F485434

General Info

Members Datasets Scaffolds Average Seq Length
910 391 909 178

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100004346|Ga0068858_1000043462
Length 198
Sequence MTDTTTAPTAKAVANGSKPSGSRWRYFVPLAIFVVVLIFLGVGLKLDPREVPSPFIGKPAPAFSLPRLERPESPISKADMQGKVWLLNVWASWCVTCREEHPVLLSLSKTGVVPIVGLNYKDERNEGLRWLNQFGNPYQTSAYDHEGKTGIDYGVYGVPETFVIDKQGVVRYKQIGAVTEEALNKKILPLVKQLNAES

Samples

Sample ID Description Type Environment
1 2643221660 Methylibium sp. Root1272 Isolate Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
121 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
192 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
193 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
199 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
200 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
201 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
206 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
210 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
211 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
216 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
217 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
218 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
219 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
220 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
221 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
222 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
223 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
224 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
225 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
226 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
232 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
233 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
236 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
237 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
238 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
239 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
246 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
253 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
254 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
255 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
256 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
257 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
258 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
259 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
260 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
263 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
264 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
269 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
270 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
274 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
275 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
278 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
279 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
282 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
285 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
286 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
287 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
288 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
291 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
292 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
293 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
301 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
305 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
306 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
332 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
335 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
345 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
346 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
347 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
348 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
349 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
350 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
351 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
352 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
353 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
354 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
358 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
359 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
360 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
361 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
370 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
374 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
375 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
376 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
377 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
378 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
379 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
380 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
381 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
382 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
383 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
384 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
385 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
386 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
387 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
388 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
389 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
390 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
391 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.55
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.85
Nodule 0
Rhizoplane 3.63
Rhizosphere 88.57
Stem 0
Stem Tuber 0
Unclassified 3.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10025878 3300003215 Bacteria 2088
2 Ga0065715_10174637 3300005293 Bacteria 1521
3 Ga0065707_10229911 3300005295 Bacteria 1192
4 Ga0070658_10085898 3300005327 Bacteria 2588
5 Ga0070658_10959302 3300005327 Bacteria 744
6 Ga0070676_10010065 3300005328 Bacteria 5122
7 Ga0070676_10135391 3300005328 Bacteria 1562
8 Ga0070676_10238731 3300005328 Bacteria 1208
9 Ga0070676_10375122 3300005328 Bacteria 984
10 Ga0070683_100778780 3300005329 Bacteria 917
11 Ga0070690_100114705 3300005330 Bacteria 1802
12 Ga0070690_100506979 3300005330 Bacteria 904
13 Ga0070670_100001774 3300005331 Bacteria 17573
14 Ga0070670_100008874 3300005331 Bacteria 8581
15 Ga0070670_100037091 3300005331 Bacteria 4194
16 Ga0070670_100081717 3300005331 Bacteria 2776
17 Ga0070670_100126728 3300005331 Bacteria 2204
18 Ga0070670_100134714 3300005331 Bacteria 2134
19 Ga0070670_100200183 3300005331 Bacteria 1735
20 Ga0070670_100278084 3300005331 Bacteria 1462
21 Ga0070670_100625434 3300005331 Bacteria 964
22 Ga0070677_10007318 3300005333 Bacteria 3683
23 Ga0070677_10089341 3300005333 Bacteria 1337
24 Ga0070677_10335462 3300005333 Bacteria 779
25 Ga0068869_100008578 3300005334 Bacteria 6598
26 Ga0068869_100009021 3300005334 Bacteria 6463
27 Ga0070666_10005482 3300005335 Bacteria 7780
28 Ga0070666_10008568 3300005335 Bacteria 6353
29 Ga0070666_10300134 3300005335 Bacteria 1144
30 Ga0070666_10323814 3300005335 Bacteria 1100
31 Ga0070666_10377329 3300005335 Bacteria 1017
32 Ga0070680_100120410 3300005336 Bacteria 2191
33 Ga0070682_100029929 3300005337 Bacteria 3282
34 Ga0070682_100824307 3300005337 Bacteria 756
35 Ga0068868_100016008 3300005338 Bacteria 5561
36 Ga0068868_100043629 3300005338 Bacteria 3503
37 Ga0068868_100142537 3300005338 Bacteria 1968
38 Ga0068868_100614279 3300005338 Bacteria 964
39 Ga0070660_100200407 3300005339 Bacteria 1619
40 Ga0070689_100051421 3300005340 Bacteria 3186
41 Ga0070687_100034731 3300005343 Bacteria 2498
42 Ga0070687_100350461 3300005343 Bacteria 953
43 Ga0070661_100128221 3300005344 Bacteria 1904
44 Ga0070661_100217152 3300005344 Bacteria 1465
45 Ga0070661_100395025 3300005344 Bacteria 1092
46 Ga0070661_100669562 3300005344 Bacteria 844
47 Ga0070692_10188529 3300005345 Bacteria 1200
48 Ga0070692_10196477 3300005345 Bacteria 1179
49 Ga0070668_100007130 3300005347 Bacteria 8283
50 Ga0070668_100008167 3300005347 Bacteria 7773
51 Ga0070668_101174839 3300005347 Bacteria 695
52 Ga0070669_100001340 3300005353 Bacteria 17754
53 Ga0070669_100077959 3300005353 Bacteria 2462
54 Ga0070669_100082105 3300005353 Bacteria 2402
55 Ga0070669_100106163 3300005353 Bacteria 2125
56 Ga0070669_100877121 3300005353 Bacteria 766
57 Ga0070675_100002913 3300005354 Bacteria 12900
58 Ga0070675_100014979 3300005354 Bacteria 6124
59 Ga0070675_100045658 3300005354 Bacteria 3585
60 Ga0070675_100061046 3300005354 Bacteria 3112
61 Ga0070675_100061075 3300005354 Bacteria 3112
62 Ga0070675_100245133 3300005354 Bacteria 1566
63 Ga0070675_100368617 3300005354 Bacteria 1276
64 Ga0070671_100009693 3300005355 Bacteria 7738
65 Ga0070671_100039335 3300005355 Bacteria 3926
66 Ga0070671_100049845 3300005355 Bacteria 3484
67 Ga0070671_100066223 3300005355 Bacteria 3010
68 Ga0070671_100099621 3300005355 Bacteria 2438
69 Ga0070671_100533158 3300005355 Bacteria 1011
70 Ga0070674_100013491 3300005356 Bacteria 5053
71 Ga0070674_100210755 3300005356 Bacteria 1506
72 Ga0070674_100222853 3300005356 Bacteria 1468
73 Ga0070673_100000512 3300005364 Bacteria 20784
74 Ga0070673_100075466 3300005364 Bacteria 2719
75 Ga0070673_100138585 3300005364 Bacteria 2050
76 Ga0070673_100186331 3300005364 Bacteria 1779
77 Ga0070673_100582630 3300005364 Bacteria 1019
78 Ga0070673_101321070 3300005364 Bacteria 677
79 Ga0070688_100092460 3300005365 Bacteria 1979
80 Ga0070688_100312538 3300005365 Bacteria 1139
81 Ga0070659_100089809 3300005366 Bacteria 2462
82 Ga0070659_100234621 3300005366 Bacteria 1517
83 Ga0070667_100000219 3300005367 Bacteria 66264
84 Ga0070667_100004388 3300005367 Bacteria 11903
85 Ga0070667_100006263 3300005367 Bacteria 9893
86 Ga0070667_100116780 3300005367 Bacteria 2317
87 Ga0070667_100407910 3300005367 Bacteria 1237
88 Ga0070714_100713512 3300005435 Bacteria 968
89 Ga0070713_100000028 3300005436 Bacteria 93227
90 Ga0070713_100026620 3300005436 Bacteria 4543
91 Ga0070713_100070549 3300005436 Bacteria 2950
92 Ga0070701_10110217 3300005438 Bacteria 1537
93 Ga0070705_101430343 3300005440 Unclassified 577
94 Ga0070694_100721490 3300005444 Bacteria 812
95 Ga0070694_100960509 3300005444 Bacteria 708
96 Ga0070708_100054134 3300005445 Bacteria 3563
97 Ga0070663_100144025 3300005455 Bacteria 1822
98 Ga0070663_100596414 3300005455 Bacteria 928
99 Ga0070678_100004036 3300005456 Bacteria 8264
100 Ga0070678_100015086 3300005456 Bacteria 4898
101 Ga0070678_100165208 3300005456 Bacteria 1797
102 Ga0070678_100216738 3300005456 Bacteria 1589
103 Ga0070678_100488605 3300005456 Bacteria 1084
104 Ga0070678_100661813 3300005456 Bacteria 938
105 Ga0070662_100008433 3300005457 Bacteria 6718
106 Ga0070662_100016652 3300005457 Bacteria 4939
107 Ga0070662_100172931 3300005457 Bacteria 1697
108 Ga0070662_100225535 3300005457 Bacteria 1497
109 Ga0070662_100575486 3300005457 Bacteria 945
110 Ga0070681_10063643 3300005458 Bacteria 3660
111 Ga0070681_10522094 3300005458 Bacteria 1101
112 Ga0070681_10975496 3300005458 Bacteria 767
113 Ga0068867_100011339 3300005459 Bacteria 6288
114 Ga0068867_100015106 3300005459 Bacteria 5475
115 Ga0068867_100292330 3300005459 Bacteria 1340
116 Ga0068867_100774755 3300005459 Bacteria 853
117 Ga0070685_10705933 3300005466 Bacteria 736
118 Ga0070706_100001448 3300005467 Bacteria 24954
119 Ga0070706_100326532 3300005467 Bacteria 1431
120 Ga0070706_100508506 3300005467 Bacteria 1121
121 Ga0070707_100323745 3300005468 Bacteria 1498
122 Ga0070707_100704259 3300005468 Bacteria 973
123 Ga0070698_100030267 3300005471 Bacteria 5614
124 Ga0070699_100136837 3300005518 Bacteria 2161
125 Ga0070699_100810224 3300005518 Bacteria 857
126 Ga0070679_100058970 3300005530 Bacteria 3825
127 Ga0070684_100009252 3300005535 Bacteria 7753
128 Ga0070684_100191604 3300005535 Bacteria 1860
129 Ga0070697_100014972 3300005536 Bacteria 6087
130 Ga0068853_100082726 3300005539 Bacteria 2812
131 Ga0068853_100377273 3300005539 Bacteria 1324
132 Ga0068853_100495111 3300005539 Bacteria 1153
133 Ga0068853_101111483 3300005539 Bacteria 762
134 Ga0068853_101276310 3300005539 Bacteria 710
135 Ga0068853_101637011 3300005539 Bacteria 624
136 Ga0070672_100002366 3300005543 Bacteria 11936
137 Ga0070672_100025703 3300005543 Bacteria 4371
138 Ga0070672_100029191 3300005543 Bacteria 4134
139 Ga0070672_100066644 3300005543 Bacteria 2851
140 Ga0070672_100128821 3300005543 Bacteria 2078
141 Ga0070686_100152088 3300005544 Bacteria 1622
142 Ga0070695_100255375 3300005545 Bacteria 1278
143 Ga0070693_100070359 3300005547 Bacteria 2059
144 Ga0070693_100151701 3300005547 Bacteria 1468
145 Ga0070693_100660652 3300005547 Bacteria 761
146 Ga0070665_100108558 3300005548 Bacteria 2777
147 Ga0070665_100245877 3300005548 Bacteria 1789
148 Ga0070704_100239853 3300005549 Bacteria 1483
149 Ga0068855_100019481 3300005563 Bacteria 8153
150 Ga0068855_100050674 3300005563 Bacteria 4891
151 Ga0068855_100187330 3300005563 Bacteria 2336
152 Ga0070664_100099293 3300005564 Bacteria 2530
153 Ga0070664_100200527 3300005564 Bacteria 1780
154 Ga0070664_100232282 3300005564 Bacteria 1653
155 Ga0070664_100322726 3300005564 Bacteria 1399
156 Ga0070664_100388722 3300005564 Bacteria 1274
157 Ga0070664_100826180 3300005564 Bacteria 867
158 Ga0068857_100061526 3300005577 Bacteria 3335
159 Ga0068857_100272538 3300005577 Bacteria 1555
160 Ga0068857_100611362 3300005577 Bacteria 1031
161 Ga0068854_100022758 3300005578 Bacteria 4275
162 Ga0068854_100071773 3300005578 Bacteria 2534
163 Ga0070702_100152382 3300005615 Bacteria 1485
164 Ga0068852_100047446 3300005616 Bacteria 3664
165 Ga0068852_100049622 3300005616 Bacteria 3591
166 Ga0068852_100114805 3300005616 Bacteria 2454
167 Ga0068852_100131355 3300005616 Bacteria 2306
168 Ga0068852_100137485 3300005616 Bacteria 2257
169 Ga0068852_100146060 3300005616 Bacteria 2194
170 Ga0068852_100176780 3300005616 Bacteria 2005
171 Ga0068852_100471228 3300005616 Bacteria 1246
172 Ga0068859_100032866 3300005617 Bacteria 5212
173 Ga0068859_100052964 3300005617 Bacteria 4081
174 Ga0068859_100325184 3300005617 Bacteria 1632
175 Ga0068864_100006724 3300005618 Bacteria 9420
176 Ga0068864_100009050 3300005618 Bacteria 8209
177 Ga0068864_100016929 3300005618 Bacteria 6074
178 Ga0068864_100024031 3300005618 Bacteria 5123
179 Ga0068864_100028258 3300005618 Bacteria 4739
180 Ga0068864_100032800 3300005618 Bacteria 4414
181 Ga0068864_100051430 3300005618 Bacteria 3549
182 Ga0068864_100095552 3300005618 Bacteria 2628
183 Ga0068864_100180700 3300005618 Bacteria 1929
184 Ga0068864_100312486 3300005618 Bacteria 1473
185 Ga0068864_100830578 3300005618 Bacteria 909
186 Ga0068866_10004159 3300005718 Bacteria 5934
187 Ga0068861_100000757 3300005719 Bacteria 19364
188 Ga0068861_100016694 3300005719 Bacteria 5200
189 Ga0068861_100055464 3300005719 Bacteria 3021
190 Ga0068861_100305984 3300005719 Bacteria 1379
191 Ga0068851_10012597 3300005834 Bacteria 3990
192 Ga0068851_10150229 3300005834 Bacteria 1273
193 Ga0068870_10305377 3300005840 Bacteria 1006
194 Ga0068863_100000585 3300005841 Bacteria 37128
195 Ga0068863_100030558 3300005841 Bacteria 5143
196 Ga0068863_100042606 3300005841 Bacteria 4313
197 Ga0068863_100115425 3300005841 Bacteria 2558
198 Ga0068863_100144088 3300005841 Bacteria 2278
199 Ga0068863_100691333 3300005841 Bacteria 1013
200 Ga0068858_100002981 3300005842 Bacteria 16991
201 Ga0068858_100003791 3300005842 Bacteria 14951
202 Ga0068858_100004338 3300005842 Bacteria 13920
203 Ga0068858_100004346 3300005842 Bacteria 13910
204 Ga0068860_100009426 3300005843 Bacteria 9703
205 Ga0068860_100052427 3300005843 Bacteria 3880
206 Ga0068860_100412436 3300005843 Bacteria 1338
207 Ga0068860_101333212 3300005843 Bacteria 739
208 Ga0068862_100010864 3300005844 Bacteria 7518
209 Ga0068862_100017376 3300005844 Bacteria 5990
210 Ga0068862_100065393 3300005844 Bacteria 3132
211 Ga0068862_100093051 3300005844 Bacteria 2628
212 Ga0081539_10048422 3300005985 Bacteria 2418
213 Ga0075368_10105044 3300006042 Bacteria 1162
214 Ga0070715_10019021 3300006163 Bacteria 2627
215 Ga0070716_100008353 3300006173 Bacteria 5135
216 Ga0070716_100143199 3300006173 Bacteria 1528
217 Ga0070716_100413934 3300006173 Bacteria 973
218 Ga0070716_100766110 3300006173 Bacteria 744
219 Ga0070712_100231807 3300006175 Bacteria 1467
220 Ga0075367_10007169 3300006178 Bacteria 5690
221 Ga0075369_10057690 3300006186 Bacteria 1689
222 Ga0075369_10318089 3300006186 Bacteria 728
223 Ga0075366_10057252 3300006195 Bacteria 2317
224 Ga0075366_10149429 3300006195 Bacteria 1414
225 Ga0097621_100049628 3300006237 Bacteria 3410
226 Ga0097621_100060666 3300006237 Bacteria 3101
227 Ga0097621_100090975 3300006237 Bacteria 2554
228 Ga0097621_100097413 3300006237 Bacteria 2470
229 Ga0097621_100104799 3300006237 Bacteria 2383
230 Ga0097621_100110135 3300006237 Bacteria 2326
231 Ga0097621_100132153 3300006237 Bacteria 2126
232 Ga0097621_100214730 3300006237 Bacteria 1674
233 Ga0097621_100786467 3300006237 Bacteria 881
234 Ga0075370_10040382 3300006353 Bacteria 2631
235 Ga0068871_100024895 3300006358 Bacteria 4648
236 Ga0068871_100032966 3300006358 Bacteria 4096
237 Ga0068871_100046861 3300006358 Bacteria 3483
238 Ga0068871_100111728 3300006358 Bacteria 2299
239 Ga0068871_100177785 3300006358 Bacteria 1827
240 Ga0068871_100205149 3300006358 Bacteria 1703
241 Ga0068871_100352208 3300006358 Bacteria 1302
242 Ga0075428_100009252 3300006844 Bacteria 10926
243 Ga0075430_100100678 3300006846 Bacteria 2413
244 Ga0075431_100010552 3300006847 Bacteria 9287
245 Ga0075433_10138514 3300006852 Bacteria 2163
246 Ga0075433_10243015 3300006852 Bacteria 1598
247 Ga0075433_10281894 3300006852 Bacteria 1472
248 Ga0075429_100006162 3300006880 Bacteria 10369
249 Ga0075429_100752140 3300006880 Bacteria 854
250 Ga0097620_100032866 3300006931 Bacteria 5212
251 Ga0097620_100052964 3300006931 Bacteria 4081
252 Ga0097620_100325184 3300006931 Bacteria 1632
253 Ga0099794_10011178 3300007265 Bacteria 3838
254 Ga0105244_10000891 3300009036 Bacteria 25233
255 Ga0111539_10027065 3300009094 Bacteria 7004
256 Ga0111539_10047083 3300009094 Bacteria 5156
257 Ga0111539_10289361 3300009094 Bacteria 1906
258 Ga0111539_10543011 3300009094 Bacteria 1354
259 Ga0111539_11552050 3300009094 Bacteria 768
260 Ga0105245_10011246 3300009098 Bacteria 7792
261 Ga0105245_10104852 3300009098 Bacteria 2622
262 Ga0105245_10114708 3300009098 Bacteria 2509
263 Ga0105245_10911358 3300009098 Bacteria 921
264 Ga0114129_10000826 3300009147 Bacteria 39997
265 Ga0105243_10007729 3300009148 Bacteria 8267
266 Ga0105243_10074803 3300009148 Bacteria 2748
267 Ga0105243_10173612 3300009148 Bacteria 1869
268 Ga0105243_10843319 3300009148 Bacteria 907
269 Ga0105241_10042664 3300009174 Bacteria 3434
270 Ga0105241_10450054 3300009174 Bacteria 1139
271 Ga0105241_10527663 3300009174 Unclassified 1057
272 Ga0105242_10066268 3300009176 Bacteria 2981
273 Ga0105242_10269659 3300009176 Bacteria 1541
274 Ga0105248_10043019 3300009177 Bacteria 5065
275 Ga0105248_10114677 3300009177 Bacteria 3039
276 Ga0105248_10154030 3300009177 Bacteria 2593
277 Ga0105248_10306196 3300009177 Bacteria 1789
278 Ga0105248_10450138 3300009177 Bacteria 1451
279 Ga0105248_10545997 3300009177 Bacteria 1307
280 Ga0105248_10922451 3300009177 Bacteria 986
281 Ga0105248_10964573 3300009177 Bacteria 963
282 Ga0105248_11157073 3300009177 Bacteria 874
283 Ga0105238_10002565 3300009551 Bacteria 18148
284 Ga0105238_10023451 3300009551 Bacteria 6291
285 Ga0105238_10133924 3300009551 Bacteria 2456
286 Ga0105238_10177742 3300009551 Bacteria 2105
287 Ga0105249_10442469 3300009553 Bacteria 1337
288 Ga0105249_11137211 3300009553 Bacteria 851
289 Ga0099796_10190695 3300010159 Bacteria 827
290 Ga0105239_10121481 3300010375 Bacteria 2901
291 Ga0105239_10981397 3300010375 Bacteria 971
292 Ga0105246_10114536 3300011119 Bacteria 1987
293 Ga0105246_10590374 3300011119 Bacteria 958
294 Ga0157373_10101389 3300013100 Bacteria 2026
295 Ga0157371_10207088 3300013102 Bacteria 1407
296 Ga0157371_10553072 3300013102 Bacteria 853
297 Ga0157370_10020147 3300013104 Bacteria 6666
298 Ga0157370_10089256 3300013104 Bacteria 2896
299 Ga0157369_10001417 3300013105 Bacteria 29468
300 Ga0157374_10073038 3300013296 Bacteria 3238
301 Ga0157374_10130476 3300013296 Bacteria 2432
302 Ga0157374_10142912 3300013296 Bacteria 2323
303 Ga0157374_10548325 3300013296 Bacteria 1164
304 Ga0157374_10765194 3300013296 Bacteria 981
305 Ga0157374_11189143 3300013296 Bacteria 784
306 Ga0157378_10077664 3300013297 Bacteria 2993
307 Ga0157378_11676571 3300013297 Bacteria 682
308 Ga0163162_10004424 3300013306 Bacteria 13529
309 Ga0163162_10038505 3300013306 Bacteria 4771
310 Ga0163162_10493901 3300013306 Bacteria 1355
311 Ga0163162_10657033 3300013306 Bacteria 1172
312 Ga0163162_12071778 3300013306 Bacteria 652
313 Ga0157372_10003179 3300013307 Bacteria 17712
314 Ga0157372_10067327 3300013307 Bacteria 4024
315 Ga0157372_10159008 3300013307 Bacteria 2610
316 Ga0157372_11245422 3300013307 Bacteria 859
317 Ga0157375_10006387 3300013308 Bacteria 10274
318 Ga0157375_10019641 3300013308 Bacteria 6152
319 Ga0157375_10080914 3300013308 Bacteria 3287
320 Ga0157375_10151633 3300013308 Bacteria 2454
321 Ga0157375_10405343 3300013308 Bacteria 1530
322 Ga0157375_10983620 3300013308 Bacteria 984
323 Ga0163163_10021119 3300014325 Bacteria 6142
324 Ga0163163_10031254 3300014325 Bacteria 5138
325 Ga0163163_10034015 3300014325 Bacteria 4933
326 Ga0163163_10164237 3300014325 Bacteria 2266
327 Ga0163163_10555810 3300014325 Bacteria 1210
328 Ga0157380_10012973 3300014326 Bacteria 6057
329 Ga0157380_10022945 3300014326 Bacteria 4706
330 Ga0157380_10027585 3300014326 Bacteria 4319
331 Ga0157380_10133142 3300014326 Bacteria 2124
332 Ga0157380_10233090 3300014326 Bacteria 1655
333 Ga0157377_10063867 3300014745 Bacteria 2110
334 Ga0157377_10267001 3300014745 Bacteria 1116
335 Ga0157379_10004462 3300014968 Bacteria 12005
336 Ga0157379_10024218 3300014968 Bacteria 5388
337 Ga0157379_10061522 3300014968 Bacteria 3357
338 Ga0157379_10092686 3300014968 Bacteria 2710
339 Ga0157379_10099305 3300014968 Bacteria 2613
340 Ga0157379_12186961 3300014968 Bacteria 549
341 Ga0157376_10085585 3300014969 Bacteria 2716
342 Ga0157376_10127747 3300014969 Bacteria 2264
343 Ga0157376_10200701 3300014969 Bacteria 1835
344 Ga0157376_10329469 3300014969 Bacteria 1454
345 Ga0157376_11544961 3300014969 Bacteria 697
346 Ga0163161_10016140 3300017792 Bacteria 5213
347 Ga0163161_10035830 3300017792 Bacteria 3552
348 Ga0163161_10350625 3300017792 Bacteria 1173
349 Ga0213874_10054231 3300021377 Bacteria 1239
350 Ga0213876_10075065 3300021384 Bacteria 1786
351 Ga0213876_10166433 3300021384 Bacteria 1173
352 Ga0207425_1000433 3300025245 Bacteria 27674
353 Ga0209026_1003689 3300025250 Bacteria 4901
354 Ga0209025_1006993 3300025294 Bacteria 8562
355 Ga0209564_1000027 3300025295 Bacteria 518458
356 Ga0209758_1000436 3300025297 Bacteria 70342
357 Ga0207656_10007890 3300025321 Bacteria 3898
358 Ga0207656_10057945 3300025321 Bacteria 1691
359 Ga0207656_10114144 3300025321 Bacteria 1251
360 Ga0207656_10128368 3300025321 Bacteria 1186
361 Ga0207656_10198568 3300025321 Bacteria 968
362 Ga0207655_1006687 3300025728 Bacteria 7598
363 Ga0207682_10002971 3300025893 Bacteria 7440
364 Ga0207682_10028879 3300025893 Bacteria 2216
365 Ga0207682_10052091 3300025893 Bacteria 1696
366 Ga0207682_10267892 3300025893 Bacteria 797
367 Ga0207642_10002689 3300025899 Bacteria 5544
368 Ga0207688_10177615 3300025901 Bacteria 1268
369 Ga0207680_10015539 3300025903 Bacteria 3974
370 Ga0207680_10016326 3300025903 Bacteria 3896
371 Ga0207680_10123465 3300025903 Bacteria 1697
372 Ga0207680_10502161 3300025903 Bacteria 864
373 Ga0207680_10540025 3300025903 Bacteria 832
374 Ga0207645_10005283 3300025907 Bacteria 9402
375 Ga0207645_10031798 3300025907 Bacteria 3393
376 Ga0207645_10046537 3300025907 Bacteria 2771
377 Ga0207645_10051897 3300025907 Bacteria 2620
378 Ga0207643_10095554 3300025908 Bacteria 1737
379 Ga0207705_10019896 3300025909 Bacteria 4801
380 Ga0207705_10057954 3300025909 Bacteria 2795
381 Ga0207705_10068798 3300025909 Bacteria 2564
382 Ga0207705_10106325 3300025909 Bacteria 2070
383 Ga0207705_10482950 3300025909 Bacteria 962
384 Ga0207684_10002129 3300025910 Bacteria 20290
385 Ga0207707_10432043 3300025912 Bacteria 1128
386 Ga0207693_10075058 3300025915 Bacteria 2648
387 Ga0207660_11166078 3300025917 Bacteria 627
388 Ga0207662_10007292 3300025918 Bacteria 6011
389 Ga0207657_10140060 3300025919 Bacteria 1977
390 Ga0207657_10178023 3300025919 Bacteria 1720
391 Ga0207649_10183781 3300025920 Bacteria 1465
392 Ga0207649_10321977 3300025920 Bacteria 1136
393 Ga0207649_10562741 3300025920 Bacteria 873
394 Ga0207652_10172838 3300025921 Bacteria 1939
395 Ga0207652_10646759 3300025921 Bacteria 946
396 Ga0207646_10593066 3300025922 Bacteria 995
397 Ga0207681_10002043 3300025923 Bacteria 12940
398 Ga0207681_10013149 3300025923 Bacteria 5117
399 Ga0207681_10015363 3300025923 Bacteria 4774
400 Ga0207681_10136582 3300025923 Bacteria 1820
401 Ga0207681_10251984 3300025923 Bacteria 1379
402 Ga0207694_10096401 3300025924 Bacteria 2339
403 Ga0207694_10328464 3300025924 Bacteria 1263
404 Ga0207650_10011876 3300025925 Bacteria 6001
405 Ga0207650_10054905 3300025925 Bacteria 2956
406 Ga0207650_10099174 3300025925 Bacteria 2239
407 Ga0207650_10099858 3300025925 Bacteria 2232
408 Ga0207650_10169221 3300025925 Bacteria 1736
409 Ga0207650_10426241 3300025925 Bacteria 1101
410 Ga0207650_10963429 3300025925 Bacteria 725
411 Ga0207659_10000313 3300025926 Bacteria 29491
412 Ga0207659_10055225 3300025926 Bacteria 2839
413 Ga0207659_10108670 3300025926 Bacteria 2104
414 Ga0207659_10132320 3300025926 Bacteria 1927
415 Ga0207659_10267502 3300025926 Bacteria 1393
416 Ga0207659_10456552 3300025926 Bacteria 1077
417 Ga0207687_10046846 3300025927 Bacteria 2995
418 Ga0207687_10222735 3300025927 Bacteria 1486
419 Ga0207687_10296428 3300025927 Bacteria 1301
420 Ga0207700_10000338 3300025928 Bacteria 27628
421 Ga0207700_10032912 3300025928 Bacteria 3704
422 Ga0207700_10100864 3300025928 Bacteria 2302
423 Ga0207664_10942764 3300025929 Bacteria 774
424 Ga0207644_10000517 3300025931 Bacteria 24952
425 Ga0207644_10005549 3300025931 Bacteria 8209
426 Ga0207644_10116617 3300025931 Bacteria 2027
427 Ga0207644_10123428 3300025931 Bacteria 1974
428 Ga0207644_10204918 3300025931 Bacteria 1557
429 Ga0207690_10069010 3300025932 Bacteria 2431
430 Ga0207690_10292890 3300025932 Bacteria 1271
431 Ga0207690_10856079 3300025932 Bacteria 753
432 Ga0207706_10003551 3300025933 Bacteria 14887
433 Ga0207706_10015438 3300025933 Bacteria 6899
434 Ga0207706_10073877 3300025933 Bacteria 2998
435 Ga0207706_10078917 3300025933 Bacteria 2895
436 Ga0207706_10301466 3300025933 Bacteria 1396
437 Ga0207706_10306354 3300025933 Bacteria 1383
438 Ga0207686_10013046 3300025934 Bacteria 4588
439 Ga0207686_10035577 3300025934 Bacteria 2991
440 Ga0207709_10148989 3300025935 Bacteria 1618
441 Ga0207709_10150709 3300025935 Bacteria 1610
442 Ga0207670_10030009 3300025936 Bacteria 3471
443 Ga0207670_10989918 3300025936 Bacteria 707
444 Ga0207669_10015520 3300025937 Bacteria 3843
445 Ga0207669_10167644 3300025937 Bacteria 1559
446 Ga0207669_10434363 3300025937 Bacteria 1036
447 Ga0207669_11028543 3300025937 Bacteria 693
448 Ga0207704_10018901 3300025938 Bacteria 3608
449 Ga0207704_11194656 3300025938 Bacteria 648
450 Ga0207665_10002235 3300025939 Bacteria 13061
451 Ga0207665_10197673 3300025939 Bacteria 1464
452 Ga0207665_10251355 3300025939 Bacteria 1306
453 Ga0207691_10007603 3300025940 Bacteria 10430
454 Ga0207691_10008416 3300025940 Bacteria 9910
455 Ga0207691_10033898 3300025940 Bacteria 4753
456 Ga0207691_10130481 3300025940 Bacteria 2221
457 Ga0207691_10225796 3300025940 Bacteria 1623
458 Ga0207691_10296005 3300025940 Bacteria 1391
459 Ga0207711_10029584 3300025941 Bacteria 4622
460 Ga0207711_10060708 3300025941 Bacteria 3258
461 Ga0207711_10087670 3300025941 Bacteria 2731
462 Ga0207711_10104118 3300025941 Bacteria 2514
463 Ga0207689_10002034 3300025942 Bacteria 19106
464 Ga0207689_10013647 3300025942 Bacteria 6928
465 Ga0207689_10021025 3300025942 Bacteria 5485
466 Ga0207689_10347648 3300025942 Bacteria 1232
467 Ga0207661_10028878 3300025944 Bacteria 4252
468 Ga0207661_10112969 3300025944 Bacteria 2301
469 Ga0207679_10182092 3300025945 Bacteria 1739
470 Ga0207679_10361937 3300025945 Bacteria 1267
471 Ga0207679_10517003 3300025945 Bacteria 1067
472 Ga0207679_11346316 3300025945 Bacteria 655
473 Ga0207667_10015924 3300025949 Bacteria 8515
474 Ga0207667_10017769 3300025949 Bacteria 7999
475 Ga0207667_10040469 3300025949 Bacteria 4963
476 Ga0207667_10232482 3300025949 Bacteria 1887
477 Ga0207651_10000600 3300025960 Bacteria 15181
478 Ga0207651_10196662 3300025960 Bacteria 1612
479 Ga0207651_10264450 3300025960 Bacteria 1414
480 Ga0207651_10787442 3300025960 Bacteria 842
481 Ga0207712_10610010 3300025961 Bacteria 945
482 Ga0207668_10005847 3300025972 Bacteria 7243
483 Ga0207668_10022312 3300025972 Bacteria 4050
484 Ga0207668_10259948 3300025972 Bacteria 1414
485 Ga0207668_10463986 3300025972 Bacteria 1083
486 Ga0207640_10065937 3300025981 Bacteria 2417
487 Ga0207640_10093962 3300025981 Bacteria 2085
488 Ga0207640_10416881 3300025981 Bacteria 1098
489 Ga0207640_10555566 3300025981 Bacteria 965
490 Ga0207658_10000812 3300025986 Bacteria 26147
491 Ga0207658_10004524 3300025986 Bacteria 9661
492 Ga0207658_10008395 3300025986 Bacteria 7030
493 Ga0207658_10104711 3300025986 Bacteria 2224
494 Ga0207658_10365385 3300025986 Bacteria 1260
495 Ga0207658_10425975 3300025986 Bacteria 1171
496 Ga0207677_10004232 3300026023 Bacteria 7684
497 Ga0207677_10012506 3300026023 Bacteria 4883
498 Ga0207677_10203650 3300026023 Bacteria 1575
499 Ga0207677_10521385 3300026023 Bacteria 1031
500 Ga0207703_10000929 3300026035 Bacteria 28489
501 Ga0207703_10001541 3300026035 Bacteria 20913
502 Ga0207703_10050619 3300026035 Bacteria 3363
503 Ga0207703_10374599 3300026035 Bacteria 1315
504 Ga0207703_11196395 3300026035 Bacteria 731
505 Ga0207639_10045094 3300026041 Bacteria 3319
506 Ga0207639_10064502 3300026041 Bacteria 2840
507 Ga0207639_10369350 3300026041 Bacteria 1286
508 Ga0207639_10620505 3300026041 Bacteria 998
509 Ga0207639_11195829 3300026041 Bacteria 713
510 Ga0207639_11325285 3300026041 Bacteria 676
511 Ga0207678_10121386 3300026067 Bacteria 2230
512 Ga0207678_10323622 3300026067 Bacteria 1327
513 Ga0207678_10622106 3300026067 Bacteria 947
514 Ga0207708_10548800 3300026075 Bacteria 974
515 Ga0207641_10000655 3300026088 Bacteria 37743
516 Ga0207641_10041985 3300026088 Bacteria 3835
517 Ga0207641_10083989 3300026088 Bacteria 2771
518 Ga0207641_10100664 3300026088 Bacteria 2545
519 Ga0207641_10263864 3300026088 Bacteria 1614
520 Ga0207641_10808793 3300026088 Bacteria 927
521 Ga0207641_11003515 3300026088 Bacteria 831
522 Ga0207648_10006616 3300026089 Bacteria 11512
523 Ga0207648_10831348 3300026089 Bacteria 861
524 Ga0207676_10002990 3300026095 Bacteria 12054
525 Ga0207676_10008396 3300026095 Bacteria 7341
526 Ga0207676_10017575 3300026095 Bacteria 5185
527 Ga0207676_10019288 3300026095 Bacteria 4972
528 Ga0207676_10040215 3300026095 Bacteria 3582
529 Ga0207676_10045925 3300026095 Bacteria 3377
530 Ga0207676_10197511 3300026095 Bacteria 1775
531 Ga0207676_10357517 3300026095 Bacteria 1352
532 Ga0207676_10472438 3300026095 Bacteria 1186
533 Ga0207676_10474911 3300026095 Bacteria 1183
534 Ga0207676_10539494 3300026095 Bacteria 1113
535 Ga0207676_10871663 3300026095 Bacteria 881
536 Ga0207674_10161382 3300026116 Bacteria 2196
537 Ga0207674_10532567 3300026116 Bacteria 1135
538 Ga0207674_10998576 3300026116 Bacteria 806
539 Ga0207675_100000956 3300026118 Bacteria 28809
540 Ga0207675_100052681 3300026118 Bacteria 3797
541 Ga0207683_10001877 3300026121 Bacteria 18588
542 Ga0207683_10030845 3300026121 Bacteria 4648
543 Ga0207683_10091526 3300026121 Bacteria 2710
544 Ga0207683_10104582 3300026121 Bacteria 2530
545 Ga0207683_10236721 3300026121 Bacteria 1665
546 Ga0207683_10297475 3300026121 Bacteria 1476
547 Ga0207698_10051451 3300026142 Bacteria 3149
548 Ga0207698_10061514 3300026142 Bacteria 2927
549 Ga0207698_10063805 3300026142 Bacteria 2885
550 Ga0207698_10082727 3300026142 Bacteria 2596
551 Ga0207698_10084881 3300026142 Bacteria 2569
552 Ga0207698_10108058 3300026142 Bacteria 2324
553 Ga0207698_10147223 3300026142 Bacteria 2038
554 Ga0207698_10152334 3300026142 Bacteria 2009
555 Ga0207698_10490085 3300026142 Bacteria 1194
556 Ga0207698_11073289 3300026142 Bacteria 817
557 Ga0207698_11279611 3300026142 Bacteria 748
558 Ga0209588_1026138 3300027671 Bacteria 1852
559 Ga0209588_1092718 3300027671 Bacteria 973
560 Ga0209813_10100218 3300027866 Bacteria 985
561 Ga0207428_10002089 3300027907 Bacteria 20124
562 Ga0207428_10002537 3300027907 Bacteria 18227
563 Ga0268266_10047759 3300028379 Bacteria 3668
564 Ga0268266_10199372 3300028379 Bacteria 1831
565 Ga0268266_10217974 3300028379 Bacteria 1753
566 Ga0268266_11382983 3300028379 Bacteria 679
567 Ga0268265_10008601 3300028380 Bacteria 6899
568 Ga0268265_10031887 3300028380 Bacteria 3810
569 Ga0268264_10002170 3300028381 Bacteria 17490
570 Ga0268264_10072300 3300028381 Unclassified 2925
571 Ga0268264_10175313 3300028381 Bacteria 1943
572 Ga0268264_11331446 3300028381 Bacteria 728
573 Ga0265336_10000129 3300028666 Bacteria 55515
574 Ga0265336_10021839 3300028666 Bacteria 2043
575 Ga0307517_10044883 3300028786 Bacteria 4660
576 Ga0307517_10134835 3300028786 Bacteria 1760
577 Ga0307515_10000026 3300028794 Bacteria 382411
578 Ga0307515_10059241 3300028794 Bacteria 5491
579 Ga0307515_10203361 3300028794 Bacteria 1849
580 Ga0265324_10000029 3300029957 Bacteria 132963
581 Ga0265324_10018935 3300029957 Bacteria 2482
582 Ga0307512_10076021 3300030522 Bacteria 2452
583 Ga0307512_10078766 3300030522 Bacteria 2386
584 Ga0265325_10000207 3300031241 Bacteria 41657
585 Ga0265325_10209885 3300031241 Bacteria 895
586 Ga0265331_10022387 3300031250 Bacteria 3225
587 Ga0265327_10001736 3300031251 Bacteria 25815
588 Ga0265327_10010729 3300031251 Bacteria 6398
589 Ga0265327_10063857 3300031251 Bacteria 1868
590 Ga0265327_10262958 3300031251 Bacteria 766
591 Ga0265316_10001407 3300031344 Bacteria 25872
592 Ga0265316_10124535 3300031344 Bacteria 1945
593 Ga0307509_10001002 3300031507 Bacteria 48561
594 Ga0307509_10001260 3300031507 Bacteria 42936
595 Ga0307509_10004767 3300031507 Bacteria 19334
596 Ga0307509_10187105 3300031507 Bacteria 1927
597 Ga0307508_10000280 3300031616 Bacteria 62637
598 Ga0307508_10105300 3300031616 Bacteria 2418
599 Ga0307514_10195648 3300031649 Bacteria 1280
600 Ga0316575_10013115 3300031665 Bacteria 3090
601 Ga0316575_10121945 3300031665 Bacteria 1066
602 Ga0316575_10176598 3300031665 Bacteria 886
603 Ga0316579_10006968 3300031691 Bacteria 4642
604 Ga0316579_10016583 3300031691 Bacteria 3220
605 Ga0316579_10018004 3300031691 Bacteria 3105
606 Ga0316579_10087313 3300031691 Bacteria 1488
607 Ga0265314_10025679 3300031711 Bacteria 4439
608 Ga0316578_10003640 3300031728 Bacteria 7107
609 Ga0307405_10247785 3300031731 Bacteria 1324
610 Ga0316577_10073697 3300031733 Bacteria 1906
611 Ga0316577_10118272 3300031733 Bacteria 1489
612 Ga0307518_10338600 3300031838 Bacteria 885
613 Ga0307412_10659572 3300031911 Bacteria 893
614 Ga0307416_100106326 3300032002 Bacteria 2459
615 Ga0307416_100229178 3300032002 Bacteria 1789
616 Ga0307416_100410429 3300032002 Bacteria 1395
617 Ga0316583_10071211 3300032133 Unclassified 1216
618 Ga0316585_10033270 3300032137 Bacteria 1626
619 Ga0316593_10006586 3300032168 Bacteria 3144
620 Ga0316593_10013817 3300032168 Bacteria 2397
621 Ga0316593_10041091 3300032168 Unclassified 1538
622 Ga0316593_10086986 3300032168 Bacteria 1097
623 Ga0307507_10251428 3300033179 Bacteria 1141
624 Ga0307510_10004362 3300033180 Bacteria 16655
625 Ga0307510_10007103 3300033180 Bacteria 13338
626 Ga0307510_10170337 3300033180 Bacteria 1757
627 Ga0316587_1002653 3300033529 Bacteria 2416
628 Ga0373930_0005560 3300034816 Bacteria 2101
629 Ga0373950_0010626 3300034818 Bacteria 1491
630 Ga0373950_0106964 3300034818 Bacteria 607
631 Ga0373958_0043208 3300034819 Bacteria 928
632 Ga0373938_0081421 3300034957 Bacteria 789
633 Ga0373928_0006702 3300035084 Bacteria 2217
634 Ga0373928_0014117 3300035084 Bacteria 1611
635 Ga0373934_0231771 3300035086 Bacteria 762
636 Ga0373940_0020375 3300035088 Bacteria 1684
637 Ga0373940_0058359 3300035088 Bacteria 1098
638 Ga0373944_0054881 3300035089 Bacteria 1265
639 Ga0373949_0012100 3300035090 Bacteria 1906
640 Ga0373952_0035000 3300035092 Bacteria 1135
641 Ga0373932_0005424 3300035112 Bacteria 2999
642 Ga0373939_0060359 3300035114 Bacteria 1205
643 Ga0373939_0060793 3300035114 Bacteria 1202
644 Ga0373939_0111111 3300035114 Bacteria 954
645 Ga0373945_0054060 3300035116 Bacteria 1484
646 Ga0373953_0092485 3300035117 Bacteria 1266
647 Ga0373954_0006461 3300035118 Bacteria 5112
648 Ga0373954_0022248 3300035118 Bacteria 2874
649 Ga0373954_0270649 3300035118 Bacteria 837
650 Ga0373956_0502738 3300035119 Bacteria 578
651 Ga0373960_0164703 3300035121 Bacteria 765
652 Ga0373943_0051985 3300035170 Bacteria 2019
653 Ga0373946_0289354 3300035171 Bacteria 808
654 Ga0373955_0113976 3300035172 Bacteria 1565
655 Ga0373942_0000734 3300035207 Bacteria 9045
656 Ga0373942_0001974 3300035207 Bacteria 5122
657 Ga0373942_0071824 3300035207 Bacteria 1012
658 Ga0373961_0017929 3300035241 Bacteria 1843
659 Ga0373961_0059455 3300035241 Bacteria 1156
660 Ga0373962_0084741 3300035242 Bacteria 967
661 Ga0316574_0047043 3300035398 Bacteria 2677
662 Ga0373924_0018981 3300035410 Bacteria 2659
663 Ga0373924_0071339 3300035410 Bacteria 1466
664 Ga0373931_0001134 3300035691 Bacteria 11315
665 Ga0373931_0021651 3300035691 Bacteria 3226
666 Ga0373931_0027208 3300035691 Bacteria 2918
667 Ga0373931_0181112 3300035691 Bacteria 1248
668 Ga0373931_0204860 3300035691 Bacteria 1180
669 Ga0373927_0597852 3300035695 Bacteria 729
670 Ga0373933_0058049 3300035724 Bacteria 2327
671 Ga0373933_0434936 3300035724 Bacteria 857
672 Ga0373947_0121761 3300035725 Bacteria 1658
673 Ga0373947_0499542 3300035725 Bacteria 826
674 Ga0373947_0653299 3300035725 Bacteria 717
675 Ga0373937_0059039 3300036401 Bacteria 3525
676 Ga0373937_0133691 3300036401 Bacteria 2318
677 Ga0373937_0335080 3300036401 Bacteria 1432
678 Ga0373937_0677445 3300036401 Bacteria 977
679 Ga0373937_1717498 3300036401 Bacteria 574
680 Ga0316582_0001711 3300036647 Bacteria 9862
681 Ga0316582_0027613 3300036647 Bacteria 3430
682 Ga0316582_0028351 3300036647 Bacteria 3391
683 Ga0316582_0762528 3300036647 Bacteria 664
684 Ga0316584_0058622 3300036712 Bacteria 2882
685 Ga0373925_0014054 3300037068 Bacteria 5795
686 Ga0373925_0067472 3300037068 Bacteria 2698
687 Ga0395898_0397175 3300037466 Bacteria 1315
688 Ga0395905_0003363 3300037471 Bacteria 17143
689 Ga0395905_0053119 3300037471 Bacteria 3793
690 Ga0316581_0003897 3300037588 Bacteria 3760
691 Ga0316581_0006691 3300037588 Bacteria 3063
692 Ga0316581_0012161 3300037588 Unclassified 2420
693 Ga0395901_0120274 3300038443 Bacteria 2760
694 Ga0395901_0143025 3300038443 Unclassified 2514
695 Ga0400487_14684 3300039110 Bacteria 7573
696 Ga0436365_0033031 3300039437 Bacteria 1437
697 Ga0436365_0697613 3300039437 Bacteria 3925
698 Ga0436365_1034743 3300039437 Bacteria 797
699 Ga0436363_0285240 3300039450 Bacteria 5060
700 Ga0451839_1414179 3300041496 Bacteria 1104
701 Ga0451851_1082858 3300041507 Bacteria 893
702 Ga0451843_0111968 3300041509 Bacteria 648
703 Ga0450891_019829 3300042129 Bacteria 656
704 Ga0439464_0003009 3300042439 Bacteria 4216
705 Ga0439460_0071839 3300042461 Bacteria 1073
706 Ga0451577_0006056 3300042876 Bacteria 12164
707 Ga0451577_0057264 3300042876 Bacteria 3475
708 Ga0451577_0085436 3300042876 Bacteria 2815
709 Ga0451577_0665218 3300042876 Bacteria 944
710 Ga0466972_0007540 3300044658 Bacteria 5461
711 Ga0453683_0002919 3300044673 Bacteria 12916
712 Ga0466965_0003754 3300044683 Bacteria 6704
713 Ga0466966_0095143 3300044684 Bacteria 1846
714 Ga0466964_0012646 3300044706 Bacteria 3196
715 Ga0453684_0023590 3300044712 Bacteria 9046
716 Ga0453684_0745692 3300044712 Bacteria 1060
717 Ga0466968_0038679 3300044735 Bacteria 2005
718 Ga0466957_0092227 3300044842 Bacteria 1899
719 Ga0466960_0353715 3300044901 Bacteria 838
720 Ga0466959_0235540 3300045049 Bacteria 1266
721 Ga0451576_0002906 3300045051 Bacteria 24460
722 Ga0451576_0009861 3300045051 Bacteria 11034
723 Ga0451576_0085191 3300045051 Bacteria 3287
724 Ga0451576_0092916 3300045051 Bacteria 3137
725 Ga0451576_0094792 3300045051 Bacteria 3104
726 Ga0451576_0107944 3300045051 Bacteria 2896
727 Ga0495617_015763 3300046452 Bacteria 2558
728 Ga0495592_0000441 3300046454 Bacteria 31137
729 Ga0495592_0043831 3300046454 Bacteria 3345
730 Ga0495592_0213900 3300046454 Bacteria 1293
731 Ga0495592_0306907 3300046454 Bacteria 1030
732 Ga0495592_0505759 3300046454 Bacteria 749
733 Ga0495603_0148969 3300046455 Bacteria 1360
734 Ga0495629_0037403 3300046459 Bacteria 3421
735 Ga0495629_0519138 3300046459 Bacteria 802
736 Ga0495638_0098481 3300046460 Bacteria 1752
737 Ga0495641_0413046 3300046461 Bacteria 613
738 Ga0495650_0000100 3300046471 Bacteria 213752
739 Ga0495650_0005611 3300046471 Bacteria 8081
740 Ga0495650_0009592 3300046471 Bacteria 5492
741 Ga0495580_0118662 3300046472 Bacteria 1837
742 Ga0495580_0130877 3300046472 Bacteria 1740
743 Ga0495664_0188941 3300046477 Bacteria 1249
744 Ga0495664_0321182 3300046477 Bacteria 934
745 Ga0495607_0010628 3300046501 Bacteria 6175
746 Ga0495583_0223199 3300046506 Bacteria 761
747 Ga0495610_0002542 3300046512 Bacteria 15193
748 Ga0495610_0148713 3300046512 Bacteria 1001
749 Ga0495620_0056590 3300046515 Bacteria 1649
750 Ga0495620_0151272 3300046515 Bacteria 905
751 Ga0495630_0185078 3300046517 Bacteria 1589
752 Ga0495630_0270923 3300046517 Bacteria 1297
753 Ga0495630_0442430 3300046517 Bacteria 996
754 Ga0495648_0050687 3300046524 Bacteria 2534
755 Ga0495648_0138814 3300046524 Bacteria 1282
756 Ga0495648_0224127 3300046524 Bacteria 925
757 Ga0495666_0048287 3300046526 Bacteria 2050
758 Ga0495666_0176388 3300046526 Bacteria 988
759 Ga0495587_0095102 3300046536 Bacteria 1720
760 Ga0495598_0109114 3300046537 Bacteria 925
761 Ga0495621_0010584 3300046539 Bacteria 2827
762 Ga0495621_0084548 3300046539 Bacteria 1188
763 Ga0495621_0218102 3300046539 Bacteria 771
764 Ga0495621_0261997 3300046539 Bacteria 708
765 Ga0495645_0060913 3300046543 Bacteria 2735
766 Ga0495645_0217869 3300046543 Bacteria 1285
767 Ga0495633_0005786 3300046558 Bacteria 7459
768 Ga0495667_0247374 3300046559 Bacteria 1135
769 Ga0495667_0286252 3300046559 Bacteria 1046
770 Ga0495667_0341937 3300046559 Bacteria 946
771 Ga0495656_0129656 3300046615 Bacteria 1199
772 Ga0495668_0000286 3300046616 Bacteria 69771
773 Ga0495668_0002018 3300046616 Bacteria 17721
774 Ga0495625_0082170 3300046660 Bacteria 2241
775 Ga0495635_0148354 3300046663 Bacteria 1597
776 Ga0495599_0032970 3300046678 Bacteria 3253
777 Ga0495623_0322318 3300046679 Bacteria 848
778 Ga0495647_0028086 3300046681 Bacteria 2073
779 Ga0495658_0047962 3300046683 Bacteria 2407
780 Ga0495658_0060024 3300046683 Bacteria 2180
781 Ga0495658_0107937 3300046683 Bacteria 1670
782 Ga0495658_0123515 3300046683 Bacteria 1568
783 Ga0495658_0218137 3300046683 Bacteria 1193
784 Ga0495613_0448882 3300046689 Bacteria 874
785 Ga0495624_0005244 3300046690 Bacteria 9361
786 Ga0495649_0118313 3300046694 Bacteria 1402
787 Ga0495649_0153993 3300046694 Bacteria 1207
788 Ga0495649_0276938 3300046694 Bacteria 858
789 Ga0495600_0167314 3300046809 Bacteria 1420
790 Ga0495600_0349362 3300046809 Bacteria 926
791 Ga0495674_0312052 3300047319 Bacteria 1283
792 Ga0495674_0703450 3300047319 Bacteria 793
793 Ga0495676_0071019 3300047321 Bacteria 2678
794 Ga0495676_0429143 3300047321 Bacteria 874
795 Ga0495680_0126817 3300047322 Bacteria 1879
796 Ga0495680_0394147 3300047322 Bacteria 957
797 Ga0495673_0000080 3300047469 Bacteria 201831
798 Ga0495673_0066497 3300047469 Bacteria 1528
799 Ga0495684_0214199 3300047471 Bacteria 1415
800 Ga0495684_0763164 3300047471 Bacteria 635
801 Ga0495686_0005098 3300047472 Bacteria 10503
802 Ga0495593_0052778 3300047673 Bacteria 2147
803 Ga0495626_0048760 3300048091 Bacteria 1964
804 Ga0496100_0605059 3300048903 Bacteria 851
805 Ga0496101_0019596 3300048904 Bacteria 4621
806 Ga0496101_0103838 3300048904 Bacteria 2131
807 Ga0496102_0011369 3300048905 Bacteria 7671
808 Ga0496102_0037417 3300048905 Bacteria 4378
809 Ga0496103_0378785 3300048906 Bacteria 909
810 Ga0496104_0051283 3300048907 Bacteria 3894
811 Ga0496104_0768246 3300048907 Bacteria 870
812 Ga0496105_0108099 3300048908 Bacteria 2296
813 Ga0496105_0300546 3300048908 Bacteria 1290
814 Ga0496105_0833301 3300048908 Bacteria 699
815 Ga0496106_0042882 3300048909 Bacteria 3393
816 Ga0496106_0693557 3300048909 Bacteria 812
817 Ga0496106_1275042 3300048909 Bacteria 571
818 Ga0496107_0015263 3300048910 Bacteria 5383
819 Ga0496107_0164021 3300048910 Bacteria 1647
820 Ga0496108_0071263 3300048911 Bacteria 2932
821 Ga0496108_0497998 3300048911 Bacteria 1064
822 Ga0496109_0122624 3300048912 Bacteria 2421
823 Ga0496109_0130713 3300048912 Bacteria 2343
824 Ga0496110_0098506 3300048913 Bacteria 2620
825 Ga0496110_0342255 3300048913 Bacteria 1362
826 Ga0496110_0535288 3300048913 Bacteria 1065
827 Ga0496110_1364294 3300048913 Bacteria 618
828 Ga0496111_0046517 3300048914 Bacteria 3124
829 Ga0496112_0111756 3300048915 Bacteria 2702
830 Ga0496112_0285050 3300048915 Bacteria 1598
831 Ga0496112_0490455 3300048915 Bacteria 1165
832 Ga0496113_0022247 3300048916 Bacteria 4482
833 Ga0496113_0104759 3300048916 Bacteria 2195
834 Ga0496114_0023038 3300048917 Bacteria 5077
835 Ga0496114_0189226 3300048917 Bacteria 1800
836 Ga0496115_0056268 3300048918 Bacteria 3161
837 Ga0496116_0007031 3300048919 Bacteria 10075
838 Ga0496124_0090236 3300048927 Bacteria 2500
839 Ga0496124_0146409 3300048927 Bacteria 1858
840 Ga0496125_0105200 3300048928 Bacteria 2063
841 Ga0501300_008030 3300049523 Bacteria 1547
842 Ga0501031_0018528 3300049568 Bacteria 4532
843 Ga0501034_0623081 3300049571 Bacteria 983
844 Ga0501036_0040574 3300049572 Bacteria 3937
845 Ga0501037_0109148 3300049573 Bacteria 1994
846 Ga0501046_0161765 3300049580 Bacteria 1683
847 Ga0501047_0006119 3300049581 Bacteria 11307
848 Ga0501048_0035242 3300049582 Bacteria 3603
849 Ga0501048_0327910 3300049582 Bacteria 1091
850 Ga0501069_0004773 3300049585 Bacteria 7015
851 Ga0501070_0070069 3300049586 Bacteria 2903
852 Ga0501072_0247331 3300049588 Bacteria 1420
853 Ga0501073_0006933 3300049589 Bacteria 8435
854 Ga0501074_0000154 3300049590 Bacteria 35857
855 Ga0501228_005417 3300049666 Unclassified 1132
856 Ga0501239_007686 3300049672 Bacteria 1135
857 Ga0501225_0110888 3300049705 Bacteria 809
858 Ga0501079_0064641 3300049741 Bacteria 2822
859 Ga0501080_0005032 3300049742 Bacteria 11775
860 Ga0501083_0000323 3300049744 Bacteria 30331
861 Ga0501265_002194 3300049762 Bacteria 2218
862 Ga0501280_002828 3300049776 Bacteria 2793
863 Ga0501035_0605827 3300049822 Bacteria 892
864 Ga0501044_0028237 3300049823 Bacteria 5923
865 Ga0501045_0666890 3300049824 Bacteria 768
866 nmdc:mga0k408_20345_c2 3300050493 Bacteria 3304
867 nmdc:mga0k408_71394_c1 3300050493 Bacteria 2027
868 nmdc:mga06z11_24806_c1 3300050494 Bacteria 2834
869 nmdc:mga04h51_118168_c1 3300050495 Bacteria 985
870 nmdc:mga07m45_114227_c1 3300050496 Bacteria 1557
871 nmdc:mga05p37_3648_c1 3300050507 Bacteria 18007
872 nmdc:mga09592_6251_c1 3300050508 Bacteria 9700
873 nmdc:mga09592_970944_c1 3300050508 Bacteria 711
874 nmdc:mga06r32_1508637_c1 3300050510 Bacteria 612
875 nmdc:mga06r32_37367_c1 3300050510 Bacteria 4593
876 nmdc:mga08y16_10350_c1 3300050511 Bacteria 9791
877 nmdc:mga08y16_386_c1 3300050511 Bacteria 40374
878 nmdc:mga08y16_396818_c1 3300050511 Bacteria 1412
879 nmdc:mga0rr50_443265_c1 3300050513 Bacteria 1100
880 nmdc:mga08x19_148984_c1 3300050514 Bacteria 1583
881 nmdc:mga0a205_238006_c1 3300050515 Bacteria 1702
882 nmdc:mga0a205_366208_c1 3300050515 Bacteria 1307
883 nmdc:mga0a205_597109_c1 3300050515 Bacteria 957
884 Ga0495601_0171470 3300053077 Bacteria 1418
885 Ga0495601_0345695 3300053077 Bacteria 967
886 Ga0495612_0111179 3300053078 Bacteria 1173
887 Ga0495595_0364007 3300053084 Bacteria 731
888 Ga0495619_0089451 3300053085 Bacteria 2083
889 Ga0495619_0152669 3300053085 Bacteria 1593
890 Ga0500578_0173163 3300053086 Bacteria 1334
891 Ga0500644_0040479 3300053088 Bacteria 1542
892 Ga0500583_0140249 3300053092 Bacteria 1201
893 Ga0500651_0117401 3300053093 Bacteria 1618
894 Ga0500593_015808 3300053117 Bacteria 3259
895 Ga0500594_0018882 3300053118 Bacteria 1703
896 Ga0500618_069032 3300053125 Bacteria 793
897 Ga0500652_062352 3300053131 Bacteria 1537
898 Ga0500655_011256 3300053133 Bacteria 1619
899 Ga0500559_0000138 3300053136 Bacteria 56620
900 Ga0500568_0125805 3300053139 Bacteria 954
901 Ga0500619_154586 3300053154 Bacteria 779
902 Ga0500622_0027122 3300053156 Bacteria 3020
903 Ga0500636_0041980 3300053177 Bacteria 2705
904 Ga0500645_008228 3300053730 Bacteria 3577
905 Ga0500587_002360 3300053739 Bacteria 2681
906 Ga0500587_031393 3300053739 Bacteria 731
907 Ga0501084_0112102 3300054114 Bacteria 2292
908 Ga0590071_026118 3300059421 Bacteria 1385
909 Ga0501082_0060312 3300060353 Bacteria 3267

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050514 nmdc:mga08x19_148984_c1 nmdc:mga08x19_148984_c1_183_713 162
2 3300005468 Ga0070707_100323745 Ga0070707_1003237452 163
3 3300005445 Ga0070708_100054134 Ga0070708_1000541344 164
4 3300005467 Ga0070706_100001448 Ga0070706_10000144828 164
5 3300005471 Ga0070698_100030267 Ga0070698_1000302672 164
6 3300006042 Ga0075368_10105044 Ga0075368_101050442 164
7 3300006178 Ga0075367_10007169 Ga0075367_100071694 164
8 3300006195 Ga0075366_10057252 Ga0075366_100572522 164
9 3300006353 Ga0075370_10040382 Ga0075370_100403822 164
10 3300025910 Ga0207684_10002129 Ga0207684_1000212919 164
11 3300027866 Ga0209813_10100218 Ga0209813_101002182 164
12 3300050493 nmdc:mga0k408_71394_c1 nmdc:mga0k408_71394_c1_1226_1804 164
13 3300050494 nmdc:mga06z11_24806_c1 nmdc:mga06z11_24806_c1_2055_2633 164
14 3300050495 nmdc:mga04h51_118168_c1 nmdc:mga04h51_118168_c1_229_807 164
15 3300050496 nmdc:mga07m45_114227_c1 nmdc:mga07m45_114227_c1_581_1159 164
16 3300005518 Ga0070699_100136837 Ga0070699_1001368373 165
17 3300005337 Ga0070682_100029929 Ga0070682_1000299292 171
18 3300005440 Ga0070705_101430343 Ga0070705_1014303431 171
19 3300005444 Ga0070694_100960509 Ga0070694_1009605091 171
20 3300006237 Ga0097621_100786467 Ga0097621_1007864671 171
21 3300009094 Ga0111539_10047083 Ga0111539_100470832 171
22 3300014326 Ga0157380_10022945 Ga0157380_100229455 171
23 3300014968 Ga0157379_12186961 Ga0157379_121869611 171
24 3300031691 Ga0316579_10018004 Ga0316579_100180042 171
25 3300031691 Ga0316579_10087313 Ga0316579_100873132 171
26 3300032133 Ga0316583_10071211 Ga0316583_100712112 171
27 3300032168 Ga0316593_10041091 Ga0316593_100410911 171
28 3300032168 Ga0316593_10086986 Ga0316593_100869861 171
29 3300036647 Ga0316582_0762528 Ga0316582_0762528_92_616 171
30 3300037588 Ga0316581_0012161 Ga0316581_0012161_819_1343 171
31 iso_pu_bacteria 2643221660 2644340343 171
32 3300005518 Ga0070699_100810224 Ga0070699_1008102242 172
33 3300005536 Ga0070697_100014972 Ga0070697_1000149722 172
34 3300005617 Ga0068859_100325184 Ga0068859_1003251842 172
35 3300006173 Ga0070716_100008353 Ga0070716_1000083532 172
36 3300006173 Ga0070716_100766110 Ga0070716_1007661102 172
37 3300006237 Ga0097621_100132153 Ga0097621_1001321533 172
38 3300006358 Ga0068871_100032966 Ga0068871_1000329663 172
39 3300006846 Ga0075430_100100678 Ga0075430_1001006782 172
40 3300006880 Ga0075429_100006162 Ga0075429_1000061629 172
41 3300006931 Ga0097620_100325184 Ga0097620_1003251842 172
42 3300007265 Ga0099794_10011178 Ga0099794_100111784 172
43 3300010159 Ga0099796_10190695 Ga0099796_101906951 172
44 3300014326 Ga0157380_10027585 Ga0157380_100275853 172
45 3300014969 Ga0157376_11544961 Ga0157376_115449612 172
46 3300025939 Ga0207665_10002235 Ga0207665_100022353 172
47 3300026142 Ga0207698_10051451 Ga0207698_100514512 172
48 3300027671 Ga0209588_1026138 Ga0209588_10261383 172
49 3300027671 Ga0209588_1092718 Ga0209588_10927182 172
50 3300028666 Ga0265336_10000129 Ga0265336_1000012935 172
51 3300028666 Ga0265336_10021839 Ga0265336_100218392 172
52 3300029957 Ga0265324_10000029 Ga0265324_1000002946 172
53 3300029957 Ga0265324_10018935 Ga0265324_100189352 172
54 3300031241 Ga0265325_10000207 Ga0265325_1000020718 172
55 3300031250 Ga0265331_10022387 Ga0265331_100223872 172
56 3300031344 Ga0265316_10124535 Ga0265316_101245352 172
57 3300031711 Ga0265314_10025679 Ga0265314_100256793 172
58 3300035086 Ga0373934_0231771 Ga0373934_0231771_83_613 172
59 3300035118 Ga0373954_0006461 Ga0373954_0006461_2575_3102 172
60 3300035118 Ga0373954_0022248 Ga0373954_0022248_1335_1862 172
61 3300035119 Ga0373956_0502738 Ga0373956_0502738_16_546 172
62 3300035241 Ga0373961_0017929 Ga0373961_0017929_93_623 172
63 3300035691 Ga0373931_0027208 Ga0373931_0027208_2320_2850 172
64 3300036401 Ga0373937_0677445 Ga0373937_0677445_394_921 172
65 3300036401 Ga0373937_1717498 Ga0373937_1717498_28_558 172
66 3300039110 Ga0400487_14684 Ga0400487_14684_1046_1573 172
67 3300042876 Ga0451577_0057264 Ga0451577_0057264_1159_1686 172
68 3300042876 Ga0451577_0085436 Ga0451577_0085436_772_1308 172
69 3300045051 Ga0451576_0002906 Ga0451576_0002906_21759_22286 172
70 3300045051 Ga0451576_0092916 Ga0451576_0092916_576_1103 172
71 3300046454 Ga0495592_0043831 Ga0495592_0043831_1914_2441 172
72 3300046517 Ga0495630_0270923 Ga0495630_0270923_123_650 172
73 3300046536 Ga0495587_0095102 Ga0495587_0095102_664_1191 172
74 3300046559 Ga0495667_0341937 Ga0495667_0341937_214_744 172
75 3300046678 Ga0495599_0032970 Ga0495599_0032970_605_1132 172
76 3300046679 Ga0495623_0322318 Ga0495623_0322318_56_586 172
77 3300047322 Ga0495680_0394147 Ga0495680_0394147_367_894 172
78 3300047471 Ga0495684_0763164 Ga0495684_0763164_55_585 172
79 3300048905 Ga0496102_0011369 Ga0496102_0011369_5834_6358 172
80 3300049523 Ga0501300_008030 Ga0501300_008030_970_1497 172
81 3300049666 Ga0501228_005417 Ga0501228_005417_114_641 172
82 3300049776 Ga0501280_002828 Ga0501280_002828_1101_1628 172
83 3300050508 nmdc:mga09592_6251_c1 nmdc:mga09592_6251_c1_1308_1835 172
84 3300053117 Ga0500593_015808 Ga0500593_015808_1270_1794 172
85 3300059421 Ga0590071_026118 Ga0590071_026118_716_1249 172
86 3300005293 Ga0065715_10174637 Ga0065715_101746372 173
87 3300005295 Ga0065707_10229911 Ga0065707_102299112 173
88 3300005327 Ga0070658_10085898 Ga0070658_100858983 173
89 3300005327 Ga0070658_10959302 Ga0070658_109593022 173
90 3300005328 Ga0070676_10010065 Ga0070676_100100653 173
91 3300005328 Ga0070676_10135391 Ga0070676_101353912 173
92 3300005328 Ga0070676_10238731 Ga0070676_102387312 173
93 3300005328 Ga0070676_10375122 Ga0070676_103751222 173
94 3300005329 Ga0070683_100778780 Ga0070683_1007787802 173
95 3300005330 Ga0070690_100114705 Ga0070690_1001147052 173
96 3300005330 Ga0070690_100506979 Ga0070690_1005069792 173
97 3300005331 Ga0070670_100001774 Ga0070670_1000017744 173
98 3300005331 Ga0070670_100037091 Ga0070670_1000370913 173
99 3300005331 Ga0070670_100126728 Ga0070670_1001267283 173
100 3300005331 Ga0070670_100134714 Ga0070670_1001347142 173
101 3300005331 Ga0070670_100200183 Ga0070670_1002001833 173
102 3300005331 Ga0070670_100278084 Ga0070670_1002780842 173
103 3300005331 Ga0070670_100625434 Ga0070670_1006254342 173
104 3300005333 Ga0070677_10007318 Ga0070677_100073182 173
105 3300005333 Ga0070677_10089341 Ga0070677_100893413 173
106 3300005333 Ga0070677_10335462 Ga0070677_103354622 173
107 3300005334 Ga0068869_100008578 Ga0068869_1000085785 173
108 3300005334 Ga0068869_100009021 Ga0068869_1000090215 173
109 3300005335 Ga0070666_10005482 Ga0070666_100054824 173
110 3300005335 Ga0070666_10008568 Ga0070666_100085686 173
111 3300005335 Ga0070666_10300134 Ga0070666_103001342 173
112 3300005335 Ga0070666_10323814 Ga0070666_103238141 173
113 3300005335 Ga0070666_10377329 Ga0070666_103773292 173
114 3300005336 Ga0070680_100120410 Ga0070680_1001204102 173
115 3300005337 Ga0070682_100824307 Ga0070682_1008243071 173
116 3300005338 Ga0068868_100016008 Ga0068868_1000160082 173
117 3300005338 Ga0068868_100043629 Ga0068868_1000436293 173
118 3300005338 Ga0068868_100142537 Ga0068868_1001425372 173
119 3300005338 Ga0068868_100614279 Ga0068868_1006142792 173
120 3300005339 Ga0070660_100200407 Ga0070660_1002004072 173
121 3300005340 Ga0070689_100051421 Ga0070689_1000514212 173
122 3300005343 Ga0070687_100034731 Ga0070687_1000347312 173
123 3300005343 Ga0070687_100350461 Ga0070687_1003504612 173
124 3300005344 Ga0070661_100217152 Ga0070661_1002171522 173
125 3300005344 Ga0070661_100395025 Ga0070661_1003950252 173
126 3300005344 Ga0070661_100669562 Ga0070661_1006695622 173
127 3300005345 Ga0070692_10188529 Ga0070692_101885292 173
128 3300005345 Ga0070692_10196477 Ga0070692_101964772 173
129 3300005347 Ga0070668_100007130 Ga0070668_1000071305 173
130 3300005347 Ga0070668_100008167 Ga0070668_1000081674 173
131 3300005347 Ga0070668_101174839 Ga0070668_1011748392 173
132 3300005353 Ga0070669_100001340 Ga0070669_1000013409 173
133 3300005353 Ga0070669_100077959 Ga0070669_1000779592 173
134 3300005353 Ga0070669_100082105 Ga0070669_1000821053 173
135 3300005353 Ga0070669_100106163 Ga0070669_1001061632 173
136 3300005353 Ga0070669_100877121 Ga0070669_1008771212 173
137 3300005354 Ga0070675_100002913 Ga0070675_10000291314 173
138 3300005354 Ga0070675_100014979 Ga0070675_1000149792 173
139 3300005354 Ga0070675_100045658 Ga0070675_1000456585 173
140 3300005354 Ga0070675_100061046 Ga0070675_1000610464 173
141 3300005354 Ga0070675_100061075 Ga0070675_1000610752 173
142 3300005354 Ga0070675_100245133 Ga0070675_1002451332 173
143 3300005354 Ga0070675_100368617 Ga0070675_1003686172 173
144 3300005355 Ga0070671_100009693 Ga0070671_1000096937 173
145 3300005355 Ga0070671_100039335 Ga0070671_1000393352 173
146 3300005355 Ga0070671_100049845 Ga0070671_1000498452 173
147 3300005355 Ga0070671_100066223 Ga0070671_1000662232 173
148 3300005355 Ga0070671_100099621 Ga0070671_1000996212 173
149 3300005355 Ga0070671_100533158 Ga0070671_1005331582 173
150 3300005356 Ga0070674_100013491 Ga0070674_1000134916 173
151 3300005356 Ga0070674_100210755 Ga0070674_1002107552 173
152 3300005356 Ga0070674_100222853 Ga0070674_1002228531 173
153 3300005364 Ga0070673_100000512 Ga0070673_10000051220 173
154 3300005364 Ga0070673_100075466 Ga0070673_1000754664 173
155 3300005364 Ga0070673_100138585 Ga0070673_1001385852 173
156 3300005364 Ga0070673_100186331 Ga0070673_1001863313 173
157 3300005364 Ga0070673_101321070 Ga0070673_1013210701 173
158 3300005365 Ga0070688_100092460 Ga0070688_1000924601 173
159 3300005366 Ga0070659_100089809 Ga0070659_1000898092 173
160 3300005366 Ga0070659_100234621 Ga0070659_1002346212 173
161 3300005367 Ga0070667_100000219 Ga0070667_10000021918 173
162 3300005367 Ga0070667_100004388 Ga0070667_1000043887 173
163 3300005367 Ga0070667_100006263 Ga0070667_1000062638 173
164 3300005367 Ga0070667_100116780 Ga0070667_1001167802 173
165 3300005367 Ga0070667_100407910 Ga0070667_1004079102 173
166 3300005435 Ga0070714_100713512 Ga0070714_1007135122 173
167 3300005436 Ga0070713_100000028 Ga0070713_10000002851 173
168 3300005436 Ga0070713_100026620 Ga0070713_1000266205 173
169 3300005436 Ga0070713_100070549 Ga0070713_1000705492 173
170 3300005438 Ga0070701_10110217 Ga0070701_101102171 173
171 3300005455 Ga0070663_100144025 Ga0070663_1001440252 173
172 3300005455 Ga0070663_100596414 Ga0070663_1005964142 173
173 3300005456 Ga0070678_100004036 Ga0070678_1000040368 173
174 3300005456 Ga0070678_100015086 Ga0070678_1000150866 173
175 3300005456 Ga0070678_100165208 Ga0070678_1001652082 173
176 3300005456 Ga0070678_100216738 Ga0070678_1002167382 173
177 3300005456 Ga0070678_100488605 Ga0070678_1004886052 173
178 3300005456 Ga0070678_100661813 Ga0070678_1006618132 173
179 3300005457 Ga0070662_100008433 Ga0070662_1000084335 173
180 3300005457 Ga0070662_100016652 Ga0070662_1000166525 173
181 3300005457 Ga0070662_100172931 Ga0070662_1001729311 173
182 3300005457 Ga0070662_100225535 Ga0070662_1002255351 173
183 3300005457 Ga0070662_100575486 Ga0070662_1005754862 173
184 3300005458 Ga0070681_10063643 Ga0070681_100636432 173
185 3300005458 Ga0070681_10522094 Ga0070681_105220942 173
186 3300005458 Ga0070681_10975496 Ga0070681_109754961 173
187 3300005459 Ga0068867_100011339 Ga0068867_1000113395 173
188 3300005459 Ga0068867_100015106 Ga0068867_1000151067 173
189 3300005459 Ga0068867_100292330 Ga0068867_1002923302 173
190 3300005459 Ga0068867_100774755 Ga0068867_1007747552 173
191 3300005466 Ga0070685_10705933 Ga0070685_107059332 173
192 3300005467 Ga0070706_100326532 Ga0070706_1003265322 173
193 3300005468 Ga0070707_100704259 Ga0070707_1007042591 173
194 3300005530 Ga0070679_100058970 Ga0070679_1000589702 173
195 3300005535 Ga0070684_100009252 Ga0070684_1000092527 173
196 3300005535 Ga0070684_100191604 Ga0070684_1001916042 173
197 3300005539 Ga0068853_100082726 Ga0068853_1000827263 173
198 3300005539 Ga0068853_100377273 Ga0068853_1003772732 173
199 3300005539 Ga0068853_100495111 Ga0068853_1004951112 173
200 3300005539 Ga0068853_101111483 Ga0068853_1011114831 173
201 3300005539 Ga0068853_101276310 Ga0068853_1012763101 173
202 3300005539 Ga0068853_101637011 Ga0068853_1016370111 173
203 3300005543 Ga0070672_100002366 Ga0070672_1000023662 173
204 3300005543 Ga0070672_100025703 Ga0070672_1000257035 173
205 3300005543 Ga0070672_100029191 Ga0070672_1000291914 173
206 3300005543 Ga0070672_100066644 Ga0070672_1000666443 173
207 3300005543 Ga0070672_100128821 Ga0070672_1001288212 173
208 3300005544 Ga0070686_100152088 Ga0070686_1001520882 173
209 3300005547 Ga0070693_100070359 Ga0070693_1000703592 173
210 3300005547 Ga0070693_100151701 Ga0070693_1001517012 173
211 3300005548 Ga0070665_100108558 Ga0070665_1001085581 173
212 3300005548 Ga0070665_100245877 Ga0070665_1002458772 173
213 3300005549 Ga0070704_100239853 Ga0070704_1002398533 173
214 3300005563 Ga0068855_100019481 Ga0068855_1000194818 173
215 3300005563 Ga0068855_100050674 Ga0068855_1000506745 173
216 3300005564 Ga0070664_100099293 Ga0070664_1000992932 173
217 3300005564 Ga0070664_100200527 Ga0070664_1002005272 173
218 3300005564 Ga0070664_100232282 Ga0070664_1002322822 173
219 3300005564 Ga0070664_100322726 Ga0070664_1003227262 173
220 3300005564 Ga0070664_100388722 Ga0070664_1003887222 173
221 3300005564 Ga0070664_100826180 Ga0070664_1008261802 173
222 3300005577 Ga0068857_100061526 Ga0068857_1000615265 173
223 3300005577 Ga0068857_100272538 Ga0068857_1002725382 173
224 3300005577 Ga0068857_100611362 Ga0068857_1006113621 173
225 3300005578 Ga0068854_100022758 Ga0068854_1000227582 173
226 3300005578 Ga0068854_100071773 Ga0068854_1000717732 173
227 3300005616 Ga0068852_100047446 Ga0068852_1000474465 173
228 3300005616 Ga0068852_100049622 Ga0068852_1000496222 173
229 3300005616 Ga0068852_100114805 Ga0068852_1001148052 173
230 3300005616 Ga0068852_100131355 Ga0068852_1001313551 173
231 3300005616 Ga0068852_100137485 Ga0068852_1001374852 173
232 3300005616 Ga0068852_100146060 Ga0068852_1001460602 173
233 3300005616 Ga0068852_100176780 Ga0068852_1001767802 173
234 3300005616 Ga0068852_100471228 Ga0068852_1004712282 173
235 3300005617 Ga0068859_100032866 Ga0068859_1000328666 173
236 3300005617 Ga0068859_100052964 Ga0068859_1000529643 173
237 3300005618 Ga0068864_100006724 Ga0068864_1000067243 173
238 3300005618 Ga0068864_100009050 Ga0068864_1000090502 173
239 3300005618 Ga0068864_100016929 Ga0068864_1000169297 173
240 3300005618 Ga0068864_100024031 Ga0068864_1000240312 173
241 3300005618 Ga0068864_100028258 Ga0068864_1000282583 173
242 3300005618 Ga0068864_100032800 Ga0068864_1000328002 173
243 3300005618 Ga0068864_100051430 Ga0068864_1000514302 173
244 3300005618 Ga0068864_100095552 Ga0068864_1000955524 173
245 3300005618 Ga0068864_100180700 Ga0068864_1001807002 173
246 3300005618 Ga0068864_100312486 Ga0068864_1003124863 173
247 3300005718 Ga0068866_10004159 Ga0068866_100041592 173
248 3300005719 Ga0068861_100000757 Ga0068861_10000075724 173
249 3300005719 Ga0068861_100016694 Ga0068861_1000166947 173
250 3300005719 Ga0068861_100055464 Ga0068861_1000554643 173
251 3300005719 Ga0068861_100305984 Ga0068861_1003059842 173
252 3300005834 Ga0068851_10012597 Ga0068851_100125976 173
253 3300005834 Ga0068851_10150229 Ga0068851_101502292 173
254 3300005840 Ga0068870_10305377 Ga0068870_103053772 173
255 3300005841 Ga0068863_100000585 Ga0068863_10000058531 173
256 3300005841 Ga0068863_100030558 Ga0068863_1000305582 173
257 3300005841 Ga0068863_100042606 Ga0068863_1000426062 173
258 3300005841 Ga0068863_100115425 Ga0068863_1001154253 173
259 3300005841 Ga0068863_100144088 Ga0068863_1001440882 173
260 3300005841 Ga0068863_100691333 Ga0068863_1006913332 173
261 3300005842 Ga0068858_100002981 Ga0068858_1000029813 173
262 3300005842 Ga0068858_100003791 Ga0068858_1000037918 173
263 3300005842 Ga0068858_100004338 Ga0068858_1000043387 173
264 3300005843 Ga0068860_100009426 Ga0068860_1000094267 173
265 3300005843 Ga0068860_100052427 Ga0068860_1000524272 173
266 3300005843 Ga0068860_100412436 Ga0068860_1004124362 173
267 3300005843 Ga0068860_101333212 Ga0068860_1013332122 173
268 3300005844 Ga0068862_100010864 Ga0068862_1000108642 173
269 3300005844 Ga0068862_100017376 Ga0068862_1000173766 173
270 3300005844 Ga0068862_100065393 Ga0068862_1000653933 173
271 3300005844 Ga0068862_100093051 Ga0068862_1000930513 173
272 3300005985 Ga0081539_10048422 Ga0081539_100484222 173
273 3300006163 Ga0070715_10019021 Ga0070715_100190213 173
274 3300006173 Ga0070716_100143199 Ga0070716_1001431992 173
275 3300006173 Ga0070716_100413934 Ga0070716_1004139342 173
276 3300006175 Ga0070712_100231807 Ga0070712_1002318072 173
277 3300006186 Ga0075369_10318089 Ga0075369_103180892 173
278 3300006195 Ga0075366_10149429 Ga0075366_101494292 173
279 3300006237 Ga0097621_100049628 Ga0097621_1000496281 173
280 3300006237 Ga0097621_100060666 Ga0097621_1000606663 173
281 3300006237 Ga0097621_100090975 Ga0097621_1000909753 173
282 3300006237 Ga0097621_100097413 Ga0097621_1000974132 173
283 3300006237 Ga0097621_100104799 Ga0097621_1001047992 173
284 3300006237 Ga0097621_100110135 Ga0097621_1001101353 173
285 3300006237 Ga0097621_100214730 Ga0097621_1002147302 173
286 3300006358 Ga0068871_100024895 Ga0068871_1000248954 173
287 3300006358 Ga0068871_100046861 Ga0068871_1000468613 173
288 3300006358 Ga0068871_100111728 Ga0068871_1001117282 173
289 3300006358 Ga0068871_100177785 Ga0068871_1001777852 173
290 3300006358 Ga0068871_100205149 Ga0068871_1002051492 173
291 3300006358 Ga0068871_100352208 Ga0068871_1003522082 173
292 3300006844 Ga0075428_100009252 Ga0075428_1000092523 173
293 3300006852 Ga0075433_10138514 Ga0075433_101385142 173
294 3300006852 Ga0075433_10243015 Ga0075433_102430152 173
295 3300006852 Ga0075433_10281894 Ga0075433_102818942 173
296 3300006880 Ga0075429_100752140 Ga0075429_1007521401 173
297 3300006931 Ga0097620_100032866 Ga0097620_1000328666 173
298 3300006931 Ga0097620_100052964 Ga0097620_1000529643 173
299 3300009094 Ga0111539_10027065 Ga0111539_100270655 173
300 3300009094 Ga0111539_10289361 Ga0111539_102893612 173
301 3300009094 Ga0111539_10543011 Ga0111539_105430111 173
302 3300009094 Ga0111539_11552050 Ga0111539_115520502 173
303 3300009098 Ga0105245_10011246 Ga0105245_100112462 173
304 3300009098 Ga0105245_10104852 Ga0105245_101048523 173
305 3300009098 Ga0105245_10114708 Ga0105245_101147082 173
306 3300009098 Ga0105245_10911358 Ga0105245_109113582 173
307 3300009147 Ga0114129_10000826 Ga0114129_100008268 173
308 3300009148 Ga0105243_10007729 Ga0105243_100077298 173
309 3300009148 Ga0105243_10074803 Ga0105243_100748034 173
310 3300009148 Ga0105243_10173612 Ga0105243_101736122 173
311 3300009148 Ga0105243_10843319 Ga0105243_108433192 173
312 3300009174 Ga0105241_10042664 Ga0105241_100426644 173
313 3300009174 Ga0105241_10450054 Ga0105241_104500542 173
314 3300009176 Ga0105242_10066268 Ga0105242_100662682 173
315 3300009176 Ga0105242_10269659 Ga0105242_102696592 173
316 3300009177 Ga0105248_10043019 Ga0105248_100430192 173
317 3300009177 Ga0105248_10114677 Ga0105248_101146772 173
318 3300009177 Ga0105248_10154030 Ga0105248_101540302 173
319 3300009177 Ga0105248_10306196 Ga0105248_103061962 173
320 3300009177 Ga0105248_10450138 Ga0105248_104501382 173
321 3300009177 Ga0105248_10922451 Ga0105248_109224511 173
322 3300009177 Ga0105248_10964573 Ga0105248_109645732 173
323 3300009177 Ga0105248_11157073 Ga0105248_111570731 173
324 3300009551 Ga0105238_10002565 Ga0105238_100025652 173
325 3300009551 Ga0105238_10133924 Ga0105238_101339242 173
326 3300009551 Ga0105238_10177742 Ga0105238_101777422 173
327 3300009553 Ga0105249_10442469 Ga0105249_104424692 173
328 3300010375 Ga0105239_10121481 Ga0105239_101214812 173
329 3300010375 Ga0105239_10981397 Ga0105239_109813972 173
330 3300011119 Ga0105246_10114536 Ga0105246_101145362 173
331 3300013100 Ga0157373_10101389 Ga0157373_101013892 173
332 3300013102 Ga0157371_10207088 Ga0157371_102070882 173
333 3300013102 Ga0157371_10553072 Ga0157371_105530721 173
334 3300013104 Ga0157370_10020147 Ga0157370_100201474 173
335 3300013104 Ga0157370_10089256 Ga0157370_100892563 173
336 3300013105 Ga0157369_10001417 Ga0157369_100014171 173
337 3300013296 Ga0157374_10073038 Ga0157374_100730383 173
338 3300013296 Ga0157374_10130476 Ga0157374_101304762 173
339 3300013296 Ga0157374_10142912 Ga0157374_101429123 173
340 3300013296 Ga0157374_10548325 Ga0157374_105483252 173
341 3300013296 Ga0157374_10765194 Ga0157374_107651942 173
342 3300013296 Ga0157374_11189143 Ga0157374_111891431 173
343 3300013297 Ga0157378_10077664 Ga0157378_100776642 173
344 3300013297 Ga0157378_11676571 Ga0157378_116765712 173
345 3300013306 Ga0163162_10004424 Ga0163162_100044243 173
346 3300013306 Ga0163162_10038505 Ga0163162_100385056 173
347 3300013306 Ga0163162_10493901 Ga0163162_104939012 173
348 3300013306 Ga0163162_10657033 Ga0163162_106570332 173
349 3300013306 Ga0163162_12071778 Ga0163162_120717781 173
350 3300013307 Ga0157372_10003179 Ga0157372_1000317913 173
351 3300013307 Ga0157372_10067327 Ga0157372_100673273 173
352 3300013307 Ga0157372_10159008 Ga0157372_101590083 173
353 3300013307 Ga0157372_11245422 Ga0157372_112454222 173
354 3300013308 Ga0157375_10006387 Ga0157375_100063879 173
355 3300013308 Ga0157375_10019641 Ga0157375_100196416 173
356 3300013308 Ga0157375_10080914 Ga0157375_100809143 173
357 3300013308 Ga0157375_10151633 Ga0157375_101516332 173
358 3300013308 Ga0157375_10405343 Ga0157375_104053432 173
359 3300013308 Ga0157375_10983620 Ga0157375_109836201 173
360 3300014325 Ga0163163_10031254 Ga0163163_100312544 173
361 3300014325 Ga0163163_10034015 Ga0163163_100340155 173
362 3300014325 Ga0163163_10164237 Ga0163163_101642372 173
363 3300014325 Ga0163163_10555810 Ga0163163_105558102 173
364 3300014326 Ga0157380_10012973 Ga0157380_100129733 173
365 3300014326 Ga0157380_10133142 Ga0157380_101331423 173
366 3300014326 Ga0157380_10233090 Ga0157380_102330902 173
367 3300014745 Ga0157377_10063867 Ga0157377_100638672 173
368 3300014745 Ga0157377_10267001 Ga0157377_102670012 173
369 3300014968 Ga0157379_10004462 Ga0157379_1000446212 173
370 3300014968 Ga0157379_10024218 Ga0157379_100242182 173
371 3300014968 Ga0157379_10061522 Ga0157379_100615222 173
372 3300014968 Ga0157379_10092686 Ga0157379_100926863 173
373 3300014968 Ga0157379_10099305 Ga0157379_100993052 173
374 3300014969 Ga0157376_10085585 Ga0157376_100855853 173
375 3300014969 Ga0157376_10127747 Ga0157376_101277473 173
376 3300014969 Ga0157376_10200701 Ga0157376_102007012 173
377 3300014969 Ga0157376_10329469 Ga0157376_103294692 173
378 3300017792 Ga0163161_10016140 Ga0163161_100161404 173
379 3300017792 Ga0163161_10035830 Ga0163161_100358304 173
380 3300017792 Ga0163161_10350625 Ga0163161_103506252 173
381 3300021377 Ga0213874_10054231 Ga0213874_100542312 173
382 3300021384 Ga0213876_10075065 Ga0213876_100750652 173
383 3300021384 Ga0213876_10166433 Ga0213876_101664332 173
384 3300025321 Ga0207656_10007890 Ga0207656_100078904 173
385 3300025321 Ga0207656_10057945 Ga0207656_100579452 173
386 3300025321 Ga0207656_10114144 Ga0207656_101141442 173
387 3300025321 Ga0207656_10128368 Ga0207656_101283682 173
388 3300025321 Ga0207656_10198568 Ga0207656_101985682 173
389 3300025893 Ga0207682_10002971 Ga0207682_100029712 173
390 3300025893 Ga0207682_10028879 Ga0207682_100288792 173
391 3300025893 Ga0207682_10052091 Ga0207682_100520912 173
392 3300025893 Ga0207682_10267892 Ga0207682_102678921 173
393 3300025899 Ga0207642_10002689 Ga0207642_100026892 173
394 3300025901 Ga0207688_10177615 Ga0207688_101776152 173
395 3300025903 Ga0207680_10015539 Ga0207680_100155395 173
396 3300025903 Ga0207680_10016326 Ga0207680_100163264 173
397 3300025903 Ga0207680_10123465 Ga0207680_101234652 173
398 3300025903 Ga0207680_10502161 Ga0207680_105021611 173
399 3300025903 Ga0207680_10540025 Ga0207680_105400252 173
400 3300025907 Ga0207645_10005283 Ga0207645_100052838 173
401 3300025907 Ga0207645_10031798 Ga0207645_100317981 173
402 3300025907 Ga0207645_10046537 Ga0207645_100465374 173
403 3300025907 Ga0207645_10051897 Ga0207645_100518973 173
404 3300025908 Ga0207643_10095554 Ga0207643_100955542 173
405 3300025909 Ga0207705_10019896 Ga0207705_100198963 173
406 3300025909 Ga0207705_10057954 Ga0207705_100579542 173
407 3300025909 Ga0207705_10068798 Ga0207705_100687982 173
408 3300025909 Ga0207705_10482950 Ga0207705_104829502 173
409 3300025912 Ga0207707_10432043 Ga0207707_104320432 173
410 3300025915 Ga0207693_10075058 Ga0207693_100750582 173
411 3300025917 Ga0207660_11166078 Ga0207660_111660781 173
412 3300025918 Ga0207662_10007292 Ga0207662_100072924 173
413 3300025919 Ga0207657_10140060 Ga0207657_101400602 173
414 3300025919 Ga0207657_10178023 Ga0207657_101780232 173
415 3300025920 Ga0207649_10183781 Ga0207649_101837813 173
416 3300025920 Ga0207649_10321977 Ga0207649_103219772 173
417 3300025920 Ga0207649_10562741 Ga0207649_105627412 173
418 3300025921 Ga0207652_10172838 Ga0207652_101728382 173
419 3300025921 Ga0207652_10646759 Ga0207652_106467592 173
420 3300025922 Ga0207646_10593066 Ga0207646_105930662 173
421 3300025923 Ga0207681_10002043 Ga0207681_100020433 173
422 3300025923 Ga0207681_10013149 Ga0207681_100131492 173
423 3300025923 Ga0207681_10015363 Ga0207681_100153632 173
424 3300025923 Ga0207681_10136582 Ga0207681_101365822 173
425 3300025923 Ga0207681_10251984 Ga0207681_102519842 173
426 3300025924 Ga0207694_10096401 Ga0207694_100964012 173
427 3300025924 Ga0207694_10328464 Ga0207694_103284642 173
428 3300025925 Ga0207650_10011876 Ga0207650_100118762 173
429 3300025925 Ga0207650_10054905 Ga0207650_100549052 173
430 3300025925 Ga0207650_10099174 Ga0207650_100991743 173
431 3300025925 Ga0207650_10099858 Ga0207650_100998582 173
432 3300025925 Ga0207650_10169221 Ga0207650_101692212 173
433 3300025925 Ga0207650_10426241 Ga0207650_104262412 173
434 3300025925 Ga0207650_10963429 Ga0207650_109634292 173
435 3300025926 Ga0207659_10000313 Ga0207659_1000031316 173
436 3300025926 Ga0207659_10055225 Ga0207659_100552253 173
437 3300025926 Ga0207659_10108670 Ga0207659_101086702 173
438 3300025926 Ga0207659_10132320 Ga0207659_101323202 173
439 3300025926 Ga0207659_10267502 Ga0207659_102675022 173
440 3300025926 Ga0207659_10456552 Ga0207659_104565522 173
441 3300025927 Ga0207687_10046846 Ga0207687_100468464 173
442 3300025927 Ga0207687_10222735 Ga0207687_102227353 173
443 3300025927 Ga0207687_10296428 Ga0207687_102964282 173
444 3300025928 Ga0207700_10000338 Ga0207700_1000033827 173
445 3300025928 Ga0207700_10032912 Ga0207700_100329123 173
446 3300025928 Ga0207700_10100864 Ga0207700_101008643 173
447 3300025929 Ga0207664_10942764 Ga0207664_109427641 173
448 3300025931 Ga0207644_10000517 Ga0207644_1000051724 173
449 3300025931 Ga0207644_10005549 Ga0207644_100055496 173
450 3300025931 Ga0207644_10116617 Ga0207644_101166172 173
451 3300025931 Ga0207644_10123428 Ga0207644_101234282 173
452 3300025931 Ga0207644_10204918 Ga0207644_102049182 173
453 3300025932 Ga0207690_10069010 Ga0207690_100690103 173
454 3300025932 Ga0207690_10292890 Ga0207690_102928902 173
455 3300025932 Ga0207690_10856079 Ga0207690_108560792 173
456 3300025933 Ga0207706_10003551 Ga0207706_100035515 173
457 3300025933 Ga0207706_10015438 Ga0207706_100154386 173
458 3300025933 Ga0207706_10073877 Ga0207706_100738774 173
459 3300025933 Ga0207706_10078917 Ga0207706_100789172 173
460 3300025933 Ga0207706_10301466 Ga0207706_103014662 173
461 3300025933 Ga0207706_10306354 Ga0207706_103063542 173
462 3300025934 Ga0207686_10013046 Ga0207686_100130463 173
463 3300025934 Ga0207686_10035577 Ga0207686_100355772 173
464 3300025935 Ga0207709_10148989 Ga0207709_101489892 173
465 3300025935 Ga0207709_10150709 Ga0207709_101507093 173
466 3300025936 Ga0207670_10030009 Ga0207670_100300095 173
467 3300025936 Ga0207670_10989918 Ga0207670_109899182 173
468 3300025937 Ga0207669_10015520 Ga0207669_100155204 173
469 3300025937 Ga0207669_10167644 Ga0207669_101676442 173
470 3300025937 Ga0207669_10434363 Ga0207669_104343632 173
471 3300025937 Ga0207669_11028543 Ga0207669_110285432 173
472 3300025938 Ga0207704_10018901 Ga0207704_100189014 173
473 3300025938 Ga0207704_11194656 Ga0207704_111946562 173
474 3300025939 Ga0207665_10197673 Ga0207665_101976732 173
475 3300025939 Ga0207665_10251355 Ga0207665_102513552 173
476 3300025940 Ga0207691_10007603 Ga0207691_100076036 173
477 3300025940 Ga0207691_10008416 Ga0207691_100084162 173
478 3300025940 Ga0207691_10033898 Ga0207691_100338987 173
479 3300025940 Ga0207691_10130481 Ga0207691_101304812 173
480 3300025940 Ga0207691_10225796 Ga0207691_102257963 173
481 3300025940 Ga0207691_10296005 Ga0207691_102960052 173
482 3300025941 Ga0207711_10029584 Ga0207711_100295846 173
483 3300025941 Ga0207711_10060708 Ga0207711_100607082 173
484 3300025941 Ga0207711_10087670 Ga0207711_100876702 173
485 3300025941 Ga0207711_10104118 Ga0207711_101041182 173
486 3300025942 Ga0207689_10002034 Ga0207689_100020345 173
487 3300025942 Ga0207689_10013647 Ga0207689_100136475 173
488 3300025942 Ga0207689_10021025 Ga0207689_100210252 173
489 3300025942 Ga0207689_10347648 Ga0207689_103476482 173
490 3300025944 Ga0207661_10028878 Ga0207661_100288782 173
491 3300025944 Ga0207661_10112969 Ga0207661_101129692 173
492 3300025945 Ga0207679_10182092 Ga0207679_101820923 173
493 3300025945 Ga0207679_10361937 Ga0207679_103619372 173
494 3300025945 Ga0207679_10517003 Ga0207679_105170032 173
495 3300025945 Ga0207679_11346316 Ga0207679_113463161 173
496 3300025949 Ga0207667_10015924 Ga0207667_100159244 173
497 3300025949 Ga0207667_10017769 Ga0207667_100177696 173
498 3300025949 Ga0207667_10040469 Ga0207667_100404693 173
499 3300025960 Ga0207651_10000600 Ga0207651_100006003 173
500 3300025960 Ga0207651_10196662 Ga0207651_101966622 173
501 3300025960 Ga0207651_10264450 Ga0207651_102644502 173
502 3300025960 Ga0207651_10787442 Ga0207651_107874422 173
503 3300025961 Ga0207712_10610010 Ga0207712_106100102 173
504 3300025972 Ga0207668_10005847 Ga0207668_100058472 173
505 3300025972 Ga0207668_10022312 Ga0207668_100223123 173
506 3300025972 Ga0207668_10259948 Ga0207668_102599482 173
507 3300025972 Ga0207668_10463986 Ga0207668_104639862 173
508 3300025981 Ga0207640_10065937 Ga0207640_100659372 173
509 3300025981 Ga0207640_10093962 Ga0207640_100939623 173
510 3300025981 Ga0207640_10416881 Ga0207640_104168812 173
511 3300025981 Ga0207640_10555566 Ga0207640_105555662 173
512 3300025986 Ga0207658_10000812 Ga0207658_1000081210 173
513 3300025986 Ga0207658_10004524 Ga0207658_100045249 173
514 3300025986 Ga0207658_10008395 Ga0207658_100083952 173
515 3300025986 Ga0207658_10104711 Ga0207658_101047113 173
516 3300025986 Ga0207658_10365385 Ga0207658_103653852 173
517 3300025986 Ga0207658_10425975 Ga0207658_104259752 173
518 3300026023 Ga0207677_10004232 Ga0207677_100042325 173
519 3300026023 Ga0207677_10012506 Ga0207677_100125067 173
520 3300026023 Ga0207677_10203650 Ga0207677_102036503 173
521 3300026023 Ga0207677_10521385 Ga0207677_105213852 173
522 3300026035 Ga0207703_10000929 Ga0207703_1000092920 173
523 3300026035 Ga0207703_10001541 Ga0207703_100015418 173
524 3300026035 Ga0207703_10374599 Ga0207703_103745992 173
525 3300026035 Ga0207703_11196395 Ga0207703_111963952 173
526 3300026041 Ga0207639_10045094 Ga0207639_100450942 173
527 3300026041 Ga0207639_10064502 Ga0207639_100645024 173
528 3300026041 Ga0207639_10369350 Ga0207639_103693503 173
529 3300026041 Ga0207639_10620505 Ga0207639_106205052 173
530 3300026041 Ga0207639_11325285 Ga0207639_113252851 173
531 3300026067 Ga0207678_10121386 Ga0207678_101213862 173
532 3300026067 Ga0207678_10323622 Ga0207678_103236222 173
533 3300026067 Ga0207678_10622106 Ga0207678_106221062 173
534 3300026075 Ga0207708_10548800 Ga0207708_105488002 173
535 3300026088 Ga0207641_10000655 Ga0207641_1000065539 173
536 3300026088 Ga0207641_10041985 Ga0207641_100419855 173
537 3300026088 Ga0207641_10100664 Ga0207641_101006642 173
538 3300026088 Ga0207641_10808793 Ga0207641_108087932 173
539 3300026088 Ga0207641_11003515 Ga0207641_110035151 173
540 3300026089 Ga0207648_10006616 Ga0207648_1000661612 173
541 3300026089 Ga0207648_10831348 Ga0207648_108313482 173
542 3300026095 Ga0207676_10002990 Ga0207676_100029908 173
543 3300026095 Ga0207676_10008396 Ga0207676_100083963 173
544 3300026095 Ga0207676_10017575 Ga0207676_100175757 173
545 3300026095 Ga0207676_10019288 Ga0207676_100192882 173
546 3300026095 Ga0207676_10040215 Ga0207676_100402153 173
547 3300026095 Ga0207676_10045925 Ga0207676_100459252 173
548 3300026095 Ga0207676_10357517 Ga0207676_103575172 173
549 3300026095 Ga0207676_10472438 Ga0207676_104724382 173
550 3300026095 Ga0207676_10474911 Ga0207676_104749112 173
551 3300026095 Ga0207676_10539494 Ga0207676_105394942 173
552 3300026095 Ga0207676_10871663 Ga0207676_108716631 173
553 3300026116 Ga0207674_10161382 Ga0207674_101613822 173
554 3300026116 Ga0207674_10532567 Ga0207674_105325672 173
555 3300026116 Ga0207674_10998576 Ga0207674_109985762 173
556 3300026118 Ga0207675_100000956 Ga0207675_10000095634 173
557 3300026118 Ga0207675_100052681 Ga0207675_1000526812 173
558 3300026121 Ga0207683_10001877 Ga0207683_100018772 173
559 3300026121 Ga0207683_10030845 Ga0207683_100308452 173
560 3300026121 Ga0207683_10091526 Ga0207683_100915262 173
561 3300026121 Ga0207683_10104582 Ga0207683_101045822 173
562 3300026121 Ga0207683_10236721 Ga0207683_102367213 173
563 3300026121 Ga0207683_10297475 Ga0207683_102974753 173
564 3300026142 Ga0207698_10061514 Ga0207698_100615142 173
565 3300026142 Ga0207698_10063805 Ga0207698_100638052 173
566 3300026142 Ga0207698_10082727 Ga0207698_100827272 173
567 3300026142 Ga0207698_10084881 Ga0207698_100848812 173
568 3300026142 Ga0207698_10108058 Ga0207698_101080582 173
569 3300026142 Ga0207698_10147223 Ga0207698_101472232 173
570 3300026142 Ga0207698_10152334 Ga0207698_101523342 173
571 3300026142 Ga0207698_10490085 Ga0207698_104900852 173
572 3300026142 Ga0207698_11073289 Ga0207698_110732892 173
573 3300026142 Ga0207698_11279611 Ga0207698_112796112 173
574 3300027907 Ga0207428_10002089 Ga0207428_100020892 173
575 3300027907 Ga0207428_10002537 Ga0207428_1000253716 173
576 3300028379 Ga0268266_10047759 Ga0268266_100477592 173
577 3300028379 Ga0268266_10199372 Ga0268266_101993721 173
578 3300028379 Ga0268266_10217974 Ga0268266_102179742 173
579 3300028379 Ga0268266_11382983 Ga0268266_113829831 173
580 3300028380 Ga0268265_10008601 Ga0268265_100086012 173
581 3300028380 Ga0268265_10031887 Ga0268265_100318876 173
582 3300028381 Ga0268264_10002170 Ga0268264_100021703 173
583 3300028381 Ga0268264_10175313 Ga0268264_101753132 173
584 3300028381 Ga0268264_11331446 Ga0268264_113314461 173
585 3300028786 Ga0307517_10044883 Ga0307517_100448833 173
586 3300028786 Ga0307517_10134835 Ga0307517_101348352 173
587 3300028794 Ga0307515_10059241 Ga0307515_100592412 173
588 3300028794 Ga0307515_10203361 Ga0307515_102033611 173
589 3300030522 Ga0307512_10076021 Ga0307512_100760212 173
590 3300030522 Ga0307512_10078766 Ga0307512_100787663 173
591 3300031241 Ga0265325_10209885 Ga0265325_102098852 173
592 3300031251 Ga0265327_10063857 Ga0265327_100638572 173
593 3300031251 Ga0265327_10262958 Ga0265327_102629581 173
594 3300031507 Ga0307509_10001002 Ga0307509_1000100231 173
595 3300031507 Ga0307509_10001260 Ga0307509_1000126034 173
596 3300031507 Ga0307509_10004767 Ga0307509_1000476719 173
597 3300031507 Ga0307509_10187105 Ga0307509_101871052 173
598 3300031616 Ga0307508_10000280 Ga0307508_1000028060 173
599 3300031616 Ga0307508_10105300 Ga0307508_101053002 173
600 3300031649 Ga0307514_10195648 Ga0307514_101956481 173
601 3300031731 Ga0307405_10247785 Ga0307405_102477851 173
602 3300031733 Ga0316577_10118272 Ga0316577_101182723 173
603 3300031838 Ga0307518_10338600 Ga0307518_103386002 173
604 3300031911 Ga0307412_10659572 Ga0307412_106595722 173
605 3300032002 Ga0307416_100106326 Ga0307416_1001063262 173
606 3300032002 Ga0307416_100229178 Ga0307416_1002291782 173
607 3300032002 Ga0307416_100410429 Ga0307416_1004104291 173
608 3300033179 Ga0307507_10251428 Ga0307507_102514281 173
609 3300033180 Ga0307510_10004362 Ga0307510_1000436215 173
610 3300033180 Ga0307510_10007103 Ga0307510_100071033 173
611 3300033180 Ga0307510_10170337 Ga0307510_101703372 173
612 3300034816 Ga0373930_0005560 Ga0373930_0005560_344_874 173
613 3300034818 Ga0373950_0010626 Ga0373950_0010626_133_663 173
614 3300034818 Ga0373950_0106964 Ga0373950_0106964_13_573 173
615 3300034819 Ga0373958_0043208 Ga0373958_0043208_356_886 173
616 3300034957 Ga0373938_0081421 Ga0373938_0081421_208_741 173
617 3300035084 Ga0373928_0006702 Ga0373928_0006702_327_887 173
618 3300035084 Ga0373928_0014117 Ga0373928_0014117_730_1260 173
619 3300035088 Ga0373940_0020375 Ga0373940_0020375_1021_1581 173
620 3300035088 Ga0373940_0058359 Ga0373940_0058359_129_659 173
621 3300035089 Ga0373944_0054881 Ga0373944_0054881_587_1117 173
622 3300035090 Ga0373949_0012100 Ga0373949_0012100_294_824 173
623 3300035112 Ga0373932_0005424 Ga0373932_0005424_2072_2602 173
624 3300035114 Ga0373939_0060359 Ga0373939_0060359_184_744 173
625 3300035114 Ga0373939_0060793 Ga0373939_0060793_366_896 173
626 3300035116 Ga0373945_0054060 Ga0373945_0054060_352_882 173
627 3300035117 Ga0373953_0092485 Ga0373953_0092485_528_1106 173
628 3300035118 Ga0373954_0270649 Ga0373954_0270649_207_785 173
629 3300035121 Ga0373960_0164703 Ga0373960_0164703_169_699 173
630 3300035170 Ga0373943_0051985 Ga0373943_0051985_900_1430 173
631 3300035171 Ga0373946_0289354 Ga0373946_0289354_141_671 173
632 3300035172 Ga0373955_0113976 Ga0373955_0113976_867_1397 173
633 3300035207 Ga0373942_0000734 Ga0373942_0000734_3805_4335 173
634 3300035207 Ga0373942_0001974 Ga0373942_0001974_162_692 173
635 3300035207 Ga0373942_0071824 Ga0373942_0071824_231_791 173
636 3300035241 Ga0373961_0059455 Ga0373961_0059455_380_910 173
637 3300035242 Ga0373962_0084741 Ga0373962_0084741_34_594 173
638 3300035410 Ga0373924_0018981 Ga0373924_0018981_1082_1612 173
639 3300035410 Ga0373924_0071339 Ga0373924_0071339_616_1194 173
640 3300035691 Ga0373931_0001134 Ga0373931_0001134_1747_2277 173
641 3300035691 Ga0373931_0021651 Ga0373931_0021651_1348_1908 173
642 3300035691 Ga0373931_0181112 Ga0373931_0181112_575_1105 173
643 3300035695 Ga0373927_0597852 Ga0373927_0597852_38_568 173
644 3300035724 Ga0373933_0058049 Ga0373933_0058049_679_1257 173
645 3300035724 Ga0373933_0434936 Ga0373933_0434936_322_846 173
646 3300035725 Ga0373947_0121761 Ga0373947_0121761_501_1079 173
647 3300035725 Ga0373947_0499542 Ga0373947_0499542_160_690 173
648 3300036401 Ga0373937_0059039 Ga0373937_0059039_607_1137 173
649 3300036401 Ga0373937_0133691 Ga0373937_0133691_1235_1813 173
650 3300036401 Ga0373937_0335080 Ga0373937_0335080_606_1142 173
651 3300036647 Ga0316582_0027613 Ga0316582_0027613_2330_2851 173
652 3300037068 Ga0373925_0014054 Ga0373925_0014054_469_999 173
653 3300037068 Ga0373925_0067472 Ga0373925_0067472_1810_2388 173
654 3300037466 Ga0395898_0397175 Ga0395898_0397175_50_586 173
655 3300037471 Ga0395905_0003363 Ga0395905_0003363_341_874 173
656 3300037471 Ga0395905_0053119 Ga0395905_0053119_2884_3420 173
657 3300038443 Ga0395901_0120274 Ga0395901_0120274_1510_2046 173
658 3300039437 Ga0436365_0033031 Ga0436365_0033031_369_899 173
659 3300039437 Ga0436365_0697613 Ga0436365_0697613_1131_1661 173
660 3300039437 Ga0436365_1034743 Ga0436365_1034743_231_761 173
661 3300039450 Ga0436363_0285240 Ga0436363_0285240_1563_2093 173
662 3300041496 Ga0451839_1414179 Ga0451839_1414179_85_615 173
663 3300041507 Ga0451851_1082858 Ga0451851_1082858_39_569 173
664 3300041509 Ga0451843_0111968 Ga0451843_0111968_14_544 173
665 3300042439 Ga0439464_0003009 Ga0439464_0003009_3195_3725 173
666 3300042461 Ga0439460_0071839 Ga0439460_0071839_493_1023 173
667 3300044684 Ga0466966_0095143 Ga0466966_0095143_1005_1541 173
668 3300044842 Ga0466957_0092227 Ga0466957_0092227_317_853 173
669 3300045049 Ga0466959_0235540 Ga0466959_0235540_370_906 173
670 3300045051 Ga0451576_0094792 Ga0451576_0094792_2542_3072 173
671 3300045051 Ga0451576_0107944 Ga0451576_0107944_1372_1902 173
672 3300046454 Ga0495592_0000441 Ga0495592_0000441_27359_27892 173
673 3300046454 Ga0495592_0213900 Ga0495592_0213900_697_1275 173
674 3300046454 Ga0495592_0306907 Ga0495592_0306907_424_954 173
675 3300046454 Ga0495592_0505759 Ga0495592_0505759_65_595 173
676 3300046455 Ga0495603_0148969 Ga0495603_0148969_405_929 173
677 3300046459 Ga0495629_0037403 Ga0495629_0037403_1380_1958 173
678 3300046459 Ga0495629_0519138 Ga0495629_0519138_183_713 173
679 3300046460 Ga0495638_0098481 Ga0495638_0098481_227_757 173
680 3300046472 Ga0495580_0118662 Ga0495580_0118662_804_1334 173
681 3300046472 Ga0495580_0130877 Ga0495580_0130877_494_1024 173
682 3300046477 Ga0495664_0188941 Ga0495664_0188941_244_822 173
683 3300046477 Ga0495664_0321182 Ga0495664_0321182_98_628 173
684 3300046506 Ga0495583_0223199 Ga0495583_0223199_40_570 173
685 3300046515 Ga0495620_0056590 Ga0495620_0056590_805_1335 173
686 3300046515 Ga0495620_0151272 Ga0495620_0151272_147_677 173
687 3300046517 Ga0495630_0442430 Ga0495630_0442430_410_940 173
688 3300046524 Ga0495648_0138814 Ga0495648_0138814_536_1069 173
689 3300046524 Ga0495648_0224127 Ga0495648_0224127_11_544 173
690 3300046526 Ga0495666_0048287 Ga0495666_0048287_1193_1723 173
691 3300046537 Ga0495598_0109114 Ga0495598_0109114_342_872 173
692 3300046539 Ga0495621_0010584 Ga0495621_0010584_892_1422 173
693 3300046539 Ga0495621_0084548 Ga0495621_0084548_376_906 173
694 3300046539 Ga0495621_0218102 Ga0495621_0218102_65_595 173
695 3300046539 Ga0495621_0261997 Ga0495621_0261997_76_606 173
696 3300046543 Ga0495645_0060913 Ga0495645_0060913_1187_1717 173
697 3300046543 Ga0495645_0217869 Ga0495645_0217869_206_736 173
698 3300046559 Ga0495667_0247374 Ga0495667_0247374_244_822 173
699 3300046559 Ga0495667_0286252 Ga0495667_0286252_430_960 173
700 3300046615 Ga0495656_0129656 Ga0495656_0129656_279_809 173
701 3300046660 Ga0495625_0082170 Ga0495625_0082170_1218_1748 173
702 3300046663 Ga0495635_0148354 Ga0495635_0148354_101_631 173
703 3300046681 Ga0495647_0028086 Ga0495647_0028086_958_1488 173
704 3300046683 Ga0495658_0047962 Ga0495658_0047962_627_1205 173
705 3300046683 Ga0495658_0060024 Ga0495658_0060024_131_661 173
706 3300046683 Ga0495658_0107937 Ga0495658_0107937_841_1371 173
707 3300046683 Ga0495658_0123515 Ga0495658_0123515_655_1185 173
708 3300046683 Ga0495658_0218137 Ga0495658_0218137_640_1170 173
709 3300046694 Ga0495649_0153993 Ga0495649_0153993_533_1063 173
710 3300046694 Ga0495649_0276938 Ga0495649_0276938_56_589 173
711 3300046809 Ga0495600_0167314 Ga0495600_0167314_232_810 173
712 3300046809 Ga0495600_0349362 Ga0495600_0349362_196_726 173
713 3300047319 Ga0495674_0312052 Ga0495674_0312052_495_1073 173
714 3300047319 Ga0495674_0703450 Ga0495674_0703450_246_776 173
715 3300047321 Ga0495676_0429143 Ga0495676_0429143_93_623 173
716 3300047322 Ga0495680_0126817 Ga0495680_0126817_663_1241 173
717 3300047471 Ga0495684_0214199 Ga0495684_0214199_327_857 173
718 3300048091 Ga0495626_0048760 Ga0495626_0048760_1030_1560 173
719 3300048903 Ga0496100_0605059 Ga0496100_0605059_149_679 173
720 3300048904 Ga0496101_0019596 Ga0496101_0019596_2847_3407 173
721 3300048905 Ga0496102_0037417 Ga0496102_0037417_3302_3862 173
722 3300048906 Ga0496103_0378785 Ga0496103_0378785_294_854 173
723 3300048907 Ga0496104_0051283 Ga0496104_0051283_1108_1668 173
724 3300048907 Ga0496104_0768246 Ga0496104_0768246_112_642 173
725 3300048908 Ga0496105_0108099 Ga0496105_0108099_878_1408 173
726 3300048908 Ga0496105_0300546 Ga0496105_0300546_377_907 173
727 3300048909 Ga0496106_0042882 Ga0496106_0042882_1358_1918 173
728 3300048909 Ga0496106_0693557 Ga0496106_0693557_198_728 173
729 3300048909 Ga0496106_1275042 Ga0496106_1275042_29_559 173
730 3300048910 Ga0496107_0015263 Ga0496107_0015263_2136_2696 173
731 3300048911 Ga0496108_0071263 Ga0496108_0071263_1978_2508 173
732 3300048911 Ga0496108_0497998 Ga0496108_0497998_249_779 173
733 3300048912 Ga0496109_0122624 Ga0496109_0122624_479_1009 173
734 3300048912 Ga0496109_0130713 Ga0496109_0130713_584_1144 173
735 3300048913 Ga0496110_0098506 Ga0496110_0098506_1219_1779 173
736 3300048913 Ga0496110_0342255 Ga0496110_0342255_312_842 173
737 3300048913 Ga0496110_0535288 Ga0496110_0535288_304_834 173
738 3300048913 Ga0496110_1364294 Ga0496110_1364294_36_566 173
739 3300048914 Ga0496111_0046517 Ga0496111_0046517_1956_2516 173
740 3300048915 Ga0496112_0111756 Ga0496112_0111756_68_598 173
741 3300048915 Ga0496112_0285050 Ga0496112_0285050_34_594 173
742 3300048915 Ga0496112_0490455 Ga0496112_0490455_327_887 173
743 3300048916 Ga0496113_0022247 Ga0496113_0022247_147_707 173
744 3300048916 Ga0496113_0104759 Ga0496113_0104759_274_834 173
745 3300048917 Ga0496114_0023038 Ga0496114_0023038_1316_1876 173
746 3300048917 Ga0496114_0189226 Ga0496114_0189226_861_1391 173
747 3300048918 Ga0496115_0056268 Ga0496115_0056268_1566_2126 173
748 3300049571 Ga0501034_0623081 Ga0501034_0623081_117_650 173
749 3300049580 Ga0501046_0161765 Ga0501046_0161765_541_1074 173
750 3300049581 Ga0501047_0006119 Ga0501047_0006119_4029_4562 173
751 3300049585 Ga0501069_0004773 Ga0501069_0004773_166_699 173
752 3300049586 Ga0501070_0070069 Ga0501070_0070069_279_812 173
753 3300049588 Ga0501072_0247331 Ga0501072_0247331_857_1390 173
754 3300049589 Ga0501073_0006933 Ga0501073_0006933_1085_1618 173
755 3300049590 Ga0501074_0000154 Ga0501074_0000154_6571_7104 173
756 3300049672 Ga0501239_007686 Ga0501239_007686_336_866 173
757 3300049741 Ga0501079_0064641 Ga0501079_0064641_997_1530 173
758 3300049742 Ga0501080_0005032 Ga0501080_0005032_7818_8351 173
759 3300049744 Ga0501083_0000323 Ga0501083_0000323_24516_25049 173
760 3300049762 Ga0501265_002194 Ga0501265_002194_1288_1818 173
761 3300049823 Ga0501044_0028237 Ga0501044_0028237_245_778 173
762 3300050493 nmdc:mga0k408_20345_c2 nmdc:mga0k408_20345_c2_1975_2505 173
763 3300050507 nmdc:mga05p37_3648_c1 nmdc:mga05p37_3648_c1_14866_15396 173
764 3300050508 nmdc:mga09592_970944_c1 nmdc:mga09592_970944_c1_14_574 173
765 3300050510 nmdc:mga06r32_1508637_c1 nmdc:mga06r32_1508637_c1_56_586 173
766 3300050511 nmdc:mga08y16_10350_c1 nmdc:mga08y16_10350_c1_2925_3455 173
767 3300050511 nmdc:mga08y16_386_c1 nmdc:mga08y16_386_c1_3572_4102 173
768 3300050511 nmdc:mga08y16_396818_c1 nmdc:mga08y16_396818_c1_376_906 173
769 3300050513 nmdc:mga0rr50_443265_c1 nmdc:mga0rr50_443265_c1_537_1067 173
770 3300050515 nmdc:mga0a205_238006_c1 nmdc:mga0a205_238006_c1_943_1473 173
771 3300050515 nmdc:mga0a205_366208_c1 nmdc:mga0a205_366208_c1_293_823 173
772 3300050515 nmdc:mga0a205_597109_c1 nmdc:mga0a205_597109_c1_182_742 173
773 3300053077 Ga0495601_0171470 Ga0495601_0171470_726_1304 173
774 3300053077 Ga0495601_0345695 Ga0495601_0345695_227_772 173
775 3300053078 Ga0495612_0111179 Ga0495612_0111179_547_1077 173
776 3300053084 Ga0495595_0364007 Ga0495595_0364007_159_689 173
777 3300053085 Ga0495619_0089451 Ga0495619_0089451_471_1049 173
778 3300053085 Ga0495619_0152669 Ga0495619_0152669_710_1240 173
779 3300053086 Ga0500578_0173163 Ga0500578_0173163_403_933 173
780 3300053088 Ga0500644_0040479 Ga0500644_0040479_883_1416 173
781 3300053092 Ga0500583_0140249 Ga0500583_0140249_417_947 173
782 3300053093 Ga0500651_0117401 Ga0500651_0117401_931_1464 173
783 3300053131 Ga0500652_062352 Ga0500652_062352_902_1432 173
784 3300053133 Ga0500655_011256 Ga0500655_011256_242_772 173
785 3300053136 Ga0500559_0000138 Ga0500559_0000138_8500_9033 173
786 3300053139 Ga0500568_0125805 Ga0500568_0125805_392_925 173
787 3300053154 Ga0500619_154586 Ga0500619_154586_31_561 173
788 3300053156 Ga0500622_0027122 Ga0500622_0027122_1253_1786 173
789 3300053177 Ga0500636_0041980 Ga0500636_0041980_1212_1742 173
790 3300053730 Ga0500645_008228 Ga0500645_008228_594_1124 173
791 3300053739 Ga0500587_002360 Ga0500587_002360_899_1429 173
792 3300053739 Ga0500587_031393 Ga0500587_031393_17_547 173
793 3300054114 Ga0501084_0112102 Ga0501084_0112102_212_745 173
794 3300060353 Ga0501082_0060312 Ga0501082_0060312_1178_1711 173
795 3300005331 Ga0070670_100081717 Ga0070670_1000817171 174
796 3300005344 Ga0070661_100128221 Ga0070661_1001282213 174
797 3300005364 Ga0070673_100582630 Ga0070673_1005826302 174
798 3300005365 Ga0070688_100312538 Ga0070688_1003125382 174
799 3300005444 Ga0070694_100721490 Ga0070694_1007214902 174
800 3300005545 Ga0070695_100255375 Ga0070695_1002553752 174
801 3300005547 Ga0070693_100660652 Ga0070693_1006606522 174
802 3300006186 Ga0075369_10057690 Ga0075369_100576902 174
803 3300009551 Ga0105238_10023451 Ga0105238_100234516 174
804 3300009553 Ga0105249_11137211 Ga0105249_111372112 174
805 3300011119 Ga0105246_10590374 Ga0105246_105903741 174
806 3300025250 Ga0209026_1003689 Ga0209026_10036892 174
807 3300025909 Ga0207705_10106325 Ga0207705_101063254 174
808 3300026041 Ga0207639_11195829 Ga0207639_111958291 174
809 3300028381 Ga0268264_10072300 Ga0268264_100723002 174
810 3300028794 Ga0307515_10000026 Ga0307515_100000263 174
811 3300031665 Ga0316575_10013115 Ga0316575_100131153 174
812 3300031665 Ga0316575_10121945 Ga0316575_101219452 174
813 3300031665 Ga0316575_10176598 Ga0316575_101765982 174
814 3300031691 Ga0316579_10006968 Ga0316579_100069682 174
815 3300031691 Ga0316579_10016583 Ga0316579_100165834 174
816 3300031728 Ga0316578_10003640 Ga0316578_100036403 174
817 3300031733 Ga0316577_10073697 Ga0316577_100736973 174
818 3300032137 Ga0316585_10033270 Ga0316585_100332702 174
819 3300032168 Ga0316593_10006586 Ga0316593_100065862 174
820 3300035092 Ga0373952_0035000 Ga0373952_0035000_289_852 174
821 3300035398 Ga0316574_0047043 Ga0316574_0047043_1725_2249 174
822 3300035691 Ga0373931_0204860 Ga0373931_0204860_277_813 174
823 3300035725 Ga0373947_0653299 Ga0373947_0653299_41_574 174
824 3300036647 Ga0316582_0001711 Ga0316582_0001711_6981_7505 174
825 3300036647 Ga0316582_0028351 Ga0316582_0028351_2202_2735 174
826 3300036712 Ga0316584_0058622 Ga0316584_0058622_1401_1934 174
827 3300037588 Ga0316581_0003897 Ga0316581_0003897_1630_2154 174
828 3300037588 Ga0316581_0006691 Ga0316581_0006691_1076_1609 174
829 3300038443 Ga0395901_0143025 Ga0395901_0143025_1724_2272 174
830 3300042129 Ga0450891_019829 Ga0450891_019829_31_564 174
831 3300042876 Ga0451577_0006056 Ga0451577_0006056_6703_7227 174
832 3300044673 Ga0453683_0002919 Ga0453683_0002919_5961_6485 174
833 3300044712 Ga0453684_0023590 Ga0453684_0023590_1155_1679 174
834 3300045051 Ga0451576_0009861 Ga0451576_0009861_3787_4311 174
835 3300046461 Ga0495641_0413046 Ga0495641_0413046_14_547 174
836 3300046517 Ga0495630_0185078 Ga0495630_0185078_1030_1566 174
837 3300046526 Ga0495666_0176388 Ga0495666_0176388_430_966 174
838 3300046689 Ga0495613_0448882 Ga0495613_0448882_40_573 174
839 3300046690 Ga0495624_0005244 Ga0495624_0005244_2838_3374 174
840 3300047321 Ga0495676_0071019 Ga0495676_0071019_833_1369 174
841 3300047673 Ga0495593_0052778 Ga0495593_0052778_570_1103 174
842 3300048904 Ga0496101_0103838 Ga0496101_0103838_329_865 174
843 3300048908 Ga0496105_0833301 Ga0496105_0833301_12_548 174
844 3300049568 Ga0501031_0018528 Ga0501031_0018528_1915_2442 174
845 3300049572 Ga0501036_0040574 Ga0501036_0040574_3277_3804 174
846 3300049573 Ga0501037_0109148 Ga0501037_0109148_1147_1674 174
847 3300049582 Ga0501048_0035242 Ga0501048_0035242_1526_2053 174
848 3300049582 Ga0501048_0327910 Ga0501048_0327910_151_732 174
849 3300049822 Ga0501035_0605827 Ga0501035_0605827_73_600 174
850 3300049824 Ga0501045_0666890 Ga0501045_0666890_126_707 174
851 3300005467 Ga0070706_100508506 Ga0070706_1005085062 175
852 3300006847 Ga0075431_100010552 Ga0075431_1000105526 175
853 3300044658 Ga0466972_0007540 Ga0466972_0007540_2367_2894 175
854 3300044683 Ga0466965_0003754 Ga0466965_0003754_3051_3578 175
855 3300044706 Ga0466964_0012646 Ga0466964_0012646_2143_2670 175
856 3300044735 Ga0466968_0038679 Ga0466968_0038679_580_1107 175
857 3300044901 Ga0466960_0353715 Ga0466960_0353715_67_594 175
858 3300050510 nmdc:mga06r32_37367_c1 nmdc:mga06r32_37367_c1_166_726 175
859 3300005331 Ga0070670_100008874 Ga0070670_1000088742 176
860 3300005563 Ga0068855_100187330 Ga0068855_1001873302 176
861 3300005615 Ga0070702_100152382 Ga0070702_1001523822 176
862 3300005618 Ga0068864_100830578 Ga0068864_1008305782 176
863 3300005842 Ga0068858_100004346 Ga0068858_1000043462 176
864 3300009174 Ga0105241_10527663 Ga0105241_105276632 176
865 3300009177 Ga0105248_10545997 Ga0105248_105459971 176
866 3300014325 Ga0163163_10021119 Ga0163163_100211192 176
867 3300025949 Ga0207667_10232482 Ga0207667_102324822 176
868 3300026035 Ga0207703_10050619 Ga0207703_100506193 176
869 3300026088 Ga0207641_10083989 Ga0207641_100839891 176
870 3300026088 Ga0207641_10263864 Ga0207641_102638641 176
871 3300026095 Ga0207676_10197511 Ga0207676_101975112 176
872 3300031251 Ga0265327_10001736 Ga0265327_100017365 176
873 3300031251 Ga0265327_10010729 Ga0265327_100107294 176
874 3300031344 Ga0265316_10001407 Ga0265316_1000140723 176
875 3300049705 Ga0501225_0110888 Ga0501225_0110888_11_565 176
876 3300046471 Ga0495650_0009592 Ga0495650_0009592_1827_2360 177
877 3300032168 Ga0316593_10013817 Ga0316593_100138173 178
878 3300033529 Ga0316587_1002653 Ga0316587_10026533 178
879 3300042876 Ga0451577_0665218 Ga0451577_0665218_157_708 178
880 3300044712 Ga0453684_0745692 Ga0453684_0745692_299_850 178
881 3300045051 Ga0451576_0085191 Ga0451576_0085191_1492_2043 178
882 3300003215 JGI25153J46596_10025878 JGI25153J46596_100258782 179
883 3300009036 Ga0105244_10000891 Ga0105244_100008912 179
884 3300025245 Ga0207425_1000433 Ga0207425_100043321 179
885 3300025294 Ga0209025_1006993 Ga0209025_10069937 179
886 3300025295 Ga0209564_1000027 Ga0209564_100002744 179
887 3300025297 Ga0209758_1000436 Ga0209758_100043654 179
888 3300025728 Ga0207655_1006687 Ga0207655_10066879 179
889 3300035114 Ga0373939_0111111 Ga0373939_0111111_88_627 179
890 3300046452 Ga0495617_015763 Ga0495617_015763_1305_1844 179
891 3300046471 Ga0495650_0000100 Ga0495650_0000100_43174_43713 179
892 3300046471 Ga0495650_0005611 Ga0495650_0005611_330_869 179
893 3300046501 Ga0495607_0010628 Ga0495607_0010628_5554_6093 179
894 3300046512 Ga0495610_0002542 Ga0495610_0002542_11250_11789 179
895 3300046512 Ga0495610_0148713 Ga0495610_0148713_22_561 179
896 3300046524 Ga0495648_0050687 Ga0495648_0050687_780_1319 179
897 3300046558 Ga0495633_0005786 Ga0495633_0005786_4729_5268 179
898 3300046616 Ga0495668_0000286 Ga0495668_0000286_22730_23269 179
899 3300046616 Ga0495668_0002018 Ga0495668_0002018_16121_16660 179
900 3300046694 Ga0495649_0118313 Ga0495649_0118313_179_718 179
901 3300047469 Ga0495673_0000080 Ga0495673_0000080_169209_169748 179
902 3300047469 Ga0495673_0066497 Ga0495673_0066497_264_803 179
903 3300047472 Ga0495686_0005098 Ga0495686_0005098_9518_10057 179
904 3300048910 Ga0496107_0164021 Ga0496107_0164021_915_1454 179
905 3300048919 Ga0496116_0007031 Ga0496116_0007031_5706_6245 179
906 3300048927 Ga0496124_0090236 Ga0496124_0090236_1065_1604 179
907 3300048927 Ga0496124_0146409 Ga0496124_0146409_989_1528 179
908 3300048928 Ga0496125_0105200 Ga0496125_0105200_250_789 179
909 3300053118 Ga0500594_0018882 Ga0500594_0018882_974_1513 179
910 3300053125 Ga0500618_069032 Ga0500618_069032_40_579 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

56

173

0.92

PF08534

Redoxin

Redoxin

55

188

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b1k-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9419 29 175
2g0f-assembly1.cif.gz_A crystal structure of p144a mutant of e.coli ccmg protein 0.9372 29 175
1z5y-assembly1.cif.gz_E crystal structure of the disulfide-linked complex between the n-terminal domain of the electron transfer catalyst dsbd and the cytochrome c biogenesis protein ccmg 0.9342 43 175
2b1k-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9238 29 175
3k8n-assembly1.cif.gz_A crystal structure of e. coli ccmg 0.921 24 174
ID Description Score Start End Superfamily
2b1kA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9418 29 175 3.40.30.10
2b1kA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9238 29 175 3.40.30.10
1kngA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9199 36 172 3.40.30.10
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.875 41 172 3.40.30.10
1kngA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8709 36 172 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W0X5A7-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9894 34 174 GO:0015036
GO:0017004
GO:0030288
AF-A0A1H7XPN3-F1-model_v4 Cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE 0.9814 21 173 GO:0015036
GO:0017004
GO:0030288
AF-A0A536Z3B2-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9756 70 172 GO:0015036
GO:0017004
GO:0030288
AF-A0A7W0X5A7-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9756 34 174 GO:0015036
GO:0017004
GO:0030288
AF-A0A3M0YK98-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9714 56 175 GO:0005886
GO:0015036
GO:0017004
GO:0030288

Feature Viewer

pLDDT pTM Quality
93.31 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map