |
| 893 | Ga0500651_0117401 | 3300053093 | Bacteria | 1618 |
| 894 | Ga0500593_015808 | 3300053117 | Bacteria | 3259 |
| 895 | Ga0500594_0018882 | 3300053118 | Bacteria | 1703 |
| 896 | Ga0500618_069032 | 3300053125 | Bacteria | 793 |
| 897 | Ga0500652_062352 | 3300053131 | Bacteria | 1537 |
| 898 | Ga0500655_011256 | 3300053133 | Bacteria | 1619 |
| 899 | Ga0500559_0000138 | 3300053136 | Bacteria | 56620 |
| 900 | Ga0500568_0125805 | 3300053139 | Bacteria | 954 |
| 901 | Ga0500619_154586 | 3300053154 | Bacteria | 779 |
| 902 | Ga0500622_0027122 | 3300053156 | Bacteria | 3020 |
| 903 | Ga0500636_0041980 | 3300053177 | Bacteria | 2705 |
| 904 | Ga0500645_008228 | 3300053730 | Bacteria | 3577 |
| 905 | Ga0500587_002360 | 3300053739 | Bacteria | 2681 |
| 906 | Ga0500587_031393 | 3300053739 | Bacteria | 731 |
| 907 | Ga0501084_0112102 | 3300054114 | Bacteria | 2292 |
| 908 | Ga0590071_026118 | 3300059421 | Bacteria | 1385 |
| 909 | Ga0501082_0060312 | 3300060353 | Bacteria | 3267 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050514 | nmdc:mga08x19_148984_c1 | nmdc:mga08x19_148984_c1_183_713 | 162 |
| 2 | 3300005468 | Ga0070707_100323745 | Ga0070707_1003237452 | 163 |
| 3 | 3300005445 | Ga0070708_100054134 | Ga0070708_1000541344 | 164 |
| 4 | 3300005467 | Ga0070706_100001448 | Ga0070706_10000144828 | 164 |
| 5 | 3300005471 | Ga0070698_100030267 | Ga0070698_1000302672 | 164 |
| 6 | 3300006042 | Ga0075368_10105044 | Ga0075368_101050442 | 164 |
| 7 | 3300006178 | Ga0075367_10007169 | Ga0075367_100071694 | 164 |
| 8 | 3300006195 | Ga0075366_10057252 | Ga0075366_100572522 | 164 |
| 9 | 3300006353 | Ga0075370_10040382 | Ga0075370_100403822 | 164 |
| 10 | 3300025910 | Ga0207684_10002129 | Ga0207684_1000212919 | 164 |
| 11 | 3300027866 | Ga0209813_10100218 | Ga0209813_101002182 | 164 |
| 12 | 3300050493 | nmdc:mga0k408_71394_c1 | nmdc:mga0k408_71394_c1_1226_1804 | 164 |
| 13 | 3300050494 | nmdc:mga06z11_24806_c1 | nmdc:mga06z11_24806_c1_2055_2633 | 164 |
| 14 | 3300050495 | nmdc:mga04h51_118168_c1 | nmdc:mga04h51_118168_c1_229_807 | 164 |
| 15 | 3300050496 | nmdc:mga07m45_114227_c1 | nmdc:mga07m45_114227_c1_581_1159 | 164 |
| 16 | 3300005518 | Ga0070699_100136837 | Ga0070699_1001368373 | 165 |
| 17 | 3300005337 | Ga0070682_100029929 | Ga0070682_1000299292 | 171 |
| 18 | 3300005440 | Ga0070705_101430343 | Ga0070705_1014303431 | 171 |
| 19 | 3300005444 | Ga0070694_100960509 | Ga0070694_1009605091 | 171 |
| 20 | 3300006237 | Ga0097621_100786467 | Ga0097621_1007864671 | 171 |
| 21 | 3300009094 | Ga0111539_10047083 | Ga0111539_100470832 | 171 |
| 22 | 3300014326 | Ga0157380_10022945 | Ga0157380_100229455 | 171 |
| 23 | 3300014968 | Ga0157379_12186961 | Ga0157379_121869611 | 171 |
| 24 | 3300031691 | Ga0316579_10018004 | Ga0316579_100180042 | 171 |
| 25 | 3300031691 | Ga0316579_10087313 | Ga0316579_100873132 | 171 |
| 26 | 3300032133 | Ga0316583_10071211 | Ga0316583_100712112 | 171 |
| 27 | 3300032168 | Ga0316593_10041091 | Ga0316593_100410911 | 171 |
| 28 | 3300032168 | Ga0316593_10086986 | Ga0316593_100869861 | 171 |
| 29 | 3300036647 | Ga0316582_0762528 | Ga0316582_0762528_92_616 | 171 |
| 30 | 3300037588 | Ga0316581_0012161 | Ga0316581_0012161_819_1343 | 171 |
| 31 | iso_pu_bacteria | 2643221660 | 2644340343 | 171 |
| 32 | 3300005518 | Ga0070699_100810224 | Ga0070699_1008102242 | 172 |
| 33 | 3300005536 | Ga0070697_100014972 | Ga0070697_1000149722 | 172 |
| 34 | 3300005617 | Ga0068859_100325184 | Ga0068859_1003251842 | 172 |
| 35 | 3300006173 | Ga0070716_100008353 | Ga0070716_1000083532 | 172 |
| 36 | 3300006173 | Ga0070716_100766110 | Ga0070716_1007661102 | 172 |
| 37 | 3300006237 | Ga0097621_100132153 | Ga0097621_1001321533 | 172 |
| 38 | 3300006358 | Ga0068871_100032966 | Ga0068871_1000329663 | 172 |
| 39 | 3300006846 | Ga0075430_100100678 | Ga0075430_1001006782 | 172 |
| 40 | 3300006880 | Ga0075429_100006162 | Ga0075429_1000061629 | 172 |
| 41 | 3300006931 | Ga0097620_100325184 | Ga0097620_1003251842 | 172 |
| 42 | 3300007265 | Ga0099794_10011178 | Ga0099794_100111784 | 172 |
| 43 | 3300010159 | Ga0099796_10190695 | Ga0099796_101906951 | 172 |
| 44 | 3300014326 | Ga0157380_10027585 | Ga0157380_100275853 | 172 |
| 45 | 3300014969 | Ga0157376_11544961 | Ga0157376_115449612 | 172 |
| 46 | 3300025939 | Ga0207665_10002235 | Ga0207665_100022353 | 172 |
| 47 | 3300026142 | Ga0207698_10051451 | Ga0207698_100514512 | 172 |
| 48 | 3300027671 | Ga0209588_1026138 | Ga0209588_10261383 | 172 |
| 49 | 3300027671 | Ga0209588_1092718 | Ga0209588_10927182 | 172 |
| 50 | 3300028666 | Ga0265336_10000129 | Ga0265336_1000012935 | 172 |
| 51 | 3300028666 | Ga0265336_10021839 | Ga0265336_100218392 | 172 |
| 52 | 3300029957 | Ga0265324_10000029 | Ga0265324_1000002946 | 172 |
| 53 | 3300029957 | Ga0265324_10018935 | Ga0265324_100189352 | 172 |
| 54 | 3300031241 | Ga0265325_10000207 | Ga0265325_1000020718 | 172 |
| 55 | 3300031250 | Ga0265331_10022387 | Ga0265331_100223872 | 172 |
| 56 | 3300031344 | Ga0265316_10124535 | Ga0265316_101245352 | 172 |
| 57 | 3300031711 | Ga0265314_10025679 | Ga0265314_100256793 | 172 |
| 58 | 3300035086 | Ga0373934_0231771 | Ga0373934_0231771_83_613 | 172 |
| 59 | 3300035118 | Ga0373954_0006461 | Ga0373954_0006461_2575_3102 | 172 |
| 60 | 3300035118 | Ga0373954_0022248 | Ga0373954_0022248_1335_1862 | 172 |
| 61 | 3300035119 | Ga0373956_0502738 | Ga0373956_0502738_16_546 | 172 |
| 62 | 3300035241 | Ga0373961_0017929 | Ga0373961_0017929_93_623 | 172 |
| 63 | 3300035691 | Ga0373931_0027208 | Ga0373931_0027208_2320_2850 | 172 |
| 64 | 3300036401 | Ga0373937_0677445 | Ga0373937_0677445_394_921 | 172 |
| 65 | 3300036401 | Ga0373937_1717498 | Ga0373937_1717498_28_558 | 172 |
| 66 | 3300039110 | Ga0400487_14684 | Ga0400487_14684_1046_1573 | 172 |
| 67 | 3300042876 | Ga0451577_0057264 | Ga0451577_0057264_1159_1686 | 172 |
| 68 | 3300042876 | Ga0451577_0085436 | Ga0451577_0085436_772_1308 | 172 |
| 69 | 3300045051 | Ga0451576_0002906 | Ga0451576_0002906_21759_22286 | 172 |
| 70 | 3300045051 | Ga0451576_0092916 | Ga0451576_0092916_576_1103 | 172 |
| 71 | 3300046454 | Ga0495592_0043831 | Ga0495592_0043831_1914_2441 | 172 |
| 72 | 3300046517 | Ga0495630_0270923 | Ga0495630_0270923_123_650 | 172 |
| 73 | 3300046536 | Ga0495587_0095102 | Ga0495587_0095102_664_1191 | 172 |
| 74 | 3300046559 | Ga0495667_0341937 | Ga0495667_0341937_214_744 | 172 |
| 75 | 3300046678 | Ga0495599_0032970 | Ga0495599_0032970_605_1132 | 172 |
| 76 | 3300046679 | Ga0495623_0322318 | Ga0495623_0322318_56_586 | 172 |
| 77 | 3300047322 | Ga0495680_0394147 | Ga0495680_0394147_367_894 | 172 |
| 78 | 3300047471 | Ga0495684_0763164 | Ga0495684_0763164_55_585 | 172 |
| 79 | 3300048905 | Ga0496102_0011369 | Ga0496102_0011369_5834_6358 | 172 |
| 80 | 3300049523 | Ga0501300_008030 | Ga0501300_008030_970_1497 | 172 |
| 81 | 3300049666 | Ga0501228_005417 | Ga0501228_005417_114_641 | 172 |
| 82 | 3300049776 | Ga0501280_002828 | Ga0501280_002828_1101_1628 | 172 |
| 83 | 3300050508 | nmdc:mga09592_6251_c1 | nmdc:mga09592_6251_c1_1308_1835 | 172 |
| 84 | 3300053117 | Ga0500593_015808 | Ga0500593_015808_1270_1794 | 172 |
| 85 | 3300059421 | Ga0590071_026118 | Ga0590071_026118_716_1249 | 172 |
| 86 | 3300005293 | Ga0065715_10174637 | Ga0065715_101746372 | 173 |
| 87 | 3300005295 | Ga0065707_10229911 | Ga0065707_102299112 | 173 |
| 88 | 3300005327 | Ga0070658_10085898 | Ga0070658_100858983 | 173 |
| 89 | 3300005327 | Ga0070658_10959302 | Ga0070658_109593022 | 173 |
| 90 | 3300005328 | Ga0070676_10010065 | Ga0070676_100100653 | 173 |
| 91 | 3300005328 | Ga0070676_10135391 | Ga0070676_101353912 | 173 |
| 92 | 3300005328 | Ga0070676_10238731 | Ga0070676_102387312 | 173 |
| 93 | 3300005328 | Ga0070676_10375122 | Ga0070676_103751222 | 173 |
| 94 | 3300005329 | Ga0070683_100778780 | Ga0070683_1007787802 | 173 |
| 95 | 3300005330 | Ga0070690_100114705 | Ga0070690_1001147052 | 173 |
| 96 | 3300005330 | Ga0070690_100506979 | Ga0070690_1005069792 | 173 |
| 97 | 3300005331 | Ga0070670_100001774 | Ga0070670_1000017744 | 173 |
| 98 | 3300005331 | Ga0070670_100037091 | Ga0070670_1000370913 | 173 |
| 99 | 3300005331 | Ga0070670_100126728 | Ga0070670_1001267283 | 173 |
| 100 | 3300005331 | Ga0070670_100134714 | Ga0070670_1001347142 | 173 |
| 101 | 3300005331 | Ga0070670_100200183 | Ga0070670_1002001833 | 173 |
| 102 | 3300005331 | Ga0070670_100278084 | Ga0070670_1002780842 | 173 |
| 103 | 3300005331 | Ga0070670_100625434 | Ga0070670_1006254342 | 173 |
| 104 | 3300005333 | Ga0070677_10007318 | Ga0070677_100073182 | 173 |
| 105 | 3300005333 | Ga0070677_10089341 | Ga0070677_100893413 | 173 |
| 106 | 3300005333 | Ga0070677_10335462 | Ga0070677_103354622 | 173 |
| 107 | 3300005334 | Ga0068869_100008578 | Ga0068869_1000085785 | 173 |
| 108 | 3300005334 | Ga0068869_100009021 | Ga0068869_1000090215 | 173 |
| 109 | 3300005335 | Ga0070666_10005482 | Ga0070666_100054824 | 173 |
| 110 | 3300005335 | Ga0070666_10008568 | Ga0070666_100085686 | 173 |
| 111 | 3300005335 | Ga0070666_10300134 | Ga0070666_103001342 | 173 |
| 112 | 3300005335 | Ga0070666_10323814 | Ga0070666_103238141 | 173 |
| 113 | 3300005335 | Ga0070666_10377329 | Ga0070666_103773292 | 173 |
| 114 | 3300005336 | Ga0070680_100120410 | Ga0070680_1001204102 | 173 |
| 115 | 3300005337 | Ga0070682_100824307 | Ga0070682_1008243071 | 173 |
| 116 | 3300005338 | Ga0068868_100016008 | Ga0068868_1000160082 | 173 |
| 117 | 3300005338 | Ga0068868_100043629 | Ga0068868_1000436293 | 173 |
| 118 | 3300005338 | Ga0068868_100142537 | Ga0068868_1001425372 | 173 |
| 119 | 3300005338 | Ga0068868_100614279 | Ga0068868_1006142792 | 173 |
| 120 | 3300005339 | Ga0070660_100200407 | Ga0070660_1002004072 | 173 |
| 121 | 3300005340 | Ga0070689_100051421 | Ga0070689_1000514212 | 173 |
| 122 | 3300005343 | Ga0070687_100034731 | Ga0070687_1000347312 | 173 |
| 123 | 3300005343 | Ga0070687_100350461 | Ga0070687_1003504612 | 173 |
| 124 | 3300005344 | Ga0070661_100217152 | Ga0070661_1002171522 | 173 |
| 125 | 3300005344 | Ga0070661_100395025 | Ga0070661_1003950252 | 173 |
| 126 | 3300005344 | Ga0070661_100669562 | Ga0070661_1006695622 | 173 |
| 127 | 3300005345 | Ga0070692_10188529 | Ga0070692_101885292 | 173 |
| 128 | 3300005345 | Ga0070692_10196477 | Ga0070692_101964772 | 173 |
| 129 | 3300005347 | Ga0070668_100007130 | Ga0070668_1000071305 | 173 |
| 130 | 3300005347 | Ga0070668_100008167 | Ga0070668_1000081674 | 173 |
| 131 | 3300005347 | Ga0070668_101174839 | Ga0070668_1011748392 | 173 |
| 132 | 3300005353 | Ga0070669_100001340 | Ga0070669_1000013409 | 173 |
| 133 | 3300005353 | Ga0070669_100077959 | Ga0070669_1000779592 | 173 |
| 134 | 3300005353 | Ga0070669_100082105 | Ga0070669_1000821053 | 173 |
| 135 | 3300005353 | Ga0070669_100106163 | Ga0070669_1001061632 | 173 |
| 136 | 3300005353 | Ga0070669_100877121 | Ga0070669_1008771212 | 173 |
| 137 | 3300005354 | Ga0070675_100002913 | Ga0070675_10000291314 | 173 |
| 138 | 3300005354 | Ga0070675_100014979 | Ga0070675_1000149792 | 173 |
| 139 | 3300005354 | Ga0070675_100045658 | Ga0070675_1000456585 | 173 |
| 140 | 3300005354 | Ga0070675_100061046 | Ga0070675_1000610464 | 173 |
| 141 | 3300005354 | Ga0070675_100061075 | Ga0070675_1000610752 | 173 |
| 142 | 3300005354 | Ga0070675_100245133 | Ga0070675_1002451332 | 173 |
| 143 | 3300005354 | Ga0070675_100368617 | Ga0070675_1003686172 | 173 |
| 144 | 3300005355 | Ga0070671_100009693 | Ga0070671_1000096937 | 173 |
| 145 | 3300005355 | Ga0070671_100039335 | Ga0070671_1000393352 | 173 |
| 146 | 3300005355 | Ga0070671_100049845 | Ga0070671_1000498452 | 173 |
| 147 | 3300005355 | Ga0070671_100066223 | Ga0070671_1000662232 | 173 |
| 148 | 3300005355 | Ga0070671_100099621 | Ga0070671_1000996212 | 173 |
| 149 | 3300005355 | Ga0070671_100533158 | Ga0070671_1005331582 | 173 |
| 150 | 3300005356 | Ga0070674_100013491 | Ga0070674_1000134916 | 173 |
| 151 | 3300005356 | Ga0070674_100210755 | Ga0070674_1002107552 | 173 |
| 152 | 3300005356 | Ga0070674_100222853 | Ga0070674_1002228531 | 173 |
| 153 | 3300005364 | Ga0070673_100000512 | Ga0070673_10000051220 | 173 |
| 154 | 3300005364 | Ga0070673_100075466 | Ga0070673_1000754664 | 173 |
| 155 | 3300005364 | Ga0070673_100138585 | Ga0070673_1001385852 | 173 |
| 156 | 3300005364 | Ga0070673_100186331 | Ga0070673_1001863313 | 173 |
| 157 | 3300005364 | Ga0070673_101321070 | Ga0070673_1013210701 | 173 |
| 158 | 3300005365 | Ga0070688_100092460 | Ga0070688_1000924601 | 173 |
| 159 | 3300005366 | Ga0070659_100089809 | Ga0070659_1000898092 | 173 |
| 160 | 3300005366 | Ga0070659_100234621 | Ga0070659_1002346212 | 173 |
| 161 | 3300005367 | Ga0070667_100000219 | Ga0070667_10000021918 | 173 |
| 162 | 3300005367 | Ga0070667_100004388 | Ga0070667_1000043887 | 173 |
| 163 | 3300005367 | Ga0070667_100006263 | Ga0070667_1000062638 | 173 |
| 164 | 3300005367 | Ga0070667_100116780 | Ga0070667_1001167802 | 173 |
| 165 | 3300005367 | Ga0070667_100407910 | Ga0070667_1004079102 | 173 |
| 166 | 3300005435 | Ga0070714_100713512 | Ga0070714_1007135122 | 173 |
| 167 | 3300005436 | Ga0070713_100000028 | Ga0070713_10000002851 | 173 |
| 168 | 3300005436 | Ga0070713_100026620 | Ga0070713_1000266205 | 173 |
| 169 | 3300005436 | Ga0070713_100070549 | Ga0070713_1000705492 | 173 |
| 170 | 3300005438 | Ga0070701_10110217 | Ga0070701_101102171 | 173 |
| 171 | 3300005455 | Ga0070663_100144025 | Ga0070663_1001440252 | 173 |
| 172 | 3300005455 | Ga0070663_100596414 | Ga0070663_1005964142 | 173 |
| 173 | 3300005456 | Ga0070678_100004036 | Ga0070678_1000040368 | 173 |
| 174 | 3300005456 | Ga0070678_100015086 | Ga0070678_1000150866 | 173 |
| 175 | 3300005456 | Ga0070678_100165208 | Ga0070678_1001652082 | 173 |
| 176 | 3300005456 | Ga0070678_100216738 | Ga0070678_1002167382 | 173 |
| 177 | 3300005456 | Ga0070678_100488605 | Ga0070678_1004886052 | 173 |
| 178 | 3300005456 | Ga0070678_100661813 | Ga0070678_1006618132 | 173 |
| 179 | 3300005457 | Ga0070662_100008433 | Ga0070662_1000084335 | 173 |
| 180 | 3300005457 | Ga0070662_100016652 | Ga0070662_1000166525 | 173 |
| 181 | 3300005457 | Ga0070662_100172931 | Ga0070662_1001729311 | 173 |
| 182 | 3300005457 | Ga0070662_100225535 | Ga0070662_1002255351 | 173 |
| 183 | 3300005457 | Ga0070662_100575486 | Ga0070662_1005754862 | 173 |
| 184 | 3300005458 | Ga0070681_10063643 | Ga0070681_100636432 | 173 |
| 185 | 3300005458 | Ga0070681_10522094 | Ga0070681_105220942 | 173 |
| 186 | 3300005458 | Ga0070681_10975496 | Ga0070681_109754961 | 173 |
| 187 | 3300005459 | Ga0068867_100011339 | Ga0068867_1000113395 | 173 |
| 188 | 3300005459 | Ga0068867_100015106 | Ga0068867_1000151067 | 173 |
| 189 | 3300005459 | Ga0068867_100292330 | Ga0068867_1002923302 | 173 |
| 190 | 3300005459 | Ga0068867_100774755 | Ga0068867_1007747552 | 173 |
| 191 | 3300005466 | Ga0070685_10705933 | Ga0070685_107059332 | 173 |
| 192 | 3300005467 | Ga0070706_100326532 | Ga0070706_1003265322 | 173 |
| 193 | 3300005468 | Ga0070707_100704259 | Ga0070707_1007042591 | 173 |
| 194 | 3300005530 | Ga0070679_100058970 | Ga0070679_1000589702 | 173 |
| 195 | 3300005535 | Ga0070684_100009252 | Ga0070684_1000092527 | 173 |
| 196 | 3300005535 | Ga0070684_100191604 | Ga0070684_1001916042 | 173 |
| 197 | 3300005539 | Ga0068853_100082726 | Ga0068853_1000827263 | 173 |
| 198 | 3300005539 | Ga0068853_100377273 | Ga0068853_1003772732 | 173 |
| 199 | 3300005539 | Ga0068853_100495111 | Ga0068853_1004951112 | 173 |
| 200 | 3300005539 | Ga0068853_101111483 | Ga0068853_1011114831 | 173 |
| 201 | 3300005539 | Ga0068853_101276310 | Ga0068853_1012763101 | 173 |
| 202 | 3300005539 | Ga0068853_101637011 | Ga0068853_1016370111 | 173 |
| 203 | 3300005543 | Ga0070672_100002366 | Ga0070672_1000023662 | 173 |
| 204 | 3300005543 | Ga0070672_100025703 | Ga0070672_1000257035 | 173 |
| 205 | 3300005543 | Ga0070672_100029191 | Ga0070672_1000291914 | 173 |
| 206 | 3300005543 | Ga0070672_100066644 | Ga0070672_1000666443 | 173 |
| 207 | 3300005543 | Ga0070672_100128821 | Ga0070672_1001288212 | 173 |
| 208 | 3300005544 | Ga0070686_100152088 | Ga0070686_1001520882 | 173 |
| 209 | 3300005547 | Ga0070693_100070359 | Ga0070693_1000703592 | 173 |
| 210 | 3300005547 | Ga0070693_100151701 | Ga0070693_1001517012 | 173 |
| 211 | 3300005548 | Ga0070665_100108558 | Ga0070665_1001085581 | 173 |
| 212 | 3300005548 | Ga0070665_100245877 | Ga0070665_1002458772 | 173 |
| 213 | 3300005549 | Ga0070704_100239853 | Ga0070704_1002398533 | 173 |
| 214 | 3300005563 | Ga0068855_100019481 | Ga0068855_1000194818 | 173 |
| 215 | 3300005563 | Ga0068855_100050674 | Ga0068855_1000506745 | 173 |
| 216 | 3300005564 | Ga0070664_100099293 | Ga0070664_1000992932 | 173 |
| 217 | 3300005564 | Ga0070664_100200527 | Ga0070664_1002005272 | 173 |
| 218 | 3300005564 | Ga0070664_100232282 | Ga0070664_1002322822 | 173 |
| 219 | 3300005564 | Ga0070664_100322726 | Ga0070664_1003227262 | 173 |
| 220 | 3300005564 | Ga0070664_100388722 | Ga0070664_1003887222 | 173 |
| 221 | 3300005564 | Ga0070664_100826180 | Ga0070664_1008261802 | 173 |
| 222 | 3300005577 | Ga0068857_100061526 | Ga0068857_1000615265 | 173 |
| 223 | 3300005577 | Ga0068857_100272538 | Ga0068857_1002725382 | 173 |
| 224 | 3300005577 | Ga0068857_100611362 | Ga0068857_1006113621 | 173 |
| 225 | 3300005578 | Ga0068854_100022758 | Ga0068854_1000227582 | 173 |
| 226 | 3300005578 | Ga0068854_100071773 | Ga0068854_1000717732 | 173 |
| 227 | 3300005616 | Ga0068852_100047446 | Ga0068852_1000474465 | 173 |
| 228 | 3300005616 | Ga0068852_100049622 | Ga0068852_1000496222 | 173 |
| 229 | 3300005616 | Ga0068852_100114805 | Ga0068852_1001148052 | 173 |
| 230 | 3300005616 | Ga0068852_100131355 | Ga0068852_1001313551 | 173 |
| 231 | 3300005616 | Ga0068852_100137485 | Ga0068852_1001374852 | 173 |
| 232 | 3300005616 | Ga0068852_100146060 | Ga0068852_1001460602 | 173 |
| 233 | 3300005616 | Ga0068852_100176780 | Ga0068852_1001767802 | 173 |
| 234 | 3300005616 | Ga0068852_100471228 | Ga0068852_1004712282 | 173 |
| 235 | 3300005617 | Ga0068859_100032866 | Ga0068859_1000328666 | 173 |
| 236 | 3300005617 | Ga0068859_100052964 | Ga0068859_1000529643 | 173 |
| 237 | 3300005618 | Ga0068864_100006724 | Ga0068864_1000067243 | 173 |
| 238 | 3300005618 | Ga0068864_100009050 | Ga0068864_1000090502 | 173 |
| 239 | 3300005618 | Ga0068864_100016929 | Ga0068864_1000169297 | 173 |
| 240 | 3300005618 | Ga0068864_100024031 | Ga0068864_1000240312 | 173 |
| 241 | 3300005618 | Ga0068864_100028258 | Ga0068864_1000282583 | 173 |
| 242 | 3300005618 | Ga0068864_100032800 | Ga0068864_1000328002 | 173 |
| 243 | 3300005618 | Ga0068864_100051430 | Ga0068864_1000514302 | 173 |
| 244 | 3300005618 | Ga0068864_100095552 | Ga0068864_1000955524 | 173 |
| 245 | 3300005618 | Ga0068864_100180700 | Ga0068864_1001807002 | 173 |
| 246 | 3300005618 | Ga0068864_100312486 | Ga0068864_1003124863 | 173 |
| 247 | 3300005718 | Ga0068866_10004159 | Ga0068866_100041592 | 173 |
| 248 | 3300005719 | Ga0068861_100000757 | Ga0068861_10000075724 | 173 |
| 249 | 3300005719 | Ga0068861_100016694 | Ga0068861_1000166947 | 173 |
| 250 | 3300005719 | Ga0068861_100055464 | Ga0068861_1000554643 | 173 |
| 251 | 3300005719 | Ga0068861_100305984 | Ga0068861_1003059842 | 173 |
| 252 | 3300005834 | Ga0068851_10012597 | Ga0068851_100125976 | 173 |
| 253 | 3300005834 | Ga0068851_10150229 | Ga0068851_101502292 | 173 |
| 254 | 3300005840 | Ga0068870_10305377 | Ga0068870_103053772 | 173 |
| 255 | 3300005841 | Ga0068863_100000585 | Ga0068863_10000058531 | 173 |
| 256 | 3300005841 | Ga0068863_100030558 | Ga0068863_1000305582 | 173 |
| 257 | 3300005841 | Ga0068863_100042606 | Ga0068863_1000426062 | 173 |
| 258 | 3300005841 | Ga0068863_100115425 | Ga0068863_1001154253 | 173 |
| 259 | 3300005841 | Ga0068863_100144088 | Ga0068863_1001440882 | 173 |
| 260 | 3300005841 | Ga0068863_100691333 | Ga0068863_1006913332 | 173 |
| 261 | 3300005842 | Ga0068858_100002981 | Ga0068858_1000029813 | 173 |
| 262 | 3300005842 | Ga0068858_100003791 | Ga0068858_1000037918 | 173 |
| 263 | 3300005842 | Ga0068858_100004338 | Ga0068858_1000043387 | 173 |
| 264 | 3300005843 | Ga0068860_100009426 | Ga0068860_1000094267 | 173 |
| 265 | 3300005843 | Ga0068860_100052427 | Ga0068860_1000524272 | 173 |
| 266 | 3300005843 | Ga0068860_100412436 | Ga0068860_1004124362 | 173 |
| 267 | 3300005843 | Ga0068860_101333212 | Ga0068860_1013332122 | 173 |
| 268 | 3300005844 | Ga0068862_100010864 | Ga0068862_1000108642 | 173 |
| 269 | 3300005844 | Ga0068862_100017376 | Ga0068862_1000173766 | 173 |
| 270 | 3300005844 | Ga0068862_100065393 | Ga0068862_1000653933 | 173 |
| 271 | 3300005844 | Ga0068862_100093051 | Ga0068862_1000930513 | 173 |
| 272 | 3300005985 | Ga0081539_10048422 | Ga0081539_100484222 | 173 |
| 273 | 3300006163 | Ga0070715_10019021 | Ga0070715_100190213 | 173 |
| 274 | 3300006173 | Ga0070716_100143199 | Ga0070716_1001431992 | 173 |
| 275 | 3300006173 | Ga0070716_100413934 | Ga0070716_1004139342 | 173 |
| 276 | 3300006175 | Ga0070712_100231807 | Ga0070712_1002318072 | 173 |
| 277 | 3300006186 | Ga0075369_10318089 | Ga0075369_103180892 | 173 |
| 278 | 3300006195 | Ga0075366_10149429 | Ga0075366_101494292 | 173 |
| 279 | 3300006237 | Ga0097621_100049628 | Ga0097621_1000496281 | 173 |
| 280 | 3300006237 | Ga0097621_100060666 | Ga0097621_1000606663 | 173 |
| 281 | 3300006237 | Ga0097621_100090975 | Ga0097621_1000909753 | 173 |
| 282 | 3300006237 | Ga0097621_100097413 | Ga0097621_1000974132 | 173 |
| 283 | 3300006237 | Ga0097621_100104799 | Ga0097621_1001047992 | 173 |
| 284 | 3300006237 | Ga0097621_100110135 | Ga0097621_1001101353 | 173 |
| 285 | 3300006237 | Ga0097621_100214730 | Ga0097621_1002147302 | 173 |
| 286 | 3300006358 | Ga0068871_100024895 | Ga0068871_1000248954 | 173 |
| 287 | 3300006358 | Ga0068871_100046861 | Ga0068871_1000468613 | 173 |
| 288 | 3300006358 | Ga0068871_100111728 | Ga0068871_1001117282 | 173 |
| 289 | 3300006358 | Ga0068871_100177785 | Ga0068871_1001777852 | 173 |
| 290 | 3300006358 | Ga0068871_100205149 | Ga0068871_1002051492 | 173 |
| 291 | 3300006358 | Ga0068871_100352208 | Ga0068871_1003522082 | 173 |
| 292 | 3300006844 | Ga0075428_100009252 | Ga0075428_1000092523 | 173 |
| 293 | 3300006852 | Ga0075433_10138514 | Ga0075433_101385142 | 173 |
| 294 | 3300006852 | Ga0075433_10243015 | Ga0075433_102430152 | 173 |
| 295 | 3300006852 | Ga0075433_10281894 | Ga0075433_102818942 | 173 |
| 296 | 3300006880 | Ga0075429_100752140 | Ga0075429_1007521401 | 173 |
| 297 | 3300006931 | Ga0097620_100032866 | Ga0097620_1000328666 | 173 |
| 298 | 3300006931 | Ga0097620_100052964 | Ga0097620_1000529643 | 173 |
| 299 | 3300009094 | Ga0111539_10027065 | Ga0111539_100270655 | 173 |
| 300 | 3300009094 | Ga0111539_10289361 | Ga0111539_102893612 | 173 |
| 301 | 3300009094 | Ga0111539_10543011 | Ga0111539_105430111 | 173 |
| 302 | 3300009094 | Ga0111539_11552050 | Ga0111539_115520502 | 173 |
| 303 | 3300009098 | Ga0105245_10011246 | Ga0105245_100112462 | 173 |
| 304 | 3300009098 | Ga0105245_10104852 | Ga0105245_101048523 | 173 |
| 305 | 3300009098 | Ga0105245_10114708 | Ga0105245_101147082 | 173 |
| 306 | 3300009098 | Ga0105245_10911358 | Ga0105245_109113582 | 173 |
| 307 | 3300009147 | Ga0114129_10000826 | Ga0114129_100008268 | 173 |
| 308 | 3300009148 | Ga0105243_10007729 | Ga0105243_100077298 | 173 |
| 309 | 3300009148 | Ga0105243_10074803 | Ga0105243_100748034 | 173 |
| 310 | 3300009148 | Ga0105243_10173612 | Ga0105243_101736122 | 173 |
| 311 | 3300009148 | Ga0105243_10843319 | Ga0105243_108433192 | 173 |
| 312 | 3300009174 | Ga0105241_10042664 | Ga0105241_100426644 | 173 |
| 313 | 3300009174 | Ga0105241_10450054 | Ga0105241_104500542 | 173 |
| 314 | 3300009176 | Ga0105242_10066268 | Ga0105242_100662682 | 173 |
| 315 | 3300009176 | Ga0105242_10269659 | Ga0105242_102696592 | 173 |
| 316 | 3300009177 | Ga0105248_10043019 | Ga0105248_100430192 | 173 |
| 317 | 3300009177 | Ga0105248_10114677 | Ga0105248_101146772 | 173 |
| 318 | 3300009177 | Ga0105248_10154030 | Ga0105248_101540302 | 173 |
| 319 | 3300009177 | Ga0105248_10306196 | Ga0105248_103061962 | 173 |
| 320 | 3300009177 | Ga0105248_10450138 | Ga0105248_104501382 | 173 |
| 321 | 3300009177 | Ga0105248_10922451 | Ga0105248_109224511 | 173 |
| 322 | 3300009177 | Ga0105248_10964573 | Ga0105248_109645732 | 173 |
| 323 | 3300009177 | Ga0105248_11157073 | Ga0105248_111570731 | 173 |
| 324 | 3300009551 | Ga0105238_10002565 | Ga0105238_100025652 | 173 |
| 325 | 3300009551 | Ga0105238_10133924 | Ga0105238_101339242 | 173 |
| 326 | 3300009551 | Ga0105238_10177742 | Ga0105238_101777422 | 173 |
| 327 | 3300009553 | Ga0105249_10442469 | Ga0105249_104424692 | 173 |
| 328 | 3300010375 | Ga0105239_10121481 | Ga0105239_101214812 | 173 |
| 329 | 3300010375 | Ga0105239_10981397 | Ga0105239_109813972 | 173 |
| 330 | 3300011119 | Ga0105246_10114536 | Ga0105246_101145362 | 173 |
| 331 | 3300013100 | Ga0157373_10101389 | Ga0157373_101013892 | 173 |
| 332 | 3300013102 | Ga0157371_10207088 | Ga0157371_102070882 | 173 |
| 333 | 3300013102 | Ga0157371_10553072 | Ga0157371_105530721 | 173 |
| 334 | 3300013104 | Ga0157370_10020147 | Ga0157370_100201474 | 173 |
| 335 | 3300013104 | Ga0157370_10089256 | Ga0157370_100892563 | 173 |
| 336 | 3300013105 | Ga0157369_10001417 | Ga0157369_100014171 | 173 |
| 337 | 3300013296 | Ga0157374_10073038 | Ga0157374_100730383 | 173 |
| 338 | 3300013296 | Ga0157374_10130476 | Ga0157374_101304762 | 173 |
| 339 | 3300013296 | Ga0157374_10142912 | Ga0157374_101429123 | 173 |
| 340 | 3300013296 | Ga0157374_10548325 | Ga0157374_105483252 | 173 |
| 341 | 3300013296 | Ga0157374_10765194 | Ga0157374_107651942 | 173 |
| 342 | 3300013296 | Ga0157374_11189143 | Ga0157374_111891431 | 173 |
| 343 | 3300013297 | Ga0157378_10077664 | Ga0157378_100776642 | 173 |
| 344 | 3300013297 | Ga0157378_11676571 | Ga0157378_116765712 | 173 |
| 345 | 3300013306 | Ga0163162_10004424 | Ga0163162_100044243 | 173 |
| 346 | 3300013306 | Ga0163162_10038505 | Ga0163162_100385056 | 173 |
| 347 | 3300013306 | Ga0163162_10493901 | Ga0163162_104939012 | 173 |
| 348 | 3300013306 | Ga0163162_10657033 | Ga0163162_106570332 | 173 |
| 349 | 3300013306 | Ga0163162_12071778 | Ga0163162_120717781 | 173 |
| 350 | 3300013307 | Ga0157372_10003179 | Ga0157372_1000317913 | 173 |
| 351 | 3300013307 | Ga0157372_10067327 | Ga0157372_100673273 | 173 |
| 352 | 3300013307 | Ga0157372_10159008 | Ga0157372_101590083 | 173 |
| 353 | 3300013307 | Ga0157372_11245422 | Ga0157372_112454222 | 173 |
| 354 | 3300013308 | Ga0157375_10006387 | Ga0157375_100063879 | 173 |
| 355 | 3300013308 | Ga0157375_10019641 | Ga0157375_100196416 | 173 |
| 356 | 3300013308 | Ga0157375_10080914 | Ga0157375_100809143 | 173 |
| 357 | 3300013308 | Ga0157375_10151633 | Ga0157375_101516332 | 173 |
| 358 | 3300013308 | Ga0157375_10405343 | Ga0157375_104053432 | 173 |
| 359 | 3300013308 | Ga0157375_10983620 | Ga0157375_109836201 | 173 |
| 360 | 3300014325 | Ga0163163_10031254 | Ga0163163_100312544 | 173 |
| 361 | 3300014325 | Ga0163163_10034015 | Ga0163163_100340155 | 173 |
| 362 | 3300014325 | Ga0163163_10164237 | Ga0163163_101642372 | 173 |
| 363 | 3300014325 | Ga0163163_10555810 | Ga0163163_105558102 | 173 |
| 364 | 3300014326 | Ga0157380_10012973 | Ga0157380_100129733 | 173 |
| 365 | 3300014326 | Ga0157380_10133142 | Ga0157380_101331423 | 173 |
| 366 | 3300014326 | Ga0157380_10233090 | Ga0157380_102330902 | 173 |
| 367 | 3300014745 | Ga0157377_10063867 | Ga0157377_100638672 | 173 |
| 368 | 3300014745 | Ga0157377_10267001 | Ga0157377_102670012 | 173 |
| 369 | 3300014968 | Ga0157379_10004462 | Ga0157379_1000446212 | 173 |
| 370 | 3300014968 | Ga0157379_10024218 | Ga0157379_100242182 | 173 |
| 371 | 3300014968 | Ga0157379_10061522 | Ga0157379_100615222 | 173 |
| 372 | 3300014968 | Ga0157379_10092686 | Ga0157379_100926863 | 173 |
| 373 | 3300014968 | Ga0157379_10099305 | Ga0157379_100993052 | 173 |
| 374 | 3300014969 | Ga0157376_10085585 | Ga0157376_100855853 | 173 |
| 375 | 3300014969 | Ga0157376_10127747 | Ga0157376_101277473 | 173 |
| 376 | 3300014969 | Ga0157376_10200701 | Ga0157376_102007012 | 173 |
| 377 | 3300014969 | Ga0157376_10329469 | Ga0157376_103294692 | 173 |
| 378 | 3300017792 | Ga0163161_10016140 | Ga0163161_100161404 | 173 |
| 379 | 3300017792 | Ga0163161_10035830 | Ga0163161_100358304 | 173 |
| 380 | 3300017792 | Ga0163161_10350625 | Ga0163161_103506252 | 173 |
| 381 | 3300021377 | Ga0213874_10054231 | Ga0213874_100542312 | 173 |
| 382 | 3300021384 | Ga0213876_10075065 | Ga0213876_100750652 | 173 |
| 383 | 3300021384 | Ga0213876_10166433 | Ga0213876_101664332 | 173 |
| 384 | 3300025321 | Ga0207656_10007890 | Ga0207656_100078904 | 173 |
| 385 | 3300025321 | Ga0207656_10057945 | Ga0207656_100579452 | 173 |
| 386 | 3300025321 | Ga0207656_10114144 | Ga0207656_101141442 | 173 |
| 387 | 3300025321 | Ga0207656_10128368 | Ga0207656_101283682 | 173 |
| 388 | 3300025321 | Ga0207656_10198568 | Ga0207656_101985682 | 173 |
| 389 | 3300025893 | Ga0207682_10002971 | Ga0207682_100029712 | 173 |
| 390 | 3300025893 | Ga0207682_10028879 | Ga0207682_100288792 | 173 |
| 391 | 3300025893 | Ga0207682_10052091 | Ga0207682_100520912 | 173 |
| 392 | 3300025893 | Ga0207682_10267892 | Ga0207682_102678921 | 173 |
| 393 | 3300025899 | Ga0207642_10002689 | Ga0207642_100026892 | 173 |
| 394 | 3300025901 | Ga0207688_10177615 | Ga0207688_101776152 | 173 |
| 395 | 3300025903 | Ga0207680_10015539 | Ga0207680_100155395 | 173 |
| 396 | 3300025903 | Ga0207680_10016326 | Ga0207680_100163264 | 173 |
| 397 | 3300025903 | Ga0207680_10123465 | Ga0207680_101234652 | 173 |
| 398 | 3300025903 | Ga0207680_10502161 | Ga0207680_105021611 | 173 |
| 399 | 3300025903 | Ga0207680_10540025 | Ga0207680_105400252 | 173 |
| 400 | 3300025907 | Ga0207645_10005283 | Ga0207645_100052838 | 173 |
| 401 | 3300025907 | Ga0207645_10031798 | Ga0207645_100317981 | 173 |
| 402 | 3300025907 | Ga0207645_10046537 | Ga0207645_100465374 | 173 |
| 403 | 3300025907 | Ga0207645_10051897 | Ga0207645_100518973 | 173 |
| 404 | 3300025908 | Ga0207643_10095554 | Ga0207643_100955542 | 173 |
| 405 | 3300025909 | Ga0207705_10019896 | Ga0207705_100198963 | 173 |
| 406 | 3300025909 | Ga0207705_10057954 | Ga0207705_100579542 | 173 |
| 407 | 3300025909 | Ga0207705_10068798 | Ga0207705_100687982 | 173 |
| 408 | 3300025909 | Ga0207705_10482950 | Ga0207705_104829502 | 173 |
| 409 | 3300025912 | Ga0207707_10432043 | Ga0207707_104320432 | 173 |
| 410 | 3300025915 | Ga0207693_10075058 | Ga0207693_100750582 | 173 |
| 411 | 3300025917 | Ga0207660_11166078 | Ga0207660_111660781 | 173 |
| 412 | 3300025918 | Ga0207662_10007292 | Ga0207662_100072924 | 173 |
| 413 | 3300025919 | Ga0207657_10140060 | Ga0207657_101400602 | 173 |
| 414 | 3300025919 | Ga0207657_10178023 | Ga0207657_101780232 | 173 |
| 415 | 3300025920 | Ga0207649_10183781 | Ga0207649_101837813 | 173 |
| 416 | 3300025920 | Ga0207649_10321977 | Ga0207649_103219772 | 173 |
| 417 | 3300025920 | Ga0207649_10562741 | Ga0207649_105627412 | 173 |
| 418 | 3300025921 | Ga0207652_10172838 | Ga0207652_101728382 | 173 |
| 419 | 3300025921 | Ga0207652_10646759 | Ga0207652_106467592 | 173 |
| 420 | 3300025922 | Ga0207646_10593066 | Ga0207646_105930662 | 173 |
| 421 | 3300025923 | Ga0207681_10002043 | Ga0207681_100020433 | 173 |
| 422 | 3300025923 | Ga0207681_10013149 | Ga0207681_100131492 | 173 |
| 423 | 3300025923 | Ga0207681_10015363 | Ga0207681_100153632 | 173 |
| 424 | 3300025923 | Ga0207681_10136582 | Ga0207681_101365822 | 173 |
| 425 | 3300025923 | Ga0207681_10251984 | Ga0207681_102519842 | 173 |
| 426 | 3300025924 | Ga0207694_10096401 | Ga0207694_100964012 | 173 |
| 427 | 3300025924 | Ga0207694_10328464 | Ga0207694_103284642 | 173 |
| 428 | 3300025925 | Ga0207650_10011876 | Ga0207650_100118762 | 173 |
| 429 | 3300025925 | Ga0207650_10054905 | Ga0207650_100549052 | 173 |
| 430 | 3300025925 | Ga0207650_10099174 | Ga0207650_100991743 | 173 |
| 431 | 3300025925 | Ga0207650_10099858 | Ga0207650_100998582 | 173 |
| 432 | 3300025925 | Ga0207650_10169221 | Ga0207650_101692212 | 173 |
| 433 | 3300025925 | Ga0207650_10426241 | Ga0207650_104262412 | 173 |
| 434 | 3300025925 | Ga0207650_10963429 | Ga0207650_109634292 | 173 |
| 435 | 3300025926 | Ga0207659_10000313 | Ga0207659_1000031316 | 173 |
| 436 | 3300025926 | Ga0207659_10055225 | Ga0207659_100552253 | 173 |
| 437 | 3300025926 | Ga0207659_10108670 | Ga0207659_101086702 | 173 |
| 438 | 3300025926 | Ga0207659_10132320 | Ga0207659_101323202 | 173 |
| 439 | 3300025926 | Ga0207659_10267502 | Ga0207659_102675022 | 173 |
| 440 | 3300025926 | Ga0207659_10456552 | Ga0207659_104565522 | 173 |
| 441 | 3300025927 | Ga0207687_10046846 | Ga0207687_100468464 | 173 |
| 442 | 3300025927 | Ga0207687_10222735 | Ga0207687_102227353 | 173 |
| 443 | 3300025927 | Ga0207687_10296428 | Ga0207687_102964282 | 173 |
| 444 | 3300025928 | Ga0207700_10000338 | Ga0207700_1000033827 | 173 |
| 445 | 3300025928 | Ga0207700_10032912 | Ga0207700_100329123 | 173 |
| 446 | 3300025928 | Ga0207700_10100864 | Ga0207700_101008643 | 173 |
| 447 | 3300025929 | Ga0207664_10942764 | Ga0207664_109427641 | 173 |
| 448 | 3300025931 | Ga0207644_10000517 | Ga0207644_1000051724 | 173 |
| 449 | 3300025931 | Ga0207644_10005549 | Ga0207644_100055496 | 173 |
| 450 | 3300025931 | Ga0207644_10116617 | Ga0207644_101166172 | 173 |
| 451 | 3300025931 | Ga0207644_10123428 | Ga0207644_101234282 | 173 |
| 452 | 3300025931 | Ga0207644_10204918 | Ga0207644_102049182 | 173 |
| 453 | 3300025932 | Ga0207690_10069010 | Ga0207690_100690103 | 173 |
| 454 | 3300025932 | Ga0207690_10292890 | Ga0207690_102928902 | 173 |
| 455 | 3300025932 | Ga0207690_10856079 | Ga0207690_108560792 | 173 |
| 456 | 3300025933 | Ga0207706_10003551 | Ga0207706_100035515 | 173 |
| 457 | 3300025933 | Ga0207706_10015438 | Ga0207706_100154386 | 173 |
| 458 | 3300025933 | Ga0207706_10073877 | Ga0207706_100738774 | 173 |
| 459 | 3300025933 | Ga0207706_10078917 | Ga0207706_100789172 | 173 |
| 460 | 3300025933 | Ga0207706_10301466 | Ga0207706_103014662 | 173 |
| 461 | 3300025933 | Ga0207706_10306354 | Ga0207706_103063542 | 173 |
| 462 | 3300025934 | Ga0207686_10013046 | Ga0207686_100130463 | 173 |
| 463 | 3300025934 | Ga0207686_10035577 | Ga0207686_100355772 | 173 |
| 464 | 3300025935 | Ga0207709_10148989 | Ga0207709_101489892 | 173 |
| 465 | 3300025935 | Ga0207709_10150709 | Ga0207709_101507093 | 173 |
| 466 | 3300025936 | Ga0207670_10030009 | Ga0207670_100300095 | 173 |
| 467 | 3300025936 | Ga0207670_10989918 | Ga0207670_109899182 | 173 |
| 468 | 3300025937 | Ga0207669_10015520 | Ga0207669_100155204 | 173 |
| 469 | 3300025937 | Ga0207669_10167644 | Ga0207669_101676442 | 173 |
| 470 | 3300025937 | Ga0207669_10434363 | Ga0207669_104343632 | 173 |
| 471 | 3300025937 | Ga0207669_11028543 | Ga0207669_110285432 | 173 |
| 472 | 3300025938 | Ga0207704_10018901 | Ga0207704_100189014 | 173 |
| 473 | 3300025938 | Ga0207704_11194656 | Ga0207704_111946562 | 173 |
| 474 | 3300025939 | Ga0207665_10197673 | Ga0207665_101976732 | 173 |
| 475 | 3300025939 | Ga0207665_10251355 | Ga0207665_102513552 | 173 |
| 476 | 3300025940 | Ga0207691_10007603 | Ga0207691_100076036 | 173 |
| 477 | 3300025940 | Ga0207691_10008416 | Ga0207691_100084162 | 173 |
| 478 | 3300025940 | Ga0207691_10033898 | Ga0207691_100338987 | 173 |
| 479 | 3300025940 | Ga0207691_10130481 | Ga0207691_101304812 | 173 |
| 480 | 3300025940 | Ga0207691_10225796 | Ga0207691_102257963 | 173 |
| 481 | 3300025940 | Ga0207691_10296005 | Ga0207691_102960052 | 173 |
| 482 | 3300025941 | Ga0207711_10029584 | Ga0207711_100295846 | 173 |
| 483 | 3300025941 | Ga0207711_10060708 | Ga0207711_100607082 | 173 |
| 484 | 3300025941 | Ga0207711_10087670 | Ga0207711_100876702 | 173 |
| 485 | 3300025941 | Ga0207711_10104118 | Ga0207711_101041182 | 173 |
| 486 | 3300025942 | Ga0207689_10002034 | Ga0207689_100020345 | 173 |
| 487 | 3300025942 | Ga0207689_10013647 | Ga0207689_100136475 | 173 |
| 488 | 3300025942 | Ga0207689_10021025 | Ga0207689_100210252 | 173 |
| 489 | 3300025942 | Ga0207689_10347648 | Ga0207689_103476482 | 173 |
| 490 | 3300025944 | Ga0207661_10028878 | Ga0207661_100288782 | 173 |
| 491 | 3300025944 | Ga0207661_10112969 | Ga0207661_101129692 | 173 |
| 492 | 3300025945 | Ga0207679_10182092 | Ga0207679_101820923 | 173 |
| 493 | 3300025945 | Ga0207679_10361937 | Ga0207679_103619372 | 173 |
| 494 | 3300025945 | Ga0207679_10517003 | Ga0207679_105170032 | 173 |
| 495 | 3300025945 | Ga0207679_11346316 | Ga0207679_113463161 | 173 |
| 496 | 3300025949 | Ga0207667_10015924 | Ga0207667_100159244 | 173 |
| 497 | 3300025949 | Ga0207667_10017769 | Ga0207667_100177696 | 173 |
| 498 | 3300025949 | Ga0207667_10040469 | Ga0207667_100404693 | 173 |
| 499 | 3300025960 | Ga0207651_10000600 | Ga0207651_100006003 | 173 |
| 500 | 3300025960 | Ga0207651_10196662 | Ga0207651_101966622 | 173 |
| 501 | 3300025960 | Ga0207651_10264450 | Ga0207651_102644502 | 173 |
| 502 | 3300025960 | Ga0207651_10787442 | Ga0207651_107874422 | 173 |
| 503 | 3300025961 | Ga0207712_10610010 | Ga0207712_106100102 | 173 |
| 504 | 3300025972 | Ga0207668_10005847 | Ga0207668_100058472 | 173 |
| 505 | 3300025972 | Ga0207668_10022312 | Ga0207668_100223123 | 173 |
| 506 | 3300025972 | Ga0207668_10259948 | Ga0207668_102599482 | 173 |
| 507 | 3300025972 | Ga0207668_10463986 | Ga0207668_104639862 | 173 |
| 508 | 3300025981 | Ga0207640_10065937 | Ga0207640_100659372 | 173 |
| 509 | 3300025981 | Ga0207640_10093962 | Ga0207640_100939623 | 173 |
| 510 | 3300025981 | Ga0207640_10416881 | Ga0207640_104168812 | 173 |
| 511 | 3300025981 | Ga0207640_10555566 | Ga0207640_105555662 | 173 |
| 512 | 3300025986 | Ga0207658_10000812 | Ga0207658_1000081210 | 173 |
| 513 | 3300025986 | Ga0207658_10004524 | Ga0207658_100045249 | 173 |
| 514 | 3300025986 | Ga0207658_10008395 | Ga0207658_100083952 | 173 |
| 515 | 3300025986 | Ga0207658_10104711 | Ga0207658_101047113 | 173 |
| 516 | 3300025986 | Ga0207658_10365385 | Ga0207658_103653852 | 173 |
| 517 | 3300025986 | Ga0207658_10425975 | Ga0207658_104259752 | 173 |
| 518 | 3300026023 | Ga0207677_10004232 | Ga0207677_100042325 | 173 |
| 519 | 3300026023 | Ga0207677_10012506 | Ga0207677_100125067 | 173 |
| 520 | 3300026023 | Ga0207677_10203650 | Ga0207677_102036503 | 173 |
| 521 | 3300026023 | Ga0207677_10521385 | Ga0207677_105213852 | 173 |
| 522 | 3300026035 | Ga0207703_10000929 | Ga0207703_1000092920 | 173 |
| 523 | 3300026035 | Ga0207703_10001541 | Ga0207703_100015418 | 173 |
| 524 | 3300026035 | Ga0207703_10374599 | Ga0207703_103745992 | 173 |
| 525 | 3300026035 | Ga0207703_11196395 | Ga0207703_111963952 | 173 |
| 526 | 3300026041 | Ga0207639_10045094 | Ga0207639_100450942 | 173 |
| 527 | 3300026041 | Ga0207639_10064502 | Ga0207639_100645024 | 173 |
| 528 | 3300026041 | Ga0207639_10369350 | Ga0207639_103693503 | 173 |
| 529 | 3300026041 | Ga0207639_10620505 | Ga0207639_106205052 | 173 |
| 530 | 3300026041 | Ga0207639_11325285 | Ga0207639_113252851 | 173 |
| 531 | 3300026067 | Ga0207678_10121386 | Ga0207678_101213862 | 173 |
| 532 | 3300026067 | Ga0207678_10323622 | Ga0207678_103236222 | 173 |
| 533 | 3300026067 | Ga0207678_10622106 | Ga0207678_106221062 | 173 |
| 534 | 3300026075 | Ga0207708_10548800 | Ga0207708_105488002 | 173 |
| 535 | 3300026088 | Ga0207641_10000655 | Ga0207641_1000065539 | 173 |
| 536 | 3300026088 | Ga0207641_10041985 | Ga0207641_100419855 | 173 |
| 537 | 3300026088 | Ga0207641_10100664 | Ga0207641_101006642 | 173 |
| 538 | 3300026088 | Ga0207641_10808793 | Ga0207641_108087932 | 173 |
| 539 | 3300026088 | Ga0207641_11003515 | Ga0207641_110035151 | 173 |
| 540 | 3300026089 | Ga0207648_10006616 | Ga0207648_1000661612 | 173 |
| 541 | 3300026089 | Ga0207648_10831348 | Ga0207648_108313482 | 173 |
| 542 | 3300026095 | Ga0207676_10002990 | Ga0207676_100029908 | 173 |
| 543 | 3300026095 | Ga0207676_10008396 | Ga0207676_100083963 | 173 |
| 544 | 3300026095 | Ga0207676_10017575 | Ga0207676_100175757 | 173 |
| 545 | 3300026095 | Ga0207676_10019288 | Ga0207676_100192882 | 173 |
| 546 | 3300026095 | Ga0207676_10040215 | Ga0207676_100402153 | 173 |
| 547 | 3300026095 | Ga0207676_10045925 | Ga0207676_100459252 | 173 |
| 548 | 3300026095 | Ga0207676_10357517 | Ga0207676_103575172 | 173 |
| 549 | 3300026095 | Ga0207676_10472438 | Ga0207676_104724382 | 173 |
| 550 | 3300026095 | Ga0207676_10474911 | Ga0207676_104749112 | 173 |
| 551 | 3300026095 | Ga0207676_10539494 | Ga0207676_105394942 | 173 |
| 552 | 3300026095 | Ga0207676_10871663 | Ga0207676_108716631 | 173 |
| 553 | 3300026116 | Ga0207674_10161382 | Ga0207674_101613822 | 173 |
| 554 | 3300026116 | Ga0207674_10532567 | Ga0207674_105325672 | 173 |
| 555 | 3300026116 | Ga0207674_10998576 | Ga0207674_109985762 | 173 |
| 556 | 3300026118 | Ga0207675_100000956 | Ga0207675_10000095634 | 173 |
| 557 | 3300026118 | Ga0207675_100052681 | Ga0207675_1000526812 | 173 |
| 558 | 3300026121 | Ga0207683_10001877 | Ga0207683_100018772 | 173 |
| 559 | 3300026121 | Ga0207683_10030845 | Ga0207683_100308452 | 173 |
| 560 | 3300026121 | Ga0207683_10091526 | Ga0207683_100915262 | 173 |
| 561 | 3300026121 | Ga0207683_10104582 | Ga0207683_101045822 | 173 |
| 562 | 3300026121 | Ga0207683_10236721 | Ga0207683_102367213 | 173 |
| 563 | 3300026121 | Ga0207683_10297475 | Ga0207683_102974753 | 173 |
| 564 | 3300026142 | Ga0207698_10061514 | Ga0207698_100615142 | 173 |
| 565 | 3300026142 | Ga0207698_10063805 | Ga0207698_100638052 | 173 |
| 566 | 3300026142 | Ga0207698_10082727 | Ga0207698_100827272 | 173 |
| 567 | 3300026142 | Ga0207698_10084881 | Ga0207698_100848812 | 173 |
| 568 | 3300026142 | Ga0207698_10108058 | Ga0207698_101080582 | 173 |
| 569 | 3300026142 | Ga0207698_10147223 | Ga0207698_101472232 | 173 |
| 570 | 3300026142 | Ga0207698_10152334 | Ga0207698_101523342 | 173 |
| 571 | 3300026142 | Ga0207698_10490085 | Ga0207698_104900852 | 173 |
| 572 | 3300026142 | Ga0207698_11073289 | Ga0207698_110732892 | 173 |
| 573 | 3300026142 | Ga0207698_11279611 | Ga0207698_112796112 | 173 |
| 574 | 3300027907 | Ga0207428_10002089 | Ga0207428_100020892 | 173 |
| 575 | 3300027907 | Ga0207428_10002537 | Ga0207428_1000253716 | 173 |
| 576 | 3300028379 | Ga0268266_10047759 | Ga0268266_100477592 | 173 |
| 577 | 3300028379 | Ga0268266_10199372 | Ga0268266_101993721 | 173 |
| 578 | 3300028379 | Ga0268266_10217974 | Ga0268266_102179742 | 173 |
| 579 | 3300028379 | Ga0268266_11382983 | Ga0268266_113829831 | 173 |
| 580 | 3300028380 | Ga0268265_10008601 | Ga0268265_100086012 | 173 |
| 581 | 3300028380 | Ga0268265_10031887 | Ga0268265_100318876 | 173 |
| 582 | 3300028381 | Ga0268264_10002170 | Ga0268264_100021703 | 173 |
| 583 | 3300028381 | Ga0268264_10175313 | Ga0268264_101753132 | 173 |
| 584 | 3300028381 | Ga0268264_11331446 | Ga0268264_113314461 | 173 |
| 585 | 3300028786 | Ga0307517_10044883 | Ga0307517_100448833 | 173 |
| 586 | 3300028786 | Ga0307517_10134835 | Ga0307517_101348352 | 173 |
| 587 | 3300028794 | Ga0307515_10059241 | Ga0307515_100592412 | 173 |
| 588 | 3300028794 | Ga0307515_10203361 | Ga0307515_102033611 | 173 |
| 589 | 3300030522 | Ga0307512_10076021 | Ga0307512_100760212 | 173 |
| 590 | 3300030522 | Ga0307512_10078766 | Ga0307512_100787663 | 173 |
| 591 | 3300031241 | Ga0265325_10209885 | Ga0265325_102098852 | 173 |
| 592 | 3300031251 | Ga0265327_10063857 | Ga0265327_100638572 | 173 |
| 593 | 3300031251 | Ga0265327_10262958 | Ga0265327_102629581 | 173 |
| 594 | 3300031507 | Ga0307509_10001002 | Ga0307509_1000100231 | 173 |
| 595 | 3300031507 | Ga0307509_10001260 | Ga0307509_1000126034 | 173 |
| 596 | 3300031507 | Ga0307509_10004767 | Ga0307509_1000476719 | 173 |
| 597 | 3300031507 | Ga0307509_10187105 | Ga0307509_101871052 | 173 |
| 598 | 3300031616 | Ga0307508_10000280 | Ga0307508_1000028060 | 173 |
| 599 | 3300031616 | Ga0307508_10105300 | Ga0307508_101053002 | 173 |
| 600 | 3300031649 | Ga0307514_10195648 | Ga0307514_101956481 | 173 |
| 601 | 3300031731 | Ga0307405_10247785 | Ga0307405_102477851 | 173 |
| 602 | 3300031733 | Ga0316577_10118272 | Ga0316577_101182723 | 173 |
| 603 | 3300031838 | Ga0307518_10338600 | Ga0307518_103386002 | 173 |
| 604 | 3300031911 | Ga0307412_10659572 | Ga0307412_106595722 | 173 |
| 605 | 3300032002 | Ga0307416_100106326 | Ga0307416_1001063262 | 173 |
| 606 | 3300032002 | Ga0307416_100229178 | Ga0307416_1002291782 | 173 |
| 607 | 3300032002 | Ga0307416_100410429 | Ga0307416_1004104291 | 173 |
| 608 | 3300033179 | Ga0307507_10251428 | Ga0307507_102514281 | 173 |
| 609 | 3300033180 | Ga0307510_10004362 | Ga0307510_1000436215 | 173 |
| 610 | 3300033180 | Ga0307510_10007103 | Ga0307510_100071033 | 173 |
| 611 | 3300033180 | Ga0307510_10170337 | Ga0307510_101703372 | 173 |
| 612 | 3300034816 | Ga0373930_0005560 | Ga0373930_0005560_344_874 | 173 |
| 613 | 3300034818 | Ga0373950_0010626 | Ga0373950_0010626_133_663 | 173 |
| 614 | 3300034818 | Ga0373950_0106964 | Ga0373950_0106964_13_573 | 173 |
| 615 | 3300034819 | Ga0373958_0043208 | Ga0373958_0043208_356_886 | 173 |
| 616 | 3300034957 | Ga0373938_0081421 | Ga0373938_0081421_208_741 | 173 |
| 617 | 3300035084 | Ga0373928_0006702 | Ga0373928_0006702_327_887 | 173 |
| 618 | 3300035084 | Ga0373928_0014117 | Ga0373928_0014117_730_1260 | 173 |
| 619 | 3300035088 | Ga0373940_0020375 | Ga0373940_0020375_1021_1581 | 173 |
| 620 | 3300035088 | Ga0373940_0058359 | Ga0373940_0058359_129_659 | 173 |
| 621 | 3300035089 | Ga0373944_0054881 | Ga0373944_0054881_587_1117 | 173 |
| 622 | 3300035090 | Ga0373949_0012100 | Ga0373949_0012100_294_824 | 173 |
| 623 | 3300035112 | Ga0373932_0005424 | Ga0373932_0005424_2072_2602 | 173 |
| 624 | 3300035114 | Ga0373939_0060359 | Ga0373939_0060359_184_744 | 173 |
| 625 | 3300035114 | Ga0373939_0060793 | Ga0373939_0060793_366_896 | 173 |
| 626 | 3300035116 | Ga0373945_0054060 | Ga0373945_0054060_352_882 | 173 |
| 627 | 3300035117 | Ga0373953_0092485 | Ga0373953_0092485_528_1106 | 173 |
| 628 | 3300035118 | Ga0373954_0270649 | Ga0373954_0270649_207_785 | 173 |
| 629 | 3300035121 | Ga0373960_0164703 | Ga0373960_0164703_169_699 | 173 |
| 630 | 3300035170 | Ga0373943_0051985 | Ga0373943_0051985_900_1430 | 173 |
| 631 | 3300035171 | Ga0373946_0289354 | Ga0373946_0289354_141_671 | 173 |
| 632 | 3300035172 | Ga0373955_0113976 | Ga0373955_0113976_867_1397 | 173 |
| 633 | 3300035207 | Ga0373942_0000734 | Ga0373942_0000734_3805_4335 | 173 |
| 634 | 3300035207 | Ga0373942_0001974 | Ga0373942_0001974_162_692 | 173 |
| 635 | 3300035207 | Ga0373942_0071824 | Ga0373942_0071824_231_791 | 173 |
| 636 | 3300035241 | Ga0373961_0059455 | Ga0373961_0059455_380_910 | 173 |
| 637 | 3300035242 | Ga0373962_0084741 | Ga0373962_0084741_34_594 | 173 |
| 638 | 3300035410 | Ga0373924_0018981 | Ga0373924_0018981_1082_1612 | 173 |
| 639 | 3300035410 | Ga0373924_0071339 | Ga0373924_0071339_616_1194 | 173 |
| 640 | 3300035691 | Ga0373931_0001134 | Ga0373931_0001134_1747_2277 | 173 |
| 641 | 3300035691 | Ga0373931_0021651 | Ga0373931_0021651_1348_1908 | 173 |
| 642 | 3300035691 | Ga0373931_0181112 | Ga0373931_0181112_575_1105 | 173 |
| 643 | 3300035695 | Ga0373927_0597852 | Ga0373927_0597852_38_568 | 173 |
| 644 | 3300035724 | Ga0373933_0058049 | Ga0373933_0058049_679_1257 | 173 |
| 645 | 3300035724 | Ga0373933_0434936 | Ga0373933_0434936_322_846 | 173 |
| 646 | 3300035725 | Ga0373947_0121761 | Ga0373947_0121761_501_1079 | 173 |
| 647 | 3300035725 | Ga0373947_0499542 | Ga0373947_0499542_160_690 | 173 |
| 648 | 3300036401 | Ga0373937_0059039 | Ga0373937_0059039_607_1137 | 173 |
| 649 | 3300036401 | Ga0373937_0133691 | Ga0373937_0133691_1235_1813 | 173 |
| 650 | 3300036401 | Ga0373937_0335080 | Ga0373937_0335080_606_1142 | 173 |
| 651 | 3300036647 | Ga0316582_0027613 | Ga0316582_0027613_2330_2851 | 173 |
| 652 | 3300037068 | Ga0373925_0014054 | Ga0373925_0014054_469_999 | 173 |
| 653 | 3300037068 | Ga0373925_0067472 | Ga0373925_0067472_1810_2388 | 173 |
| 654 | 3300037466 | Ga0395898_0397175 | Ga0395898_0397175_50_586 | 173 |
| 655 | 3300037471 | Ga0395905_0003363 | Ga0395905_0003363_341_874 | 173 |
| 656 | 3300037471 | Ga0395905_0053119 | Ga0395905_0053119_2884_3420 | 173 |
| 657 | 3300038443 | Ga0395901_0120274 | Ga0395901_0120274_1510_2046 | 173 |
| 658 | 3300039437 | Ga0436365_0033031 | Ga0436365_0033031_369_899 | 173 |
| 659 | 3300039437 | Ga0436365_0697613 | Ga0436365_0697613_1131_1661 | 173 |
| 660 | 3300039437 | Ga0436365_1034743 | Ga0436365_1034743_231_761 | 173 |
| 661 | 3300039450 | Ga0436363_0285240 | Ga0436363_0285240_1563_2093 | 173 |
| 662 | 3300041496 | Ga0451839_1414179 | Ga0451839_1414179_85_615 | 173 |
| 663 | 3300041507 | Ga0451851_1082858 | Ga0451851_1082858_39_569 | 173 |
| 664 | 3300041509 | Ga0451843_0111968 | Ga0451843_0111968_14_544 | 173 |
| 665 | 3300042439 | Ga0439464_0003009 | Ga0439464_0003009_3195_3725 | 173 |
| 666 | 3300042461 | Ga0439460_0071839 | Ga0439460_0071839_493_1023 | 173 |
| 667 | 3300044684 | Ga0466966_0095143 | Ga0466966_0095143_1005_1541 | 173 |
| 668 | 3300044842 | Ga0466957_0092227 | Ga0466957_0092227_317_853 | 173 |
| 669 | 3300045049 | Ga0466959_0235540 | Ga0466959_0235540_370_906 | 173 |
| 670 | 3300045051 | Ga0451576_0094792 | Ga0451576_0094792_2542_3072 | 173 |
| 671 | 3300045051 | Ga0451576_0107944 | Ga0451576_0107944_1372_1902 | 173 |
| 672 | 3300046454 | Ga0495592_0000441 | Ga0495592_0000441_27359_27892 | 173 |
| 673 | 3300046454 | Ga0495592_0213900 | Ga0495592_0213900_697_1275 | 173 |
| 674 | 3300046454 | Ga0495592_0306907 | Ga0495592_0306907_424_954 | 173 |
| 675 | 3300046454 | Ga0495592_0505759 | Ga0495592_0505759_65_595 | 173 |
| 676 | 3300046455 | Ga0495603_0148969 | Ga0495603_0148969_405_929 | 173 |
| 677 | 3300046459 | Ga0495629_0037403 | Ga0495629_0037403_1380_1958 | 173 |
| 678 | 3300046459 | Ga0495629_0519138 | Ga0495629_0519138_183_713 | 173 |
| 679 | 3300046460 | Ga0495638_0098481 | Ga0495638_0098481_227_757 | 173 |
| 680 | 3300046472 | Ga0495580_0118662 | Ga0495580_0118662_804_1334 | 173 |
| 681 | 3300046472 | Ga0495580_0130877 | Ga0495580_0130877_494_1024 | 173 |
| 682 | 3300046477 | Ga0495664_0188941 | Ga0495664_0188941_244_822 | 173 |
| 683 | 3300046477 | Ga0495664_0321182 | Ga0495664_0321182_98_628 | 173 |
| 684 | 3300046506 | Ga0495583_0223199 | Ga0495583_0223199_40_570 | 173 |
| 685 | 3300046515 | Ga0495620_0056590 | Ga0495620_0056590_805_1335 | 173 |
| 686 | 3300046515 | Ga0495620_0151272 | Ga0495620_0151272_147_677 | 173 |
| 687 | 3300046517 | Ga0495630_0442430 | Ga0495630_0442430_410_940 | 173 |
| 688 | 3300046524 | Ga0495648_0138814 | Ga0495648_0138814_536_1069 | 173 |
| 689 | 3300046524 | Ga0495648_0224127 | Ga0495648_0224127_11_544 | 173 |
| 690 | 3300046526 | Ga0495666_0048287 | Ga0495666_0048287_1193_1723 | 173 |
| 691 | 3300046537 | Ga0495598_0109114 | Ga0495598_0109114_342_872 | 173 |
| 692 | 3300046539 | Ga0495621_0010584 | Ga0495621_0010584_892_1422 | 173 |
| 693 | 3300046539 | Ga0495621_0084548 | Ga0495621_0084548_376_906 | 173 |
| 694 | 3300046539 | Ga0495621_0218102 | Ga0495621_0218102_65_595 | 173 |
| 695 | 3300046539 | Ga0495621_0261997 | Ga0495621_0261997_76_606 | 173 |
| 696 | 3300046543 | Ga0495645_0060913 | Ga0495645_0060913_1187_1717 | 173 |
| 697 | 3300046543 | Ga0495645_0217869 | Ga0495645_0217869_206_736 | 173 |
| 698 | 3300046559 | Ga0495667_0247374 | Ga0495667_0247374_244_822 | 173 |
| 699 | 3300046559 | Ga0495667_0286252 | Ga0495667_0286252_430_960 | 173 |
| 700 | 3300046615 | Ga0495656_0129656 | Ga0495656_0129656_279_809 | 173 |
| 701 | 3300046660 | Ga0495625_0082170 | Ga0495625_0082170_1218_1748 | 173 |
| 702 | 3300046663 | Ga0495635_0148354 | Ga0495635_0148354_101_631 | 173 |
| 703 | 3300046681 | Ga0495647_0028086 | Ga0495647_0028086_958_1488 | 173 |
| 704 | 3300046683 | Ga0495658_0047962 | Ga0495658_0047962_627_1205 | 173 |
| 705 | 3300046683 | Ga0495658_0060024 | Ga0495658_0060024_131_661 | 173 |
| 706 | 3300046683 | Ga0495658_0107937 | Ga0495658_0107937_841_1371 | 173 |
| 707 | 3300046683 | Ga0495658_0123515 | Ga0495658_0123515_655_1185 | 173 |
| 708 | 3300046683 | Ga0495658_0218137 | Ga0495658_0218137_640_1170 | 173 |
| 709 | 3300046694 | Ga0495649_0153993 | Ga0495649_0153993_533_1063 | 173 |
| 710 | 3300046694 | Ga0495649_0276938 | Ga0495649_0276938_56_589 | 173 |
| 711 | 3300046809 | Ga0495600_0167314 | Ga0495600_0167314_232_810 | 173 |
| 712 | 3300046809 | Ga0495600_0349362 | Ga0495600_0349362_196_726 | 173 |
| 713 | 3300047319 | Ga0495674_0312052 | Ga0495674_0312052_495_1073 | 173 |
| 714 | 3300047319 | Ga0495674_0703450 | Ga0495674_0703450_246_776 | 173 |
| 715 | 3300047321 | Ga0495676_0429143 | Ga0495676_0429143_93_623 | 173 |
| 716 | 3300047322 | Ga0495680_0126817 | Ga0495680_0126817_663_1241 | 173 |
| 717 | 3300047471 | Ga0495684_0214199 | Ga0495684_0214199_327_857 | 173 |
| 718 | 3300048091 | Ga0495626_0048760 | Ga0495626_0048760_1030_1560 | 173 |
| 719 | 3300048903 | Ga0496100_0605059 | Ga0496100_0605059_149_679 | 173 |
| 720 | 3300048904 | Ga0496101_0019596 | Ga0496101_0019596_2847_3407 | 173 |
| 721 | 3300048905 | Ga0496102_0037417 | Ga0496102_0037417_3302_3862 | 173 |
| 722 | 3300048906 | Ga0496103_0378785 | Ga0496103_0378785_294_854 | 173 |
| 723 | 3300048907 | Ga0496104_0051283 | Ga0496104_0051283_1108_1668 | 173 |
| 724 | 3300048907 | Ga0496104_0768246 | Ga0496104_0768246_112_642 | 173 |
| 725 | 3300048908 | Ga0496105_0108099 | Ga0496105_0108099_878_1408 | 173 |
| 726 | 3300048908 | Ga0496105_0300546 | Ga0496105_0300546_377_907 | 173 |
| 727 | 3300048909 | Ga0496106_0042882 | Ga0496106_0042882_1358_1918 | 173 |
| 728 | 3300048909 | Ga0496106_0693557 | Ga0496106_0693557_198_728 | 173 |
| 729 | 3300048909 | Ga0496106_1275042 | Ga0496106_1275042_29_559 | 173 |
| 730 | 3300048910 | Ga0496107_0015263 | Ga0496107_0015263_2136_2696 | 173 |
| 731 | 3300048911 | Ga0496108_0071263 | Ga0496108_0071263_1978_2508 | 173 |
| 732 | 3300048911 | Ga0496108_0497998 | Ga0496108_0497998_249_779 | 173 |
| 733 | 3300048912 | Ga0496109_0122624 | Ga0496109_0122624_479_1009 | 173 |
| 734 | 3300048912 | Ga0496109_0130713 | Ga0496109_0130713_584_1144 | 173 |
| 735 | 3300048913 | Ga0496110_0098506 | Ga0496110_0098506_1219_1779 | 173 |
| 736 | 3300048913 | Ga0496110_0342255 | Ga0496110_0342255_312_842 | 173 |
| 737 | 3300048913 | Ga0496110_0535288 | Ga0496110_0535288_304_834 | 173 |
| 738 | 3300048913 | Ga0496110_1364294 | Ga0496110_1364294_36_566 | 173 |
| 739 | 3300048914 | Ga0496111_0046517 | Ga0496111_0046517_1956_2516 | 173 |
| 740 | 3300048915 | Ga0496112_0111756 | Ga0496112_0111756_68_598 | 173 |
| 741 | 3300048915 | Ga0496112_0285050 | Ga0496112_0285050_34_594 | 173 |
| 742 | 3300048915 | Ga0496112_0490455 | Ga0496112_0490455_327_887 | 173 |
| 743 | 3300048916 | Ga0496113_0022247 | Ga0496113_0022247_147_707 | 173 |
| 744 | 3300048916 | Ga0496113_0104759 | Ga0496113_0104759_274_834 | 173 |
| 745 | 3300048917 | Ga0496114_0023038 | Ga0496114_0023038_1316_1876 | 173 |
| 746 | 3300048917 | Ga0496114_0189226 | Ga0496114_0189226_861_1391 | 173 |
| 747 | 3300048918 | Ga0496115_0056268 | Ga0496115_0056268_1566_2126 | 173 |
| 748 | 3300049571 | Ga0501034_0623081 | Ga0501034_0623081_117_650 | 173 |
| 749 | 3300049580 | Ga0501046_0161765 | Ga0501046_0161765_541_1074 | 173 |
| 750 | 3300049581 | Ga0501047_0006119 | Ga0501047_0006119_4029_4562 | 173 |
| 751 | 3300049585 | Ga0501069_0004773 | Ga0501069_0004773_166_699 | 173 |
| 752 | 3300049586 | Ga0501070_0070069 | Ga0501070_0070069_279_812 | 173 |
| 753 | 3300049588 | Ga0501072_0247331 | Ga0501072_0247331_857_1390 | 173 |
| 754 | 3300049589 | Ga0501073_0006933 | Ga0501073_0006933_1085_1618 | 173 |
| 755 | 3300049590 | Ga0501074_0000154 | Ga0501074_0000154_6571_7104 | 173 |
| 756 | 3300049672 | Ga0501239_007686 | Ga0501239_007686_336_866 | 173 |
| 757 | 3300049741 | Ga0501079_0064641 | Ga0501079_0064641_997_1530 | 173 |
| 758 | 3300049742 | Ga0501080_0005032 | Ga0501080_0005032_7818_8351 | 173 |
| 759 | 3300049744 | Ga0501083_0000323 | Ga0501083_0000323_24516_25049 | 173 |
| 760 | 3300049762 | Ga0501265_002194 | Ga0501265_002194_1288_1818 | 173 |
| 761 | 3300049823 | Ga0501044_0028237 | Ga0501044_0028237_245_778 | 173 |
| 762 | 3300050493 | nmdc:mga0k408_20345_c2 | nmdc:mga0k408_20345_c2_1975_2505 | 173 |
| 763 | 3300050507 | nmdc:mga05p37_3648_c1 | nmdc:mga05p37_3648_c1_14866_15396 | 173 |
| 764 | 3300050508 | nmdc:mga09592_970944_c1 | nmdc:mga09592_970944_c1_14_574 | 173 |
| 765 | 3300050510 | nmdc:mga06r32_1508637_c1 | nmdc:mga06r32_1508637_c1_56_586 | 173 |
| 766 | 3300050511 | nmdc:mga08y16_10350_c1 | nmdc:mga08y16_10350_c1_2925_3455 | 173 |
| 767 | 3300050511 | nmdc:mga08y16_386_c1 | nmdc:mga08y16_386_c1_3572_4102 | 173 |
| 768 | 3300050511 | nmdc:mga08y16_396818_c1 | nmdc:mga08y16_396818_c1_376_906 | 173 |
| 769 | 3300050513 | nmdc:mga0rr50_443265_c1 | nmdc:mga0rr50_443265_c1_537_1067 | 173 |
| 770 | 3300050515 | nmdc:mga0a205_238006_c1 | nmdc:mga0a205_238006_c1_943_1473 | 173 |
| 771 | 3300050515 | nmdc:mga0a205_366208_c1 | nmdc:mga0a205_366208_c1_293_823 | 173 |
| 772 | 3300050515 | nmdc:mga0a205_597109_c1 | nmdc:mga0a205_597109_c1_182_742 | 173 |
| 773 | 3300053077 | Ga0495601_0171470 | Ga0495601_0171470_726_1304 | 173 |
| 774 | 3300053077 | Ga0495601_0345695 | Ga0495601_0345695_227_772 | 173 |
| 775 | 3300053078 | Ga0495612_0111179 | Ga0495612_0111179_547_1077 | 173 |
| 776 | 3300053084 | Ga0495595_0364007 | Ga0495595_0364007_159_689 | 173 |
| 777 | 3300053085 | Ga0495619_0089451 | Ga0495619_0089451_471_1049 | 173 |
| 778 | 3300053085 | Ga0495619_0152669 | Ga0495619_0152669_710_1240 | 173 |
| 779 | 3300053086 | Ga0500578_0173163 | Ga0500578_0173163_403_933 | 173 |
| 780 | 3300053088 | Ga0500644_0040479 | Ga0500644_0040479_883_1416 | 173 |
| 781 | 3300053092 | Ga0500583_0140249 | Ga0500583_0140249_417_947 | 173 |
| 782 | 3300053093 | Ga0500651_0117401 | Ga0500651_0117401_931_1464 | 173 |
| 783 | 3300053131 | Ga0500652_062352 | Ga0500652_062352_902_1432 | 173 |
| 784 | 3300053133 | Ga0500655_011256 | Ga0500655_011256_242_772 | 173 |
| 785 | 3300053136 | Ga0500559_0000138 | Ga0500559_0000138_8500_9033 | 173 |
| 786 | 3300053139 | Ga0500568_0125805 | Ga0500568_0125805_392_925 | 173 |
| 787 | 3300053154 | Ga0500619_154586 | Ga0500619_154586_31_561 | 173 |
| 788 | 3300053156 | Ga0500622_0027122 | Ga0500622_0027122_1253_1786 | 173 |
| 789 | 3300053177 | Ga0500636_0041980 | Ga0500636_0041980_1212_1742 | 173 |
| 790 | 3300053730 | Ga0500645_008228 | Ga0500645_008228_594_1124 | 173 |
| 791 | 3300053739 | Ga0500587_002360 | Ga0500587_002360_899_1429 | 173 |
| 792 | 3300053739 | Ga0500587_031393 | Ga0500587_031393_17_547 | 173 |
| 793 | 3300054114 | Ga0501084_0112102 | Ga0501084_0112102_212_745 | 173 |
| 794 | 3300060353 | Ga0501082_0060312 | Ga0501082_0060312_1178_1711 | 173 |
| 795 | 3300005331 | Ga0070670_100081717 | Ga0070670_1000817171 | 174 |
| 796 | 3300005344 | Ga0070661_100128221 | Ga0070661_1001282213 | 174 |
| 797 | 3300005364 | Ga0070673_100582630 | Ga0070673_1005826302 | 174 |
| 798 | 3300005365 | Ga0070688_100312538 | Ga0070688_1003125382 | 174 |
| 799 | 3300005444 | Ga0070694_100721490 | Ga0070694_1007214902 | 174 |
| 800 | 3300005545 | Ga0070695_100255375 | Ga0070695_1002553752 | 174 |
| 801 | 3300005547 | Ga0070693_100660652 | Ga0070693_1006606522 | 174 |
| 802 | 3300006186 | Ga0075369_10057690 | Ga0075369_100576902 | 174 |
| 803 | 3300009551 | Ga0105238_10023451 | Ga0105238_100234516 | 174 |
| 804 | 3300009553 | Ga0105249_11137211 | Ga0105249_111372112 | 174 |
| 805 | 3300011119 | Ga0105246_10590374 | Ga0105246_105903741 | 174 |
| 806 | 3300025250 | Ga0209026_1003689 | Ga0209026_10036892 | 174 |
| 807 | 3300025909 | Ga0207705_10106325 | Ga0207705_101063254 | 174 |
| 808 | 3300026041 | Ga0207639_11195829 | Ga0207639_111958291 | 174 |
| 809 | 3300028381 | Ga0268264_10072300 | Ga0268264_100723002 | 174 |
| 810 | 3300028794 | Ga0307515_10000026 | Ga0307515_100000263 | 174 |
| 811 | 3300031665 | Ga0316575_10013115 | Ga0316575_100131153 | 174 |
| 812 | 3300031665 | Ga0316575_10121945 | Ga0316575_101219452 | 174 |
| 813 | 3300031665 | Ga0316575_10176598 | Ga0316575_101765982 | 174 |
| 814 | 3300031691 | Ga0316579_10006968 | Ga0316579_100069682 | 174 |
| 815 | 3300031691 | Ga0316579_10016583 | Ga0316579_100165834 | 174 |
| 816 | 3300031728 | Ga0316578_10003640 | Ga0316578_100036403 | 174 |
| 817 | 3300031733 | Ga0316577_10073697 | Ga0316577_100736973 | 174 |
| 818 | 3300032137 | Ga0316585_10033270 | Ga0316585_100332702 | 174 |
| 819 | 3300032168 | Ga0316593_10006586 | Ga0316593_100065862 | 174 |
| 820 | 3300035092 | Ga0373952_0035000 | Ga0373952_0035000_289_852 | 174 |
| 821 | 3300035398 | Ga0316574_0047043 | Ga0316574_0047043_1725_2249 | 174 |
| 822 | 3300035691 | Ga0373931_0204860 | Ga0373931_0204860_277_813 | 174 |
| 823 | 3300035725 | Ga0373947_0653299 | Ga0373947_0653299_41_574 | 174 |
| 824 | 3300036647 | Ga0316582_0001711 | Ga0316582_0001711_6981_7505 | 174 |
| 825 | 3300036647 | Ga0316582_0028351 | Ga0316582_0028351_2202_2735 | 174 |
| 826 | 3300036712 | Ga0316584_0058622 | Ga0316584_0058622_1401_1934 | 174 |
| 827 | 3300037588 | Ga0316581_0003897 | Ga0316581_0003897_1630_2154 | 174 |
| 828 | 3300037588 | Ga0316581_0006691 | Ga0316581_0006691_1076_1609 | 174 |
| 829 | 3300038443 | Ga0395901_0143025 | Ga0395901_0143025_1724_2272 | 174 |
| 830 | 3300042129 | Ga0450891_019829 | Ga0450891_019829_31_564 | 174 |
| 831 | 3300042876 | Ga0451577_0006056 | Ga0451577_0006056_6703_7227 | 174 |
| 832 | 3300044673 | Ga0453683_0002919 | Ga0453683_0002919_5961_6485 | 174 |
| 833 | 3300044712 | Ga0453684_0023590 | Ga0453684_0023590_1155_1679 | 174 |
| 834 | 3300045051 | Ga0451576_0009861 | Ga0451576_0009861_3787_4311 | 174 |
| 835 | 3300046461 | Ga0495641_0413046 | Ga0495641_0413046_14_547 | 174 |
| 836 | 3300046517 | Ga0495630_0185078 | Ga0495630_0185078_1030_1566 | 174 |
| 837 | 3300046526 | Ga0495666_0176388 | Ga0495666_0176388_430_966 | 174 |
| 838 | 3300046689 | Ga0495613_0448882 | Ga0495613_0448882_40_573 | 174 |
| 839 | 3300046690 | Ga0495624_0005244 | Ga0495624_0005244_2838_3374 | 174 |
| 840 | 3300047321 | Ga0495676_0071019 | Ga0495676_0071019_833_1369 | 174 |
| 841 | 3300047673 | Ga0495593_0052778 | Ga0495593_0052778_570_1103 | 174 |
| 842 | 3300048904 | Ga0496101_0103838 | Ga0496101_0103838_329_865 | 174 |
| 843 | 3300048908 | Ga0496105_0833301 | Ga0496105_0833301_12_548 | 174 |
| 844 | 3300049568 | Ga0501031_0018528 | Ga0501031_0018528_1915_2442 | 174 |
| 845 | 3300049572 | Ga0501036_0040574 | Ga0501036_0040574_3277_3804 | 174 |
| 846 | 3300049573 | Ga0501037_0109148 | Ga0501037_0109148_1147_1674 | 174 |
| 847 | 3300049582 | Ga0501048_0035242 | Ga0501048_0035242_1526_2053 | 174 |
| 848 | 3300049582 | Ga0501048_0327910 | Ga0501048_0327910_151_732 | 174 |
| 849 | 3300049822 | Ga0501035_0605827 | Ga0501035_0605827_73_600 | 174 |
| 850 | 3300049824 | Ga0501045_0666890 | Ga0501045_0666890_126_707 | 174 |
| 851 | 3300005467 | Ga0070706_100508506 | Ga0070706_1005085062 | 175 |
| 852 | 3300006847 | Ga0075431_100010552 | Ga0075431_1000105526 | 175 |
| 853 | 3300044658 | Ga0466972_0007540 | Ga0466972_0007540_2367_2894 | 175 |
| 854 | 3300044683 | Ga0466965_0003754 | Ga0466965_0003754_3051_3578 | 175 |
| 855 | 3300044706 | Ga0466964_0012646 | Ga0466964_0012646_2143_2670 | 175 |
| 856 | 3300044735 | Ga0466968_0038679 | Ga0466968_0038679_580_1107 | 175 |
| 857 | 3300044901 | Ga0466960_0353715 | Ga0466960_0353715_67_594 | 175 |
| 858 | 3300050510 | nmdc:mga06r32_37367_c1 | nmdc:mga06r32_37367_c1_166_726 | 175 |
| 859 | 3300005331 | Ga0070670_100008874 | Ga0070670_1000088742 | 176 |
| 860 | 3300005563 | Ga0068855_100187330 | Ga0068855_1001873302 | 176 |
| 861 | 3300005615 | Ga0070702_100152382 | Ga0070702_1001523822 | 176 |
| 862 | 3300005618 | Ga0068864_100830578 | Ga0068864_1008305782 | 176 |
| 863 | 3300005842 | Ga0068858_100004346 | Ga0068858_1000043462 | 176 |
| 864 | 3300009174 | Ga0105241_10527663 | Ga0105241_105276632 | 176 |
| 865 | 3300009177 | Ga0105248_10545997 | Ga0105248_105459971 | 176 |
| 866 | 3300014325 | Ga0163163_10021119 | Ga0163163_100211192 | 176 |
| 867 | 3300025949 | Ga0207667_10232482 | Ga0207667_102324822 | 176 |
| 868 | 3300026035 | Ga0207703_10050619 | Ga0207703_100506193 | 176 |
| 869 | 3300026088 | Ga0207641_10083989 | Ga0207641_100839891 | 176 |
| 870 | 3300026088 | Ga0207641_10263864 | Ga0207641_102638641 | 176 |
| 871 | 3300026095 | Ga0207676_10197511 | Ga0207676_101975112 | 176 |
| 872 | 3300031251 | Ga0265327_10001736 | Ga0265327_100017365 | 176 |
| 873 | 3300031251 | Ga0265327_10010729 | Ga0265327_100107294 | 176 |
| 874 | 3300031344 | Ga0265316_10001407 | Ga0265316_1000140723 | 176 |
| 875 | 3300049705 | Ga0501225_0110888 | Ga0501225_0110888_11_565 | 176 |
| 876 | 3300046471 | Ga0495650_0009592 | Ga0495650_0009592_1827_2360 | 177 |
| 877 | 3300032168 | Ga0316593_10013817 | Ga0316593_100138173 | 178 |
| 878 | 3300033529 | Ga0316587_1002653 | Ga0316587_10026533 | 178 |
| 879 | 3300042876 | Ga0451577_0665218 | Ga0451577_0665218_157_708 | 178 |
| 880 | 3300044712 | Ga0453684_0745692 | Ga0453684_0745692_299_850 | 178 |
| 881 | 3300045051 | Ga0451576_0085191 | Ga0451576_0085191_1492_2043 | 178 |
| 882 | 3300003215 | JGI25153J46596_10025878 | JGI25153J46596_100258782 | 179 |
| 883 | 3300009036 | Ga0105244_10000891 | Ga0105244_100008912 | 179 |
| 884 | 3300025245 | Ga0207425_1000433 | Ga0207425_100043321 | 179 |
| 885 | 3300025294 | Ga0209025_1006993 | Ga0209025_10069937 | 179 |
| 886 | 3300025295 | Ga0209564_1000027 | Ga0209564_100002744 | 179 |
| 887 | 3300025297 | Ga0209758_1000436 | Ga0209758_100043654 | 179 |
| 888 | 3300025728 | Ga0207655_1006687 | Ga0207655_10066879 | 179 |
| 889 | 3300035114 | Ga0373939_0111111 | Ga0373939_0111111_88_627 | 179 |
| 890 | 3300046452 | Ga0495617_015763 | Ga0495617_015763_1305_1844 | 179 |
| 891 | 3300046471 | Ga0495650_0000100 | Ga0495650_0000100_43174_43713 | 179 |
| 892 | 3300046471 | Ga0495650_0005611 | Ga0495650_0005611_330_869 | 179 |
| 893 | 3300046501 | Ga0495607_0010628 | Ga0495607_0010628_5554_6093 | 179 |
| 894 | 3300046512 | Ga0495610_0002542 | Ga0495610_0002542_11250_11789 | 179 |
| 895 | 3300046512 | Ga0495610_0148713 | Ga0495610_0148713_22_561 | 179 |
| 896 | 3300046524 | Ga0495648_0050687 | Ga0495648_0050687_780_1319 | 179 |
| 897 | 3300046558 | Ga0495633_0005786 | Ga0495633_0005786_4729_5268 | 179 |
| 898 | 3300046616 | Ga0495668_0000286 | Ga0495668_0000286_22730_23269 | 179 |
| 899 | 3300046616 | Ga0495668_0002018 | Ga0495668_0002018_16121_16660 | 179 |
| 900 | 3300046694 | Ga0495649_0118313 | Ga0495649_0118313_179_718 | 179 |
| 901 | 3300047469 | Ga0495673_0000080 | Ga0495673_0000080_169209_169748 | 179 |
| 902 | 3300047469 | Ga0495673_0066497 | Ga0495673_0066497_264_803 | 179 |
| 903 | 3300047472 | Ga0495686_0005098 | Ga0495686_0005098_9518_10057 | 179 |
| 904 | 3300048910 | Ga0496107_0164021 | Ga0496107_0164021_915_1454 | 179 |
| 905 | 3300048919 | Ga0496116_0007031 | Ga0496116_0007031_5706_6245 | 179 |
| 906 | 3300048927 | Ga0496124_0090236 | Ga0496124_0090236_1065_1604 | 179 |
| 907 | 3300048927 | Ga0496124_0146409 | Ga0496124_0146409_989_1528 | 179 |
| 908 | 3300048928 | Ga0496125_0105200 | Ga0496125_0105200_250_789 | 179 |
| 909 | 3300053118 | Ga0500594_0018882 | Ga0500594_0018882_974_1513 | 179 |
| 910 | 3300053125 | Ga0500618_069032 | Ga0500618_069032_40_579 | 179 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2b1k-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9419 | 29 | 175 |
| 2g0f-assembly1.cif.gz_A | crystal structure of p144a mutant of e.coli ccmg protein | 0.9372 | 29 | 175 |
| 1z5y-assembly1.cif.gz_E | crystal structure of the disulfide-linked complex between the n-terminal domain of the electron transfer catalyst dsbd and the cytochrome c biogenesis protein ccmg | 0.9342 | 43 | 175 |
| 2b1k-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9238 | 29 | 175 |
| 3k8n-assembly1.cif.gz_A | crystal structure of e. coli ccmg | 0.921 | 24 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2b1kA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9418 | 29 | 175 | 3.40.30.10 |
| 2b1kA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9238 | 29 | 175 | 3.40.30.10 |
| 1kngA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9199 | 36 | 172 | 3.40.30.10 |
| 3iosA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.875 | 41 | 172 | 3.40.30.10 |
| 1kngA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8709 | 36 | 172 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0X5A7-F1-model_v4 | DsbE family thiol:disulfide interchange protein | 0.9894 | 34 | 174 |
GO:0015036
GO:0017004 GO:0030288 |
| AF-A0A1H7XPN3-F1-model_v4 | Cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE | 0.9814 | 21 | 173 |
GO:0015036
GO:0017004 GO:0030288 |
| AF-A0A536Z3B2-F1-model_v4 | DsbE family thiol:disulfide interchange protein | 0.9756 | 70 | 172 |
GO:0015036
GO:0017004 GO:0030288 |
| AF-A0A7W0X5A7-F1-model_v4 | DsbE family thiol:disulfide interchange protein | 0.9756 | 34 | 174 |
GO:0015036
GO:0017004 GO:0030288 |
| AF-A0A3M0YK98-F1-model_v4 | DsbE family thiol:disulfide interchange protein | 0.9714 | 56 | 175 |
GO:0005886
GO:0015036 GO:0017004 GO:0030288 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar