F485419
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 909 | 391 | 883 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0000002|Ga0466969_0000002_16633_17763 |
| Length | 376 |
| Sequence | MRNISRLQNRNGYAFTPRMASAELRRRNGGTGATRVPIWHAGCPGVRKMKRGDIRIGISGWRYEPWRGVFYPEGLAQRRELEYASRMFPTIELNGSFYSLQKPEFFAEWHDETPEDFVFAVKGPKYITHVRRLKEVRTPLANFLASGLFELKAKLGPILWQFPPMLPFKPERFEAFFEMLPRDLEAAAAIAAEHDQRVEGRCTLTIDANRPLRHAVEIRHPSFADGAFVAMLRKHKIALVVADTAGKWPLLEDLTADFVYLRLHGDKELYASGYSDAALDRWAARIATWSEGGQVDDARLATHKAAPRRSRRDVYCYFDNDVKVHAPYDAASLGRKLGLDSPLGPKGRPSWPPGFEVPQPRVRAPGFERRRGATPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 5 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 6 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 7 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 8 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 9 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 10 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 11 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 12 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 13 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 14 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 15 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 16 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 17 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 18 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 19 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 20 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 21 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 22 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 23 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 24 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 25 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 26 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 27 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 28 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 29 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 30 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 31 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 32 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 33 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 34 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 35 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 36 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 37 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 38 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 39 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 40 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 50 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 53 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 54 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 55 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 60 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 64 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 91 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 94 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 102 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 104 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 105 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 106 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 108 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 109 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 110 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 111 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 112 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 113 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 114 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 115 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 116 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 117 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 118 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 119 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 120 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 122 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 123 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 125 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 126 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 127 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 128 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 129 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 130 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 131 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 132 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 133 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 135 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 136 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 137 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 151 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 163 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 167 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 168 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 248 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 249 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 251 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 255 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 256 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 257 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 258 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 259 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 260 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 261 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 262 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 263 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 264 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 265 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 266 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 267 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 268 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 269 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 270 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 271 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 272 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 273 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 274 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 275 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 276 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 277 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 278 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 282 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 283 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 285 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 286 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 287 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 288 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 289 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 290 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 291 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 292 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 293 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 294 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 296 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 297 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 298 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 299 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 300 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 301 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 302 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 303 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 304 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 305 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 306 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 307 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 308 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 309 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 310 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 311 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 312 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 313 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 314 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 315 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 316 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 317 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 318 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 319 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 320 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 321 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 322 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 323 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 324 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 325 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 338 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 339 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 340 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 341 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 345 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 346 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 347 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 348 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 349 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 350 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 351 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 352 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 359 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 360 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 361 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 362 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 363 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 364 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 367 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 368 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 372 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 373 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 374 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 375 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 376 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 377 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 378 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 386 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 390 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 391 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.92 |
| Metatranscriptomes | 0.11 |
| Isolates | 2.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.42 |
| Nodule | 0.55 |
| Rhizoplane | 2.2 |
| Rhizosphere | 78.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10014614 | 3300001979 | Bacteria | 2889 |
| 2 | JGI25152J39213_1000235 | 3300002773 | Bacteria | 37077 |
| 3 | JGI25152J39213_1006017 | 3300002773 | Bacteria | 3396 |
| 4 | JGI25152J39213_1006552 | 3300002773 | Bacteria | 3145 |
| 5 | JGI25150J39212_1002798 | 3300002774 | Bacteria | 4233 |
| 6 | JGI25150J39212_1005920 | 3300002774 | Bacteria | 2571 |
| 7 | JGI25159J45721_1000103 | 3300002987 | Bacteria | 40372 |
| 8 | JGI25151J46595_10000696 | 3300003187 | Bacteria | 28239 |
| 9 | JGI25151J46595_10007041 | 3300003187 | Bacteria | 5562 |
| 10 | JGI25151J46595_10026948 | 3300003187 | Bacteria | 2311 |
| 11 | JGI25153J46596_10000298 | 3300003215 | Bacteria | 37077 |
| 12 | JGI25153J46596_10022611 | 3300003215 | Bacteria | 2311 |
| 13 | rootH1_10034705 | 3300003316 | Bacteria | 8660 |
| 14 | rootH1_10034705 | 3300003323 | Bacteria | 1881 |
| 15 | rootH2_10100170 | 3300003320 | Bacteria | 1298 |
| 16 | rootH1_10019948 | 3300003323 | Bacteria | 6154 |
| 17 | rootH1_10134544 | 3300003323 | Bacteria | 4027 |
| 18 | rootH1_10168926 | 3300003323 | Bacteria | 2072 |
| 19 | JGI25160J50197_1000255 | 3300003354 | Bacteria | 40372 |
| 20 | JGI25161J50226_1002151 | 3300003374 | Bacteria | 5286 |
| 21 | JGI25161J50226_1002672 | 3300003374 | Bacteria | 4438 |
| 22 | Ga0006562J51391_1136022 | 3300003578 | Bacteria | 1790 |
| 23 | Ga0055535_1000075 | 3300003761 | Bacteria | 111667 |
| 24 | Ga0055542_1000059 | 3300003762 | Bacteria | 162670 |
| 25 | Ga0055526_1000357 | 3300003771 | Bacteria | 37077 |
| 26 | Ga0055526_1003917 | 3300003771 | Bacteria | 9189 |
| 27 | Ga0055526_1006587 | 3300003771 | Bacteria | 6262 |
| 28 | Ga0055537_1000274 | 3300003773 | Bacteria | 37077 |
| 29 | Ga0055537_1000544 | 3300003773 | Bacteria | 21755 |
| 30 | Ga0055524_1000400 | 3300003775 | Bacteria | 37077 |
| 31 | Ga0055536_1001372 | 3300003781 | Bacteria | 14798 |
| 32 | Ga0055534_1000255 | 3300003784 | Bacteria | 37077 |
| 33 | Ga0055534_1000494 | 3300003784 | Bacteria | 21755 |
| 34 | Ga0055534_1008056 | 3300003784 | Bacteria | 2430 |
| 35 | Ga0055528_1000277 | 3300003790 | Bacteria | 43644 |
| 36 | Ga0055528_1002350 | 3300003790 | Bacteria | 10234 |
| 37 | Ga0055530_10000110 | 3300003791 | Bacteria | 71015 |
| 38 | Ga0055540_1001401 | 3300003792 | Bacteria | 14381 |
| 39 | Ga0055531_10001242 | 3300003794 | Bacteria | 19363 |
| 40 | Ga0055531_10001413 | 3300003794 | Bacteria | 17732 |
| 41 | Ga0055531_10003669 | 3300003794 | Bacteria | 9674 |
| 42 | Ga0055543_1000262 | 3300004625 | Bacteria | 39412 |
| 43 | Ga0055543_1000644 | 3300004625 | Bacteria | 18672 |
| 44 | Ga0065165_1000494 | 3300005262 | Bacteria | 60929 |
| 45 | Ga0065714_10071324 | 3300005288 | Bacteria | 3602 |
| 46 | Ga0065707_10089760 | 3300005295 | Bacteria | 4287 |
| 47 | Ga0070676_10000256 | 3300005328 | Bacteria | 23138 |
| 48 | Ga0070676_10023646 | 3300005328 | Bacteria | 3455 |
| 49 | Ga0070683_100131351 | 3300005329 | Bacteria | 2370 |
| 50 | Ga0070670_100000274 | 3300005331 | Bacteria | 45804 |
| 51 | Ga0070670_100002086 | 3300005331 | Bacteria | 16383 |
| 52 | Ga0070670_100004507 | 3300005331 | Bacteria | 11675 |
| 53 | Ga0070670_100027541 | 3300005331 | Bacteria | 4888 |
| 54 | Ga0070670_100055280 | 3300005331 | Bacteria | 3407 |
| 55 | Ga0070670_100142038 | 3300005331 | Bacteria | 2076 |
| 56 | Ga0070670_100176784 | 3300005331 | Bacteria | 1852 |
| 57 | Ga0070670_100201633 | 3300005331 | Bacteria | 1729 |
| 58 | Ga0070677_10000666 | 3300005333 | Bacteria | 11477 |
| 59 | Ga0070677_10018435 | 3300005333 | Bacteria | 2513 |
| 60 | Ga0068869_100000242 | 3300005334 | Bacteria | 28762 |
| 61 | Ga0068869_100003103 | 3300005334 | Bacteria | 10132 |
| 62 | Ga0068869_100004100 | 3300005334 | Bacteria | 9026 |
| 63 | Ga0068869_100005398 | 3300005334 | Bacteria | 8035 |
| 64 | Ga0068869_100015284 | 3300005334 | Bacteria | 5145 |
| 65 | Ga0068869_100030693 | 3300005334 | Bacteria | 3776 |
| 66 | Ga0070666_10000632 | 3300005335 | Bacteria | 21185 |
| 67 | Ga0070666_10001227 | 3300005335 | Bacteria | 15482 |
| 68 | Ga0070666_10019284 | 3300005335 | Bacteria | 4400 |
| 69 | Ga0070666_10035838 | 3300005335 | Bacteria | 3290 |
| 70 | Ga0070680_100000172 | 3300005336 | Bacteria | 41297 |
| 71 | Ga0070680_100062213 | 3300005336 | Bacteria | 3056 |
| 72 | Ga0070682_100002377 | 3300005337 | Bacteria | 10428 |
| 73 | Ga0068868_100000197 | 3300005338 | Bacteria | 40300 |
| 74 | Ga0068868_100027785 | 3300005338 | Bacteria | 4319 |
| 75 | Ga0068868_100049743 | 3300005338 | Bacteria | 3290 |
| 76 | Ga0068868_100170719 | 3300005338 | Bacteria | 1800 |
| 77 | Ga0068868_100218157 | 3300005338 | Bacteria | 1596 |
| 78 | Ga0070660_100001451 | 3300005339 | Bacteria | 16205 |
| 79 | Ga0070660_100018945 | 3300005339 | Bacteria | 5038 |
| 80 | Ga0070660_100132602 | 3300005339 | Bacteria | 1995 |
| 81 | Ga0070689_100089389 | 3300005340 | Bacteria | 2426 |
| 82 | Ga0070689_100089976 | 3300005340 | Bacteria | 2418 |
| 83 | Ga0070689_100153538 | 3300005340 | Bacteria | 1858 |
| 84 | Ga0070689_100208444 | 3300005340 | Bacteria | 1599 |
| 85 | Ga0070687_100004159 | 3300005343 | Bacteria | 5730 |
| 86 | Ga0070687_100020042 | 3300005343 | Bacteria | 3121 |
| 87 | Ga0070687_100055963 | 3300005343 | Bacteria | 2062 |
| 88 | Ga0070661_100001049 | 3300005344 | Bacteria | 19550 |
| 89 | Ga0070661_100007506 | 3300005344 | Bacteria | 7524 |
| 90 | Ga0070692_10000564 | 3300005345 | Bacteria | 11606 |
| 91 | Ga0070692_10009685 | 3300005345 | Bacteria | 4357 |
| 92 | Ga0070668_100003835 | 3300005347 | Bacteria | 11106 |
| 93 | Ga0070668_100006076 | 3300005347 | Bacteria | 8954 |
| 94 | Ga0070668_100013298 | 3300005347 | Bacteria | 6142 |
| 95 | Ga0070668_100014299 | 3300005347 | Bacteria | 5931 |
| 96 | Ga0070669_100001974 | 3300005353 | Bacteria | 14822 |
| 97 | Ga0070669_100074254 | 3300005353 | Bacteria | 2521 |
| 98 | Ga0070669_100155009 | 3300005353 | Bacteria | 1776 |
| 99 | Ga0070675_100000297 | 3300005354 | Bacteria | 33289 |
| 100 | Ga0070675_100005416 | 3300005354 | Bacteria | 9760 |
| 101 | Ga0070675_100012809 | 3300005354 | Bacteria | 6580 |
| 102 | Ga0070675_100029594 | 3300005354 | Bacteria | 4418 |
| 103 | Ga0070675_100065833 | 3300005354 | Bacteria | 2996 |
| 104 | Ga0070675_100076015 | 3300005354 | Bacteria | 2792 |
| 105 | Ga0070671_100000622 | 3300005355 | Bacteria | 25307 |
| 106 | Ga0070671_100001843 | 3300005355 | Bacteria | 16144 |
| 107 | Ga0070671_100033348 | 3300005355 | Bacteria | 4257 |
| 108 | Ga0070671_100259234 | 3300005355 | Bacteria | 1477 |
| 109 | Ga0070674_100000657 | 3300005356 | Bacteria | 17460 |
| 110 | Ga0070674_100000722 | 3300005356 | Bacteria | 16867 |
| 111 | Ga0070674_100119556 | 3300005356 | Bacteria | 1949 |
| 112 | Ga0070673_100000892 | 3300005364 | Bacteria | 16840 |
| 113 | Ga0070673_100002101 | 3300005364 | Bacteria | 12033 |
| 114 | Ga0070673_100066019 | 3300005364 | Bacteria | 2889 |
| 115 | Ga0070673_100130092 | 3300005364 | Bacteria | 2111 |
| 116 | Ga0070673_100220008 | 3300005364 | Bacteria | 1643 |
| 117 | Ga0070673_100501594 | 3300005364 | Bacteria | 1098 |
| 118 | Ga0070659_100000892 | 3300005366 | Bacteria | 21835 |
| 119 | Ga0070659_100003263 | 3300005366 | Bacteria | 11544 |
| 120 | Ga0070659_100021770 | 3300005366 | Bacteria | 4887 |
| 121 | Ga0070659_100128061 | 3300005366 | Bacteria | 2060 |
| 122 | Ga0070659_100327527 | 3300005366 | Bacteria | 1281 |
| 123 | Ga0070667_100006184 | 3300005367 | Bacteria | 9957 |
| 124 | Ga0070667_100007725 | 3300005367 | Bacteria | 8913 |
| 125 | Ga0070667_100008672 | 3300005367 | Bacteria | 8424 |
| 126 | Ga0070667_100066934 | 3300005367 | Bacteria | 3053 |
| 127 | Ga0070667_100232179 | 3300005367 | Bacteria | 1645 |
| 128 | Ga0070703_10025469 | 3300005406 | Bacteria | 1755 |
| 129 | Ga0070713_100001451 | 3300005436 | Bacteria | 15131 |
| 130 | Ga0070710_10193709 | 3300005437 | Bacteria | 1280 |
| 131 | Ga0070701_10013999 | 3300005438 | Bacteria | 3666 |
| 132 | Ga0070711_100372519 | 3300005439 | Bacteria | 1153 |
| 133 | Ga0070705_100000829 | 3300005440 | Bacteria | 17358 |
| 134 | Ga0070700_100204597 | 3300005441 | Bacteria | 1389 |
| 135 | Ga0070694_100001268 | 3300005444 | Bacteria | 14675 |
| 136 | Ga0070708_100400638 | 3300005445 | Bacteria | 1294 |
| 137 | Ga0070663_100001081 | 3300005455 | Bacteria | 14917 |
| 138 | Ga0070663_100002216 | 3300005455 | Bacteria | 10875 |
| 139 | Ga0070663_100066689 | 3300005455 | Bacteria | 2608 |
| 140 | Ga0070663_100080571 | 3300005455 | Bacteria | 2391 |
| 141 | Ga0070663_100113931 | 3300005455 | Bacteria | 2035 |
| 142 | Ga0070663_100293807 | 3300005455 | Bacteria | 1298 |
| 143 | Ga0070678_100010378 | 3300005456 | Bacteria | 5685 |
| 144 | Ga0070678_100036279 | 3300005456 | Bacteria | 3449 |
| 145 | Ga0070678_100085005 | 3300005456 | Bacteria | 2410 |
| 146 | Ga0070678_100085493 | 3300005456 | Bacteria | 2404 |
| 147 | Ga0070662_100008473 | 3300005457 | Bacteria | 6707 |
| 148 | Ga0070662_100015351 | 3300005457 | Bacteria | 5128 |
| 149 | Ga0070662_100019349 | 3300005457 | Bacteria | 4622 |
| 150 | Ga0070662_100019586 | 3300005457 | Bacteria | 4595 |
| 151 | Ga0070662_100094189 | 3300005457 | Bacteria | 2254 |
| 152 | Ga0070662_100210587 | 3300005457 | Bacteria | 1547 |
| 153 | Ga0070662_100388668 | 3300005457 | Bacteria | 1149 |
| 154 | Ga0070681_10013452 | 3300005458 | Bacteria | 8130 |
| 155 | Ga0070681_10216502 | 3300005458 | Bacteria | 1831 |
| 156 | Ga0068867_100000047 | 3300005459 | Bacteria | 74014 |
| 157 | Ga0068867_100000424 | 3300005459 | Bacteria | 28257 |
| 158 | Ga0068867_100002201 | 3300005459 | Bacteria | 13676 |
| 159 | Ga0068867_100004082 | 3300005459 | Bacteria | 10270 |
| 160 | Ga0068867_100007097 | 3300005459 | Bacteria | 7917 |
| 161 | Ga0068867_100032027 | 3300005459 | Bacteria | 3799 |
| 162 | Ga0070679_100000185 | 3300005530 | Bacteria | 50363 |
| 163 | Ga0070679_100006933 | 3300005530 | Bacteria | 10571 |
| 164 | Ga0070684_100015224 | 3300005535 | Bacteria | 6256 |
| 165 | Ga0070684_100103958 | 3300005535 | Bacteria | 2541 |
| 166 | Ga0070684_100210820 | 3300005535 | Bacteria | 1771 |
| 167 | Ga0068853_100003221 | 3300005539 | Bacteria | 12479 |
| 168 | Ga0068853_100022179 | 3300005539 | Bacteria | 5300 |
| 169 | Ga0068853_100045573 | 3300005539 | Bacteria | 3756 |
| 170 | Ga0068853_100108970 | 3300005539 | Bacteria | 2458 |
| 171 | Ga0070672_100003390 | 3300005543 | Bacteria | 10330 |
| 172 | Ga0070672_100003947 | 3300005543 | Bacteria | 9669 |
| 173 | Ga0070672_100013936 | 3300005543 | Bacteria | 5688 |
| 174 | Ga0070672_100072430 | 3300005543 | Bacteria | 2743 |
| 175 | Ga0070672_100079787 | 3300005543 | Bacteria | 2621 |
| 176 | Ga0070672_100099402 | 3300005543 | Bacteria | 2358 |
| 177 | Ga0070672_100217772 | 3300005543 | Bacteria | 1601 |
| 178 | Ga0070672_100437728 | 3300005543 | Bacteria | 1125 |
| 179 | Ga0070686_100037582 | 3300005544 | Bacteria | 3004 |
| 180 | Ga0070695_100003882 | 3300005545 | Bacteria | 8720 |
| 181 | Ga0070696_100002658 | 3300005546 | Bacteria | 11843 |
| 182 | Ga0070696_100148649 | 3300005546 | Bacteria | 1718 |
| 183 | Ga0070693_100000248 | 3300005547 | Bacteria | 25117 |
| 184 | Ga0070665_100097987 | 3300005548 | Bacteria | 2937 |
| 185 | Ga0070665_100137179 | 3300005548 | Bacteria | 2449 |
| 186 | Ga0070665_100262352 | 3300005548 | Bacteria | 1729 |
| 187 | Ga0070704_100002912 | 3300005549 | Bacteria | 9719 |
| 188 | Ga0070704_100114219 | 3300005549 | Bacteria | 2061 |
| 189 | Ga0068855_100000437 | 3300005563 | Bacteria | 51661 |
| 190 | Ga0068855_100008322 | 3300005563 | Bacteria | 12538 |
| 191 | Ga0068855_100016992 | 3300005563 | Bacteria | 8751 |
| 192 | Ga0068855_100044952 | 3300005563 | Bacteria | 5225 |
| 193 | Ga0068855_100097495 | 3300005563 | Bacteria | 3386 |
| 194 | Ga0070664_100002952 | 3300005564 | Bacteria | 13754 |
| 195 | Ga0070664_100004721 | 3300005564 | Bacteria | 10929 |
| 196 | Ga0070664_100022450 | 3300005564 | Bacteria | 5202 |
| 197 | Ga0070664_100100237 | 3300005564 | Bacteria | 2518 |
| 198 | Ga0070664_100102425 | 3300005564 | Bacteria | 2491 |
| 199 | Ga0070664_100195180 | 3300005564 | Bacteria | 1804 |
| 200 | Ga0070664_100196618 | 3300005564 | Bacteria | 1797 |
| 201 | Ga0068857_100003534 | 3300005577 | Bacteria | 13063 |
| 202 | Ga0068857_100017776 | 3300005577 | Bacteria | 6233 |
| 203 | Ga0068857_100059742 | 3300005577 | Bacteria | 3387 |
| 204 | Ga0068854_100002679 | 3300005578 | Bacteria | 11036 |
| 205 | Ga0068854_100003177 | 3300005578 | Bacteria | 10252 |
| 206 | Ga0068854_100004830 | 3300005578 | Bacteria | 8502 |
| 207 | Ga0068854_100023555 | 3300005578 | Bacteria | 4207 |
| 208 | Ga0068856_100000464 | 3300005614 | Bacteria | 44730 |
| 209 | Ga0068856_100121603 | 3300005614 | Bacteria | 2612 |
| 210 | Ga0068856_100333968 | 3300005614 | Bacteria | 1533 |
| 211 | Ga0070702_100069858 | 3300005615 | Bacteria | 2071 |
| 212 | Ga0070702_100071124 | 3300005615 | Bacteria | 2056 |
| 213 | Ga0070702_100078656 | 3300005615 | Bacteria | 1969 |
| 214 | Ga0068852_100000895 | 3300005616 | Bacteria | 19700 |
| 215 | Ga0068852_100007034 | 3300005616 | Bacteria | 8193 |
| 216 | Ga0068852_100015220 | 3300005616 | Bacteria | 5956 |
| 217 | Ga0068852_100031572 | 3300005616 | Bacteria | 4373 |
| 218 | Ga0068852_100062542 | 3300005616 | Bacteria | 3238 |
| 219 | Ga0068852_100062905 | 3300005616 | Bacteria | 3229 |
| 220 | Ga0068852_100085617 | 3300005616 | Bacteria | 2808 |
| 221 | Ga0068852_100104118 | 3300005616 | Bacteria | 2568 |
| 222 | Ga0068852_100178897 | 3300005616 | Bacteria | 1993 |
| 223 | Ga0068852_100230640 | 3300005616 | Bacteria | 1765 |
| 224 | Ga0068859_100002792 | 3300005617 | Bacteria | 17696 |
| 225 | Ga0068859_100007895 | 3300005617 | Bacteria | 10798 |
| 226 | Ga0068859_100281934 | 3300005617 | Bacteria | 1754 |
| 227 | Ga0068859_100658147 | 3300005617 | Bacteria | 1139 |
| 228 | Ga0068864_100001333 | 3300005618 | Bacteria | 20559 |
| 229 | Ga0068864_100006397 | 3300005618 | Bacteria | 9652 |
| 230 | Ga0068864_100008382 | 3300005618 | Bacteria | 8528 |
| 231 | Ga0068864_100182348 | 3300005618 | Bacteria | 1920 |
| 232 | Ga0068864_100226386 | 3300005618 | Bacteria | 1727 |
| 233 | Ga0068866_10002303 | 3300005718 | Bacteria | 7907 |
| 234 | Ga0068866_10090767 | 3300005718 | Bacteria | 1663 |
| 235 | Ga0068861_100001445 | 3300005719 | Bacteria | 15020 |
| 236 | Ga0068861_100004435 | 3300005719 | Bacteria | 9417 |
| 237 | Ga0068861_100010099 | 3300005719 | Bacteria | 6546 |
| 238 | Ga0068861_100120248 | 3300005719 | Bacteria | 2118 |
| 239 | Ga0068861_100281759 | 3300005719 | Bacteria | 1432 |
| 240 | Ga0068851_10008604 | 3300005834 | Bacteria | 4721 |
| 241 | Ga0068851_10027727 | 3300005834 | Bacteria | 2793 |
| 242 | Ga0068851_10049347 | 3300005834 | Bacteria | 2134 |
| 243 | Ga0068851_10171750 | 3300005834 | Bacteria | 1197 |
| 244 | Ga0068870_10000256 | 3300005840 | Bacteria | 19580 |
| 245 | Ga0068870_10055487 | 3300005840 | Bacteria | 2111 |
| 246 | Ga0068863_100000793 | 3300005841 | Bacteria | 31764 |
| 247 | Ga0068863_100019711 | 3300005841 | Bacteria | 6451 |
| 248 | Ga0068863_100050562 | 3300005841 | Bacteria | 3940 |
| 249 | Ga0068863_100077811 | 3300005841 | Bacteria | 3139 |
| 250 | Ga0068863_100105074 | 3300005841 | Bacteria | 2686 |
| 251 | Ga0068863_100196143 | 3300005841 | Bacteria | 1941 |
| 252 | Ga0068863_100208949 | 3300005841 | Bacteria | 1879 |
| 253 | Ga0068863_100291272 | 3300005841 | Bacteria | 1582 |
| 254 | Ga0068863_100583086 | 3300005841 | Bacteria | 1106 |
| 255 | Ga0068858_100000345 | 3300005842 | Bacteria | 49147 |
| 256 | Ga0068858_100007270 | 3300005842 | Bacteria | 10730 |
| 257 | Ga0068858_100011883 | 3300005842 | Bacteria | 8205 |
| 258 | Ga0068858_100026341 | 3300005842 | Bacteria | 5405 |
| 259 | Ga0068858_100262837 | 3300005842 | Bacteria | 1641 |
| 260 | Ga0068860_100000216 | 3300005843 | Bacteria | 90423 |
| 261 | Ga0068860_100001723 | 3300005843 | Bacteria | 23333 |
| 262 | Ga0068860_100009885 | 3300005843 | Bacteria | 9458 |
| 263 | Ga0068860_100030858 | 3300005843 | Bacteria | 5153 |
| 264 | Ga0068860_100376181 | 3300005843 | Bacteria | 1401 |
| 265 | Ga0068862_100008744 | 3300005844 | Bacteria | 8383 |
| 266 | Ga0068862_100334171 | 3300005844 | Bacteria | 1402 |
| 267 | Ga0081539_10068401 | 3300005985 | Bacteria | 1916 |
| 268 | Ga0075363_100025332 | 3300006048 | Bacteria | 3024 |
| 269 | Ga0075363_100028759 | 3300006048 | Bacteria | 2862 |
| 270 | Ga0070716_100068725 | 3300006173 | Bacteria | 2073 |
| 271 | Ga0075362_10005526 | 3300006177 | Bacteria | 4634 |
| 272 | Ga0075362_10006134 | 3300006177 | Bacteria | 4456 |
| 273 | Ga0075362_10017513 | 3300006177 | Bacteria | 2952 |
| 274 | Ga0075362_10117549 | 3300006177 | Bacteria | 1256 |
| 275 | Ga0075366_10016780 | 3300006195 | Bacteria | 4209 |
| 276 | Ga0075366_10064581 | 3300006195 | Bacteria | 2177 |
| 277 | Ga0075366_10076142 | 3300006195 | Bacteria | 2002 |
| 278 | Ga0075366_10123972 | 3300006195 | Bacteria | 1558 |
| 279 | Ga0097621_100091399 | 3300006237 | Bacteria | 2548 |
| 280 | Ga0097621_100324333 | 3300006237 | Bacteria | 1365 |
| 281 | Ga0075370_10001936 | 3300006353 | Bacteria | 9342 |
| 282 | Ga0075370_10003801 | 3300006353 | Bacteria | 7228 |
| 283 | Ga0075370_10014723 | 3300006353 | Bacteria | 4176 |
| 284 | Ga0075370_10026589 | 3300006353 | Bacteria | 3206 |
| 285 | Ga0075370_10077658 | 3300006353 | Bacteria | 1905 |
| 286 | Ga0075370_10110263 | 3300006353 | Bacteria | 1598 |
| 287 | Ga0068871_100001908 | 3300006358 | Bacteria | 14090 |
| 288 | Ga0068871_100138408 | 3300006358 | Bacteria | 2069 |
| 289 | Ga0068871_100159579 | 3300006358 | Bacteria | 1928 |
| 290 | Ga0068871_100159987 | 3300006358 | Bacteria | 1925 |
| 291 | Ga0075428_100470065 | 3300006844 | Bacteria | 1346 |
| 292 | Ga0075430_100035882 | 3300006846 | Bacteria | 4205 |
| 293 | Ga0075433_10015747 | 3300006852 | Bacteria | 6213 |
| 294 | Ga0075433_10075983 | 3300006852 | Bacteria | 2957 |
| 295 | Ga0075434_100000018 | 3300006871 | Bacteria | 73715 |
| 296 | Ga0075434_100116972 | 3300006871 | Bacteria | 2679 |
| 297 | Ga0075429_100019226 | 3300006880 | Bacteria | 5917 |
| 298 | Ga0075429_100416201 | 3300006880 | Bacteria | 1177 |
| 299 | Ga0068865_100042684 | 3300006881 | Bacteria | 3094 |
| 300 | Ga0068865_100047597 | 3300006881 | Bacteria | 2947 |
| 301 | Ga0075436_100015029 | 3300006914 | Bacteria | 5305 |
| 302 | Ga0097620_100002792 | 3300006931 | Bacteria | 17696 |
| 303 | Ga0097620_100007895 | 3300006931 | Bacteria | 10798 |
| 304 | Ga0097620_100106515 | 3300006931 | Bacteria | 2863 |
| 305 | Ga0097620_100281920 | 3300006931 | Bacteria | 1754 |
| 306 | Ga0097620_100658223 | 3300006931 | Bacteria | 1139 |
| 307 | Ga0079104_1005275 | 3300006946 | Bacteria | 5207 |
| 308 | Ga0099826_10000408 | 3300006948 | Bacteria | 20307 |
| 309 | Ga0075435_100000675 | 3300007076 | Bacteria | 21138 |
| 310 | Ga0075435_100013522 | 3300007076 | Bacteria | 6074 |
| 311 | Ga0105250_10000005 | 3300009092 | Bacteria | 422580 |
| 312 | Ga0105240_10039918 | 3300009093 | Bacteria | 6008 |
| 313 | Ga0105240_10182607 | 3300009093 | Bacteria | 2474 |
| 314 | Ga0105240_10251318 | 3300009093 | Bacteria | 2044 |
| 315 | Ga0111539_10010277 | 3300009094 | Bacteria | 11782 |
| 316 | Ga0111539_10010327 | 3300009094 | Bacteria | 11756 |
| 317 | Ga0105245_10030772 | 3300009098 | Bacteria | 4747 |
| 318 | Ga0105245_10254344 | 3300009098 | Bacteria | 1708 |
| 319 | Ga0105245_10639080 | 3300009098 | Bacteria | 1094 |
| 320 | Ga0105247_10012713 | 3300009101 | Bacteria | 5052 |
| 321 | Ga0105243_10001038 | 3300009148 | Bacteria | 25466 |
| 322 | Ga0105243_10004148 | 3300009148 | Bacteria | 11507 |
| 323 | Ga0105243_10007628 | 3300009148 | Bacteria | 8316 |
| 324 | Ga0105243_10047155 | 3300009148 | Bacteria | 3391 |
| 325 | Ga0105242_10020867 | 3300009176 | Bacteria | 5139 |
| 326 | Ga0105242_10076846 | 3300009176 | Bacteria | 2785 |
| 327 | Ga0105248_10001546 | 3300009177 | Bacteria | 25613 |
| 328 | Ga0105248_10024066 | 3300009177 | Bacteria | 6768 |
| 329 | Ga0105248_10066735 | 3300009177 | Bacteria | 4039 |
| 330 | Ga0105237_10006409 | 3300009545 | Bacteria | 13059 |
| 331 | Ga0105237_10035501 | 3300009545 | Bacteria | 5045 |
| 332 | Ga0105238_10001243 | 3300009551 | Bacteria | 25672 |
| 333 | Ga0105238_10052924 | 3300009551 | Bacteria | 4081 |
| 334 | Ga0105238_10510656 | 3300009551 | Bacteria | 1204 |
| 335 | Ga0105249_10006350 | 3300009553 | Bacteria | 10275 |
| 336 | Ga0105239_10142391 | 3300010375 | Bacteria | 2673 |
| 337 | Ga0105246_10011961 | 3300011119 | Bacteria | 5402 |
| 338 | Ga0105246_10056982 | 3300011119 | Bacteria | 2703 |
| 339 | Ga0105246_10091230 | 3300011119 | Bacteria | 2195 |
| 340 | Ga0105246_10248460 | 3300011119 | Bacteria | 1410 |
| 341 | Ga0157339_1000950 | 3300012505 | Bacteria | 1636 |
| 342 | Ga0157373_10000439 | 3300013100 | Bacteria | 33045 |
| 343 | Ga0157373_10018978 | 3300013100 | Bacteria | 5005 |
| 344 | Ga0157371_10102595 | 3300013102 | Bacteria | 2029 |
| 345 | Ga0157370_10053337 | 3300013104 | Bacteria | 3856 |
| 346 | Ga0157369_10007249 | 3300013105 | Bacteria | 12763 |
| 347 | Ga0157369_10026826 | 3300013105 | Bacteria | 6387 |
| 348 | Ga0157374_10035714 | 3300013296 | Bacteria | 4548 |
| 349 | Ga0157374_10060197 | 3300013296 | Bacteria | 3553 |
| 350 | Ga0157374_10165877 | 3300013296 | Bacteria | 2152 |
| 351 | Ga0157374_10204518 | 3300013296 | Bacteria | 1934 |
| 352 | Ga0157378_10035469 | 3300013297 | Bacteria | 4412 |
| 353 | Ga0157378_10136919 | 3300013297 | Bacteria | 2271 |
| 354 | Ga0163162_10004873 | 3300013306 | Bacteria | 12950 |
| 355 | Ga0163162_10060281 | 3300013306 | Bacteria | 3830 |
| 356 | Ga0163162_10063167 | 3300013306 | Bacteria | 3744 |
| 357 | Ga0163162_10070135 | 3300013306 | Bacteria | 3556 |
| 358 | Ga0157372_10000313 | 3300013307 | Bacteria | 53548 |
| 359 | Ga0157372_10013839 | 3300013307 | Bacteria | 8615 |
| 360 | Ga0157372_10013841 | 3300013307 | Bacteria | 8615 |
| 361 | Ga0157372_10496813 | 3300013307 | Bacteria | 1423 |
| 362 | Ga0157375_10002130 | 3300013308 | Bacteria | 17095 |
| 363 | Ga0157375_10002932 | 3300013308 | Bacteria | 14804 |
| 364 | Ga0157375_10016898 | 3300013308 | Bacteria | 6572 |
| 365 | Ga0157375_10068128 | 3300013308 | Bacteria | 3559 |
| 366 | Ga0157375_10071599 | 3300013308 | Bacteria | 3481 |
| 367 | Ga0157375_10082218 | 3300013308 | Bacteria | 3262 |
| 368 | Ga0157375_10354687 | 3300013308 | Bacteria | 1633 |
| 369 | Ga0163163_10002386 | 3300014325 | Bacteria | 15903 |
| 370 | Ga0163163_10085003 | 3300014325 | Bacteria | 3172 |
| 371 | Ga0163163_10677048 | 3300014325 | Bacteria | 1095 |
| 372 | Ga0157380_10002054 | 3300014326 | Bacteria | 13470 |
| 373 | Ga0157380_10062669 | 3300014326 | Bacteria | 2980 |
| 374 | Ga0182008_10051560 | 3300014497 | Bacteria | 2040 |
| 375 | Ga0182008_10052135 | 3300014497 | Bacteria | 2029 |
| 376 | Ga0182008_10124202 | 3300014497 | Bacteria | 1284 |
| 377 | Ga0157377_10000083 | 3300014745 | Bacteria | 73632 |
| 378 | Ga0157377_10000246 | 3300014745 | Bacteria | 26794 |
| 379 | Ga0157379_10000443 | 3300014968 | Bacteria | 33618 |
| 380 | Ga0157379_10000977 | 3300014968 | Bacteria | 23193 |
| 381 | Ga0157379_10003793 | 3300014968 | Bacteria | 12872 |
| 382 | Ga0157379_10055099 | 3300014968 | Bacteria | 3553 |
| 383 | Ga0157379_10157266 | 3300014968 | Bacteria | 2051 |
| 384 | Ga0157379_10184432 | 3300014968 | Bacteria | 1885 |
| 385 | Ga0157376_10108867 | 3300014969 | Bacteria | 2435 |
| 386 | Ga0157376_10273812 | 3300014969 | Bacteria | 1587 |
| 387 | Ga0157376_10319378 | 3300014969 | Bacteria | 1476 |
| 388 | Ga0182006_1010807 | 3300015261 | Bacteria | 4044 |
| 389 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 390 | Ga0163161_10027428 | 3300017792 | Bacteria | 4040 |
| 391 | Ga0163161_10035454 | 3300017792 | Bacteria | 3571 |
| 392 | Ga0209436_105818 | 3300025208 | Bacteria | 2778 |
| 393 | Ga0209672_101676 | 3300025228 | Bacteria | 7181 |
| 394 | Ga0209147_100323 | 3300025229 | Bacteria | 36564 |
| 395 | Ga0209258_100078 | 3300025242 | Bacteria | 263996 |
| 396 | Ga0207425_1000087 | 3300025245 | Bacteria | 93219 |
| 397 | Ga0207425_1000254 | 3300025245 | Bacteria | 40131 |
| 398 | Ga0207425_1002288 | 3300025245 | Bacteria | 6888 |
| 399 | Ga0209148_1000086 | 3300025254 | Bacteria | 263996 |
| 400 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 401 | Ga0209129_1000035 | 3300025258 | Bacteria | 329303 |
| 402 | Ga0209129_1001670 | 3300025258 | Bacteria | 12015 |
| 403 | Ga0209565_1000038 | 3300025263 | Bacteria | 286433 |
| 404 | Ga0209565_1000138 | 3300025263 | Bacteria | 101729 |
| 405 | Ga0209673_1000064 | 3300025273 | Bacteria | 254712 |
| 406 | Ga0209673_1000080 | 3300025273 | Bacteria | 223503 |
| 407 | Ga0209673_1000814 | 3300025273 | Bacteria | 41220 |
| 408 | Ga0209673_1003257 | 3300025273 | Bacteria | 9794 |
| 409 | Ga0209130_1000137 | 3300025284 | Bacteria | 116784 |
| 410 | Ga0209130_1000468 | 3300025284 | Bacteria | 41796 |
| 411 | Ga0209675_1000036 | 3300025291 | Bacteria | 254712 |
| 412 | Ga0209675_1000102 | 3300025291 | Bacteria | 123742 |
| 413 | Ga0209675_1007050 | 3300025291 | Bacteria | 4382 |
| 414 | Ga0209676_1000125 | 3300025292 | Bacteria | 191565 |
| 415 | Ga0209676_1004374 | 3300025292 | Bacteria | 7904 |
| 416 | Ga0209676_1013635 | 3300025292 | Bacteria | 3112 |
| 417 | Ga0209676_1048528 | 3300025292 | Bacteria | 1133 |
| 418 | Ga0209025_1000056 | 3300025294 | Bacteria | 316188 |
| 419 | Ga0209025_1000938 | 3300025294 | Bacteria | 44376 |
| 420 | Ga0209025_1016025 | 3300025294 | Bacteria | 4461 |
| 421 | Ga0209564_1000024 | 3300025295 | Bacteria | 535041 |
| 422 | Ga0209564_1000073 | 3300025295 | Bacteria | 288080 |
| 423 | Ga0209564_1000833 | 3300025295 | Bacteria | 41796 |
| 424 | Ga0209758_1000044 | 3300025297 | Bacteria | 398448 |
| 425 | Ga0209758_1000066 | 3300025297 | Bacteria | 298620 |
| 426 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 427 | Ga0209256_1000020 | 3300025299 | Bacteria | 542402 |
| 428 | Ga0209256_1000764 | 3300025299 | Bacteria | 41796 |
| 429 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 430 | Ga0207426_1000667 | 3300025302 | Bacteria | 41796 |
| 431 | Ga0209051_1000113 | 3300025303 | Bacteria | 152417 |
| 432 | Ga0209051_1000332 | 3300025303 | Bacteria | 71041 |
| 433 | Ga0209051_1000367 | 3300025303 | Bacteria | 65677 |
| 434 | Ga0209051_1002717 | 3300025303 | Bacteria | 12300 |
| 435 | Ga0209051_1009665 | 3300025303 | Bacteria | 4949 |
| 436 | Ga0209051_1032044 | 3300025303 | Bacteria | 2011 |
| 437 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 438 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 439 | Ga0209257_1000222 | 3300025304 | Bacteria | 134717 |
| 440 | Ga0209257_1036695 | 3300025304 | Bacteria | 1503 |
| 441 | Ga0207697_10059264 | 3300025315 | Bacteria | 1591 |
| 442 | Ga0207656_10023745 | 3300025321 | Bacteria | 2472 |
| 443 | Ga0207696_1000470 | 3300025711 | Bacteria | 34731 |
| 444 | Ga0207653_10000897 | 3300025885 | Bacteria | 9881 |
| 445 | Ga0207682_10000418 | 3300025893 | Bacteria | 19541 |
| 446 | Ga0207682_10001443 | 3300025893 | Bacteria | 10971 |
| 447 | Ga0207682_10003883 | 3300025893 | Bacteria | 6388 |
| 448 | Ga0207682_10047377 | 3300025893 | Bacteria | 1770 |
| 449 | Ga0207682_10070862 | 3300025893 | Bacteria | 1477 |
| 450 | Ga0207692_10072501 | 3300025898 | Bacteria | 1819 |
| 451 | Ga0207642_10024852 | 3300025899 | Bacteria | 2414 |
| 452 | Ga0207688_10017055 | 3300025901 | Bacteria | 3946 |
| 453 | Ga0207688_10039840 | 3300025901 | Bacteria | 2610 |
| 454 | Ga0207688_10127630 | 3300025901 | Bacteria | 1489 |
| 455 | Ga0207680_10020860 | 3300025903 | Bacteria | 3537 |
| 456 | Ga0207680_10063998 | 3300025903 | Bacteria | 2253 |
| 457 | Ga0207680_10066044 | 3300025903 | Bacteria | 2223 |
| 458 | Ga0207680_10077324 | 3300025903 | Bacteria | 2081 |
| 459 | Ga0207680_10110635 | 3300025903 | Bacteria | 1781 |
| 460 | Ga0207645_10000113 | 3300025907 | Bacteria | 60937 |
| 461 | Ga0207645_10000301 | 3300025907 | Bacteria | 41468 |
| 462 | Ga0207645_10001729 | 3300025907 | Bacteria | 17698 |
| 463 | Ga0207645_10004200 | 3300025907 | Bacteria | 10699 |
| 464 | Ga0207645_10026198 | 3300025907 | Bacteria | 3769 |
| 465 | Ga0207645_10263222 | 3300025907 | Bacteria | 1143 |
| 466 | Ga0207643_10000164 | 3300025908 | Bacteria | 45857 |
| 467 | Ga0207643_10002187 | 3300025908 | Bacteria | 10667 |
| 468 | Ga0207643_10167634 | 3300025908 | Bacteria | 1324 |
| 469 | Ga0207705_10060723 | 3300025909 | Bacteria | 2731 |
| 470 | Ga0207707_10000305 | 3300025912 | Bacteria | 51662 |
| 471 | Ga0207707_10225792 | 3300025912 | Bacteria | 1630 |
| 472 | Ga0207695_10029741 | 3300025913 | Bacteria | 6028 |
| 473 | Ga0207671_10024778 | 3300025914 | Bacteria | 4508 |
| 474 | Ga0207660_10000085 | 3300025917 | Bacteria | 49898 |
| 475 | Ga0207660_10017667 | 3300025917 | Bacteria | 4743 |
| 476 | Ga0207662_10007091 | 3300025918 | Bacteria | 6086 |
| 477 | Ga0207662_10023326 | 3300025918 | Bacteria | 3555 |
| 478 | Ga0207662_10075942 | 3300025918 | Bacteria | 2042 |
| 479 | Ga0207657_10000236 | 3300025919 | Bacteria | 58234 |
| 480 | Ga0207657_10008943 | 3300025919 | Bacteria | 10121 |
| 481 | Ga0207657_10039155 | 3300025919 | Bacteria | 4214 |
| 482 | Ga0207657_10050479 | 3300025919 | Bacteria | 3621 |
| 483 | Ga0207657_10151052 | 3300025919 | Bacteria | 1892 |
| 484 | Ga0207649_10007149 | 3300025920 | Bacteria | 6067 |
| 485 | Ga0207649_10008827 | 3300025920 | Bacteria | 5503 |
| 486 | Ga0207652_10000572 | 3300025921 | Bacteria | 37038 |
| 487 | Ga0207652_10063689 | 3300025921 | Bacteria | 3189 |
| 488 | Ga0207652_10271781 | 3300025921 | Bacteria | 1529 |
| 489 | Ga0207681_10000162 | 3300025923 | Bacteria | 55291 |
| 490 | Ga0207681_10360780 | 3300025923 | Bacteria | 1165 |
| 491 | Ga0207694_10051255 | 3300025924 | Bacteria | 3199 |
| 492 | Ga0207694_10055328 | 3300025924 | Bacteria | 3080 |
| 493 | Ga0207694_10126313 | 3300025924 | Bacteria | 2046 |
| 494 | Ga0207694_10400970 | 3300025924 | Bacteria | 1140 |
| 495 | Ga0207650_10004962 | 3300025925 | Bacteria | 9095 |
| 496 | Ga0207650_10005657 | 3300025925 | Bacteria | 8537 |
| 497 | Ga0207650_10012639 | 3300025925 | Bacteria | 5826 |
| 498 | Ga0207650_10094336 | 3300025925 | Bacteria | 2292 |
| 499 | Ga0207650_10123616 | 3300025925 | Bacteria | 2017 |
| 500 | Ga0207650_10169565 | 3300025925 | Bacteria | 1734 |
| 501 | Ga0207659_10005626 | 3300025926 | Bacteria | 7618 |
| 502 | Ga0207659_10012076 | 3300025926 | Bacteria | 5476 |
| 503 | Ga0207659_10014964 | 3300025926 | Bacteria | 5016 |
| 504 | Ga0207659_10024575 | 3300025926 | Bacteria | 4039 |
| 505 | Ga0207659_10074219 | 3300025926 | Bacteria | 2493 |
| 506 | Ga0207659_10396910 | 3300025926 | Bacteria | 1153 |
| 507 | Ga0207687_10032857 | 3300025927 | Bacteria | 3517 |
| 508 | Ga0207687_10061124 | 3300025927 | Bacteria | 2660 |
| 509 | Ga0207687_10071446 | 3300025927 | Bacteria | 2480 |
| 510 | Ga0207664_10000197 | 3300025929 | Bacteria | 45209 |
| 511 | Ga0207644_10000803 | 3300025931 | Bacteria | 19918 |
| 512 | Ga0207644_10008709 | 3300025931 | Bacteria | 6642 |
| 513 | Ga0207644_10097091 | 3300025931 | Bacteria | 2207 |
| 514 | Ga0207644_10132150 | 3300025931 | Bacteria | 1912 |
| 515 | Ga0207690_10006655 | 3300025932 | Bacteria | 6847 |
| 516 | Ga0207690_10009936 | 3300025932 | Bacteria | 5653 |
| 517 | Ga0207690_10059497 | 3300025932 | Bacteria | 2589 |
| 518 | Ga0207706_10002100 | 3300025933 | Bacteria | 19502 |
| 519 | Ga0207706_10010173 | 3300025933 | Bacteria | 8610 |
| 520 | Ga0207706_10014083 | 3300025933 | Bacteria | 7251 |
| 521 | Ga0207706_10027626 | 3300025933 | Bacteria | 5073 |
| 522 | Ga0207706_10044187 | 3300025933 | Bacteria | 3950 |
| 523 | Ga0207706_10048887 | 3300025933 | Bacteria | 3740 |
| 524 | Ga0207706_10071755 | 3300025933 | Bacteria | 3046 |
| 525 | Ga0207686_10008635 | 3300025934 | Bacteria | 5502 |
| 526 | Ga0207686_10048026 | 3300025934 | Bacteria | 2642 |
| 527 | Ga0207709_10002423 | 3300025935 | Bacteria | 11738 |
| 528 | Ga0207709_10009952 | 3300025935 | Bacteria | 5237 |
| 529 | Ga0207709_10023354 | 3300025935 | Bacteria | 3519 |
| 530 | Ga0207670_10069272 | 3300025936 | Bacteria | 2433 |
| 531 | Ga0207670_10096525 | 3300025936 | Bacteria | 2102 |
| 532 | Ga0207669_10001640 | 3300025937 | Bacteria | 9507 |
| 533 | Ga0207704_10001096 | 3300025938 | Bacteria | 12024 |
| 534 | Ga0207704_10134190 | 3300025938 | Bacteria | 1720 |
| 535 | Ga0207691_10000029 | 3300025940 | Bacteria | 120814 |
| 536 | Ga0207691_10009666 | 3300025940 | Bacteria | 9251 |
| 537 | Ga0207691_10012987 | 3300025940 | Bacteria | 7975 |
| 538 | Ga0207691_10030305 | 3300025940 | Bacteria | 5056 |
| 539 | Ga0207691_10037465 | 3300025940 | Bacteria | 4491 |
| 540 | Ga0207691_10047077 | 3300025940 | Bacteria | 3960 |
| 541 | Ga0207691_10050458 | 3300025940 | Bacteria | 3809 |
| 542 | Ga0207691_10062505 | 3300025940 | Bacteria | 3378 |
| 543 | Ga0207691_10197629 | 3300025940 | Bacteria | 1751 |
| 544 | Ga0207711_10003120 | 3300025941 | Bacteria | 14443 |
| 545 | Ga0207711_10177630 | 3300025941 | Bacteria | 1935 |
| 546 | Ga0207689_10000870 | 3300025942 | Bacteria | 29137 |
| 547 | Ga0207689_10002362 | 3300025942 | Bacteria | 17615 |
| 548 | Ga0207689_10002739 | 3300025942 | Bacteria | 16300 |
| 549 | Ga0207689_10007372 | 3300025942 | Bacteria | 9647 |
| 550 | Ga0207689_10008166 | 3300025942 | Bacteria | 9125 |
| 551 | Ga0207661_10145561 | 3300025944 | Bacteria | 2044 |
| 552 | Ga0207679_10000918 | 3300025945 | Bacteria | 18832 |
| 553 | Ga0207679_10008717 | 3300025945 | Bacteria | 6469 |
| 554 | Ga0207679_10071289 | 3300025945 | Bacteria | 2621 |
| 555 | Ga0207679_10127032 | 3300025945 | Bacteria | 2039 |
| 556 | Ga0207679_10324393 | 3300025945 | Bacteria | 1334 |
| 557 | Ga0207679_10328535 | 3300025945 | Bacteria | 1326 |
| 558 | Ga0207667_10000036 | 3300025949 | Bacteria | 297966 |
| 559 | Ga0207667_10001952 | 3300025949 | Bacteria | 25839 |
| 560 | Ga0207667_10029665 | 3300025949 | Bacteria | 5929 |
| 561 | Ga0207667_10047017 | 3300025949 | Bacteria | 4569 |
| 562 | Ga0207667_10145685 | 3300025949 | Bacteria | 2438 |
| 563 | Ga0207667_10154499 | 3300025949 | Bacteria | 2361 |
| 564 | Ga0207667_10285819 | 3300025949 | Bacteria | 1685 |
| 565 | Ga0207651_10027488 | 3300025960 | Bacteria | 3573 |
| 566 | Ga0207651_10037969 | 3300025960 | Bacteria | 3160 |
| 567 | Ga0207651_10050856 | 3300025960 | Bacteria | 2817 |
| 568 | Ga0207651_10071064 | 3300025960 | Bacteria | 2465 |
| 569 | Ga0207651_10082929 | 3300025960 | Bacteria | 2316 |
| 570 | Ga0207651_10243076 | 3300025960 | Bacteria | 1468 |
| 571 | Ga0207712_10381751 | 3300025961 | Bacteria | 1179 |
| 572 | Ga0207668_10002399 | 3300025972 | Bacteria | 10961 |
| 573 | Ga0207668_10028441 | 3300025972 | Bacteria | 3655 |
| 574 | Ga0207668_10092930 | 3300025972 | Bacteria | 2221 |
| 575 | Ga0207640_10019862 | 3300025981 | Bacteria | 3977 |
| 576 | Ga0207640_10077683 | 3300025981 | Bacteria | 2257 |
| 577 | Ga0207658_10000181 | 3300025986 | Bacteria | 67700 |
| 578 | Ga0207658_10002598 | 3300025986 | Bacteria | 13108 |
| 579 | Ga0207658_10004916 | 3300025986 | Bacteria | 9219 |
| 580 | Ga0207658_10040972 | 3300025986 | Bacteria | 3351 |
| 581 | Ga0207658_10203124 | 3300025986 | Bacteria | 1656 |
| 582 | Ga0207677_10035435 | 3300026023 | Bacteria | 3241 |
| 583 | Ga0207677_10044097 | 3300026023 | Bacteria | 2969 |
| 584 | Ga0207677_10315386 | 3300026023 | Bacteria | 1297 |
| 585 | Ga0207677_10328371 | 3300026023 | Bacteria | 1274 |
| 586 | Ga0207703_10000292 | 3300026035 | Bacteria | 54983 |
| 587 | Ga0207703_10016526 | 3300026035 | Bacteria | 5754 |
| 588 | Ga0207703_10095969 | 3300026035 | Bacteria | 2502 |
| 589 | Ga0207703_10328310 | 3300026035 | Bacteria | 1403 |
| 590 | Ga0207639_10002377 | 3300026041 | Bacteria | 12641 |
| 591 | Ga0207639_10005201 | 3300026041 | Bacteria | 8778 |
| 592 | Ga0207639_10080988 | 3300026041 | Bacteria | 2570 |
| 593 | Ga0207639_10110400 | 3300026041 | Bacteria | 2240 |
| 594 | Ga0207678_10002867 | 3300026067 | Bacteria | 15651 |
| 595 | Ga0207678_10007096 | 3300026067 | Bacteria | 9937 |
| 596 | Ga0207678_10009966 | 3300026067 | Bacteria | 8337 |
| 597 | Ga0207678_10256216 | 3300026067 | Bacteria | 1499 |
| 598 | Ga0207678_10265773 | 3300026067 | Bacteria | 1471 |
| 599 | Ga0207708_10153450 | 3300026075 | Bacteria | 1815 |
| 600 | Ga0207708_10254791 | 3300026075 | Bacteria | 1415 |
| 601 | Ga0207708_10417434 | 3300026075 | Bacteria | 1112 |
| 602 | Ga0207702_10000725 | 3300026078 | Bacteria | 35324 |
| 603 | Ga0207702_10012210 | 3300026078 | Bacteria | 7148 |
| 604 | Ga0207702_10026211 | 3300026078 | Bacteria | 4839 |
| 605 | Ga0207702_10041205 | 3300026078 | Bacteria | 3872 |
| 606 | Ga0207702_10444242 | 3300026078 | Bacteria | 1257 |
| 607 | Ga0207641_10001206 | 3300026088 | Bacteria | 25861 |
| 608 | Ga0207641_10006113 | 3300026088 | Bacteria | 10190 |
| 609 | Ga0207641_10009643 | 3300026088 | Bacteria | 7956 |
| 610 | Ga0207641_10251851 | 3300026088 | Bacteria | 1650 |
| 611 | Ga0207648_10000091 | 3300026089 | Bacteria | 85128 |
| 612 | Ga0207648_10000753 | 3300026089 | Bacteria | 36419 |
| 613 | Ga0207648_10003584 | 3300026089 | Bacteria | 16250 |
| 614 | Ga0207648_10007124 | 3300026089 | Bacteria | 11031 |
| 615 | Ga0207648_10007170 | 3300026089 | Bacteria | 10990 |
| 616 | Ga0207648_10012095 | 3300026089 | Bacteria | 8093 |
| 617 | Ga0207648_10054111 | 3300026089 | Bacteria | 3507 |
| 618 | Ga0207648_10086547 | 3300026089 | Bacteria | 2734 |
| 619 | Ga0207648_10091747 | 3300026089 | Bacteria | 2655 |
| 620 | Ga0207676_10001693 | 3300026095 | Bacteria | 16260 |
| 621 | Ga0207676_10007242 | 3300026095 | Bacteria | 7855 |
| 622 | Ga0207676_10107345 | 3300026095 | Bacteria | 2328 |
| 623 | Ga0207676_10213022 | 3300026095 | Bacteria | 1715 |
| 624 | Ga0207676_10217181 | 3300026095 | Bacteria | 1700 |
| 625 | Ga0207676_10218481 | 3300026095 | Bacteria | 1696 |
| 626 | Ga0207676_10231970 | 3300026095 | Bacteria | 1650 |
| 627 | Ga0207674_10000170 | 3300026116 | Bacteria | 78770 |
| 628 | Ga0207674_10003102 | 3300026116 | Bacteria | 20519 |
| 629 | Ga0207674_10007473 | 3300026116 | Bacteria | 12735 |
| 630 | Ga0207674_10039028 | 3300026116 | Bacteria | 4925 |
| 631 | Ga0207675_100000273 | 3300026118 | Bacteria | 49026 |
| 632 | Ga0207675_100001077 | 3300026118 | Bacteria | 27123 |
| 633 | Ga0207675_100009324 | 3300026118 | Bacteria | 9201 |
| 634 | Ga0207675_100012300 | 3300026118 | Bacteria | 7995 |
| 635 | Ga0207675_100015774 | 3300026118 | Bacteria | 7045 |
| 636 | Ga0207675_100100562 | 3300026118 | Bacteria | 2724 |
| 637 | Ga0207675_100157741 | 3300026118 | Bacteria | 2163 |
| 638 | Ga0207683_10000305 | 3300026121 | Bacteria | 44345 |
| 639 | Ga0207683_10031632 | 3300026121 | Bacteria | 4592 |
| 640 | Ga0207683_10063103 | 3300026121 | Bacteria | 3264 |
| 641 | Ga0207683_10134011 | 3300026121 | Bacteria | 2229 |
| 642 | Ga0207698_10000543 | 3300026142 | Bacteria | 21895 |
| 643 | Ga0207698_10003201 | 3300026142 | Bacteria | 9827 |
| 644 | Ga0207698_10007407 | 3300026142 | Bacteria | 6875 |
| 645 | Ga0207698_10012920 | 3300026142 | Bacteria | 5488 |
| 646 | Ga0207698_10125034 | 3300026142 | Bacteria | 2185 |
| 647 | Ga0207698_10138375 | 3300026142 | Bacteria | 2093 |
| 648 | Ga0207698_10486136 | 3300026142 | Bacteria | 1198 |
| 649 | Ga0209281_1011560 | 3300027111 | Bacteria | 1973 |
| 650 | Ga0209282_1000521 | 3300027666 | Bacteria | 18596 |
| 651 | Ga0209813_10049692 | 3300027866 | Bacteria | 1306 |
| 652 | Ga0207428_10011958 | 3300027907 | Bacteria | 7639 |
| 653 | Ga0268266_10029837 | 3300028379 | Bacteria | 4634 |
| 654 | Ga0268265_10125350 | 3300028380 | Bacteria | 2124 |
| 655 | Ga0268265_10464344 | 3300028380 | Bacteria | 1185 |
| 656 | Ga0268264_10000862 | 3300028381 | Bacteria | 32146 |
| 657 | Ga0268264_10002185 | 3300028381 | Bacteria | 17390 |
| 658 | Ga0268264_10020212 | 3300028381 | Bacteria | 5442 |
| 659 | Ga0268264_10311160 | 3300028381 | Bacteria | 1486 |
| 660 | Ga0268264_10404144 | 3300028381 | Bacteria | 1313 |
| 661 | Ga0307515_10004838 | 3300028794 | Bacteria | 27552 |
| 662 | Ga0307515_10066724 | 3300028794 | Bacteria | 4978 |
| 663 | Ga0307515_10082486 | 3300028794 | Bacteria | 4157 |
| 664 | Ga0307515_10197516 | 3300028794 | Bacteria | 1899 |
| 665 | Ga0316177_1089736 | 3300030731 | Bacteria | 1573 |
| 666 | Ga0314311_1055507 | 3300030733 | Bacteria | 11059 |
| 667 | Ga0316178_1036717 | 3300030735 | Bacteria | 5475 |
| 668 | Ga0316180_1039863 | 3300030736 | Bacteria | 1650 |
| 669 | Ga0316181_1234386 | 3300030744 | Bacteria | 2073 |
| 670 | Ga0307513_10043216 | 3300031456 | Bacteria | 4953 |
| 671 | Ga0307513_10118073 | 3300031456 | Bacteria | 2628 |
| 672 | Ga0307513_10281371 | 3300031456 | Bacteria | 1440 |
| 673 | Ga0307509_10008945 | 3300031507 | Bacteria | 12627 |
| 674 | Ga0307408_100000026 | 3300031548 | Bacteria | 261688 |
| 675 | Ga0307408_100098348 | 3300031548 | Bacteria | 2224 |
| 676 | Ga0307508_10000222 | 3300031616 | Bacteria | 69029 |
| 677 | Ga0307514_10108540 | 3300031649 | Bacteria | 1973 |
| 678 | Ga0307516_10001053 | 3300031730 | Bacteria | 38382 |
| 679 | Ga0307516_10042854 | 3300031730 | Bacteria | 4487 |
| 680 | Ga0307516_10061501 | 3300031730 | Bacteria | 3643 |
| 681 | Ga0307516_10177457 | 3300031730 | Bacteria | 1866 |
| 682 | Ga0307405_10007710 | 3300031731 | Bacteria | 5409 |
| 683 | Ga0307405_10115181 | 3300031731 | Bacteria | 1828 |
| 684 | Ga0307413_10173723 | 3300031824 | Eukaryota | 1528 |
| 685 | Ga0307406_10002407 | 3300031901 | Bacteria | 10164 |
| 686 | Ga0307406_10291886 | 3300031901 | Bacteria | 1249 |
| 687 | Ga0307412_10000334 | 3300031911 | Bacteria | 29763 |
| 688 | Ga0307412_10103102 | 3300031911 | Bacteria | 2021 |
| 689 | Ga0307412_10123087 | 3300031911 | Bacteria | 1871 |
| 690 | Ga0307412_10215557 | 3300031911 | Bacteria | 1468 |
| 691 | Ga0307412_10262098 | 3300031911 | Bacteria | 1348 |
| 692 | Ga0307409_100011603 | 3300031995 | Bacteria | 5567 |
| 693 | Ga0307416_100001205 | 3300032002 | Bacteria | 13922 |
| 694 | Ga0307416_100106492 | 3300032002 | Bacteria | 2458 |
| 695 | Ga0307416_100151369 | 3300032002 | Bacteria | 2128 |
| 696 | Ga0307416_100156290 | 3300032002 | Bacteria | 2100 |
| 697 | Ga0307416_100393049 | 3300032002 | Bacteria | 1421 |
| 698 | Ga0307414_10036574 | 3300032004 | Bacteria | 3279 |
| 699 | Ga0307414_10053714 | 3300032004 | Bacteria | 2811 |
| 700 | Ga0307414_10370429 | 3300032004 | Bacteria | 1235 |
| 701 | Ga0307411_10035182 | 3300032005 | Bacteria | 3124 |
| 702 | Ga0307411_10241423 | 3300032005 | Bacteria | 1414 |
| 703 | Ga0307415_100018199 | 3300032126 | Bacteria | 4236 |
| 704 | Ga0307507_10143225 | 3300033179 | Bacteria | 1825 |
| 705 | Ga0307510_10216326 | 3300033180 | Bacteria | 1432 |
| 706 | Ga0373949_0017114 | 3300035090 | Bacteria | 1631 |
| 707 | Ga0373951_0007193 | 3300035091 | Bacteria | 2532 |
| 708 | Ga0373945_0085402 | 3300035116 | Bacteria | 1215 |
| 709 | Ga0373945_0087234 | 3300035116 | Bacteria | 1204 |
| 710 | Ga0373961_0012075 | 3300035241 | Bacteria | 2155 |
| 711 | Ga0373935_0011023 | 3300035692 | Bacteria | 5431 |
| 712 | Ga0373947_0102441 | 3300035725 | Bacteria | 1800 |
| 713 | Ga0373937_0019429 | 3300036401 | Bacteria | 6082 |
| 714 | Ga0395900_0000054 | 3300037418 | Bacteria | 220487 |
| 715 | Ga0395900_0001265 | 3300037418 | Bacteria | 30893 |
| 716 | Ga0395898_0000485 | 3300037466 | Bacteria | 78871 |
| 717 | Ga0395898_0061467 | 3300037466 | Bacteria | 3649 |
| 718 | Ga0395905_0003176 | 3300037471 | Bacteria | 17695 |
| 719 | Ga0395905_0009794 | 3300037471 | Bacteria | 9341 |
| 720 | Ga0395905_0010349 | 3300037471 | Bacteria | 9079 |
| 721 | Ga0395905_0028723 | 3300037471 | Bacteria | 5241 |
| 722 | Ga0395905_0103047 | 3300037471 | Bacteria | 2679 |
| 723 | Ga0395901_0348188 | 3300038443 | Bacteria | 1529 |
| 724 | Ga0436365_1917885 | 3300039437 | Bacteria | 1758 |
| 725 | Ga0439436_0000003 | 3300041404 | Bacteria | 186684 |
| 726 | Ga0439436_0001289 | 3300041404 | Bacteria | 7164 |
| 727 | Ga0439436_0007927 | 3300041404 | Bacteria | 3262 |
| 728 | Ga0439439_0002493 | 3300041406 | Bacteria | 3922 |
| 729 | Ga0439466_0018193 | 3300041411 | Bacteria | 2523 |
| 730 | Ga0439466_0028682 | 3300041411 | Bacteria | 1919 |
| 731 | Ga0439466_0060726 | 3300041411 | Bacteria | 1218 |
| 732 | Ga0439465_0001535 | 3300041413 | Bacteria | 7508 |
| 733 | Ga0439465_0028288 | 3300041413 | Bacteria | 1777 |
| 734 | Ga0451793_0233126 | 3300041452 | Bacteria | 1486 |
| 735 | Ga0451797_0100768 | 3300041453 | Bacteria | 1637 |
| 736 | Ga0451839_0071674 | 3300041496 | Unclassified | 1293 |
| 737 | Ga0451839_0654308 | 3300041496 | Bacteria | 1103 |
| 738 | Ga0439431_0000205 | 3300041997 | Bacteria | 11661 |
| 739 | Ga0439433_0002049 | 3300041999 | Bacteria | 4241 |
| 740 | Ga0439433_0016990 | 3300041999 | Bacteria | 1613 |
| 741 | Ga0439442_007132 | 3300042002 | Bacteria | 2246 |
| 742 | Ga0439442_008923 | 3300042002 | Bacteria | 2026 |
| 743 | Ga0439445_0001824 | 3300042004 | Bacteria | 4697 |
| 744 | Ga0439432_001895 | 3300042006 | Bacteria | 7886 |
| 745 | Ga0439432_027931 | 3300042006 | Bacteria | 1839 |
| 746 | Ga0439449_0001384 | 3300042007 | Bacteria | 9489 |
| 747 | Ga0439449_0003417 | 3300042007 | Bacteria | 6179 |
| 748 | Ga0439449_0018173 | 3300042007 | Bacteria | 2638 |
| 749 | Ga0439457_044293 | 3300042014 | Bacteria | 993 |
| 750 | Ga0439462_0018997 | 3300042015 | Bacteria | 1787 |
| 751 | Ga0450919_007325 | 3300042121 | Bacteria | 1291 |
| 752 | Ga0450923_001505 | 3300042125 | Bacteria | 3113 |
| 753 | Ga0450923_010263 | 3300042125 | Bacteria | 1658 |
| 754 | Ga0450894_009092 | 3300042131 | Bacteria | 1286 |
| 755 | Ga0450898_006256 | 3300042134 | Bacteria | 1822 |
| 756 | Ga0450898_014796 | 3300042134 | Bacteria | 1316 |
| 757 | Ga0450906_001314 | 3300042145 | Bacteria | 5446 |
| 758 | Ga0439446_0002478 | 3300042156 | Bacteria | 4438 |
| 759 | Ga0439446_0013170 | 3300042156 | Bacteria | 2268 |
| 760 | Ga0450908_009442 | 3300042184 | Bacteria | 1811 |
| 761 | Ga0450909_011553 | 3300042185 | Bacteria | 1294 |
| 762 | Ga0439434_0041319 | 3300042435 | Bacteria | 1417 |
| 763 | Ga0439459_0001488 | 3300042438 | Bacteria | 3463 |
| 764 | Ga0439459_0040870 | 3300042438 | Bacteria | 985 |
| 765 | Ga0451577_0043545 | 3300042876 | Bacteria | 4021 |
| 766 | Ga0451577_0053149 | 3300042876 | Bacteria | 3617 |
| 767 | Ga0466969_0000002 | 3300044656 | Bacteria | 178693 |
| 768 | Ga0466969_0017798 | 3300044656 | Bacteria | 3707 |
| 769 | Ga0466972_0004058 | 3300044658 | Bacteria | 7304 |
| 770 | Ga0466965_0010749 | 3300044683 | Bacteria | 4280 |
| 771 | Ga0466965_0085445 | 3300044683 | Bacteria | 1599 |
| 772 | Ga0466966_0006654 | 3300044684 | Bacteria | 7656 |
| 773 | Ga0466961_0008842 | 3300044693 | Bacteria | 6424 |
| 774 | Ga0466961_0030141 | 3300044693 | Bacteria | 3486 |
| 775 | Ga0466964_0002963 | 3300044706 | Bacteria | 6138 |
| 776 | Ga0466971_0078343 | 3300044719 | Bacteria | 1505 |
| 777 | Ga0466959_0016205 | 3300045049 | Bacteria | 5441 |
| 778 | Ga0451576_0197347 | 3300045051 | Bacteria | 2102 |
| 779 | Ga0451576_0578170 | 3300045051 | Bacteria | 1180 |
| 780 | Ga0466967_0019917 | 3300045976 | Bacteria | 5409 |
| 781 | Ga0495638_0064125 | 3300046460 | Bacteria | 2264 |
| 782 | Ga0495638_0140729 | 3300046460 | Bacteria | 1409 |
| 783 | Ga0495610_0000450 | 3300046512 | Bacteria | 42530 |
| 784 | Ga0495610_0076078 | 3300046512 | Bacteria | 1553 |
| 785 | Ga0495663_0003155 | 3300046525 | Bacteria | 4807 |
| 786 | Ga0495586_0089625 | 3300046535 | Bacteria | 1698 |
| 787 | Ga0495621_0022473 | 3300046539 | Bacteria | 2091 |
| 788 | Ga0495645_0009403 | 3300046543 | Bacteria | 6833 |
| 789 | Ga0495656_0006031 | 3300046615 | Bacteria | 4222 |
| 790 | Ga0495625_0000057 | 3300046660 | Bacteria | 181623 |
| 791 | Ga0495625_0006349 | 3300046660 | Bacteria | 10559 |
| 792 | Ga0495635_0137180 | 3300046663 | Bacteria | 1667 |
| 793 | Ga0495658_0008234 | 3300046683 | Bacteria | 5165 |
| 794 | Ga0495670_0283717 | 3300046691 | Bacteria | 886 |
| 795 | Ga0495685_023041 | 3300047447 | Bacteria | 2143 |
| 796 | Ga0496102_0000192 | 3300048905 | Bacteria | 83166 |
| 797 | Ga0496102_0054088 | 3300048905 | Bacteria | 3660 |
| 798 | Ga0496102_0138386 | 3300048905 | Bacteria | 2282 |
| 799 | Ga0496102_0169842 | 3300048905 | Bacteria | 2053 |
| 800 | Ga0496102_0552900 | 3300048905 | Bacteria | 1074 |
| 801 | Ga0496103_0001678 | 3300048906 | Bacteria | 14484 |
| 802 | Ga0496103_0103586 | 3300048906 | Bacteria | 1803 |
| 803 | Ga0496104_0052530 | 3300048907 | Bacteria | 3850 |
| 804 | Ga0496106_0047730 | 3300048909 | Bacteria | 3223 |
| 805 | Ga0496106_0126254 | 3300048909 | Bacteria | 2003 |
| 806 | Ga0496107_0039482 | 3300048910 | Bacteria | 3386 |
| 807 | Ga0496108_0038014 | 3300048911 | Bacteria | 4010 |
| 808 | Ga0496108_0094392 | 3300048911 | Bacteria | 2546 |
| 809 | Ga0496109_0089462 | 3300048912 | Bacteria | 2846 |
| 810 | Ga0496111_0049406 | 3300048914 | Bacteria | 3033 |
| 811 | Ga0496112_0127400 | 3300048915 | Bacteria | 2516 |
| 812 | Ga0496113_0119634 | 3300048916 | Bacteria | 2058 |
| 813 | Ga0496114_0050992 | 3300048917 | Bacteria | 3445 |
| 814 | Ga0496119_0020446 | 3300048922 | Bacteria | 4832 |
| 815 | Ga0496121_0000762 | 3300048924 | Bacteria | 59172 |
| 816 | Ga0496121_0063636 | 3300048924 | Bacteria | 3012 |
| 817 | Ga0496121_0171027 | 3300048924 | Bacteria | 1578 |
| 818 | Ga0496124_0000086 | 3300048927 | Bacteria | 202844 |
| 819 | Ga0496124_0027862 | 3300048927 | Bacteria | 5060 |
| 820 | Ga0496125_0019805 | 3300048928 | Bacteria | 6331 |
| 821 | Ga0496125_0029046 | 3300048928 | Bacteria | 4978 |
| 822 | Ga0501033_0061157 | 3300049570 | Bacteria | 2776 |
| 823 | Ga0501034_0042352 | 3300049571 | Bacteria | 4609 |
| 824 | Ga0501043_0110669 | 3300049579 | Bacteria | 2156 |
| 825 | Ga0501046_0000007 | 3300049580 | Bacteria | 356002 |
| 826 | Ga0501046_0001185 | 3300049580 | Bacteria | 25348 |
| 827 | Ga0501047_0001232 | 3300049581 | Bacteria | 25329 |
| 828 | Ga0501047_0173424 | 3300049581 | Bacteria | 2025 |
| 829 | Ga0501048_0002373 | 3300049582 | Bacteria | 14383 |
| 830 | Ga0501048_0006947 | 3300049582 | Bacteria | 8599 |
| 831 | Ga0501198_000015 | 3300049649 | Bacteria | 102945 |
| 832 | Ga0501211_006287 | 3300049658 | Bacteria | 1177 |
| 833 | Ga0501222_000540 | 3300049662 | Bacteria | 5615 |
| 834 | Ga0501222_003387 | 3300049662 | Bacteria | 2179 |
| 835 | Ga0501235_005038 | 3300049669 | Bacteria | 2866 |
| 836 | Ga0501221_001344 | 3300049704 | Bacteria | 4043 |
| 837 | Ga0501225_0024214 | 3300049705 | Bacteria | 1671 |
| 838 | Ga0501080_0003909 | 3300049742 | Bacteria | 13198 |
| 839 | Ga0501080_0126763 | 3300049742 | Bacteria | 2364 |
| 840 | Ga0501083_0000046 | 3300049744 | Bacteria | 88934 |
| 841 | Ga0501262_000028 | 3300049759 | Bacteria | 19106 |
| 842 | Ga0501272_002337 | 3300049769 | Bacteria | 1868 |
| 843 | Ga0501035_0010010 | 3300049822 | Bacteria | 8797 |
| 844 | Ga0501035_0022189 | 3300049822 | Bacteria | 5832 |
| 845 | Ga0501035_0035441 | 3300049822 | Bacteria | 4529 |
| 846 | Ga0501035_0422534 | 3300049822 | Bacteria | 1106 |
| 847 | Ga0501044_0000691 | 3300049823 | Bacteria | 40824 |
| 848 | Ga0501044_0068317 | 3300049823 | Bacteria | 3620 |
| 849 | Ga0501044_0328662 | 3300049823 | Bacteria | 1452 |
| 850 | Ga0501045_0042015 | 3300049824 | Bacteria | 3327 |
| 851 | nmdc:mga03683_1056_c1 | 3300050489 | Bacteria | 8065 |
| 852 | nmdc:mga03683_15637_c1 | 3300050489 | Bacteria | 2835 |
| 853 | nmdc:mga03683_63977_c1 | 3300050489 | Bacteria | 1560 |
| 854 | nmdc:mga03n38_18474_c1 | 3300050490 | Bacteria | 2753 |
| 855 | nmdc:mga03n38_7431_c1 | 3300050490 | Bacteria | 3879 |
| 856 | nmdc:mga03n38_75142_c1 | 3300050490 | Bacteria | 1573 |
| 857 | nmdc:mga00v17_59988_c1 | 3300050491 | Bacteria | 2335 |
| 858 | nmdc:mga0k408_135021_c1 | 3300050493 | Bacteria | 1466 |
| 859 | nmdc:mga0k408_57521_c1 | 3300050493 | Bacteria | 2257 |
| 860 | nmdc:mga0k408_60488_c1 | 3300050493 | Bacteria | 2201 |
| 861 | nmdc:mga06z11_86570_c1 | 3300050494 | Bacteria | 1693 |
| 862 | nmdc:mga04h51_25130_c1 | 3300050495 | Bacteria | 1830 |
| 863 | nmdc:mga07m45_156406_c1 | 3300050496 | Bacteria | 1323 |
| 864 | nmdc:mga07m45_33614_c1 | 3300050496 | Bacteria | 2848 |
| 865 | nmdc:mga07m45_42289_c1 | 3300050496 | Bacteria | 2554 |
| 866 | nmdc:mga07m45_59_c1 | 3300050496 | Bacteria | 45010 |
| 867 | nmdc:mga07m45_61132_c1 | 3300050496 | Bacteria | 2133 |
| 868 | nmdc:mga09592_43010_c1 | 3300050508 | Bacteria | 3801 |
| 869 | nmdc:mga09592_89510_c1 | 3300050508 | Unclassified | 2629 |
| 870 | nmdc:mga0qj67_77025_c1 | 3300050509 | Bacteria | 2668 |
| 871 | nmdc:mga06r32_16310_c1 | 3300050510 | Bacteria | 6766 |
| 872 | nmdc:mga08y16_186202_c1 | 3300050511 | Bacteria | 2154 |
| 873 | nmdc:mga08y16_3895_c1 | 3300050511 | Bacteria | 15539 |
| 874 | nmdc:mga0n895_161_c1 | 3300050512 | Bacteria | 41386 |
| 875 | nmdc:mga08x19_2900_c1 | 3300050514 | Bacteria | 10322 |
| 876 | nmdc:mga0a205_12927_c1 | 3300050515 | Bacteria | 7745 |
| 877 | nmdc:mga0sz30_5751_c1 | 3300050516 | Bacteria | 4565 |
| 878 | Ga0495601_0048867 | 3300053077 | Bacteria | 2665 |
| 879 | Ga0495612_0031608 | 3300053078 | Bacteria | 2135 |
| 880 | Ga0495619_0107890 | 3300053085 | Bacteria | 1900 |
| 881 | Ga0500590_007880 | 3300053148 | Bacteria | 5293 |
| 882 | Ga0500616_0001154 | 3300053153 | Bacteria | 27009 |
| 883 | Ga0466962_0015334 | 3300061719 | Bacteria | 3695 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046691 | Ga0495670_0283717 | Ga0495670_0283717_39_872 | 271 |
| 2 | 3300003323 | rootH1_10019948 | rootH1_100199488 | 282 |
| 3 | 3300005340 | Ga0070689_100153538 | Ga0070689_1001535382 | 283 |
| 4 | 3300005364 | Ga0070673_100501594 | Ga0070673_1005015941 | 283 |
| 5 | 3300005618 | Ga0068864_100182348 | Ga0068864_1001823482 | 283 |
| 6 | 3300005842 | Ga0068858_100262837 | Ga0068858_1002628372 | 283 |
| 7 | 3300006852 | Ga0075433_10015747 | Ga0075433_100157476 | 283 |
| 8 | 3300006871 | Ga0075434_100000018 | Ga0075434_10000001824 | 283 |
| 9 | 3300006914 | Ga0075436_100015029 | Ga0075436_1000150293 | 283 |
| 10 | 3300007076 | Ga0075435_100000675 | Ga0075435_10000067510 | 283 |
| 11 | 3300009094 | Ga0111539_10010327 | Ga0111539_1001032712 | 283 |
| 12 | 3300025936 | Ga0207670_10096525 | Ga0207670_100965252 | 283 |
| 13 | 3300026078 | Ga0207702_10041205 | Ga0207702_100412055 | 283 |
| 14 | 3300026095 | Ga0207676_10217181 | Ga0207676_102171811 | 283 |
| 15 | 3300026118 | Ga0207675_100100562 | Ga0207675_1001005623 | 283 |
| 16 | 3300050512 | nmdc:mga0n895_161_c1 | nmdc:mga0n895_161_c1_21735_22673 | 283 |
| 17 | 3300050514 | nmdc:mga08x19_2900_c1 | nmdc:mga08x19_2900_c1_6545_7483 | 283 |
| 18 | 3300050515 | nmdc:mga0a205_12927_c1 | nmdc:mga0a205_12927_c1_3068_4006 | 283 |
| 19 | 3300005338 | Ga0068868_100218157 | Ga0068868_1002181572 | 287 |
| 20 | 3300005455 | Ga0070663_100080571 | Ga0070663_1000805713 | 287 |
| 21 | 3300005459 | Ga0068867_100032027 | Ga0068867_1000320273 | 287 |
| 22 | 3300005841 | Ga0068863_100583086 | Ga0068863_1005830862 | 287 |
| 23 | 3300025893 | Ga0207682_10047377 | Ga0207682_100473773 | 287 |
| 24 | 3300025907 | Ga0207645_10263222 | Ga0207645_102632222 | 287 |
| 25 | 3300032002 | Ga0307416_100106492 | Ga0307416_1001064921 | 287 |
| 26 | 3300005355 | Ga0070671_100033348 | Ga0070671_1000333482 | 288 |
| 27 | 3300025931 | Ga0207644_10097091 | Ga0207644_100970912 | 288 |
| 28 | 3300046539 | Ga0495621_0022473 | Ga0495621_0022473_966_1850 | 288 |
| 29 | 3300005328 | Ga0070676_10000256 | Ga0070676_1000025610 | 292 |
| 30 | 3300005331 | Ga0070670_100004507 | Ga0070670_10000450710 | 292 |
| 31 | 3300005333 | Ga0070677_10000666 | Ga0070677_100006662 | 292 |
| 32 | 3300005334 | Ga0068869_100030693 | Ga0068869_1000306934 | 292 |
| 33 | 3300005335 | Ga0070666_10001227 | Ga0070666_1000122717 | 292 |
| 34 | 3300005338 | Ga0068868_100000197 | Ga0068868_10000019730 | 292 |
| 35 | 3300005347 | Ga0070668_100006076 | Ga0070668_1000060764 | 292 |
| 36 | 3300005353 | Ga0070669_100155009 | Ga0070669_1001550092 | 292 |
| 37 | 3300005354 | Ga0070675_100000297 | Ga0070675_10000029710 | 292 |
| 38 | 3300005355 | Ga0070671_100000622 | Ga0070671_10000062216 | 292 |
| 39 | 3300005356 | Ga0070674_100000722 | Ga0070674_1000007227 | 292 |
| 40 | 3300005364 | Ga0070673_100000892 | Ga0070673_1000008927 | 292 |
| 41 | 3300005364 | Ga0070673_100220008 | Ga0070673_1002200082 | 292 |
| 42 | 3300005367 | Ga0070667_100007725 | Ga0070667_1000077254 | 292 |
| 43 | 3300005455 | Ga0070663_100066689 | Ga0070663_1000666892 | 292 |
| 44 | 3300005456 | Ga0070678_100010378 | Ga0070678_1000103782 | 292 |
| 45 | 3300005457 | Ga0070662_100210587 | Ga0070662_1002105872 | 292 |
| 46 | 3300005539 | Ga0068853_100045573 | Ga0068853_1000455732 | 292 |
| 47 | 3300005543 | Ga0070672_100003947 | Ga0070672_1000039472 | 292 |
| 48 | 3300005615 | Ga0070702_100071124 | Ga0070702_1000711242 | 292 |
| 49 | 3300005616 | Ga0068852_100000895 | Ga0068852_1000008958 | 292 |
| 50 | 3300005617 | Ga0068859_100281934 | Ga0068859_1002819342 | 292 |
| 51 | 3300005719 | Ga0068861_100120248 | Ga0068861_1001202482 | 292 |
| 52 | 3300005841 | Ga0068863_100077811 | Ga0068863_1000778112 | 292 |
| 53 | 3300005843 | Ga0068860_100009885 | Ga0068860_1000098857 | 292 |
| 54 | 3300006358 | Ga0068871_100001908 | Ga0068871_1000019082 | 292 |
| 55 | 3300006881 | Ga0068865_100047597 | Ga0068865_1000475972 | 292 |
| 56 | 3300006931 | Ga0097620_100281920 | Ga0097620_1002819202 | 292 |
| 57 | 3300009094 | Ga0111539_10010277 | Ga0111539_1001027712 | 292 |
| 58 | 3300013296 | Ga0157374_10204518 | Ga0157374_102045182 | 292 |
| 59 | 3300013306 | Ga0163162_10063167 | Ga0163162_100631672 | 292 |
| 60 | 3300013308 | Ga0157375_10002932 | Ga0157375_1000293210 | 292 |
| 61 | 3300017792 | Ga0163161_10035454 | Ga0163161_100354544 | 292 |
| 62 | 3300025893 | Ga0207682_10000418 | Ga0207682_100004184 | 292 |
| 63 | 3300025903 | Ga0207680_10066044 | Ga0207680_100660442 | 292 |
| 64 | 3300025907 | Ga0207645_10000301 | Ga0207645_1000030125 | 292 |
| 65 | 3300025908 | Ga0207643_10002187 | Ga0207643_1000218713 | 292 |
| 66 | 3300025925 | Ga0207650_10012639 | Ga0207650_100126397 | 292 |
| 67 | 3300025925 | Ga0207650_10094336 | Ga0207650_100943362 | 292 |
| 68 | 3300025926 | Ga0207659_10024575 | Ga0207659_100245752 | 292 |
| 69 | 3300025940 | Ga0207691_10000029 | Ga0207691_1000002925 | 292 |
| 70 | 3300025972 | Ga0207668_10092930 | Ga0207668_100929302 | 292 |
| 71 | 3300025986 | Ga0207658_10002598 | Ga0207658_1000259810 | 292 |
| 72 | 3300026041 | Ga0207639_10110400 | Ga0207639_101104002 | 292 |
| 73 | 3300026067 | Ga0207678_10009966 | Ga0207678_1000996612 | 292 |
| 74 | 3300026088 | Ga0207641_10009643 | Ga0207641_100096433 | 292 |
| 75 | 3300026089 | Ga0207648_10007124 | Ga0207648_1000712414 | 292 |
| 76 | 3300026118 | Ga0207675_100012300 | Ga0207675_1000123009 | 292 |
| 77 | 3300026121 | Ga0207683_10000305 | Ga0207683_1000030530 | 292 |
| 78 | 3300026142 | Ga0207698_10000543 | Ga0207698_100005435 | 292 |
| 79 | 3300028381 | Ga0268264_10020212 | Ga0268264_100202124 | 292 |
| 80 | 3300050511 | nmdc:mga08y16_3895_c1 | nmdc:mga08y16_3895_c1_10062_10982 | 292 |
| 81 | 3300053077 | Ga0495601_0048867 | Ga0495601_0048867_1122_2099 | 292 |
| 82 | 3300031911 | Ga0307412_10000334 | Ga0307412_1000033415 | 293 |
| 83 | 3300041404 | Ga0439436_0000003 | Ga0439436_0000003_31628_32572 | 293 |
| 84 | 3300042876 | Ga0451577_0053149 | Ga0451577_0053149_1269_2219 | 293 |
| 85 | 3300046460 | Ga0495638_0064125 | Ga0495638_0064125_232_1173 | 293 |
| 86 | 3300046512 | Ga0495610_0000450 | Ga0495610_0000450_22220_23164 | 293 |
| 87 | 3300048922 | Ga0496119_0020446 | Ga0496119_0020446_3698_4642 | 293 |
| 88 | 3300005548 | Ga0070665_100137179 | Ga0070665_1001371793 | 294 |
| 89 | 3300005564 | Ga0070664_100102425 | Ga0070664_1001024253 | 294 |
| 90 | 3300005719 | Ga0068861_100281759 | Ga0068861_1002817593 | 294 |
| 91 | 3300025940 | Ga0207691_10009666 | Ga0207691_100096664 | 294 |
| 92 | 3300025945 | Ga0207679_10127032 | Ga0207679_101270323 | 294 |
| 93 | 3300026088 | Ga0207641_10251851 | Ga0207641_102518512 | 294 |
| 94 | 3300026089 | Ga0207648_10054111 | Ga0207648_100541113 | 294 |
| 95 | 3300026118 | Ga0207675_100157741 | Ga0207675_1001577412 | 294 |
| 96 | 3300049570 | Ga0501033_0061157 | Ga0501033_0061157_580_1500 | 294 |
| 97 | 3300049581 | Ga0501047_0173424 | Ga0501047_0173424_189_1109 | 294 |
| 98 | 3300049822 | Ga0501035_0422534 | Ga0501035_0422534_102_1022 | 294 |
| 99 | 3300050491 | nmdc:mga00v17_59988_c1 | nmdc:mga00v17_59988_c1_331_1257 | 294 |
| 100 | iso_pu_bacteria | 2811994881 | 2812366799 | 294 |
| 101 | iso_pu_bacteria | 2923519811 | 2923520834 | 294 |
| 102 | 3300005328 | Ga0070676_10023646 | Ga0070676_100236462 | 295 |
| 103 | 3300005331 | Ga0070670_100002086 | Ga0070670_10000208612 | 295 |
| 104 | 3300005334 | Ga0068869_100000242 | Ga0068869_10000024218 | 295 |
| 105 | 3300005336 | Ga0070680_100000172 | Ga0070680_10000017228 | 295 |
| 106 | 3300005337 | Ga0070682_100002377 | Ga0070682_1000023779 | 295 |
| 107 | 3300005338 | Ga0068868_100027785 | Ga0068868_1000277855 | 295 |
| 108 | 3300005339 | Ga0070660_100001451 | Ga0070660_1000014517 | 295 |
| 109 | 3300005340 | Ga0070689_100089389 | Ga0070689_1000893892 | 295 |
| 110 | 3300005343 | Ga0070687_100055963 | Ga0070687_1000559632 | 295 |
| 111 | 3300005344 | Ga0070661_100001049 | Ga0070661_10000104918 | 295 |
| 112 | 3300005345 | Ga0070692_10000564 | Ga0070692_100005644 | 295 |
| 113 | 3300005366 | Ga0070659_100000892 | Ga0070659_10000089216 | 295 |
| 114 | 3300005406 | Ga0070703_10025469 | Ga0070703_100254691 | 295 |
| 115 | 3300005438 | Ga0070701_10013999 | Ga0070701_100139992 | 295 |
| 116 | 3300005440 | Ga0070705_100000829 | Ga0070705_10000082917 | 295 |
| 117 | 3300005441 | Ga0070700_100204597 | Ga0070700_1002045971 | 295 |
| 118 | 3300005444 | Ga0070694_100001268 | Ga0070694_1000012686 | 295 |
| 119 | 3300005445 | Ga0070708_100400638 | Ga0070708_1004006382 | 295 |
| 120 | 3300005455 | Ga0070663_100002216 | Ga0070663_1000022162 | 295 |
| 121 | 3300005457 | Ga0070662_100015351 | Ga0070662_1000153512 | 295 |
| 122 | 3300005458 | Ga0070681_10013452 | Ga0070681_100134526 | 295 |
| 123 | 3300005459 | Ga0068867_100002201 | Ga0068867_1000022013 | 295 |
| 124 | 3300005530 | Ga0070679_100000185 | Ga0070679_10000018530 | 295 |
| 125 | 3300005539 | Ga0068853_100022179 | Ga0068853_1000221792 | 295 |
| 126 | 3300005543 | Ga0070672_100099402 | Ga0070672_1000994022 | 295 |
| 127 | 3300005545 | Ga0070695_100003882 | Ga0070695_1000038826 | 295 |
| 128 | 3300005546 | Ga0070696_100002658 | Ga0070696_1000026583 | 295 |
| 129 | 3300005547 | Ga0070693_100000248 | Ga0070693_10000024817 | 295 |
| 130 | 3300005549 | Ga0070704_100002912 | Ga0070704_1000029122 | 295 |
| 131 | 3300005563 | Ga0068855_100000437 | Ga0068855_10000043752 | 295 |
| 132 | 3300005564 | Ga0070664_100004721 | Ga0070664_1000047212 | 295 |
| 133 | 3300005577 | Ga0068857_100059742 | Ga0068857_1000597422 | 295 |
| 134 | 3300005578 | Ga0068854_100002679 | Ga0068854_1000026792 | 295 |
| 135 | 3300005614 | Ga0068856_100000464 | Ga0068856_10000046426 | 295 |
| 136 | 3300005616 | Ga0068852_100104118 | Ga0068852_1001041182 | 295 |
| 137 | 3300005617 | Ga0068859_100007895 | Ga0068859_1000078955 | 295 |
| 138 | 3300005618 | Ga0068864_100001333 | Ga0068864_1000013332 | 295 |
| 139 | 3300005719 | Ga0068861_100010099 | Ga0068861_1000100992 | 295 |
| 140 | 3300005840 | Ga0068870_10000256 | Ga0068870_1000025617 | 295 |
| 141 | 3300005841 | Ga0068863_100050562 | Ga0068863_1000505622 | 295 |
| 142 | 3300005842 | Ga0068858_100026341 | Ga0068858_1000263412 | 295 |
| 143 | 3300005843 | Ga0068860_100030858 | Ga0068860_1000308586 | 295 |
| 144 | 3300006852 | Ga0075433_10075983 | Ga0075433_100759832 | 295 |
| 145 | 3300006871 | Ga0075434_100116972 | Ga0075434_1001169722 | 295 |
| 146 | 3300006931 | Ga0097620_100007895 | Ga0097620_1000078955 | 295 |
| 147 | 3300011119 | Ga0105246_10056982 | Ga0105246_100569822 | 295 |
| 148 | 3300013100 | Ga0157373_10000439 | Ga0157373_1000043910 | 295 |
| 149 | 3300013104 | Ga0157370_10053337 | Ga0157370_100533374 | 295 |
| 150 | 3300013105 | Ga0157369_10007249 | Ga0157369_100072497 | 295 |
| 151 | 3300013307 | Ga0157372_10000313 | Ga0157372_100003139 | 295 |
| 152 | 3300013308 | Ga0157375_10071599 | Ga0157375_100715992 | 295 |
| 153 | 3300014497 | Ga0182008_10052135 | Ga0182008_100521351 | 295 |
| 154 | 3300025885 | Ga0207653_10000897 | Ga0207653_100008973 | 295 |
| 155 | 3300025901 | Ga0207688_10017055 | Ga0207688_100170552 | 295 |
| 156 | 3300025903 | Ga0207680_10110635 | Ga0207680_101106351 | 295 |
| 157 | 3300025907 | Ga0207645_10000113 | Ga0207645_1000011316 | 295 |
| 158 | 3300025908 | Ga0207643_10000164 | Ga0207643_1000016437 | 295 |
| 159 | 3300025912 | Ga0207707_10000305 | Ga0207707_1000030549 | 295 |
| 160 | 3300025917 | Ga0207660_10000085 | Ga0207660_100000859 | 295 |
| 161 | 3300025918 | Ga0207662_10023326 | Ga0207662_100233262 | 295 |
| 162 | 3300025919 | Ga0207657_10000236 | Ga0207657_100002367 | 295 |
| 163 | 3300025920 | Ga0207649_10007149 | Ga0207649_100071494 | 295 |
| 164 | 3300025921 | Ga0207652_10000572 | Ga0207652_1000057229 | 295 |
| 165 | 3300025925 | Ga0207650_10004962 | Ga0207650_100049621 | 295 |
| 166 | 3300025926 | Ga0207659_10396910 | Ga0207659_103969102 | 295 |
| 167 | 3300025932 | Ga0207690_10006655 | Ga0207690_100066552 | 295 |
| 168 | 3300025933 | Ga0207706_10027626 | Ga0207706_100276266 | 295 |
| 169 | 3300025940 | Ga0207691_10047077 | Ga0207691_100470772 | 295 |
| 170 | 3300025942 | Ga0207689_10000870 | Ga0207689_1000087028 | 295 |
| 171 | 3300025945 | Ga0207679_10000918 | Ga0207679_1000091818 | 295 |
| 172 | 3300025949 | Ga0207667_10001952 | Ga0207667_100019528 | 295 |
| 173 | 3300025960 | Ga0207651_10037969 | Ga0207651_100379692 | 295 |
| 174 | 3300025981 | Ga0207640_10019862 | Ga0207640_100198622 | 295 |
| 175 | 3300026035 | Ga0207703_10328310 | Ga0207703_103283101 | 295 |
| 176 | 3300026041 | Ga0207639_10002377 | Ga0207639_100023776 | 295 |
| 177 | 3300026075 | Ga0207708_10153450 | Ga0207708_101534501 | 295 |
| 178 | 3300026078 | Ga0207702_10000725 | Ga0207702_1000072532 | 295 |
| 179 | 3300026089 | Ga0207648_10000753 | Ga0207648_1000075334 | 295 |
| 180 | 3300026095 | Ga0207676_10231970 | Ga0207676_102319701 | 295 |
| 181 | 3300026116 | Ga0207674_10000170 | Ga0207674_1000017031 | 295 |
| 182 | 3300026118 | Ga0207675_100009324 | Ga0207675_1000093248 | 295 |
| 183 | 3300026142 | Ga0207698_10138375 | Ga0207698_101383751 | 295 |
| 184 | 3300028381 | Ga0268264_10404144 | Ga0268264_104041441 | 295 |
| 185 | 3300035090 | Ga0373949_0017114 | Ga0373949_0017114_514_1566 | 295 |
| 186 | 3300035091 | Ga0373951_0007193 | Ga0373951_0007193_619_1671 | 295 |
| 187 | 3300035241 | Ga0373961_0012075 | Ga0373961_0012075_719_1771 | 295 |
| 188 | 3300036401 | Ga0373937_0019429 | Ga0373937_0019429_3945_4931 | 295 |
| 189 | 3300037418 | Ga0395900_0001265 | Ga0395900_0001265_11678_12586 | 295 |
| 190 | 3300037471 | Ga0395905_0009794 | Ga0395905_0009794_7812_8795 | 295 |
| 191 | 3300042438 | Ga0439459_0001488 | Ga0439459_0001488_1196_2248 | 295 |
| 192 | 3300042876 | Ga0451577_0043545 | Ga0451577_0043545_937_1989 | 295 |
| 193 | 3300046535 | Ga0495586_0089625 | Ga0495586_0089625_37_1023 | 295 |
| 194 | 3300046543 | Ga0495645_0009403 | Ga0495645_0009403_3424_4410 | 295 |
| 195 | 3300046663 | Ga0495635_0137180 | Ga0495635_0137180_40_1026 | 295 |
| 196 | 3300046683 | Ga0495658_0008234 | Ga0495658_0008234_1903_2889 | 295 |
| 197 | 3300048905 | Ga0496102_0138386 | Ga0496102_0138386_295_1347 | 295 |
| 198 | 3300048909 | Ga0496106_0126254 | Ga0496106_0126254_195_1247 | 295 |
| 199 | 3300049822 | Ga0501035_0022189 | Ga0501035_0022189_1037_1942 | 295 |
| 200 | 3300050490 | nmdc:mga03n38_75142_c1 | nmdc:mga03n38_75142_c1_452_1360 | 295 |
| 201 | 3300035116 | Ga0373945_0085402 | Ga0373945_0085402_282_1202 | 296 |
| 202 | 3300035692 | Ga0373935_0011023 | Ga0373935_0011023_656_1576 | 296 |
| 203 | 3300035725 | Ga0373947_0102441 | Ga0373947_0102441_391_1311 | 296 |
| 204 | 3300037466 | Ga0395898_0061467 | Ga0395898_0061467_244_1152 | 296 |
| 205 | 3300037471 | Ga0395905_0103047 | Ga0395905_0103047_1451_2359 | 296 |
| 206 | 3300038443 | Ga0395901_0348188 | Ga0395901_0348188_56_964 | 296 |
| 207 | 3300042435 | Ga0439434_0041319 | Ga0439434_0041319_243_1157 | 296 |
| 208 | 3300046615 | Ga0495656_0006031 | Ga0495656_0006031_3276_4184 | 296 |
| 209 | 3300053078 | Ga0495612_0031608 | Ga0495612_0031608_1048_1968 | 296 |
| 210 | 3300005329 | Ga0070683_100131351 | Ga0070683_1001313512 | 297 |
| 211 | 3300005345 | Ga0070692_10009685 | Ga0070692_100096854 | 297 |
| 212 | 3300005366 | Ga0070659_100128061 | Ga0070659_1001280612 | 297 |
| 213 | 3300005436 | Ga0070713_100001451 | Ga0070713_10000145110 | 297 |
| 214 | 3300005437 | Ga0070710_10193709 | Ga0070710_101937092 | 297 |
| 215 | 3300005439 | Ga0070711_100372519 | Ga0070711_1003725191 | 297 |
| 216 | 3300005455 | Ga0070663_100293807 | Ga0070663_1002938072 | 297 |
| 217 | 3300005457 | Ga0070662_100388668 | Ga0070662_1003886682 | 297 |
| 218 | 3300005549 | Ga0070704_100114219 | Ga0070704_1001142191 | 297 |
| 219 | 3300005578 | Ga0068854_100023555 | Ga0068854_1000235555 | 297 |
| 220 | 3300005615 | Ga0070702_100069858 | Ga0070702_1000698582 | 297 |
| 221 | 3300005616 | Ga0068852_100230640 | Ga0068852_1002306402 | 297 |
| 222 | 3300005834 | Ga0068851_10171750 | Ga0068851_101717502 | 297 |
| 223 | 3300006173 | Ga0070716_100068725 | Ga0070716_1000687253 | 297 |
| 224 | 3300007076 | Ga0075435_100013522 | Ga0075435_1000135224 | 297 |
| 225 | 3300009093 | Ga0105240_10182607 | Ga0105240_101826073 | 297 |
| 226 | 3300009098 | Ga0105245_10639080 | Ga0105245_106390801 | 297 |
| 227 | 3300009551 | Ga0105238_10510656 | Ga0105238_105106561 | 297 |
| 228 | 3300011119 | Ga0105246_10248460 | Ga0105246_102484602 | 297 |
| 229 | 3300013307 | Ga0157372_10496813 | Ga0157372_104968132 | 297 |
| 230 | 3300014497 | Ga0182008_10124202 | Ga0182008_101242022 | 297 |
| 231 | 3300025898 | Ga0207692_10072501 | Ga0207692_100725012 | 297 |
| 232 | 3300025919 | Ga0207657_10008943 | Ga0207657_100089433 | 297 |
| 233 | 3300025924 | Ga0207694_10400970 | Ga0207694_104009702 | 297 |
| 234 | 3300025927 | Ga0207687_10061124 | Ga0207687_100611242 | 297 |
| 235 | 3300025929 | Ga0207664_10000197 | Ga0207664_1000019732 | 297 |
| 236 | 3300025944 | Ga0207661_10145561 | Ga0207661_101455612 | 297 |
| 237 | 3300026067 | Ga0207678_10265773 | Ga0207678_102657732 | 297 |
| 238 | 3300026078 | Ga0207702_10026211 | Ga0207702_100262113 | 297 |
| 239 | 3300026142 | Ga0207698_10486136 | Ga0207698_104861362 | 297 |
| 240 | 3300042438 | Ga0439459_0040870 | Ga0439459_0040870_52_975 | 297 |
| 241 | 3300048906 | Ga0496103_0103586 | Ga0496103_0103586_347_1270 | 297 |
| 242 | iso_pu_bacteria | 2588253510 | 2588292744 | 297 |
| 243 | iso_pu_bacteria | 2643221592 | 2643967320 | 297 |
| 244 | iso_pu_bacteria | 2643221625 | 2644140150 | 297 |
| 245 | iso_pu_bacteria | 2643221648 | 2644271389 | 297 |
| 246 | 3300003320 | rootH2_10100170 | rootH2_101001701 | 298 |
| 247 | 3300003794 | Ga0055531_10001242 | Ga0055531_100012425 | 298 |
| 248 | 3300005295 | Ga0065707_10089760 | Ga0065707_100897602 | 298 |
| 249 | 3300005563 | Ga0068855_100016992 | Ga0068855_1000169927 | 298 |
| 250 | 3300005578 | Ga0068854_100004830 | Ga0068854_1000048302 | 298 |
| 251 | 3300009092 | Ga0105250_10000005 | Ga0105250_10000005123 | 298 |
| 252 | 3300014968 | Ga0157379_10003793 | Ga0157379_100037933 | 298 |
| 253 | 3300015261 | Ga0182006_1010807 | Ga0182006_10108072 | 298 |
| 254 | 3300025292 | Ga0209676_1013635 | Ga0209676_10136352 | 298 |
| 255 | 3300025303 | Ga0209051_1000367 | Ga0209051_100036740 | 298 |
| 256 | 3300025304 | Ga0209257_1000012 | Ga0209257_1000012562 | 298 |
| 257 | 3300025711 | Ga0207696_1000470 | Ga0207696_10004705 | 298 |
| 258 | 3300025913 | Ga0207695_10029741 | Ga0207695_100297415 | 298 |
| 259 | 3300025924 | Ga0207694_10051255 | Ga0207694_100512552 | 298 |
| 260 | 3300025949 | Ga0207667_10000036 | Ga0207667_1000003681 | 298 |
| 261 | 3300031824 | Ga0307413_10173723 | Ga0307413_101737232 | 298 |
| 262 | 3300041496 | Ga0451839_0071674 | Ga0451839_0071674_132_1049 | 298 |
| 263 | 3300046460 | Ga0495638_0140729 | Ga0495638_0140729_178_1083 | 298 |
| 264 | 3300048924 | Ga0496121_0171027 | Ga0496121_0171027_85_990 | 298 |
| 265 | iso_pu_bacteria | 2585428057 | 2587726185 | 298 |
| 266 | 3300005563 | Ga0068855_100008322 | Ga0068855_1000083223 | 299 |
| 267 | 3300005985 | Ga0081539_10068401 | Ga0081539_100684012 | 299 |
| 268 | 3300006946 | Ga0079104_1005275 | Ga0079104_10052755 | 299 |
| 269 | 3300009093 | Ga0105240_10039918 | Ga0105240_100399186 | 299 |
| 270 | 3300025949 | Ga0207667_10154499 | Ga0207667_101544992 | 299 |
| 271 | 3300027111 | Ga0209281_1011560 | Ga0209281_10115602 | 299 |
| 272 | 3300046525 | Ga0495663_0003155 | Ga0495663_0003155_1428_2342 | 299 |
| 273 | 3300047447 | Ga0495685_023041 | Ga0495685_023041_164_1078 | 299 |
| 274 | 3300048905 | Ga0496102_0000192 | Ga0496102_0000192_6675_7589 | 299 |
| 275 | 3300048906 | Ga0496103_0001678 | Ga0496103_0001678_10895_11809 | 299 |
| 276 | 3300005331 | Ga0070670_100000274 | Ga0070670_10000027437 | 300 |
| 277 | 3300005334 | Ga0068869_100004100 | Ga0068869_10000410012 | 300 |
| 278 | 3300005338 | Ga0068868_100049743 | Ga0068868_1000497433 | 300 |
| 279 | 3300005343 | Ga0070687_100020042 | Ga0070687_1000200423 | 300 |
| 280 | 3300005347 | Ga0070668_100014299 | Ga0070668_1000142992 | 300 |
| 281 | 3300005353 | Ga0070669_100074254 | Ga0070669_1000742542 | 300 |
| 282 | 3300005364 | Ga0070673_100002101 | Ga0070673_1000021012 | 300 |
| 283 | 3300005367 | Ga0070667_100008672 | Ga0070667_1000086723 | 300 |
| 284 | 3300005459 | Ga0068867_100007097 | Ga0068867_1000070977 | 300 |
| 285 | 3300005539 | Ga0068853_100108970 | Ga0068853_1001089702 | 300 |
| 286 | 3300005543 | Ga0070672_100079787 | Ga0070672_1000797872 | 300 |
| 287 | 3300005546 | Ga0070696_100148649 | Ga0070696_1001486492 | 300 |
| 288 | 3300005563 | Ga0068855_100044952 | Ga0068855_1000449526 | 300 |
| 289 | 3300005564 | Ga0070664_100100237 | Ga0070664_1001002372 | 300 |
| 290 | 3300005577 | Ga0068857_100003534 | Ga0068857_1000035343 | 300 |
| 291 | 3300005616 | Ga0068852_100178897 | Ga0068852_1001788972 | 300 |
| 292 | 3300005617 | Ga0068859_100002792 | Ga0068859_10000279212 | 300 |
| 293 | 3300005618 | Ga0068864_100008382 | Ga0068864_1000083823 | 300 |
| 294 | 3300005719 | Ga0068861_100004435 | Ga0068861_1000044356 | 300 |
| 295 | 3300005840 | Ga0068870_10055487 | Ga0068870_100554872 | 300 |
| 296 | 3300005842 | Ga0068858_100000345 | Ga0068858_10000034535 | 300 |
| 297 | 3300005843 | Ga0068860_100001723 | Ga0068860_10000172323 | 300 |
| 298 | 3300005844 | Ga0068862_100008744 | Ga0068862_1000087447 | 300 |
| 299 | 3300006844 | Ga0075428_100470065 | Ga0075428_1004700651 | 300 |
| 300 | 3300006880 | Ga0075429_100416201 | Ga0075429_1004162011 | 300 |
| 301 | 3300006931 | Ga0097620_100002792 | Ga0097620_1000027927 | 300 |
| 302 | 3300013297 | Ga0157378_10035469 | Ga0157378_100354692 | 300 |
| 303 | 3300013308 | Ga0157375_10016898 | Ga0157375_100168987 | 300 |
| 304 | 3300014325 | Ga0163163_10002386 | Ga0163163_1000238614 | 300 |
| 305 | 3300014968 | Ga0157379_10000443 | Ga0157379_100004432 | 300 |
| 306 | 3300025907 | Ga0207645_10026198 | Ga0207645_100261984 | 300 |
| 307 | 3300025918 | Ga0207662_10075942 | Ga0207662_100759422 | 300 |
| 308 | 3300025925 | Ga0207650_10005657 | Ga0207650_100056573 | 300 |
| 309 | 3300025938 | Ga0207704_10134190 | Ga0207704_101341902 | 300 |
| 310 | 3300025942 | Ga0207689_10008166 | Ga0207689_1000816612 | 300 |
| 311 | 3300025945 | Ga0207679_10071289 | Ga0207679_100712892 | 300 |
| 312 | 3300025949 | Ga0207667_10029665 | Ga0207667_100296654 | 300 |
| 313 | 3300025960 | Ga0207651_10071064 | Ga0207651_100710642 | 300 |
| 314 | 3300025972 | Ga0207668_10028441 | Ga0207668_100284412 | 300 |
| 315 | 3300025986 | Ga0207658_10004916 | Ga0207658_100049163 | 300 |
| 316 | 3300026023 | Ga0207677_10044097 | Ga0207677_100440972 | 300 |
| 317 | 3300026035 | Ga0207703_10000292 | Ga0207703_100002928 | 300 |
| 318 | 3300026041 | Ga0207639_10080988 | Ga0207639_100809883 | 300 |
| 319 | 3300026075 | Ga0207708_10417434 | Ga0207708_104174341 | 300 |
| 320 | 3300026089 | Ga0207648_10007170 | Ga0207648_100071707 | 300 |
| 321 | 3300026095 | Ga0207676_10001693 | Ga0207676_1000169310 | 300 |
| 322 | 3300026116 | Ga0207674_10007473 | Ga0207674_1000747313 | 300 |
| 323 | 3300026118 | Ga0207675_100001077 | Ga0207675_10000107711 | 300 |
| 324 | 3300027907 | Ga0207428_10011958 | Ga0207428_100119588 | 300 |
| 325 | 3300028381 | Ga0268264_10000862 | Ga0268264_1000086211 | 300 |
| 326 | 3300035116 | Ga0373945_0087234 | Ga0373945_0087234_15_935 | 300 |
| 327 | 3300048905 | Ga0496102_0169842 | Ga0496102_0169842_528_1451 | 300 |
| 328 | 3300048911 | Ga0496108_0094392 | Ga0496108_0094392_1254_2177 | 300 |
| 329 | 3300049822 | Ga0501035_0035441 | Ga0501035_0035441_141_1199 | 300 |
| 330 | 3300050496 | nmdc:mga07m45_33614_c1 | nmdc:mga07m45_33614_c1_809_1786 | 300 |
| 331 | 3300005335 | Ga0070666_10019284 | Ga0070666_100192842 | 301 |
| 332 | 3300005338 | Ga0068868_100170719 | Ga0068868_1001707191 | 301 |
| 333 | 3300005340 | Ga0070689_100089976 | Ga0070689_1000899762 | 301 |
| 334 | 3300005354 | Ga0070675_100065833 | Ga0070675_1000658332 | 301 |
| 335 | 3300005355 | Ga0070671_100001843 | Ga0070671_1000018432 | 301 |
| 336 | 3300005364 | Ga0070673_100066019 | Ga0070673_1000660191 | 301 |
| 337 | 3300005367 | Ga0070667_100066934 | Ga0070667_1000669342 | 301 |
| 338 | 3300005535 | Ga0070684_100103958 | Ga0070684_1001039581 | 301 |
| 339 | 3300005544 | Ga0070686_100037582 | Ga0070686_1000375822 | 301 |
| 340 | 3300005548 | Ga0070665_100097987 | Ga0070665_1000979871 | 301 |
| 341 | 3300005564 | Ga0070664_100022450 | Ga0070664_1000224502 | 301 |
| 342 | 3300005614 | Ga0068856_100333968 | Ga0068856_1003339682 | 301 |
| 343 | 3300005615 | Ga0070702_100078656 | Ga0070702_1000786562 | 301 |
| 344 | 3300005617 | Ga0068859_100658147 | Ga0068859_1006581471 | 301 |
| 345 | 3300005841 | Ga0068863_100208949 | Ga0068863_1002089492 | 301 |
| 346 | 3300005842 | Ga0068858_100011883 | Ga0068858_1000118833 | 301 |
| 347 | 3300006358 | Ga0068871_100159579 | Ga0068871_1001595792 | 301 |
| 348 | 3300006931 | Ga0097620_100658223 | Ga0097620_1006582231 | 301 |
| 349 | 3300009093 | Ga0105240_10251318 | Ga0105240_102513182 | 301 |
| 350 | 3300009098 | Ga0105245_10254344 | Ga0105245_102543442 | 301 |
| 351 | 3300009101 | Ga0105247_10012713 | Ga0105247_100127132 | 301 |
| 352 | 3300009551 | Ga0105238_10001243 | Ga0105238_100012434 | 301 |
| 353 | 3300009551 | Ga0105238_10052924 | Ga0105238_100529242 | 301 |
| 354 | 3300010375 | Ga0105239_10142391 | Ga0105239_101423912 | 301 |
| 355 | 3300011119 | Ga0105246_10011961 | Ga0105246_100119613 | 301 |
| 356 | 3300013296 | Ga0157374_10035714 | Ga0157374_100357142 | 301 |
| 357 | 3300013297 | Ga0157378_10136919 | Ga0157378_101369192 | 301 |
| 358 | 3300013306 | Ga0163162_10060281 | Ga0163162_100602812 | 301 |
| 359 | 3300013308 | Ga0157375_10068128 | Ga0157375_100681281 | 301 |
| 360 | 3300014325 | Ga0163163_10085003 | Ga0163163_100850032 | 301 |
| 361 | 3300014968 | Ga0157379_10184432 | Ga0157379_101844322 | 301 |
| 362 | 3300014969 | Ga0157376_10319378 | Ga0157376_103193781 | 301 |
| 363 | 3300015683 | Ga0183362_10001 | Ga0183362_10001788 | 301 |
| 364 | 3300025903 | Ga0207680_10077324 | Ga0207680_100773242 | 301 |
| 365 | 3300025924 | Ga0207694_10126313 | Ga0207694_101263132 | 301 |
| 366 | 3300025927 | Ga0207687_10032857 | Ga0207687_100328572 | 301 |
| 367 | 3300025931 | Ga0207644_10008709 | Ga0207644_100087094 | 301 |
| 368 | 3300025936 | Ga0207670_10069272 | Ga0207670_100692722 | 301 |
| 369 | 3300025941 | Ga0207711_10003120 | Ga0207711_1000312012 | 301 |
| 370 | 3300025945 | Ga0207679_10008717 | Ga0207679_100087172 | 301 |
| 371 | 3300025986 | Ga0207658_10040972 | Ga0207658_100409721 | 301 |
| 372 | 3300026035 | Ga0207703_10095969 | Ga0207703_100959691 | 301 |
| 373 | 3300026088 | Ga0207641_10006113 | Ga0207641_100061132 | 301 |
| 374 | 3300026095 | Ga0207676_10007242 | Ga0207676_100072422 | 301 |
| 375 | 3300028379 | Ga0268266_10029837 | Ga0268266_100298372 | 301 |
| 376 | 3300031548 | Ga0307408_100098348 | Ga0307408_1000983484 | 301 |
| 377 | 3300031730 | Ga0307516_10001053 | Ga0307516_100010534 | 301 |
| 378 | 3300048905 | Ga0496102_0552900 | Ga0496102_0552900_78_1064 | 301 |
| 379 | 3300048912 | Ga0496109_0089462 | Ga0496109_0089462_1480_2466 | 301 |
| 380 | 3300048915 | Ga0496112_0127400 | Ga0496112_0127400_799_1785 | 301 |
| 381 | 3300048916 | Ga0496113_0119634 | Ga0496113_0119634_870_1856 | 301 |
| 382 | 3300005336 | Ga0070680_100062213 | Ga0070680_1000622134 | 302 |
| 383 | 3300005458 | Ga0070681_10216502 | Ga0070681_102165022 | 302 |
| 384 | 3300005530 | Ga0070679_100006933 | Ga0070679_1000069334 | 302 |
| 385 | 3300006048 | Ga0075363_100028759 | Ga0075363_1000287592 | 302 |
| 386 | 3300006177 | Ga0075362_10005526 | Ga0075362_100055263 | 302 |
| 387 | 3300006353 | Ga0075370_10003801 | Ga0075370_100038015 | 302 |
| 388 | 3300025901 | Ga0207688_10127630 | Ga0207688_101276302 | 302 |
| 389 | 3300025912 | Ga0207707_10225792 | Ga0207707_102257922 | 302 |
| 390 | 3300025917 | Ga0207660_10017667 | Ga0207660_100176675 | 302 |
| 391 | 3300025921 | Ga0207652_10063689 | Ga0207652_100636894 | 302 |
| 392 | 3300031731 | Ga0307405_10115181 | Ga0307405_101151812 | 302 |
| 393 | 3300031901 | Ga0307406_10291886 | Ga0307406_102918862 | 302 |
| 394 | 3300032002 | Ga0307416_100151369 | Ga0307416_1001513692 | 302 |
| 395 | 3300039437 | Ga0436365_1917885 | Ga0436365_1917885_692_1672 | 302 |
| 396 | 3300041404 | Ga0439436_0007927 | Ga0439436_0007927_2282_3199 | 302 |
| 397 | 3300041406 | Ga0439439_0002493 | Ga0439439_0002493_1640_2557 | 302 |
| 398 | 3300041411 | Ga0439466_0028682 | Ga0439466_0028682_138_1055 | 302 |
| 399 | 3300041999 | Ga0439433_0016990 | Ga0439433_0016990_597_1514 | 302 |
| 400 | 3300042002 | Ga0439442_008923 | Ga0439442_008923_219_1136 | 302 |
| 401 | 3300042006 | Ga0439432_027931 | Ga0439432_027931_85_1002 | 302 |
| 402 | 3300042007 | Ga0439449_0003417 | Ga0439449_0003417_2340_3257 | 302 |
| 403 | 3300042014 | Ga0439457_044293 | Ga0439457_044293_47_964 | 302 |
| 404 | 3300042125 | Ga0450923_001505 | Ga0450923_001505_916_1833 | 302 |
| 405 | 3300042131 | Ga0450894_009092 | Ga0450894_009092_153_1070 | 302 |
| 406 | 3300042156 | Ga0439446_0013170 | Ga0439446_0013170_147_1064 | 302 |
| 407 | 3300042184 | Ga0450908_009442 | Ga0450908_009442_566_1483 | 302 |
| 408 | 3300044658 | Ga0466972_0004058 | Ga0466972_0004058_6015_7013 | 302 |
| 409 | 3300049742 | Ga0501080_0126763 | Ga0501080_0126763_330_1310 | 302 |
| 410 | 3300050490 | nmdc:mga03n38_18474_c1 | nmdc:mga03n38_18474_c1_1680_2597 | 302 |
| 411 | 3300050493 | nmdc:mga0k408_60488_c1 | nmdc:mga0k408_60488_c1_1255_2172 | 302 |
| 412 | iso_pu_bacteria | 2643221628 | 2644160021 | 302 |
| 413 | iso_pu_bacteria | 2842677519 | 2842680440 | 302 |
| 414 | iso_pu_bacteria | 2904449895 | 2904452283 | 302 |
| 415 | iso_pu_bacteria | 2904456579 | 2904458571 | 302 |
| 416 | iso_pu_bacteria | 2919462493 | 2919466336 | 302 |
| 417 | iso_pu_bacteria | 2945972063 | 2945976324 | 302 |
| 418 | 3300006880 | Ga0075429_100019226 | Ga0075429_1000192262 | 303 |
| 419 | 3300009545 | Ga0105237_10035501 | Ga0105237_100355014 | 303 |
| 420 | 3300050508 | nmdc:mga09592_89510_c1 | nmdc:mga09592_89510_c1_19_1056 | 303 |
| 421 | 3300050509 | nmdc:mga0qj67_77025_c1 | nmdc:mga0qj67_77025_c1_798_1835 | 303 |
| 422 | 3300050510 | nmdc:mga06r32_16310_c1 | nmdc:mga06r32_16310_c1_442_1479 | 303 |
| 423 | iso_pu_bacteria | 2643221544 | 2643745180 | 303 |
| 424 | iso_pu_bacteria | 2838054893 | 2838061755 | 303 |
| 425 | 3300049571 | Ga0501034_0042352 | Ga0501034_0042352_3262_4254 | 304 |
| 426 | 3300049742 | Ga0501080_0003909 | Ga0501080_0003909_8825_9817 | 304 |
| 427 | 3300049823 | Ga0501044_0000691 | Ga0501044_0000691_2583_3575 | 304 |
| 428 | 3300003578 | Ga0006562J51391_1136022 | Ga0006562J51391_11360222 | 305 |
| 429 | 3300005331 | Ga0070670_100201633 | Ga0070670_1002016332 | 305 |
| 430 | 3300005347 | Ga0070668_100013298 | Ga0070668_1000132982 | 305 |
| 431 | 3300005354 | Ga0070675_100005416 | Ga0070675_1000054163 | 305 |
| 432 | 3300005366 | Ga0070659_100327527 | Ga0070659_1003275272 | 305 |
| 433 | 3300013100 | Ga0157373_10018978 | Ga0157373_100189786 | 305 |
| 434 | 3300014497 | Ga0182008_10051560 | Ga0182008_100515602 | 305 |
| 435 | 3300014969 | Ga0157376_10273812 | Ga0157376_102738122 | 305 |
| 436 | 3300025919 | Ga0207657_10039155 | Ga0207657_100391556 | 305 |
| 437 | 3300025926 | Ga0207659_10005626 | Ga0207659_100056267 | 305 |
| 438 | 3300025940 | Ga0207691_10197629 | Ga0207691_101976292 | 305 |
| 439 | 3300044684 | Ga0466966_0006654 | Ga0466966_0006654_3274_4260 | 305 |
| 440 | 3300044693 | Ga0466961_0008842 | Ga0466961_0008842_1551_2537 | 305 |
| 441 | 3300048924 | Ga0496121_0000762 | Ga0496121_0000762_47876_48814 | 305 |
| 442 | iso_pu_bacteria | 2585428062 | 2587755996 | 305 |
| 443 | iso_pu_bacteria | 2643221585 | 2643935673 | 305 |
| 444 | iso_pu_bacteria | 2643221656 | 2644317456 | 305 |
| 445 | iso_pu_bacteria | 2929160207 | 2929165158 | 305 |
| 446 | 3300003773 | Ga0055537_1000544 | Ga0055537_100054413 | 306 |
| 447 | 3300003784 | Ga0055534_1000494 | Ga0055534_100049413 | 306 |
| 448 | 3300003790 | Ga0055528_1002350 | Ga0055528_10023509 | 306 |
| 449 | 3300005288 | Ga0065714_10071324 | Ga0065714_100713243 | 306 |
| 450 | 3300005548 | Ga0070665_100262352 | Ga0070665_1002623522 | 306 |
| 451 | 3300006177 | Ga0075362_10006134 | Ga0075362_100061342 | 306 |
| 452 | 3300006353 | Ga0075370_10001936 | Ga0075370_100019369 | 306 |
| 453 | 3300006948 | Ga0099826_10000408 | Ga0099826_1000040813 | 306 |
| 454 | 3300011119 | Ga0105246_10091230 | Ga0105246_100912302 | 306 |
| 455 | 3300025263 | Ga0209565_1000138 | Ga0209565_100013813 | 306 |
| 456 | 3300025273 | Ga0209673_1000064 | Ga0209673_100006413 | 306 |
| 457 | 3300025273 | Ga0209673_1003257 | Ga0209673_10032572 | 306 |
| 458 | 3300025291 | Ga0209675_1000036 | Ga0209675_100003613 | 306 |
| 459 | 3300025292 | Ga0209676_1048528 | Ga0209676_10485281 | 306 |
| 460 | 3300025303 | Ga0209051_1000113 | Ga0209051_100011317 | 306 |
| 461 | 3300025914 | Ga0207671_10024778 | Ga0207671_100247782 | 306 |
| 462 | 3300027666 | Ga0209282_1000521 | Ga0209282_10005218 | 306 |
| 463 | 3300030731 | Ga0316177_1089736 | Ga0316177_10897361 | 306 |
| 464 | 3300030733 | Ga0314311_1055507 | Ga0314311_10555075 | 306 |
| 465 | 3300030736 | Ga0316180_1039863 | Ga0316180_10398631 | 306 |
| 466 | 3300031649 | Ga0307514_10108540 | Ga0307514_101085402 | 306 |
| 467 | 3300031901 | Ga0307406_10002407 | Ga0307406_100024072 | 306 |
| 468 | 3300031911 | Ga0307412_10215557 | Ga0307412_102155572 | 306 |
| 469 | 3300032004 | Ga0307414_10036574 | Ga0307414_100365743 | 306 |
| 470 | 3300041411 | Ga0439466_0060726 | Ga0439466_0060726_31_993 | 306 |
| 471 | 3300041413 | Ga0439465_0028288 | Ga0439465_0028288_450_1412 | 306 |
| 472 | 3300042002 | Ga0439442_007132 | Ga0439442_007132_240_1202 | 306 |
| 473 | 3300042121 | Ga0450919_007325 | Ga0450919_007325_33_995 | 306 |
| 474 | 3300042125 | Ga0450923_010263 | Ga0450923_010263_101_1063 | 306 |
| 475 | 3300042134 | Ga0450898_014796 | Ga0450898_014796_33_995 | 306 |
| 476 | 3300042145 | Ga0450906_001314 | Ga0450906_001314_300_1262 | 306 |
| 477 | 3300042185 | Ga0450909_011553 | Ga0450909_011553_59_1021 | 306 |
| 478 | 3300046660 | Ga0495625_0000057 | Ga0495625_0000057_7524_8492 | 306 |
| 479 | 3300049649 | Ga0501198_000015 | Ga0501198_000015_54429_55433 | 306 |
| 480 | 3300049662 | Ga0501222_000540 | Ga0501222_000540_4335_5339 | 306 |
| 481 | 3300049705 | Ga0501225_0024214 | Ga0501225_0024214_335_1297 | 306 |
| 482 | 3300049759 | Ga0501262_000028 | Ga0501262_000028_8585_9547 | 306 |
| 483 | 3300050489 | nmdc:mga03683_1056_c1 | nmdc:mga03683_1056_c1_6977_7942 | 306 |
| 484 | 3300050496 | nmdc:mga07m45_59_c1 | nmdc:mga07m45_59_c1_6882_7844 | 306 |
| 485 | 3300050516 | nmdc:mga0sz30_5751_c1 | nmdc:mga0sz30_5751_c1_1472_2437 | 306 |
| 486 | 3300053148 | Ga0500590_007880 | Ga0500590_007880_2044_3006 | 306 |
| 487 | iso_pu_bacteria | 2842733646 | 2842738934 | 306 |
| 488 | 3300003316 | rootH1_10034705 | rootH1_100347054 | 307 |
| 489 | 3300003323 | rootH1_10134544 | rootH1_101345444 | 307 |
| 490 | 3300003323 | rootH1_10168926 | rootH1_101689263 | 307 |
| 491 | 3300005616 | Ga0068852_100085617 | Ga0068852_1000856175 | 307 |
| 492 | 3300009176 | Ga0105242_10076846 | Ga0105242_100768463 | 307 |
| 493 | 3300025934 | Ga0207686_10048026 | Ga0207686_100480263 | 307 |
| 494 | 3300026023 | Ga0207677_10328371 | Ga0207677_103283711 | 307 |
| 495 | 3300028794 | Ga0307515_10197516 | Ga0307515_101975162 | 307 |
| 496 | 3300031548 | Ga0307408_100000026 | Ga0307408_100000026190 | 307 |
| 497 | 3300032004 | Ga0307414_10370429 | Ga0307414_103704292 | 307 |
| 498 | 3300032005 | Ga0307411_10035182 | Ga0307411_100351823 | 307 |
| 499 | 3300037471 | Ga0395905_0010349 | Ga0395905_0010349_2497_3483 | 307 |
| 500 | 3300044683 | Ga0466965_0010749 | Ga0466965_0010749_434_1432 | 307 |
| 501 | 3300045051 | Ga0451576_0578170 | Ga0451576_0578170_40_1008 | 307 |
| 502 | 3300049580 | Ga0501046_0000007 | Ga0501046_0000007_129595_130602 | 307 |
| 503 | 3300049582 | Ga0501048_0002373 | Ga0501048_0002373_11110_12117 | 307 |
| 504 | 3300049658 | Ga0501211_006287 | Ga0501211_006287_149_1129 | 307 |
| 505 | 3300049662 | Ga0501222_003387 | Ga0501222_003387_1017_1997 | 307 |
| 506 | 3300049669 | Ga0501235_005038 | Ga0501235_005038_301_1281 | 307 |
| 507 | 3300049704 | Ga0501221_001344 | Ga0501221_001344_1548_2528 | 307 |
| 508 | 3300049744 | Ga0501083_0000046 | Ga0501083_0000046_77463_78470 | 307 |
| 509 | 3300049769 | Ga0501272_002337 | Ga0501272_002337_441_1421 | 307 |
| 510 | 3300049822 | Ga0501035_0010010 | Ga0501035_0010010_5690_6697 | 307 |
| 511 | 3300049823 | Ga0501044_0068317 | Ga0501044_0068317_583_1590 | 307 |
| 512 | 3300050496 | nmdc:mga07m45_42289_c1 | nmdc:mga07m45_42289_c1_584_1546 | 307 |
| 513 | 3300005355 | Ga0070671_100259234 | Ga0070671_1002592341 | 308 |
| 514 | 3300005543 | Ga0070672_100072430 | Ga0070672_1000724302 | 308 |
| 515 | 3300005841 | Ga0068863_100105074 | Ga0068863_1001050743 | 308 |
| 516 | 3300006237 | Ga0097621_100091399 | Ga0097621_1000913993 | 308 |
| 517 | 3300009177 | Ga0105248_10001546 | Ga0105248_1000154610 | 308 |
| 518 | 3300014325 | Ga0163163_10677048 | Ga0163163_106770481 | 308 |
| 519 | 3300025940 | Ga0207691_10050458 | Ga0207691_100504583 | 308 |
| 520 | 3300025949 | Ga0207667_10047017 | Ga0207667_100470172 | 308 |
| 521 | 3300031730 | Ga0307516_10177457 | Ga0307516_101774572 | 308 |
| 522 | iso_pu_bacteria | 2945945610 | 2945946601 | 308 |
| 523 | 3300003187 | JGI25151J46595_10007041 | JGI25151J46595_100070416 | 309 |
| 524 | 3300005334 | Ga0068869_100005398 | Ga0068869_1000053985 | 309 |
| 525 | 3300005339 | Ga0070660_100018945 | Ga0070660_1000189454 | 309 |
| 526 | 3300005344 | Ga0070661_100007506 | Ga0070661_1000075066 | 309 |
| 527 | 3300005354 | Ga0070675_100012809 | Ga0070675_1000128092 | 309 |
| 528 | 3300005356 | Ga0070674_100119556 | Ga0070674_1001195561 | 309 |
| 529 | 3300005366 | Ga0070659_100003263 | Ga0070659_1000032635 | 309 |
| 530 | 3300005366 | Ga0070659_100021770 | Ga0070659_1000217703 | 309 |
| 531 | 3300005455 | Ga0070663_100113931 | Ga0070663_1001139311 | 309 |
| 532 | 3300005456 | Ga0070678_100085005 | Ga0070678_1000850051 | 309 |
| 533 | 3300005457 | Ga0070662_100019586 | Ga0070662_1000195864 | 309 |
| 534 | 3300005535 | Ga0070684_100015224 | Ga0070684_1000152245 | 309 |
| 535 | 3300005535 | Ga0070684_100210820 | Ga0070684_1002108203 | 309 |
| 536 | 3300005543 | Ga0070672_100437728 | Ga0070672_1004377281 | 309 |
| 537 | 3300005563 | Ga0068855_100097495 | Ga0068855_1000974953 | 309 |
| 538 | 3300005564 | Ga0070664_100002952 | Ga0070664_10000295216 | 309 |
| 539 | 3300005578 | Ga0068854_100003177 | Ga0068854_1000031776 | 309 |
| 540 | 3300005614 | Ga0068856_100121603 | Ga0068856_1001216033 | 309 |
| 541 | 3300005616 | Ga0068852_100031572 | Ga0068852_1000315726 | 309 |
| 542 | 3300005616 | Ga0068852_100062542 | Ga0068852_1000625425 | 309 |
| 543 | 3300005618 | Ga0068864_100006397 | Ga0068864_1000063978 | 309 |
| 544 | 3300005618 | Ga0068864_100226386 | Ga0068864_1002263862 | 309 |
| 545 | 3300005834 | Ga0068851_10008604 | Ga0068851_100086045 | 309 |
| 546 | 3300005834 | Ga0068851_10027727 | Ga0068851_100277273 | 309 |
| 547 | 3300005841 | Ga0068863_100291272 | Ga0068863_1002912723 | 309 |
| 548 | 3300006195 | Ga0075366_10064581 | Ga0075366_100645813 | 309 |
| 549 | 3300006846 | Ga0075430_100035882 | Ga0075430_1000358823 | 309 |
| 550 | 3300006931 | Ga0097620_100106515 | Ga0097620_1001065154 | 309 |
| 551 | 3300009098 | Ga0105245_10030772 | Ga0105245_100307724 | 309 |
| 552 | 3300009177 | Ga0105248_10066735 | Ga0105248_100667355 | 309 |
| 553 | 3300013105 | Ga0157369_10026826 | Ga0157369_100268267 | 309 |
| 554 | 3300013296 | Ga0157374_10060197 | Ga0157374_100601973 | 309 |
| 555 | 3300013306 | Ga0163162_10070135 | Ga0163162_100701355 | 309 |
| 556 | 3300013307 | Ga0157372_10013839 | Ga0157372_100138394 | 309 |
| 557 | 3300013307 | Ga0157372_10013841 | Ga0157372_100138418 | 309 |
| 558 | 3300013308 | Ga0157375_10354687 | Ga0157375_103546873 | 309 |
| 559 | 3300014326 | Ga0157380_10062669 | Ga0157380_100626692 | 309 |
| 560 | 3300014745 | Ga0157377_10000246 | Ga0157377_100002462 | 309 |
| 561 | 3300014968 | Ga0157379_10157266 | Ga0157379_101572662 | 309 |
| 562 | 3300017792 | Ga0163161_10027428 | Ga0163161_100274285 | 309 |
| 563 | 3300025294 | Ga0209025_1000938 | Ga0209025_100093839 | 309 |
| 564 | 3300025303 | Ga0209051_1002717 | Ga0209051_10027175 | 309 |
| 565 | 3300025321 | Ga0207656_10023745 | Ga0207656_100237453 | 309 |
| 566 | 3300025901 | Ga0207688_10039840 | Ga0207688_100398403 | 309 |
| 567 | 3300025919 | Ga0207657_10050479 | Ga0207657_100504794 | 309 |
| 568 | 3300025920 | Ga0207649_10008827 | Ga0207649_100088276 | 309 |
| 569 | 3300025921 | Ga0207652_10271781 | Ga0207652_102717812 | 309 |
| 570 | 3300025923 | Ga0207681_10360780 | Ga0207681_103607802 | 309 |
| 571 | 3300025924 | Ga0207694_10055328 | Ga0207694_100553284 | 309 |
| 572 | 3300025926 | Ga0207659_10014964 | Ga0207659_100149644 | 309 |
| 573 | 3300025927 | Ga0207687_10071446 | Ga0207687_100714462 | 309 |
| 574 | 3300025931 | Ga0207644_10000803 | Ga0207644_100008035 | 309 |
| 575 | 3300025932 | Ga0207690_10009936 | Ga0207690_100099362 | 309 |
| 576 | 3300025932 | Ga0207690_10059497 | Ga0207690_100594974 | 309 |
| 577 | 3300025933 | Ga0207706_10002100 | Ga0207706_1000210011 | 309 |
| 578 | 3300025942 | Ga0207689_10002362 | Ga0207689_100023626 | 309 |
| 579 | 3300025945 | Ga0207679_10328535 | Ga0207679_103285352 | 309 |
| 580 | 3300025949 | Ga0207667_10145685 | Ga0207667_101456854 | 309 |
| 581 | 3300025949 | Ga0207667_10285819 | Ga0207667_102858191 | 309 |
| 582 | 3300025960 | Ga0207651_10050856 | Ga0207651_100508561 | 309 |
| 583 | 3300025981 | Ga0207640_10077683 | Ga0207640_100776834 | 309 |
| 584 | 3300026067 | Ga0207678_10007096 | Ga0207678_100070966 | 309 |
| 585 | 3300026078 | Ga0207702_10012210 | Ga0207702_1001221010 | 309 |
| 586 | 3300026089 | Ga0207648_10086547 | Ga0207648_100865474 | 309 |
| 587 | 3300026095 | Ga0207676_10107345 | Ga0207676_101073452 | 309 |
| 588 | 3300026095 | Ga0207676_10213022 | Ga0207676_102130222 | 309 |
| 589 | 3300026116 | Ga0207674_10039028 | Ga0207674_100390282 | 309 |
| 590 | 3300026118 | Ga0207675_100000273 | Ga0207675_1000002735 | 309 |
| 591 | 3300026121 | Ga0207683_10063103 | Ga0207683_100631033 | 309 |
| 592 | 3300026142 | Ga0207698_10012920 | Ga0207698_100129202 | 309 |
| 593 | 3300026142 | Ga0207698_10125034 | Ga0207698_101250344 | 309 |
| 594 | 3300028380 | Ga0268265_10464344 | Ga0268265_104643442 | 309 |
| 595 | 3300028794 | Ga0307515_10082486 | Ga0307515_100824862 | 309 |
| 596 | 3300031456 | Ga0307513_10043216 | Ga0307513_100432164 | 309 |
| 597 | 3300031456 | Ga0307513_10118073 | Ga0307513_101180732 | 309 |
| 598 | 3300031507 | Ga0307509_10008945 | Ga0307509_100089453 | 309 |
| 599 | 3300031616 | Ga0307508_10000222 | Ga0307508_1000022255 | 309 |
| 600 | 3300031730 | Ga0307516_10042854 | Ga0307516_100428543 | 309 |
| 601 | 3300031911 | Ga0307412_10123087 | Ga0307412_101230872 | 309 |
| 602 | 3300033179 | Ga0307507_10143225 | Ga0307507_101432252 | 309 |
| 603 | 3300033180 | Ga0307510_10216326 | Ga0307510_102163262 | 309 |
| 604 | 3300041404 | Ga0439436_0001289 | Ga0439436_0001289_2053_3003 | 309 |
| 605 | 3300041411 | Ga0439466_0018193 | Ga0439466_0018193_249_1199 | 309 |
| 606 | 3300041413 | Ga0439465_0001535 | Ga0439465_0001535_3836_4786 | 309 |
| 607 | 3300041452 | Ga0451793_0233126 | Ga0451793_0233126_189_1166 | 309 |
| 608 | 3300041453 | Ga0451797_0100768 | Ga0451797_0100768_629_1606 | 309 |
| 609 | 3300041496 | Ga0451839_0654308 | Ga0451839_0654308_46_1023 | 309 |
| 610 | 3300041997 | Ga0439431_0000205 | Ga0439431_0000205_7706_8656 | 309 |
| 611 | 3300041999 | Ga0439433_0002049 | Ga0439433_0002049_1234_2184 | 309 |
| 612 | 3300042004 | Ga0439445_0001824 | Ga0439445_0001824_3130_4080 | 309 |
| 613 | 3300042006 | Ga0439432_001895 | Ga0439432_001895_4769_5719 | 309 |
| 614 | 3300042007 | Ga0439449_0001384 | Ga0439449_0001384_345_1295 | 309 |
| 615 | 3300042007 | Ga0439449_0018173 | Ga0439449_0018173_1658_2611 | 309 |
| 616 | 3300042015 | Ga0439462_0018997 | Ga0439462_0018997_670_1620 | 309 |
| 617 | 3300042156 | Ga0439446_0002478 | Ga0439446_0002478_2774_3724 | 309 |
| 618 | 3300044683 | Ga0466965_0085445 | Ga0466965_0085445_291_1250 | 309 |
| 619 | 3300046512 | Ga0495610_0076078 | Ga0495610_0076078_465_1442 | 309 |
| 620 | 3300046660 | Ga0495625_0006349 | Ga0495625_0006349_6416_7393 | 309 |
| 621 | 3300048905 | Ga0496102_0054088 | Ga0496102_0054088_1456_2436 | 309 |
| 622 | 3300048907 | Ga0496104_0052530 | Ga0496104_0052530_1255_2235 | 309 |
| 623 | 3300048909 | Ga0496106_0047730 | Ga0496106_0047730_1520_2500 | 309 |
| 624 | 3300048910 | Ga0496107_0039482 | Ga0496107_0039482_1283_2263 | 309 |
| 625 | 3300048914 | Ga0496111_0049406 | Ga0496111_0049406_2018_2998 | 309 |
| 626 | 3300048917 | Ga0496114_0050992 | Ga0496114_0050992_852_1832 | 309 |
| 627 | 3300050508 | nmdc:mga09592_43010_c1 | nmdc:mga09592_43010_c1_1921_2916 | 309 |
| 628 | 3300002773 | JGI25152J39213_1006552 | JGI25152J39213_10065522 | 310 |
| 629 | 3300003771 | Ga0055526_1006587 | Ga0055526_10065877 | 310 |
| 630 | 3300005331 | Ga0070670_100142038 | Ga0070670_1001420381 | 310 |
| 631 | 3300005331 | Ga0070670_100176784 | Ga0070670_1001767842 | 310 |
| 632 | 3300005334 | Ga0068869_100015284 | Ga0068869_1000152844 | 310 |
| 633 | 3300005335 | Ga0070666_10000632 | Ga0070666_1000063215 | 310 |
| 634 | 3300005335 | Ga0070666_10035838 | Ga0070666_100358382 | 310 |
| 635 | 3300005339 | Ga0070660_100132602 | Ga0070660_1001326022 | 310 |
| 636 | 3300005340 | Ga0070689_100208444 | Ga0070689_1002084442 | 310 |
| 637 | 3300005343 | Ga0070687_100004159 | Ga0070687_1000041594 | 310 |
| 638 | 3300005347 | Ga0070668_100003835 | Ga0070668_1000038356 | 310 |
| 639 | 3300005353 | Ga0070669_100001974 | Ga0070669_1000019749 | 310 |
| 640 | 3300005354 | Ga0070675_100029594 | Ga0070675_1000295943 | 310 |
| 641 | 3300005356 | Ga0070674_100000657 | Ga0070674_1000006577 | 310 |
| 642 | 3300005364 | Ga0070673_100130092 | Ga0070673_1001300922 | 310 |
| 643 | 3300005367 | Ga0070667_100006184 | Ga0070667_1000061845 | 310 |
| 644 | 3300005456 | Ga0070678_100036279 | Ga0070678_1000362793 | 310 |
| 645 | 3300005457 | Ga0070662_100008473 | Ga0070662_1000084735 | 310 |
| 646 | 3300005459 | Ga0068867_100000424 | Ga0068867_1000004245 | 310 |
| 647 | 3300005543 | Ga0070672_100003390 | Ga0070672_1000033905 | 310 |
| 648 | 3300005564 | Ga0070664_100196618 | Ga0070664_1001966183 | 310 |
| 649 | 3300005616 | Ga0068852_100007034 | Ga0068852_1000070344 | 310 |
| 650 | 3300005616 | Ga0068852_100062905 | Ga0068852_1000629052 | 310 |
| 651 | 3300005718 | Ga0068866_10002303 | Ga0068866_100023034 | 310 |
| 652 | 3300005719 | Ga0068861_100001445 | Ga0068861_10000144511 | 310 |
| 653 | 3300005834 | Ga0068851_10049347 | Ga0068851_100493472 | 310 |
| 654 | 3300005841 | Ga0068863_100000793 | Ga0068863_10000079318 | 310 |
| 655 | 3300005842 | Ga0068858_100007270 | Ga0068858_1000072704 | 310 |
| 656 | 3300005843 | Ga0068860_100000216 | Ga0068860_10000021673 | 310 |
| 657 | 3300006237 | Ga0097621_100324333 | Ga0097621_1003243332 | 310 |
| 658 | 3300006358 | Ga0068871_100138408 | Ga0068871_1001384082 | 310 |
| 659 | 3300006358 | Ga0068871_100159987 | Ga0068871_1001599872 | 310 |
| 660 | 3300006881 | Ga0068865_100042684 | Ga0068865_1000426843 | 310 |
| 661 | 3300009148 | Ga0105243_10007628 | Ga0105243_100076284 | 310 |
| 662 | 3300009176 | Ga0105242_10020867 | Ga0105242_100208674 | 310 |
| 663 | 3300009545 | Ga0105237_10006409 | Ga0105237_100064095 | 310 |
| 664 | 3300009553 | Ga0105249_10006350 | Ga0105249_100063509 | 310 |
| 665 | 3300013296 | Ga0157374_10165877 | Ga0157374_101658772 | 310 |
| 666 | 3300013306 | Ga0163162_10004873 | Ga0163162_100048734 | 310 |
| 667 | 3300013308 | Ga0157375_10002130 | Ga0157375_100021303 | 310 |
| 668 | 3300014326 | Ga0157380_10002054 | Ga0157380_100020543 | 310 |
| 669 | 3300014968 | Ga0157379_10000977 | Ga0157379_100009779 | 310 |
| 670 | 3300025245 | Ga0207425_1000254 | Ga0207425_10002547 | 310 |
| 671 | 3300025258 | Ga0209129_1000035 | Ga0209129_1000035156 | 310 |
| 672 | 3300025295 | Ga0209564_1000024 | Ga0209564_1000024350 | 310 |
| 673 | 3300025297 | Ga0209758_1000066 | Ga0209758_1000066162 | 310 |
| 674 | 3300025304 | Ga0209257_1036695 | Ga0209257_10366952 | 310 |
| 675 | 3300025315 | Ga0207697_10059264 | Ga0207697_100592642 | 310 |
| 676 | 3300025893 | Ga0207682_10001443 | Ga0207682_100014433 | 310 |
| 677 | 3300025893 | Ga0207682_10070862 | Ga0207682_100708622 | 310 |
| 678 | 3300025899 | Ga0207642_10024852 | Ga0207642_100248523 | 310 |
| 679 | 3300025903 | Ga0207680_10020860 | Ga0207680_100208603 | 310 |
| 680 | 3300025903 | Ga0207680_10063998 | Ga0207680_100639982 | 310 |
| 681 | 3300025907 | Ga0207645_10004200 | Ga0207645_100042005 | 310 |
| 682 | 3300025908 | Ga0207643_10167634 | Ga0207643_101676342 | 310 |
| 683 | 3300025909 | Ga0207705_10060723 | Ga0207705_100607232 | 310 |
| 684 | 3300025918 | Ga0207662_10007091 | Ga0207662_100070916 | 310 |
| 685 | 3300025919 | Ga0207657_10151052 | Ga0207657_101510523 | 310 |
| 686 | 3300025923 | Ga0207681_10000162 | Ga0207681_1000016213 | 310 |
| 687 | 3300025925 | Ga0207650_10169565 | Ga0207650_101695652 | 310 |
| 688 | 3300025926 | Ga0207659_10012076 | Ga0207659_100120763 | 310 |
| 689 | 3300025931 | Ga0207644_10132150 | Ga0207644_101321502 | 310 |
| 690 | 3300025933 | Ga0207706_10014083 | Ga0207706_100140835 | 310 |
| 691 | 3300025933 | Ga0207706_10048887 | Ga0207706_100488873 | 310 |
| 692 | 3300025934 | Ga0207686_10008635 | Ga0207686_100086354 | 310 |
| 693 | 3300025935 | Ga0207709_10009952 | Ga0207709_100099522 | 310 |
| 694 | 3300025937 | Ga0207669_10001640 | Ga0207669_100016404 | 310 |
| 695 | 3300025938 | Ga0207704_10001096 | Ga0207704_100010967 | 310 |
| 696 | 3300025940 | Ga0207691_10012987 | Ga0207691_100129874 | 310 |
| 697 | 3300025940 | Ga0207691_10030305 | Ga0207691_100303054 | 310 |
| 698 | 3300025942 | Ga0207689_10002739 | Ga0207689_100027397 | 310 |
| 699 | 3300025945 | Ga0207679_10324393 | Ga0207679_103243932 | 310 |
| 700 | 3300025960 | Ga0207651_10082929 | Ga0207651_100829292 | 310 |
| 701 | 3300025972 | Ga0207668_10002399 | Ga0207668_100023995 | 310 |
| 702 | 3300025986 | Ga0207658_10000181 | Ga0207658_1000018135 | 310 |
| 703 | 3300026023 | Ga0207677_10315386 | Ga0207677_103153861 | 310 |
| 704 | 3300026035 | Ga0207703_10016526 | Ga0207703_100165264 | 310 |
| 705 | 3300026067 | Ga0207678_10256216 | Ga0207678_102562162 | 310 |
| 706 | 3300026075 | Ga0207708_10254791 | Ga0207708_102547911 | 310 |
| 707 | 3300026088 | Ga0207641_10001206 | Ga0207641_1000120621 | 310 |
| 708 | 3300026089 | Ga0207648_10012095 | Ga0207648_100120955 | 310 |
| 709 | 3300026095 | Ga0207676_10218481 | Ga0207676_102184813 | 310 |
| 710 | 3300026118 | Ga0207675_100015774 | Ga0207675_1000157742 | 310 |
| 711 | 3300026121 | Ga0207683_10134011 | Ga0207683_101340112 | 310 |
| 712 | 3300026142 | Ga0207698_10007407 | Ga0207698_100074074 | 310 |
| 713 | 3300028381 | Ga0268264_10002185 | Ga0268264_100021857 | 310 |
| 714 | 3300028794 | Ga0307515_10004838 | Ga0307515_100048387 | 310 |
| 715 | 3300028794 | Ga0307515_10066724 | Ga0307515_100667245 | 310 |
| 716 | 3300031730 | Ga0307516_10061501 | Ga0307516_100615013 | 310 |
| 717 | 3300031911 | Ga0307412_10262098 | Ga0307412_102620982 | 310 |
| 718 | 3300031995 | Ga0307409_100011603 | Ga0307409_1000116035 | 310 |
| 719 | 3300032002 | Ga0307416_100001205 | Ga0307416_10000120517 | 310 |
| 720 | 3300032126 | Ga0307415_100018199 | Ga0307415_1000181994 | 310 |
| 721 | 3300048911 | Ga0496108_0038014 | Ga0496108_0038014_2615_3577 | 310 |
| 722 | 3300048924 | Ga0496121_0063636 | Ga0496121_0063636_1539_2534 | 310 |
| 723 | 3300048927 | Ga0496124_0000086 | Ga0496124_0000086_191654_192649 | 310 |
| 724 | 3300048928 | Ga0496125_0029046 | Ga0496125_0029046_1631_2626 | 310 |
| 725 | 3300050511 | nmdc:mga08y16_186202_c1 | nmdc:mga08y16_186202_c1_142_1128 | 310 |
| 726 | 3300005331 | Ga0070670_100055280 | Ga0070670_1000552802 | 311 |
| 727 | 3300005333 | Ga0070677_10018435 | Ga0070677_100184352 | 311 |
| 728 | 3300005354 | Ga0070675_100076015 | Ga0070675_1000760153 | 311 |
| 729 | 3300005457 | Ga0070662_100094189 | Ga0070662_1000941892 | 311 |
| 730 | 3300005459 | Ga0068867_100000047 | Ga0068867_10000004720 | 311 |
| 731 | 3300005543 | Ga0070672_100217772 | Ga0070672_1002177722 | 311 |
| 732 | 3300005564 | Ga0070664_100195180 | Ga0070664_1001951802 | 311 |
| 733 | 3300005718 | Ga0068866_10090767 | Ga0068866_100907672 | 311 |
| 734 | 3300005844 | Ga0068862_100334171 | Ga0068862_1003341712 | 311 |
| 735 | 3300006195 | Ga0075366_10076142 | Ga0075366_100761422 | 311 |
| 736 | 3300006353 | Ga0075370_10077658 | Ga0075370_100776582 | 311 |
| 737 | 3300009148 | Ga0105243_10004148 | Ga0105243_100041482 | 311 |
| 738 | 3300014969 | Ga0157376_10108867 | Ga0157376_101088672 | 311 |
| 739 | 3300025893 | Ga0207682_10003883 | Ga0207682_100038832 | 311 |
| 740 | 3300025926 | Ga0207659_10074219 | Ga0207659_100742191 | 311 |
| 741 | 3300025933 | Ga0207706_10071755 | Ga0207706_100717553 | 311 |
| 742 | 3300025940 | Ga0207691_10037465 | Ga0207691_100374652 | 311 |
| 743 | 3300025941 | Ga0207711_10177630 | Ga0207711_101776302 | 311 |
| 744 | 3300025960 | Ga0207651_10243076 | Ga0207651_102430762 | 311 |
| 745 | 3300028380 | Ga0268265_10125350 | Ga0268265_101253502 | 311 |
| 746 | 3300037418 | Ga0395900_0000054 | Ga0395900_0000054_209646_210659 | 311 |
| 747 | 3300037466 | Ga0395898_0000485 | Ga0395898_0000485_55540_56553 | 311 |
| 748 | 3300037471 | Ga0395905_0028723 | Ga0395905_0028723_754_1740 | 311 |
| 749 | 3300045051 | Ga0451576_0197347 | Ga0451576_0197347_353_1366 | 311 |
| 750 | iso_pu_bacteria | 2831265667 | 2831272083 | 311 |
| 751 | 3300005455 | Ga0070663_100001081 | Ga0070663_1000010812 | 312 |
| 752 | 3300005543 | Ga0070672_100013936 | Ga0070672_1000139367 | 312 |
| 753 | 3300005577 | Ga0068857_100017776 | Ga0068857_1000177767 | 312 |
| 754 | 3300005616 | Ga0068852_100015220 | Ga0068852_1000152205 | 312 |
| 755 | 3300006177 | Ga0075362_10117549 | Ga0075362_101175491 | 312 |
| 756 | 3300006195 | Ga0075366_10016780 | Ga0075366_100167802 | 312 |
| 757 | 3300006195 | Ga0075366_10123972 | Ga0075366_101239722 | 312 |
| 758 | 3300006353 | Ga0075370_10014723 | Ga0075370_100147232 | 312 |
| 759 | 3300013308 | Ga0157375_10082218 | Ga0157375_100822182 | 312 |
| 760 | 3300025292 | Ga0209676_1004374 | Ga0209676_10043746 | 312 |
| 761 | 3300025303 | Ga0209051_1009665 | Ga0209051_10096652 | 312 |
| 762 | 3300025907 | Ga0207645_10001729 | Ga0207645_1000172912 | 312 |
| 763 | 3300025925 | Ga0207650_10123616 | Ga0207650_101236162 | 312 |
| 764 | 3300025933 | Ga0207706_10010173 | Ga0207706_100101736 | 312 |
| 765 | 3300025935 | Ga0207709_10023354 | Ga0207709_100233542 | 312 |
| 766 | 3300025940 | Ga0207691_10062505 | Ga0207691_100625054 | 312 |
| 767 | 3300025942 | Ga0207689_10007372 | Ga0207689_100073726 | 312 |
| 768 | 3300025960 | Ga0207651_10027488 | Ga0207651_100274884 | 312 |
| 769 | 3300025961 | Ga0207712_10381751 | Ga0207712_103817512 | 312 |
| 770 | 3300026023 | Ga0207677_10035435 | Ga0207677_100354352 | 312 |
| 771 | 3300026067 | Ga0207678_10002867 | Ga0207678_100028679 | 312 |
| 772 | 3300026089 | Ga0207648_10003584 | Ga0207648_100035844 | 312 |
| 773 | 3300026116 | Ga0207674_10003102 | Ga0207674_1000310218 | 312 |
| 774 | 3300026121 | Ga0207683_10031632 | Ga0207683_100316325 | 312 |
| 775 | 3300026142 | Ga0207698_10003201 | Ga0207698_100032013 | 312 |
| 776 | 3300031456 | Ga0307513_10281371 | Ga0307513_102813712 | 312 |
| 777 | 3300037471 | Ga0395905_0003176 | Ga0395905_0003176_7530_8504 | 312 |
| 778 | 3300042134 | Ga0450898_006256 | Ga0450898_006256_565_1566 | 312 |
| 779 | 3300044693 | Ga0466961_0030141 | Ga0466961_0030141_841_1848 | 312 |
| 780 | 3300044706 | Ga0466964_0002963 | Ga0466964_0002963_3428_4435 | 312 |
| 781 | 3300044719 | Ga0466971_0078343 | Ga0466971_0078343_483_1490 | 312 |
| 782 | 3300045049 | Ga0466959_0016205 | Ga0466959_0016205_975_1982 | 312 |
| 783 | 3300045976 | Ga0466967_0019917 | Ga0466967_0019917_1778_2785 | 312 |
| 784 | 3300050489 | nmdc:mga03683_63977_c1 | nmdc:mga03683_63977_c1_56_1036 | 312 |
| 785 | 3300053153 | Ga0500616_0001154 | Ga0500616_0001154_2731_3696 | 312 |
| 786 | 3300009148 | Ga0105243_10001038 | Ga0105243_100010384 | 313 |
| 787 | 3300009148 | Ga0105243_10047155 | Ga0105243_100471554 | 313 |
| 788 | 3300014745 | Ga0157377_10000083 | Ga0157377_1000008312 | 313 |
| 789 | 3300026089 | Ga0207648_10091747 | Ga0207648_100917472 | 313 |
| 790 | 3300027866 | Ga0209813_10049692 | Ga0209813_100496922 | 313 |
| 791 | 3300044656 | Ga0466969_0017798 | Ga0466969_0017798_843_1868 | 313 |
| 792 | 3300049579 | Ga0501043_0110669 | Ga0501043_0110669_1033_2043 | 313 |
| 793 | 3300049580 | Ga0501046_0001185 | Ga0501046_0001185_24222_25232 | 313 |
| 794 | 3300049581 | Ga0501047_0001232 | Ga0501047_0001232_114_1124 | 313 |
| 795 | 3300049582 | Ga0501048_0006947 | Ga0501048_0006947_89_1099 | 313 |
| 796 | 3300049823 | Ga0501044_0328662 | Ga0501044_0328662_66_1076 | 313 |
| 797 | 3300049824 | Ga0501045_0042015 | Ga0501045_0042015_1141_2151 | 313 |
| 798 | 3300050493 | nmdc:mga0k408_135021_c1 | nmdc:mga0k408_135021_c1_348_1355 | 313 |
| 799 | 3300050494 | nmdc:mga06z11_86570_c1 | nmdc:mga06z11_86570_c1_566_1573 | 313 |
| 800 | 3300050495 | nmdc:mga04h51_25130_c1 | nmdc:mga04h51_25130_c1_321_1328 | 313 |
| 801 | 3300050496 | nmdc:mga07m45_156406_c1 | nmdc:mga07m45_156406_c1_205_1212 | 313 |
| 802 | 3300061719 | Ga0466962_0015334 | Ga0466962_0015334_2632_3657 | 313 |
| 803 | 3300002773 | JGI25152J39213_1006017 | JGI25152J39213_10060173 | 315 |
| 804 | 3300002774 | JGI25150J39212_1005920 | JGI25150J39212_10059202 | 315 |
| 805 | 3300003187 | JGI25151J46595_10026948 | JGI25151J46595_100269482 | 315 |
| 806 | 3300003215 | JGI25153J46596_10022611 | JGI25153J46596_100226112 | 315 |
| 807 | 3300003374 | JGI25161J50226_1002151 | JGI25161J50226_10021513 | 315 |
| 808 | 3300003771 | Ga0055526_1003917 | Ga0055526_10039175 | 315 |
| 809 | 3300003781 | Ga0055536_1001372 | Ga0055536_10013722 | 315 |
| 810 | 3300003784 | Ga0055534_1008056 | Ga0055534_10080562 | 315 |
| 811 | 3300003791 | Ga0055530_10000110 | Ga0055530_1000011044 | 315 |
| 812 | 3300003792 | Ga0055540_1001401 | Ga0055540_10014019 | 315 |
| 813 | 3300003794 | Ga0055531_10001413 | Ga0055531_100014133 | 315 |
| 814 | 3300004625 | Ga0055543_1000644 | Ga0055543_100064415 | 315 |
| 815 | 3300006177 | Ga0075362_10017513 | Ga0075362_100175134 | 315 |
| 816 | 3300006353 | Ga0075370_10026589 | Ga0075370_100265892 | 315 |
| 817 | 3300006353 | Ga0075370_10110263 | Ga0075370_101102633 | 315 |
| 818 | 3300012505 | Ga0157339_1000950 | Ga0157339_10009502 | 315 |
| 819 | 3300025245 | Ga0207425_1002288 | Ga0207425_10022884 | 315 |
| 820 | 3300025258 | Ga0209129_1001670 | Ga0209129_10016704 | 315 |
| 821 | 3300025273 | Ga0209673_1000814 | Ga0209673_10008143 | 315 |
| 822 | 3300025284 | Ga0209130_1000468 | Ga0209130_10004683 | 315 |
| 823 | 3300025291 | Ga0209675_1007050 | Ga0209675_10070502 | 315 |
| 824 | 3300025292 | Ga0209676_1000125 | Ga0209676_100012542 | 315 |
| 825 | 3300025294 | Ga0209025_1016025 | Ga0209025_10160252 | 315 |
| 826 | 3300025295 | Ga0209564_1000833 | Ga0209564_10008333 | 315 |
| 827 | 3300025298 | Ga0209050_1000012 | Ga0209050_1000012742 | 315 |
| 828 | 3300025299 | Ga0209256_1000764 | Ga0209256_10007643 | 315 |
| 829 | 3300025302 | Ga0207426_1000667 | Ga0207426_10006673 | 315 |
| 830 | 3300025303 | Ga0209051_1000332 | Ga0209051_100033242 | 315 |
| 831 | 3300025304 | Ga0209257_1000024 | Ga0209257_1000024688 | 315 |
| 832 | 3300050489 | nmdc:mga03683_15637_c1 | nmdc:mga03683_15637_c1_1840_2814 | 315 |
| 833 | 3300050493 | nmdc:mga0k408_57521_c1 | nmdc:mga0k408_57521_c1_850_1851 | 315 |
| 834 | 3300050496 | nmdc:mga07m45_61132_c1 | nmdc:mga07m45_61132_c1_787_1746 | 315 |
| 835 | 3300005367 | Ga0070667_100232179 | Ga0070667_1002321792 | 317 |
| 836 | 3300005841 | Ga0068863_100019711 | Ga0068863_1000197112 | 317 |
| 837 | 3300009177 | Ga0105248_10024066 | Ga0105248_100240663 | 317 |
| 838 | 3300025986 | Ga0207658_10203124 | Ga0207658_102031242 | 317 |
| 839 | 3300053085 | Ga0495619_0107890 | Ga0495619_0107890_11_1021 | 317 |
| 840 | 3300030735 | Ga0316178_1036717 | Ga0316178_10367172 | 318 |
| 841 | 3300030744 | Ga0316181_1234386 | Ga0316181_12343862 | 318 |
| 842 | 3300031731 | Ga0307405_10007710 | Ga0307405_100077102 | 318 |
| 843 | 3300032002 | Ga0307416_100156290 | Ga0307416_1001562902 | 319 |
| 844 | 3300026078 | Ga0207702_10444242 | Ga0207702_104442421 | 320 |
| 845 | 3300044656 | Ga0466969_0000002 | Ga0466969_0000002_16633_17763 | 320 |
| 846 | 3300002773 | JGI25152J39213_1000235 | JGI25152J39213_100023522 | 321 |
| 847 | 3300002774 | JGI25150J39212_1002798 | JGI25150J39212_10027983 | 321 |
| 848 | 3300002987 | JGI25159J45721_1000103 | JGI25159J45721_100010316 | 321 |
| 849 | 3300003187 | JGI25151J46595_10000696 | JGI25151J46595_1000069622 | 321 |
| 850 | 3300003215 | JGI25153J46596_10000298 | JGI25153J46596_1000029822 | 321 |
| 851 | 3300003354 | JGI25160J50197_1000255 | JGI25160J50197_100025526 | 321 |
| 852 | 3300003374 | JGI25161J50226_1002672 | JGI25161J50226_10026724 | 321 |
| 853 | 3300003771 | Ga0055526_1000357 | Ga0055526_100035716 | 321 |
| 854 | 3300003773 | Ga0055537_1000274 | Ga0055537_100027422 | 321 |
| 855 | 3300003775 | Ga0055524_1000400 | Ga0055524_100040022 | 321 |
| 856 | 3300003784 | Ga0055534_1000255 | Ga0055534_100025522 | 321 |
| 857 | 3300003790 | Ga0055528_1000277 | Ga0055528_100027724 | 321 |
| 858 | 3300003794 | Ga0055531_10003669 | Ga0055531_100036697 | 321 |
| 859 | 3300004625 | Ga0055543_1000262 | Ga0055543_100026226 | 321 |
| 860 | 3300005262 | Ga0065165_1000494 | Ga0065165_100049426 | 321 |
| 861 | 3300005841 | Ga0068863_100196143 | Ga0068863_1001961432 | 321 |
| 862 | 3300005843 | Ga0068860_100376181 | Ga0068860_1003761812 | 321 |
| 863 | 3300006048 | Ga0075363_100025332 | Ga0075363_1000253322 | 321 |
| 864 | 3300014968 | Ga0157379_10055099 | Ga0157379_100550992 | 321 |
| 865 | 3300025208 | Ga0209436_105818 | Ga0209436_1058182 | 321 |
| 866 | 3300025245 | Ga0207425_1000087 | Ga0207425_100008736 | 321 |
| 867 | 3300025258 | Ga0209129_1000007 | Ga0209129_1000007676 | 321 |
| 868 | 3300025263 | Ga0209565_1000038 | Ga0209565_1000038123 | 321 |
| 869 | 3300025273 | Ga0209673_1000080 | Ga0209673_1000080138 | 321 |
| 870 | 3300025284 | Ga0209130_1000137 | Ga0209130_100013737 | 321 |
| 871 | 3300025291 | Ga0209675_1000102 | Ga0209675_100010223 | 321 |
| 872 | 3300025294 | Ga0209025_1000056 | Ga0209025_1000056162 | 321 |
| 873 | 3300025295 | Ga0209564_1000073 | Ga0209564_1000073198 | 321 |
| 874 | 3300025297 | Ga0209758_1000044 | Ga0209758_1000044149 | 321 |
| 875 | 3300025299 | Ga0209256_1000020 | Ga0209256_1000020152 | 321 |
| 876 | 3300025302 | Ga0207426_1000001 | Ga0207426_1000001787 | 321 |
| 877 | 3300025303 | Ga0209051_1032044 | Ga0209051_10320442 | 321 |
| 878 | 3300025304 | Ga0209257_1000222 | Ga0209257_100022288 | 321 |
| 879 | 3300025935 | Ga0207709_10002423 | Ga0207709_100024239 | 321 |
| 880 | 3300026089 | Ga0207648_10000091 | Ga0207648_1000009121 | 321 |
| 881 | 3300028381 | Ga0268264_10311160 | Ga0268264_103111601 | 321 |
| 882 | 3300031911 | Ga0307412_10103102 | Ga0307412_101031022 | 321 |
| 883 | 3300032002 | Ga0307416_100393049 | Ga0307416_1003930491 | 321 |
| 884 | 3300032004 | Ga0307414_10053714 | Ga0307414_100537144 | 321 |
| 885 | 3300032005 | Ga0307411_10241423 | Ga0307411_102414231 | 321 |
| 886 | 3300050490 | nmdc:mga03n38_7431_c1 | nmdc:mga03n38_7431_c1_2591_3688 | 321 |
| 887 | iso_pu_bacteria | 2899924645 | 2899928688 | 324 |
| 888 | iso_pu_bacteria | 2928037797 | 2928043367 | 324 |
| 889 | iso_pu_bacteria | 2928044640 | 2928050809 | 324 |
| 890 | iso_pu_bacteria | 2928051484 | 2928056291 | 324 |
| 891 | iso_pu_bacteria | 2928064002 | 2928066226 | 324 |
| 892 | 3300005331 | Ga0070670_100027541 | Ga0070670_1000275414 | 327 |
| 893 | 3300005334 | Ga0068869_100003103 | Ga0068869_1000031036 | 327 |
| 894 | 3300005456 | Ga0070678_100085493 | Ga0070678_1000854932 | 327 |
| 895 | 3300005457 | Ga0070662_100019349 | Ga0070662_1000193492 | 327 |
| 896 | 3300005459 | Ga0068867_100004082 | Ga0068867_1000040824 | 327 |
| 897 | 3300025933 | Ga0207706_10044187 | Ga0207706_100441872 | 327 |
| 898 | 3300003761 | Ga0055535_1000075 | Ga0055535_100007571 | 328 |
| 899 | 3300003762 | Ga0055542_1000059 | Ga0055542_1000059118 | 328 |
| 900 | 3300013102 | Ga0157371_10102595 | Ga0157371_101025952 | 328 |
| 901 | 3300025228 | Ga0209672_101676 | Ga0209672_1016764 | 328 |
| 902 | 3300025229 | Ga0209147_100323 | Ga0209147_10032322 | 328 |
| 903 | 3300025242 | Ga0209258_100078 | Ga0209258_10007829 | 328 |
| 904 | 3300025254 | Ga0209148_1000086 | Ga0209148_100008629 | 328 |
| 905 | 3300048928 | Ga0496125_0019805 | Ga0496125_0019805_174_1181 | 328 |
| 906 | 3300001979 | JGI24740J21852_10014614 | JGI24740J21852_100146142 | 330 |
| 907 | 3300005539 | Ga0068853_100003221 | Ga0068853_1000032214 | 330 |
| 908 | 3300026041 | Ga0207639_10005201 | Ga0207639_100052012 | 330 |
| 909 | 3300048927 | Ga0496124_0027862 | Ga0496124_0027862_1441_2454 | 330 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vpq-assembly1.cif.gz_A | crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution | 0.8059 | 25 | 309 |
| 1vpq-assembly1.cif.gz_A | crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution | 0.7971 | 25 | 309 |
| 1vpy-assembly1.cif.gz_A | crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution | 0.7601 | 21 | 311 |
| 1vpy-assembly1.cif.gz_A | crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution | 0.7573 | 21 | 311 |
| 1ztv-assembly1.cif.gz_B | crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution | 0.7488 | 26 | 311 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vpqA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.8059 | 25 | 309 | 3.20.20.410 |
| 1vpqA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.7971 | 25 | 309 | 3.20.20.410 |
| 1vpyA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.7586 | 23 | 311 | 3.20.20.410 |
| af_P37348_1_259_3.20.20.410 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.7533 | 26 | 308 | 3.20.20.410 |
| 1vpyA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 | 0.7528 | 23 | 311 | 3.20.20.410 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536VSC8-F1-model_v4 | DUF72 domain-containing protein | 0.9987 | 24 | 141 |
|
| AF-A0A7W5LGV9-F1-model_v4 | Uncharacterized protein YecE (DUF72 family) | 0.9935 | 24 | 168 |
|
| AF-A0A4Y9S332-F1-model_v4 | DUF72 domain-containing protein | 0.9928 | 24 | 309 |
|
| AF-A0A7Y7LQ92-F1-model_v4 | Uncharacterized protein YecE (DUF72 family) | 0.9925 | 24 | 308 |
|
| AF-A0A536VHC3-F1-model_v4 | DUF72 domain-containing protein | 0.9921 | 23 | 316 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar