F485419

General Info

Members Datasets Scaffolds Average Seq Length
909 391 883 319

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0000002|Ga0466969_0000002_16633_17763
Length 376
Sequence MRNISRLQNRNGYAFTPRMASAELRRRNGGTGATRVPIWHAGCPGVRKMKRGDIRIGISGWRYEPWRGVFYPEGLAQRRELEYASRMFPTIELNGSFYSLQKPEFFAEWHDETPEDFVFAVKGPKYITHVRRLKEVRTPLANFLASGLFELKAKLGPILWQFPPMLPFKPERFEAFFEMLPRDLEAAAAIAAEHDQRVEGRCTLTIDANRPLRHAVEIRHPSFADGAFVAMLRKHKIALVVADTAGKWPLLEDLTADFVYLRLHGDKELYASGYSDAALDRWAARIATWSEGGQVDDARLATHKAAPRRSRRDVYCYFDNDVKVHAPYDAASLGRKLGLDSPLGPKGRPSWPPGFEVPQPRVRAPGFERRRGATPR

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
5 2643221585 Pelomonas sp. Root662 Isolate Unclassified
6 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
7 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
8 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
9 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
10 2643221656 Pelomonas sp. Root405 Isolate Unclassified
11 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
12 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
13 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
14 2842677519 Variovorax sp. R-72495 Isolate Unclassified
15 2842733646 Variovorax sp. R-72446 Isolate Unclassified
16 2899924645 Variovorax sp. 369 Isolate Unclassified
17 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
18 2904456579 Variovorax sp. 2002 Isolate Unclassified
19 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
20 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
21 2928037797 Variovorax sp. 1126 Isolate Unclassified
22 2928044640 Variovorax sp. 1128 Isolate Unclassified
23 2928051484 Variovorax sp. 1133 Isolate Unclassified
24 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
25 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
26 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
27 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
28 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
29 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
30 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
31 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
32 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
37 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
38 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
39 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
40 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
41 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
42 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
43 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
44 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
45 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
46 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
47 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
50 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
51 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
55 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
56 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
59 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
60 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
61 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
62 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
66 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
69 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
70 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
71 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
72 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
73 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
74 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
78 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
79 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
80 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
81 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
82 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
83 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
84 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
85 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
86 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
87 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
88 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
89 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
90 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
91 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
92 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
93 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
94 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
95 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
96 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
97 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
98 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
103 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
104 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
105 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
106 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
107 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
108 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
109 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
110 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
111 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
112 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
113 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
114 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
115 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
116 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
117 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
118 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
119 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
120 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
121 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
122 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
123 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
125 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
126 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
127 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
128 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
129 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
130 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
135 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
136 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
137 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
149 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
150 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
160 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
161 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
162 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
163 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
167 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
170 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
174 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
176 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
184 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
187 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
248 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
249 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
250 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
251 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
255 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
256 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
257 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
258 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
259 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
260 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
261 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
262 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
263 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
264 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
265 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
266 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
267 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
268 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
269 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
270 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
271 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
272 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
273 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
274 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
275 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
276 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
277 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
278 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
279 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
280 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
281 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
282 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
283 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
285 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
286 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
287 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
288 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
289 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
290 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
291 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
292 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
293 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
294 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
295 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
296 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
297 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
298 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
299 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
300 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
301 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
302 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
303 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
304 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
305 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
306 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
307 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
308 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
309 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
310 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
311 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
312 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
313 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
314 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
315 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
316 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
317 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
318 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
319 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
320 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
321 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
322 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
323 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
324 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
325 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
326 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
327 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
328 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
329 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
330 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
331 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
332 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
333 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
334 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
335 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
336 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
339 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
345 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
346 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
347 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
348 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
349 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
350 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
351 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
359 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
360 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
361 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
362 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
363 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
364 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
365 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
366 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
367 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
368 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
371 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
372 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
373 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
374 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
375 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
376 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
377 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
378 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
384 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
385 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
386 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
387 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
388 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
389 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
390 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
391 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0.11
Isolates 2.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.42
Nodule 0.55
Rhizoplane 2.2
Rhizosphere 78.44
Stem 0
Stem Tuber 0
Unclassified 5.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10014614 3300001979 Bacteria 2889
2 JGI25152J39213_1000235 3300002773 Bacteria 37077
3 JGI25152J39213_1006017 3300002773 Bacteria 3396
4 JGI25152J39213_1006552 3300002773 Bacteria 3145
5 JGI25150J39212_1002798 3300002774 Bacteria 4233
6 JGI25150J39212_1005920 3300002774 Bacteria 2571
7 JGI25159J45721_1000103 3300002987 Bacteria 40372
8 JGI25151J46595_10000696 3300003187 Bacteria 28239
9 JGI25151J46595_10007041 3300003187 Bacteria 5562
10 JGI25151J46595_10026948 3300003187 Bacteria 2311
11 JGI25153J46596_10000298 3300003215 Bacteria 37077
12 JGI25153J46596_10022611 3300003215 Bacteria 2311
13 rootH1_10034705 3300003316 Bacteria 8660
14 rootH1_10034705 3300003323 Bacteria 1881
15 rootH2_10100170 3300003320 Bacteria 1298
16 rootH1_10019948 3300003323 Bacteria 6154
17 rootH1_10134544 3300003323 Bacteria 4027
18 rootH1_10168926 3300003323 Bacteria 2072
19 JGI25160J50197_1000255 3300003354 Bacteria 40372
20 JGI25161J50226_1002151 3300003374 Bacteria 5286
21 JGI25161J50226_1002672 3300003374 Bacteria 4438
22 Ga0006562J51391_1136022 3300003578 Bacteria 1790
23 Ga0055535_1000075 3300003761 Bacteria 111667
24 Ga0055542_1000059 3300003762 Bacteria 162670
25 Ga0055526_1000357 3300003771 Bacteria 37077
26 Ga0055526_1003917 3300003771 Bacteria 9189
27 Ga0055526_1006587 3300003771 Bacteria 6262
28 Ga0055537_1000274 3300003773 Bacteria 37077
29 Ga0055537_1000544 3300003773 Bacteria 21755
30 Ga0055524_1000400 3300003775 Bacteria 37077
31 Ga0055536_1001372 3300003781 Bacteria 14798
32 Ga0055534_1000255 3300003784 Bacteria 37077
33 Ga0055534_1000494 3300003784 Bacteria 21755
34 Ga0055534_1008056 3300003784 Bacteria 2430
35 Ga0055528_1000277 3300003790 Bacteria 43644
36 Ga0055528_1002350 3300003790 Bacteria 10234
37 Ga0055530_10000110 3300003791 Bacteria 71015
38 Ga0055540_1001401 3300003792 Bacteria 14381
39 Ga0055531_10001242 3300003794 Bacteria 19363
40 Ga0055531_10001413 3300003794 Bacteria 17732
41 Ga0055531_10003669 3300003794 Bacteria 9674
42 Ga0055543_1000262 3300004625 Bacteria 39412
43 Ga0055543_1000644 3300004625 Bacteria 18672
44 Ga0065165_1000494 3300005262 Bacteria 60929
45 Ga0065714_10071324 3300005288 Bacteria 3602
46 Ga0065707_10089760 3300005295 Bacteria 4287
47 Ga0070676_10000256 3300005328 Bacteria 23138
48 Ga0070676_10023646 3300005328 Bacteria 3455
49 Ga0070683_100131351 3300005329 Bacteria 2370
50 Ga0070670_100000274 3300005331 Bacteria 45804
51 Ga0070670_100002086 3300005331 Bacteria 16383
52 Ga0070670_100004507 3300005331 Bacteria 11675
53 Ga0070670_100027541 3300005331 Bacteria 4888
54 Ga0070670_100055280 3300005331 Bacteria 3407
55 Ga0070670_100142038 3300005331 Bacteria 2076
56 Ga0070670_100176784 3300005331 Bacteria 1852
57 Ga0070670_100201633 3300005331 Bacteria 1729
58 Ga0070677_10000666 3300005333 Bacteria 11477
59 Ga0070677_10018435 3300005333 Bacteria 2513
60 Ga0068869_100000242 3300005334 Bacteria 28762
61 Ga0068869_100003103 3300005334 Bacteria 10132
62 Ga0068869_100004100 3300005334 Bacteria 9026
63 Ga0068869_100005398 3300005334 Bacteria 8035
64 Ga0068869_100015284 3300005334 Bacteria 5145
65 Ga0068869_100030693 3300005334 Bacteria 3776
66 Ga0070666_10000632 3300005335 Bacteria 21185
67 Ga0070666_10001227 3300005335 Bacteria 15482
68 Ga0070666_10019284 3300005335 Bacteria 4400
69 Ga0070666_10035838 3300005335 Bacteria 3290
70 Ga0070680_100000172 3300005336 Bacteria 41297
71 Ga0070680_100062213 3300005336 Bacteria 3056
72 Ga0070682_100002377 3300005337 Bacteria 10428
73 Ga0068868_100000197 3300005338 Bacteria 40300
74 Ga0068868_100027785 3300005338 Bacteria 4319
75 Ga0068868_100049743 3300005338 Bacteria 3290
76 Ga0068868_100170719 3300005338 Bacteria 1800
77 Ga0068868_100218157 3300005338 Bacteria 1596
78 Ga0070660_100001451 3300005339 Bacteria 16205
79 Ga0070660_100018945 3300005339 Bacteria 5038
80 Ga0070660_100132602 3300005339 Bacteria 1995
81 Ga0070689_100089389 3300005340 Bacteria 2426
82 Ga0070689_100089976 3300005340 Bacteria 2418
83 Ga0070689_100153538 3300005340 Bacteria 1858
84 Ga0070689_100208444 3300005340 Bacteria 1599
85 Ga0070687_100004159 3300005343 Bacteria 5730
86 Ga0070687_100020042 3300005343 Bacteria 3121
87 Ga0070687_100055963 3300005343 Bacteria 2062
88 Ga0070661_100001049 3300005344 Bacteria 19550
89 Ga0070661_100007506 3300005344 Bacteria 7524
90 Ga0070692_10000564 3300005345 Bacteria 11606
91 Ga0070692_10009685 3300005345 Bacteria 4357
92 Ga0070668_100003835 3300005347 Bacteria 11106
93 Ga0070668_100006076 3300005347 Bacteria 8954
94 Ga0070668_100013298 3300005347 Bacteria 6142
95 Ga0070668_100014299 3300005347 Bacteria 5931
96 Ga0070669_100001974 3300005353 Bacteria 14822
97 Ga0070669_100074254 3300005353 Bacteria 2521
98 Ga0070669_100155009 3300005353 Bacteria 1776
99 Ga0070675_100000297 3300005354 Bacteria 33289
100 Ga0070675_100005416 3300005354 Bacteria 9760
101 Ga0070675_100012809 3300005354 Bacteria 6580
102 Ga0070675_100029594 3300005354 Bacteria 4418
103 Ga0070675_100065833 3300005354 Bacteria 2996
104 Ga0070675_100076015 3300005354 Bacteria 2792
105 Ga0070671_100000622 3300005355 Bacteria 25307
106 Ga0070671_100001843 3300005355 Bacteria 16144
107 Ga0070671_100033348 3300005355 Bacteria 4257
108 Ga0070671_100259234 3300005355 Bacteria 1477
109 Ga0070674_100000657 3300005356 Bacteria 17460
110 Ga0070674_100000722 3300005356 Bacteria 16867
111 Ga0070674_100119556 3300005356 Bacteria 1949
112 Ga0070673_100000892 3300005364 Bacteria 16840
113 Ga0070673_100002101 3300005364 Bacteria 12033
114 Ga0070673_100066019 3300005364 Bacteria 2889
115 Ga0070673_100130092 3300005364 Bacteria 2111
116 Ga0070673_100220008 3300005364 Bacteria 1643
117 Ga0070673_100501594 3300005364 Bacteria 1098
118 Ga0070659_100000892 3300005366 Bacteria 21835
119 Ga0070659_100003263 3300005366 Bacteria 11544
120 Ga0070659_100021770 3300005366 Bacteria 4887
121 Ga0070659_100128061 3300005366 Bacteria 2060
122 Ga0070659_100327527 3300005366 Bacteria 1281
123 Ga0070667_100006184 3300005367 Bacteria 9957
124 Ga0070667_100007725 3300005367 Bacteria 8913
125 Ga0070667_100008672 3300005367 Bacteria 8424
126 Ga0070667_100066934 3300005367 Bacteria 3053
127 Ga0070667_100232179 3300005367 Bacteria 1645
128 Ga0070703_10025469 3300005406 Bacteria 1755
129 Ga0070713_100001451 3300005436 Bacteria 15131
130 Ga0070710_10193709 3300005437 Bacteria 1280
131 Ga0070701_10013999 3300005438 Bacteria 3666
132 Ga0070711_100372519 3300005439 Bacteria 1153
133 Ga0070705_100000829 3300005440 Bacteria 17358
134 Ga0070700_100204597 3300005441 Bacteria 1389
135 Ga0070694_100001268 3300005444 Bacteria 14675
136 Ga0070708_100400638 3300005445 Bacteria 1294
137 Ga0070663_100001081 3300005455 Bacteria 14917
138 Ga0070663_100002216 3300005455 Bacteria 10875
139 Ga0070663_100066689 3300005455 Bacteria 2608
140 Ga0070663_100080571 3300005455 Bacteria 2391
141 Ga0070663_100113931 3300005455 Bacteria 2035
142 Ga0070663_100293807 3300005455 Bacteria 1298
143 Ga0070678_100010378 3300005456 Bacteria 5685
144 Ga0070678_100036279 3300005456 Bacteria 3449
145 Ga0070678_100085005 3300005456 Bacteria 2410
146 Ga0070678_100085493 3300005456 Bacteria 2404
147 Ga0070662_100008473 3300005457 Bacteria 6707
148 Ga0070662_100015351 3300005457 Bacteria 5128
149 Ga0070662_100019349 3300005457 Bacteria 4622
150 Ga0070662_100019586 3300005457 Bacteria 4595
151 Ga0070662_100094189 3300005457 Bacteria 2254
152 Ga0070662_100210587 3300005457 Bacteria 1547
153 Ga0070662_100388668 3300005457 Bacteria 1149
154 Ga0070681_10013452 3300005458 Bacteria 8130
155 Ga0070681_10216502 3300005458 Bacteria 1831
156 Ga0068867_100000047 3300005459 Bacteria 74014
157 Ga0068867_100000424 3300005459 Bacteria 28257
158 Ga0068867_100002201 3300005459 Bacteria 13676
159 Ga0068867_100004082 3300005459 Bacteria 10270
160 Ga0068867_100007097 3300005459 Bacteria 7917
161 Ga0068867_100032027 3300005459 Bacteria 3799
162 Ga0070679_100000185 3300005530 Bacteria 50363
163 Ga0070679_100006933 3300005530 Bacteria 10571
164 Ga0070684_100015224 3300005535 Bacteria 6256
165 Ga0070684_100103958 3300005535 Bacteria 2541
166 Ga0070684_100210820 3300005535 Bacteria 1771
167 Ga0068853_100003221 3300005539 Bacteria 12479
168 Ga0068853_100022179 3300005539 Bacteria 5300
169 Ga0068853_100045573 3300005539 Bacteria 3756
170 Ga0068853_100108970 3300005539 Bacteria 2458
171 Ga0070672_100003390 3300005543 Bacteria 10330
172 Ga0070672_100003947 3300005543 Bacteria 9669
173 Ga0070672_100013936 3300005543 Bacteria 5688
174 Ga0070672_100072430 3300005543 Bacteria 2743
175 Ga0070672_100079787 3300005543 Bacteria 2621
176 Ga0070672_100099402 3300005543 Bacteria 2358
177 Ga0070672_100217772 3300005543 Bacteria 1601
178 Ga0070672_100437728 3300005543 Bacteria 1125
179 Ga0070686_100037582 3300005544 Bacteria 3004
180 Ga0070695_100003882 3300005545 Bacteria 8720
181 Ga0070696_100002658 3300005546 Bacteria 11843
182 Ga0070696_100148649 3300005546 Bacteria 1718
183 Ga0070693_100000248 3300005547 Bacteria 25117
184 Ga0070665_100097987 3300005548 Bacteria 2937
185 Ga0070665_100137179 3300005548 Bacteria 2449
186 Ga0070665_100262352 3300005548 Bacteria 1729
187 Ga0070704_100002912 3300005549 Bacteria 9719
188 Ga0070704_100114219 3300005549 Bacteria 2061
189 Ga0068855_100000437 3300005563 Bacteria 51661
190 Ga0068855_100008322 3300005563 Bacteria 12538
191 Ga0068855_100016992 3300005563 Bacteria 8751
192 Ga0068855_100044952 3300005563 Bacteria 5225
193 Ga0068855_100097495 3300005563 Bacteria 3386
194 Ga0070664_100002952 3300005564 Bacteria 13754
195 Ga0070664_100004721 3300005564 Bacteria 10929
196 Ga0070664_100022450 3300005564 Bacteria 5202
197 Ga0070664_100100237 3300005564 Bacteria 2518
198 Ga0070664_100102425 3300005564 Bacteria 2491
199 Ga0070664_100195180 3300005564 Bacteria 1804
200 Ga0070664_100196618 3300005564 Bacteria 1797
201 Ga0068857_100003534 3300005577 Bacteria 13063
202 Ga0068857_100017776 3300005577 Bacteria 6233
203 Ga0068857_100059742 3300005577 Bacteria 3387
204 Ga0068854_100002679 3300005578 Bacteria 11036
205 Ga0068854_100003177 3300005578 Bacteria 10252
206 Ga0068854_100004830 3300005578 Bacteria 8502
207 Ga0068854_100023555 3300005578 Bacteria 4207
208 Ga0068856_100000464 3300005614 Bacteria 44730
209 Ga0068856_100121603 3300005614 Bacteria 2612
210 Ga0068856_100333968 3300005614 Bacteria 1533
211 Ga0070702_100069858 3300005615 Bacteria 2071
212 Ga0070702_100071124 3300005615 Bacteria 2056
213 Ga0070702_100078656 3300005615 Bacteria 1969
214 Ga0068852_100000895 3300005616 Bacteria 19700
215 Ga0068852_100007034 3300005616 Bacteria 8193
216 Ga0068852_100015220 3300005616 Bacteria 5956
217 Ga0068852_100031572 3300005616 Bacteria 4373
218 Ga0068852_100062542 3300005616 Bacteria 3238
219 Ga0068852_100062905 3300005616 Bacteria 3229
220 Ga0068852_100085617 3300005616 Bacteria 2808
221 Ga0068852_100104118 3300005616 Bacteria 2568
222 Ga0068852_100178897 3300005616 Bacteria 1993
223 Ga0068852_100230640 3300005616 Bacteria 1765
224 Ga0068859_100002792 3300005617 Bacteria 17696
225 Ga0068859_100007895 3300005617 Bacteria 10798
226 Ga0068859_100281934 3300005617 Bacteria 1754
227 Ga0068859_100658147 3300005617 Bacteria 1139
228 Ga0068864_100001333 3300005618 Bacteria 20559
229 Ga0068864_100006397 3300005618 Bacteria 9652
230 Ga0068864_100008382 3300005618 Bacteria 8528
231 Ga0068864_100182348 3300005618 Bacteria 1920
232 Ga0068864_100226386 3300005618 Bacteria 1727
233 Ga0068866_10002303 3300005718 Bacteria 7907
234 Ga0068866_10090767 3300005718 Bacteria 1663
235 Ga0068861_100001445 3300005719 Bacteria 15020
236 Ga0068861_100004435 3300005719 Bacteria 9417
237 Ga0068861_100010099 3300005719 Bacteria 6546
238 Ga0068861_100120248 3300005719 Bacteria 2118
239 Ga0068861_100281759 3300005719 Bacteria 1432
240 Ga0068851_10008604 3300005834 Bacteria 4721
241 Ga0068851_10027727 3300005834 Bacteria 2793
242 Ga0068851_10049347 3300005834 Bacteria 2134
243 Ga0068851_10171750 3300005834 Bacteria 1197
244 Ga0068870_10000256 3300005840 Bacteria 19580
245 Ga0068870_10055487 3300005840 Bacteria 2111
246 Ga0068863_100000793 3300005841 Bacteria 31764
247 Ga0068863_100019711 3300005841 Bacteria 6451
248 Ga0068863_100050562 3300005841 Bacteria 3940
249 Ga0068863_100077811 3300005841 Bacteria 3139
250 Ga0068863_100105074 3300005841 Bacteria 2686
251 Ga0068863_100196143 3300005841 Bacteria 1941
252 Ga0068863_100208949 3300005841 Bacteria 1879
253 Ga0068863_100291272 3300005841 Bacteria 1582
254 Ga0068863_100583086 3300005841 Bacteria 1106
255 Ga0068858_100000345 3300005842 Bacteria 49147
256 Ga0068858_100007270 3300005842 Bacteria 10730
257 Ga0068858_100011883 3300005842 Bacteria 8205
258 Ga0068858_100026341 3300005842 Bacteria 5405
259 Ga0068858_100262837 3300005842 Bacteria 1641
260 Ga0068860_100000216 3300005843 Bacteria 90423
261 Ga0068860_100001723 3300005843 Bacteria 23333
262 Ga0068860_100009885 3300005843 Bacteria 9458
263 Ga0068860_100030858 3300005843 Bacteria 5153
264 Ga0068860_100376181 3300005843 Bacteria 1401
265 Ga0068862_100008744 3300005844 Bacteria 8383
266 Ga0068862_100334171 3300005844 Bacteria 1402
267 Ga0081539_10068401 3300005985 Bacteria 1916
268 Ga0075363_100025332 3300006048 Bacteria 3024
269 Ga0075363_100028759 3300006048 Bacteria 2862
270 Ga0070716_100068725 3300006173 Bacteria 2073
271 Ga0075362_10005526 3300006177 Bacteria 4634
272 Ga0075362_10006134 3300006177 Bacteria 4456
273 Ga0075362_10017513 3300006177 Bacteria 2952
274 Ga0075362_10117549 3300006177 Bacteria 1256
275 Ga0075366_10016780 3300006195 Bacteria 4209
276 Ga0075366_10064581 3300006195 Bacteria 2177
277 Ga0075366_10076142 3300006195 Bacteria 2002
278 Ga0075366_10123972 3300006195 Bacteria 1558
279 Ga0097621_100091399 3300006237 Bacteria 2548
280 Ga0097621_100324333 3300006237 Bacteria 1365
281 Ga0075370_10001936 3300006353 Bacteria 9342
282 Ga0075370_10003801 3300006353 Bacteria 7228
283 Ga0075370_10014723 3300006353 Bacteria 4176
284 Ga0075370_10026589 3300006353 Bacteria 3206
285 Ga0075370_10077658 3300006353 Bacteria 1905
286 Ga0075370_10110263 3300006353 Bacteria 1598
287 Ga0068871_100001908 3300006358 Bacteria 14090
288 Ga0068871_100138408 3300006358 Bacteria 2069
289 Ga0068871_100159579 3300006358 Bacteria 1928
290 Ga0068871_100159987 3300006358 Bacteria 1925
291 Ga0075428_100470065 3300006844 Bacteria 1346
292 Ga0075430_100035882 3300006846 Bacteria 4205
293 Ga0075433_10015747 3300006852 Bacteria 6213
294 Ga0075433_10075983 3300006852 Bacteria 2957
295 Ga0075434_100000018 3300006871 Bacteria 73715
296 Ga0075434_100116972 3300006871 Bacteria 2679
297 Ga0075429_100019226 3300006880 Bacteria 5917
298 Ga0075429_100416201 3300006880 Bacteria 1177
299 Ga0068865_100042684 3300006881 Bacteria 3094
300 Ga0068865_100047597 3300006881 Bacteria 2947
301 Ga0075436_100015029 3300006914 Bacteria 5305
302 Ga0097620_100002792 3300006931 Bacteria 17696
303 Ga0097620_100007895 3300006931 Bacteria 10798
304 Ga0097620_100106515 3300006931 Bacteria 2863
305 Ga0097620_100281920 3300006931 Bacteria 1754
306 Ga0097620_100658223 3300006931 Bacteria 1139
307 Ga0079104_1005275 3300006946 Bacteria 5207
308 Ga0099826_10000408 3300006948 Bacteria 20307
309 Ga0075435_100000675 3300007076 Bacteria 21138
310 Ga0075435_100013522 3300007076 Bacteria 6074
311 Ga0105250_10000005 3300009092 Bacteria 422580
312 Ga0105240_10039918 3300009093 Bacteria 6008
313 Ga0105240_10182607 3300009093 Bacteria 2474
314 Ga0105240_10251318 3300009093 Bacteria 2044
315 Ga0111539_10010277 3300009094 Bacteria 11782
316 Ga0111539_10010327 3300009094 Bacteria 11756
317 Ga0105245_10030772 3300009098 Bacteria 4747
318 Ga0105245_10254344 3300009098 Bacteria 1708
319 Ga0105245_10639080 3300009098 Bacteria 1094
320 Ga0105247_10012713 3300009101 Bacteria 5052
321 Ga0105243_10001038 3300009148 Bacteria 25466
322 Ga0105243_10004148 3300009148 Bacteria 11507
323 Ga0105243_10007628 3300009148 Bacteria 8316
324 Ga0105243_10047155 3300009148 Bacteria 3391
325 Ga0105242_10020867 3300009176 Bacteria 5139
326 Ga0105242_10076846 3300009176 Bacteria 2785
327 Ga0105248_10001546 3300009177 Bacteria 25613
328 Ga0105248_10024066 3300009177 Bacteria 6768
329 Ga0105248_10066735 3300009177 Bacteria 4039
330 Ga0105237_10006409 3300009545 Bacteria 13059
331 Ga0105237_10035501 3300009545 Bacteria 5045
332 Ga0105238_10001243 3300009551 Bacteria 25672
333 Ga0105238_10052924 3300009551 Bacteria 4081
334 Ga0105238_10510656 3300009551 Bacteria 1204
335 Ga0105249_10006350 3300009553 Bacteria 10275
336 Ga0105239_10142391 3300010375 Bacteria 2673
337 Ga0105246_10011961 3300011119 Bacteria 5402
338 Ga0105246_10056982 3300011119 Bacteria 2703
339 Ga0105246_10091230 3300011119 Bacteria 2195
340 Ga0105246_10248460 3300011119 Bacteria 1410
341 Ga0157339_1000950 3300012505 Bacteria 1636
342 Ga0157373_10000439 3300013100 Bacteria 33045
343 Ga0157373_10018978 3300013100 Bacteria 5005
344 Ga0157371_10102595 3300013102 Bacteria 2029
345 Ga0157370_10053337 3300013104 Bacteria 3856
346 Ga0157369_10007249 3300013105 Bacteria 12763
347 Ga0157369_10026826 3300013105 Bacteria 6387
348 Ga0157374_10035714 3300013296 Bacteria 4548
349 Ga0157374_10060197 3300013296 Bacteria 3553
350 Ga0157374_10165877 3300013296 Bacteria 2152
351 Ga0157374_10204518 3300013296 Bacteria 1934
352 Ga0157378_10035469 3300013297 Bacteria 4412
353 Ga0157378_10136919 3300013297 Bacteria 2271
354 Ga0163162_10004873 3300013306 Bacteria 12950
355 Ga0163162_10060281 3300013306 Bacteria 3830
356 Ga0163162_10063167 3300013306 Bacteria 3744
357 Ga0163162_10070135 3300013306 Bacteria 3556
358 Ga0157372_10000313 3300013307 Bacteria 53548
359 Ga0157372_10013839 3300013307 Bacteria 8615
360 Ga0157372_10013841 3300013307 Bacteria 8615
361 Ga0157372_10496813 3300013307 Bacteria 1423
362 Ga0157375_10002130 3300013308 Bacteria 17095
363 Ga0157375_10002932 3300013308 Bacteria 14804
364 Ga0157375_10016898 3300013308 Bacteria 6572
365 Ga0157375_10068128 3300013308 Bacteria 3559
366 Ga0157375_10071599 3300013308 Bacteria 3481
367 Ga0157375_10082218 3300013308 Bacteria 3262
368 Ga0157375_10354687 3300013308 Bacteria 1633
369 Ga0163163_10002386 3300014325 Bacteria 15903
370 Ga0163163_10085003 3300014325 Bacteria 3172
371 Ga0163163_10677048 3300014325 Bacteria 1095
372 Ga0157380_10002054 3300014326 Bacteria 13470
373 Ga0157380_10062669 3300014326 Bacteria 2980
374 Ga0182008_10051560 3300014497 Bacteria 2040
375 Ga0182008_10052135 3300014497 Bacteria 2029
376 Ga0182008_10124202 3300014497 Bacteria 1284
377 Ga0157377_10000083 3300014745 Bacteria 73632
378 Ga0157377_10000246 3300014745 Bacteria 26794
379 Ga0157379_10000443 3300014968 Bacteria 33618
380 Ga0157379_10000977 3300014968 Bacteria 23193
381 Ga0157379_10003793 3300014968 Bacteria 12872
382 Ga0157379_10055099 3300014968 Bacteria 3553
383 Ga0157379_10157266 3300014968 Bacteria 2051
384 Ga0157379_10184432 3300014968 Bacteria 1885
385 Ga0157376_10108867 3300014969 Bacteria 2435
386 Ga0157376_10273812 3300014969 Bacteria 1587
387 Ga0157376_10319378 3300014969 Bacteria 1476
388 Ga0182006_1010807 3300015261 Bacteria 4044
389 Ga0183362_10001 3300015683 Bacteria 2046624
390 Ga0163161_10027428 3300017792 Bacteria 4040
391 Ga0163161_10035454 3300017792 Bacteria 3571
392 Ga0209436_105818 3300025208 Bacteria 2778
393 Ga0209672_101676 3300025228 Bacteria 7181
394 Ga0209147_100323 3300025229 Bacteria 36564
395 Ga0209258_100078 3300025242 Bacteria 263996
396 Ga0207425_1000087 3300025245 Bacteria 93219
397 Ga0207425_1000254 3300025245 Bacteria 40131
398 Ga0207425_1002288 3300025245 Bacteria 6888
399 Ga0209148_1000086 3300025254 Bacteria 263996
400 Ga0209129_1000007 3300025258 Bacteria 771325
401 Ga0209129_1000035 3300025258 Bacteria 329303
402 Ga0209129_1001670 3300025258 Bacteria 12015
403 Ga0209565_1000038 3300025263 Bacteria 286433
404 Ga0209565_1000138 3300025263 Bacteria 101729
405 Ga0209673_1000064 3300025273 Bacteria 254712
406 Ga0209673_1000080 3300025273 Bacteria 223503
407 Ga0209673_1000814 3300025273 Bacteria 41220
408 Ga0209673_1003257 3300025273 Bacteria 9794
409 Ga0209130_1000137 3300025284 Bacteria 116784
410 Ga0209130_1000468 3300025284 Bacteria 41796
411 Ga0209675_1000036 3300025291 Bacteria 254712
412 Ga0209675_1000102 3300025291 Bacteria 123742
413 Ga0209675_1007050 3300025291 Bacteria 4382
414 Ga0209676_1000125 3300025292 Bacteria 191565
415 Ga0209676_1004374 3300025292 Bacteria 7904
416 Ga0209676_1013635 3300025292 Bacteria 3112
417 Ga0209676_1048528 3300025292 Bacteria 1133
418 Ga0209025_1000056 3300025294 Bacteria 316188
419 Ga0209025_1000938 3300025294 Bacteria 44376
420 Ga0209025_1016025 3300025294 Bacteria 4461
421 Ga0209564_1000024 3300025295 Bacteria 535041
422 Ga0209564_1000073 3300025295 Bacteria 288080
423 Ga0209564_1000833 3300025295 Bacteria 41796
424 Ga0209758_1000044 3300025297 Bacteria 398448
425 Ga0209758_1000066 3300025297 Bacteria 298620
426 Ga0209050_1000012 3300025298 Bacteria 813717
427 Ga0209256_1000020 3300025299 Bacteria 542402
428 Ga0209256_1000764 3300025299 Bacteria 41796
429 Ga0207426_1000001 3300025302 Bacteria 1341301
430 Ga0207426_1000667 3300025302 Bacteria 41796
431 Ga0209051_1000113 3300025303 Bacteria 152417
432 Ga0209051_1000332 3300025303 Bacteria 71041
433 Ga0209051_1000367 3300025303 Bacteria 65677
434 Ga0209051_1002717 3300025303 Bacteria 12300
435 Ga0209051_1009665 3300025303 Bacteria 4949
436 Ga0209051_1032044 3300025303 Bacteria 2011
437 Ga0209257_1000012 3300025304 Bacteria 1111138
438 Ga0209257_1000024 3300025304 Bacteria 726068
439 Ga0209257_1000222 3300025304 Bacteria 134717
440 Ga0209257_1036695 3300025304 Bacteria 1503
441 Ga0207697_10059264 3300025315 Bacteria 1591
442 Ga0207656_10023745 3300025321 Bacteria 2472
443 Ga0207696_1000470 3300025711 Bacteria 34731
444 Ga0207653_10000897 3300025885 Bacteria 9881
445 Ga0207682_10000418 3300025893 Bacteria 19541
446 Ga0207682_10001443 3300025893 Bacteria 10971
447 Ga0207682_10003883 3300025893 Bacteria 6388
448 Ga0207682_10047377 3300025893 Bacteria 1770
449 Ga0207682_10070862 3300025893 Bacteria 1477
450 Ga0207692_10072501 3300025898 Bacteria 1819
451 Ga0207642_10024852 3300025899 Bacteria 2414
452 Ga0207688_10017055 3300025901 Bacteria 3946
453 Ga0207688_10039840 3300025901 Bacteria 2610
454 Ga0207688_10127630 3300025901 Bacteria 1489
455 Ga0207680_10020860 3300025903 Bacteria 3537
456 Ga0207680_10063998 3300025903 Bacteria 2253
457 Ga0207680_10066044 3300025903 Bacteria 2223
458 Ga0207680_10077324 3300025903 Bacteria 2081
459 Ga0207680_10110635 3300025903 Bacteria 1781
460 Ga0207645_10000113 3300025907 Bacteria 60937
461 Ga0207645_10000301 3300025907 Bacteria 41468
462 Ga0207645_10001729 3300025907 Bacteria 17698
463 Ga0207645_10004200 3300025907 Bacteria 10699
464 Ga0207645_10026198 3300025907 Bacteria 3769
465 Ga0207645_10263222 3300025907 Bacteria 1143
466 Ga0207643_10000164 3300025908 Bacteria 45857
467 Ga0207643_10002187 3300025908 Bacteria 10667
468 Ga0207643_10167634 3300025908 Bacteria 1324
469 Ga0207705_10060723 3300025909 Bacteria 2731
470 Ga0207707_10000305 3300025912 Bacteria 51662
471 Ga0207707_10225792 3300025912 Bacteria 1630
472 Ga0207695_10029741 3300025913 Bacteria 6028
473 Ga0207671_10024778 3300025914 Bacteria 4508
474 Ga0207660_10000085 3300025917 Bacteria 49898
475 Ga0207660_10017667 3300025917 Bacteria 4743
476 Ga0207662_10007091 3300025918 Bacteria 6086
477 Ga0207662_10023326 3300025918 Bacteria 3555
478 Ga0207662_10075942 3300025918 Bacteria 2042
479 Ga0207657_10000236 3300025919 Bacteria 58234
480 Ga0207657_10008943 3300025919 Bacteria 10121
481 Ga0207657_10039155 3300025919 Bacteria 4214
482 Ga0207657_10050479 3300025919 Bacteria 3621
483 Ga0207657_10151052 3300025919 Bacteria 1892
484 Ga0207649_10007149 3300025920 Bacteria 6067
485 Ga0207649_10008827 3300025920 Bacteria 5503
486 Ga0207652_10000572 3300025921 Bacteria 37038
487 Ga0207652_10063689 3300025921 Bacteria 3189
488 Ga0207652_10271781 3300025921 Bacteria 1529
489 Ga0207681_10000162 3300025923 Bacteria 55291
490 Ga0207681_10360780 3300025923 Bacteria 1165
491 Ga0207694_10051255 3300025924 Bacteria 3199
492 Ga0207694_10055328 3300025924 Bacteria 3080
493 Ga0207694_10126313 3300025924 Bacteria 2046
494 Ga0207694_10400970 3300025924 Bacteria 1140
495 Ga0207650_10004962 3300025925 Bacteria 9095
496 Ga0207650_10005657 3300025925 Bacteria 8537
497 Ga0207650_10012639 3300025925 Bacteria 5826
498 Ga0207650_10094336 3300025925 Bacteria 2292
499 Ga0207650_10123616 3300025925 Bacteria 2017
500 Ga0207650_10169565 3300025925 Bacteria 1734
501 Ga0207659_10005626 3300025926 Bacteria 7618
502 Ga0207659_10012076 3300025926 Bacteria 5476
503 Ga0207659_10014964 3300025926 Bacteria 5016
504 Ga0207659_10024575 3300025926 Bacteria 4039
505 Ga0207659_10074219 3300025926 Bacteria 2493
506 Ga0207659_10396910 3300025926 Bacteria 1153
507 Ga0207687_10032857 3300025927 Bacteria 3517
508 Ga0207687_10061124 3300025927 Bacteria 2660
509 Ga0207687_10071446 3300025927 Bacteria 2480
510 Ga0207664_10000197 3300025929 Bacteria 45209
511 Ga0207644_10000803 3300025931 Bacteria 19918
512 Ga0207644_10008709 3300025931 Bacteria 6642
513 Ga0207644_10097091 3300025931 Bacteria 2207
514 Ga0207644_10132150 3300025931 Bacteria 1912
515 Ga0207690_10006655 3300025932 Bacteria 6847
516 Ga0207690_10009936 3300025932 Bacteria 5653
517 Ga0207690_10059497 3300025932 Bacteria 2589
518 Ga0207706_10002100 3300025933 Bacteria 19502
519 Ga0207706_10010173 3300025933 Bacteria 8610
520 Ga0207706_10014083 3300025933 Bacteria 7251
521 Ga0207706_10027626 3300025933 Bacteria 5073
522 Ga0207706_10044187 3300025933 Bacteria 3950
523 Ga0207706_10048887 3300025933 Bacteria 3740
524 Ga0207706_10071755 3300025933 Bacteria 3046
525 Ga0207686_10008635 3300025934 Bacteria 5502
526 Ga0207686_10048026 3300025934 Bacteria 2642
527 Ga0207709_10002423 3300025935 Bacteria 11738
528 Ga0207709_10009952 3300025935 Bacteria 5237
529 Ga0207709_10023354 3300025935 Bacteria 3519
530 Ga0207670_10069272 3300025936 Bacteria 2433
531 Ga0207670_10096525 3300025936 Bacteria 2102
532 Ga0207669_10001640 3300025937 Bacteria 9507
533 Ga0207704_10001096 3300025938 Bacteria 12024
534 Ga0207704_10134190 3300025938 Bacteria 1720
535 Ga0207691_10000029 3300025940 Bacteria 120814
536 Ga0207691_10009666 3300025940 Bacteria 9251
537 Ga0207691_10012987 3300025940 Bacteria 7975
538 Ga0207691_10030305 3300025940 Bacteria 5056
539 Ga0207691_10037465 3300025940 Bacteria 4491
540 Ga0207691_10047077 3300025940 Bacteria 3960
541 Ga0207691_10050458 3300025940 Bacteria 3809
542 Ga0207691_10062505 3300025940 Bacteria 3378
543 Ga0207691_10197629 3300025940 Bacteria 1751
544 Ga0207711_10003120 3300025941 Bacteria 14443
545 Ga0207711_10177630 3300025941 Bacteria 1935
546 Ga0207689_10000870 3300025942 Bacteria 29137
547 Ga0207689_10002362 3300025942 Bacteria 17615
548 Ga0207689_10002739 3300025942 Bacteria 16300
549 Ga0207689_10007372 3300025942 Bacteria 9647
550 Ga0207689_10008166 3300025942 Bacteria 9125
551 Ga0207661_10145561 3300025944 Bacteria 2044
552 Ga0207679_10000918 3300025945 Bacteria 18832
553 Ga0207679_10008717 3300025945 Bacteria 6469
554 Ga0207679_10071289 3300025945 Bacteria 2621
555 Ga0207679_10127032 3300025945 Bacteria 2039
556 Ga0207679_10324393 3300025945 Bacteria 1334
557 Ga0207679_10328535 3300025945 Bacteria 1326
558 Ga0207667_10000036 3300025949 Bacteria 297966
559 Ga0207667_10001952 3300025949 Bacteria 25839
560 Ga0207667_10029665 3300025949 Bacteria 5929
561 Ga0207667_10047017 3300025949 Bacteria 4569
562 Ga0207667_10145685 3300025949 Bacteria 2438
563 Ga0207667_10154499 3300025949 Bacteria 2361
564 Ga0207667_10285819 3300025949 Bacteria 1685
565 Ga0207651_10027488 3300025960 Bacteria 3573
566 Ga0207651_10037969 3300025960 Bacteria 3160
567 Ga0207651_10050856 3300025960 Bacteria 2817
568 Ga0207651_10071064 3300025960 Bacteria 2465
569 Ga0207651_10082929 3300025960 Bacteria 2316
570 Ga0207651_10243076 3300025960 Bacteria 1468
571 Ga0207712_10381751 3300025961 Bacteria 1179
572 Ga0207668_10002399 3300025972 Bacteria 10961
573 Ga0207668_10028441 3300025972 Bacteria 3655
574 Ga0207668_10092930 3300025972 Bacteria 2221
575 Ga0207640_10019862 3300025981 Bacteria 3977
576 Ga0207640_10077683 3300025981 Bacteria 2257
577 Ga0207658_10000181 3300025986 Bacteria 67700
578 Ga0207658_10002598 3300025986 Bacteria 13108
579 Ga0207658_10004916 3300025986 Bacteria 9219
580 Ga0207658_10040972 3300025986 Bacteria 3351
581 Ga0207658_10203124 3300025986 Bacteria 1656
582 Ga0207677_10035435 3300026023 Bacteria 3241
583 Ga0207677_10044097 3300026023 Bacteria 2969
584 Ga0207677_10315386 3300026023 Bacteria 1297
585 Ga0207677_10328371 3300026023 Bacteria 1274
586 Ga0207703_10000292 3300026035 Bacteria 54983
587 Ga0207703_10016526 3300026035 Bacteria 5754
588 Ga0207703_10095969 3300026035 Bacteria 2502
589 Ga0207703_10328310 3300026035 Bacteria 1403
590 Ga0207639_10002377 3300026041 Bacteria 12641
591 Ga0207639_10005201 3300026041 Bacteria 8778
592 Ga0207639_10080988 3300026041 Bacteria 2570
593 Ga0207639_10110400 3300026041 Bacteria 2240
594 Ga0207678_10002867 3300026067 Bacteria 15651
595 Ga0207678_10007096 3300026067 Bacteria 9937
596 Ga0207678_10009966 3300026067 Bacteria 8337
597 Ga0207678_10256216 3300026067 Bacteria 1499
598 Ga0207678_10265773 3300026067 Bacteria 1471
599 Ga0207708_10153450 3300026075 Bacteria 1815
600 Ga0207708_10254791 3300026075 Bacteria 1415
601 Ga0207708_10417434 3300026075 Bacteria 1112
602 Ga0207702_10000725 3300026078 Bacteria 35324
603 Ga0207702_10012210 3300026078 Bacteria 7148
604 Ga0207702_10026211 3300026078 Bacteria 4839
605 Ga0207702_10041205 3300026078 Bacteria 3872
606 Ga0207702_10444242 3300026078 Bacteria 1257
607 Ga0207641_10001206 3300026088 Bacteria 25861
608 Ga0207641_10006113 3300026088 Bacteria 10190
609 Ga0207641_10009643 3300026088 Bacteria 7956
610 Ga0207641_10251851 3300026088 Bacteria 1650
611 Ga0207648_10000091 3300026089 Bacteria 85128
612 Ga0207648_10000753 3300026089 Bacteria 36419
613 Ga0207648_10003584 3300026089 Bacteria 16250
614 Ga0207648_10007124 3300026089 Bacteria 11031
615 Ga0207648_10007170 3300026089 Bacteria 10990
616 Ga0207648_10012095 3300026089 Bacteria 8093
617 Ga0207648_10054111 3300026089 Bacteria 3507
618 Ga0207648_10086547 3300026089 Bacteria 2734
619 Ga0207648_10091747 3300026089 Bacteria 2655
620 Ga0207676_10001693 3300026095 Bacteria 16260
621 Ga0207676_10007242 3300026095 Bacteria 7855
622 Ga0207676_10107345 3300026095 Bacteria 2328
623 Ga0207676_10213022 3300026095 Bacteria 1715
624 Ga0207676_10217181 3300026095 Bacteria 1700
625 Ga0207676_10218481 3300026095 Bacteria 1696
626 Ga0207676_10231970 3300026095 Bacteria 1650
627 Ga0207674_10000170 3300026116 Bacteria 78770
628 Ga0207674_10003102 3300026116 Bacteria 20519
629 Ga0207674_10007473 3300026116 Bacteria 12735
630 Ga0207674_10039028 3300026116 Bacteria 4925
631 Ga0207675_100000273 3300026118 Bacteria 49026
632 Ga0207675_100001077 3300026118 Bacteria 27123
633 Ga0207675_100009324 3300026118 Bacteria 9201
634 Ga0207675_100012300 3300026118 Bacteria 7995
635 Ga0207675_100015774 3300026118 Bacteria 7045
636 Ga0207675_100100562 3300026118 Bacteria 2724
637 Ga0207675_100157741 3300026118 Bacteria 2163
638 Ga0207683_10000305 3300026121 Bacteria 44345
639 Ga0207683_10031632 3300026121 Bacteria 4592
640 Ga0207683_10063103 3300026121 Bacteria 3264
641 Ga0207683_10134011 3300026121 Bacteria 2229
642 Ga0207698_10000543 3300026142 Bacteria 21895
643 Ga0207698_10003201 3300026142 Bacteria 9827
644 Ga0207698_10007407 3300026142 Bacteria 6875
645 Ga0207698_10012920 3300026142 Bacteria 5488
646 Ga0207698_10125034 3300026142 Bacteria 2185
647 Ga0207698_10138375 3300026142 Bacteria 2093
648 Ga0207698_10486136 3300026142 Bacteria 1198
649 Ga0209281_1011560 3300027111 Bacteria 1973
650 Ga0209282_1000521 3300027666 Bacteria 18596
651 Ga0209813_10049692 3300027866 Bacteria 1306
652 Ga0207428_10011958 3300027907 Bacteria 7639
653 Ga0268266_10029837 3300028379 Bacteria 4634
654 Ga0268265_10125350 3300028380 Bacteria 2124
655 Ga0268265_10464344 3300028380 Bacteria 1185
656 Ga0268264_10000862 3300028381 Bacteria 32146
657 Ga0268264_10002185 3300028381 Bacteria 17390
658 Ga0268264_10020212 3300028381 Bacteria 5442
659 Ga0268264_10311160 3300028381 Bacteria 1486
660 Ga0268264_10404144 3300028381 Bacteria 1313
661 Ga0307515_10004838 3300028794 Bacteria 27552
662 Ga0307515_10066724 3300028794 Bacteria 4978
663 Ga0307515_10082486 3300028794 Bacteria 4157
664 Ga0307515_10197516 3300028794 Bacteria 1899
665 Ga0316177_1089736 3300030731 Bacteria 1573
666 Ga0314311_1055507 3300030733 Bacteria 11059
667 Ga0316178_1036717 3300030735 Bacteria 5475
668 Ga0316180_1039863 3300030736 Bacteria 1650
669 Ga0316181_1234386 3300030744 Bacteria 2073
670 Ga0307513_10043216 3300031456 Bacteria 4953
671 Ga0307513_10118073 3300031456 Bacteria 2628
672 Ga0307513_10281371 3300031456 Bacteria 1440
673 Ga0307509_10008945 3300031507 Bacteria 12627
674 Ga0307408_100000026 3300031548 Bacteria 261688
675 Ga0307408_100098348 3300031548 Bacteria 2224
676 Ga0307508_10000222 3300031616 Bacteria 69029
677 Ga0307514_10108540 3300031649 Bacteria 1973
678 Ga0307516_10001053 3300031730 Bacteria 38382
679 Ga0307516_10042854 3300031730 Bacteria 4487
680 Ga0307516_10061501 3300031730 Bacteria 3643
681 Ga0307516_10177457 3300031730 Bacteria 1866
682 Ga0307405_10007710 3300031731 Bacteria 5409
683 Ga0307405_10115181 3300031731 Bacteria 1828
684 Ga0307413_10173723 3300031824 Eukaryota 1528
685 Ga0307406_10002407 3300031901 Bacteria 10164
686 Ga0307406_10291886 3300031901 Bacteria 1249
687 Ga0307412_10000334 3300031911 Bacteria 29763
688 Ga0307412_10103102 3300031911 Bacteria 2021
689 Ga0307412_10123087 3300031911 Bacteria 1871
690 Ga0307412_10215557 3300031911 Bacteria 1468
691 Ga0307412_10262098 3300031911 Bacteria 1348
692 Ga0307409_100011603 3300031995 Bacteria 5567
693 Ga0307416_100001205 3300032002 Bacteria 13922
694 Ga0307416_100106492 3300032002 Bacteria 2458
695 Ga0307416_100151369 3300032002 Bacteria 2128
696 Ga0307416_100156290 3300032002 Bacteria 2100
697 Ga0307416_100393049 3300032002 Bacteria 1421
698 Ga0307414_10036574 3300032004 Bacteria 3279
699 Ga0307414_10053714 3300032004 Bacteria 2811
700 Ga0307414_10370429 3300032004 Bacteria 1235
701 Ga0307411_10035182 3300032005 Bacteria 3124
702 Ga0307411_10241423 3300032005 Bacteria 1414
703 Ga0307415_100018199 3300032126 Bacteria 4236
704 Ga0307507_10143225 3300033179 Bacteria 1825
705 Ga0307510_10216326 3300033180 Bacteria 1432
706 Ga0373949_0017114 3300035090 Bacteria 1631
707 Ga0373951_0007193 3300035091 Bacteria 2532
708 Ga0373945_0085402 3300035116 Bacteria 1215
709 Ga0373945_0087234 3300035116 Bacteria 1204
710 Ga0373961_0012075 3300035241 Bacteria 2155
711 Ga0373935_0011023 3300035692 Bacteria 5431
712 Ga0373947_0102441 3300035725 Bacteria 1800
713 Ga0373937_0019429 3300036401 Bacteria 6082
714 Ga0395900_0000054 3300037418 Bacteria 220487
715 Ga0395900_0001265 3300037418 Bacteria 30893
716 Ga0395898_0000485 3300037466 Bacteria 78871
717 Ga0395898_0061467 3300037466 Bacteria 3649
718 Ga0395905_0003176 3300037471 Bacteria 17695
719 Ga0395905_0009794 3300037471 Bacteria 9341
720 Ga0395905_0010349 3300037471 Bacteria 9079
721 Ga0395905_0028723 3300037471 Bacteria 5241
722 Ga0395905_0103047 3300037471 Bacteria 2679
723 Ga0395901_0348188 3300038443 Bacteria 1529
724 Ga0436365_1917885 3300039437 Bacteria 1758
725 Ga0439436_0000003 3300041404 Bacteria 186684
726 Ga0439436_0001289 3300041404 Bacteria 7164
727 Ga0439436_0007927 3300041404 Bacteria 3262
728 Ga0439439_0002493 3300041406 Bacteria 3922
729 Ga0439466_0018193 3300041411 Bacteria 2523
730 Ga0439466_0028682 3300041411 Bacteria 1919
731 Ga0439466_0060726 3300041411 Bacteria 1218
732 Ga0439465_0001535 3300041413 Bacteria 7508
733 Ga0439465_0028288 3300041413 Bacteria 1777
734 Ga0451793_0233126 3300041452 Bacteria 1486
735 Ga0451797_0100768 3300041453 Bacteria 1637
736 Ga0451839_0071674 3300041496 Unclassified 1293
737 Ga0451839_0654308 3300041496 Bacteria 1103
738 Ga0439431_0000205 3300041997 Bacteria 11661
739 Ga0439433_0002049 3300041999 Bacteria 4241
740 Ga0439433_0016990 3300041999 Bacteria 1613
741 Ga0439442_007132 3300042002 Bacteria 2246
742 Ga0439442_008923 3300042002 Bacteria 2026
743 Ga0439445_0001824 3300042004 Bacteria 4697
744 Ga0439432_001895 3300042006 Bacteria 7886
745 Ga0439432_027931 3300042006 Bacteria 1839
746 Ga0439449_0001384 3300042007 Bacteria 9489
747 Ga0439449_0003417 3300042007 Bacteria 6179
748 Ga0439449_0018173 3300042007 Bacteria 2638
749 Ga0439457_044293 3300042014 Bacteria 993
750 Ga0439462_0018997 3300042015 Bacteria 1787
751 Ga0450919_007325 3300042121 Bacteria 1291
752 Ga0450923_001505 3300042125 Bacteria 3113
753 Ga0450923_010263 3300042125 Bacteria 1658
754 Ga0450894_009092 3300042131 Bacteria 1286
755 Ga0450898_006256 3300042134 Bacteria 1822
756 Ga0450898_014796 3300042134 Bacteria 1316
757 Ga0450906_001314 3300042145 Bacteria 5446
758 Ga0439446_0002478 3300042156 Bacteria 4438
759 Ga0439446_0013170 3300042156 Bacteria 2268
760 Ga0450908_009442 3300042184 Bacteria 1811
761 Ga0450909_011553 3300042185 Bacteria 1294
762 Ga0439434_0041319 3300042435 Bacteria 1417
763 Ga0439459_0001488 3300042438 Bacteria 3463
764 Ga0439459_0040870 3300042438 Bacteria 985
765 Ga0451577_0043545 3300042876 Bacteria 4021
766 Ga0451577_0053149 3300042876 Bacteria 3617
767 Ga0466969_0000002 3300044656 Bacteria 178693
768 Ga0466969_0017798 3300044656 Bacteria 3707
769 Ga0466972_0004058 3300044658 Bacteria 7304
770 Ga0466965_0010749 3300044683 Bacteria 4280
771 Ga0466965_0085445 3300044683 Bacteria 1599
772 Ga0466966_0006654 3300044684 Bacteria 7656
773 Ga0466961_0008842 3300044693 Bacteria 6424
774 Ga0466961_0030141 3300044693 Bacteria 3486
775 Ga0466964_0002963 3300044706 Bacteria 6138
776 Ga0466971_0078343 3300044719 Bacteria 1505
777 Ga0466959_0016205 3300045049 Bacteria 5441
778 Ga0451576_0197347 3300045051 Bacteria 2102
779 Ga0451576_0578170 3300045051 Bacteria 1180
780 Ga0466967_0019917 3300045976 Bacteria 5409
781 Ga0495638_0064125 3300046460 Bacteria 2264
782 Ga0495638_0140729 3300046460 Bacteria 1409
783 Ga0495610_0000450 3300046512 Bacteria 42530
784 Ga0495610_0076078 3300046512 Bacteria 1553
785 Ga0495663_0003155 3300046525 Bacteria 4807
786 Ga0495586_0089625 3300046535 Bacteria 1698
787 Ga0495621_0022473 3300046539 Bacteria 2091
788 Ga0495645_0009403 3300046543 Bacteria 6833
789 Ga0495656_0006031 3300046615 Bacteria 4222
790 Ga0495625_0000057 3300046660 Bacteria 181623
791 Ga0495625_0006349 3300046660 Bacteria 10559
792 Ga0495635_0137180 3300046663 Bacteria 1667
793 Ga0495658_0008234 3300046683 Bacteria 5165
794 Ga0495670_0283717 3300046691 Bacteria 886
795 Ga0495685_023041 3300047447 Bacteria 2143
796 Ga0496102_0000192 3300048905 Bacteria 83166
797 Ga0496102_0054088 3300048905 Bacteria 3660
798 Ga0496102_0138386 3300048905 Bacteria 2282
799 Ga0496102_0169842 3300048905 Bacteria 2053
800 Ga0496102_0552900 3300048905 Bacteria 1074
801 Ga0496103_0001678 3300048906 Bacteria 14484
802 Ga0496103_0103586 3300048906 Bacteria 1803
803 Ga0496104_0052530 3300048907 Bacteria 3850
804 Ga0496106_0047730 3300048909 Bacteria 3223
805 Ga0496106_0126254 3300048909 Bacteria 2003
806 Ga0496107_0039482 3300048910 Bacteria 3386
807 Ga0496108_0038014 3300048911 Bacteria 4010
808 Ga0496108_0094392 3300048911 Bacteria 2546
809 Ga0496109_0089462 3300048912 Bacteria 2846
810 Ga0496111_0049406 3300048914 Bacteria 3033
811 Ga0496112_0127400 3300048915 Bacteria 2516
812 Ga0496113_0119634 3300048916 Bacteria 2058
813 Ga0496114_0050992 3300048917 Bacteria 3445
814 Ga0496119_0020446 3300048922 Bacteria 4832
815 Ga0496121_0000762 3300048924 Bacteria 59172
816 Ga0496121_0063636 3300048924 Bacteria 3012
817 Ga0496121_0171027 3300048924 Bacteria 1578
818 Ga0496124_0000086 3300048927 Bacteria 202844
819 Ga0496124_0027862 3300048927 Bacteria 5060
820 Ga0496125_0019805 3300048928 Bacteria 6331
821 Ga0496125_0029046 3300048928 Bacteria 4978
822 Ga0501033_0061157 3300049570 Bacteria 2776
823 Ga0501034_0042352 3300049571 Bacteria 4609
824 Ga0501043_0110669 3300049579 Bacteria 2156
825 Ga0501046_0000007 3300049580 Bacteria 356002
826 Ga0501046_0001185 3300049580 Bacteria 25348
827 Ga0501047_0001232 3300049581 Bacteria 25329
828 Ga0501047_0173424 3300049581 Bacteria 2025
829 Ga0501048_0002373 3300049582 Bacteria 14383
830 Ga0501048_0006947 3300049582 Bacteria 8599
831 Ga0501198_000015 3300049649 Bacteria 102945
832 Ga0501211_006287 3300049658 Bacteria 1177
833 Ga0501222_000540 3300049662 Bacteria 5615
834 Ga0501222_003387 3300049662 Bacteria 2179
835 Ga0501235_005038 3300049669 Bacteria 2866
836 Ga0501221_001344 3300049704 Bacteria 4043
837 Ga0501225_0024214 3300049705 Bacteria 1671
838 Ga0501080_0003909 3300049742 Bacteria 13198
839 Ga0501080_0126763 3300049742 Bacteria 2364
840 Ga0501083_0000046 3300049744 Bacteria 88934
841 Ga0501262_000028 3300049759 Bacteria 19106
842 Ga0501272_002337 3300049769 Bacteria 1868
843 Ga0501035_0010010 3300049822 Bacteria 8797
844 Ga0501035_0022189 3300049822 Bacteria 5832
845 Ga0501035_0035441 3300049822 Bacteria 4529
846 Ga0501035_0422534 3300049822 Bacteria 1106
847 Ga0501044_0000691 3300049823 Bacteria 40824
848 Ga0501044_0068317 3300049823 Bacteria 3620
849 Ga0501044_0328662 3300049823 Bacteria 1452
850 Ga0501045_0042015 3300049824 Bacteria 3327
851 nmdc:mga03683_1056_c1 3300050489 Bacteria 8065
852 nmdc:mga03683_15637_c1 3300050489 Bacteria 2835
853 nmdc:mga03683_63977_c1 3300050489 Bacteria 1560
854 nmdc:mga03n38_18474_c1 3300050490 Bacteria 2753
855 nmdc:mga03n38_7431_c1 3300050490 Bacteria 3879
856 nmdc:mga03n38_75142_c1 3300050490 Bacteria 1573
857 nmdc:mga00v17_59988_c1 3300050491 Bacteria 2335
858 nmdc:mga0k408_135021_c1 3300050493 Bacteria 1466
859 nmdc:mga0k408_57521_c1 3300050493 Bacteria 2257
860 nmdc:mga0k408_60488_c1 3300050493 Bacteria 2201
861 nmdc:mga06z11_86570_c1 3300050494 Bacteria 1693
862 nmdc:mga04h51_25130_c1 3300050495 Bacteria 1830
863 nmdc:mga07m45_156406_c1 3300050496 Bacteria 1323
864 nmdc:mga07m45_33614_c1 3300050496 Bacteria 2848
865 nmdc:mga07m45_42289_c1 3300050496 Bacteria 2554
866 nmdc:mga07m45_59_c1 3300050496 Bacteria 45010
867 nmdc:mga07m45_61132_c1 3300050496 Bacteria 2133
868 nmdc:mga09592_43010_c1 3300050508 Bacteria 3801
869 nmdc:mga09592_89510_c1 3300050508 Unclassified 2629
870 nmdc:mga0qj67_77025_c1 3300050509 Bacteria 2668
871 nmdc:mga06r32_16310_c1 3300050510 Bacteria 6766
872 nmdc:mga08y16_186202_c1 3300050511 Bacteria 2154
873 nmdc:mga08y16_3895_c1 3300050511 Bacteria 15539
874 nmdc:mga0n895_161_c1 3300050512 Bacteria 41386
875 nmdc:mga08x19_2900_c1 3300050514 Bacteria 10322
876 nmdc:mga0a205_12927_c1 3300050515 Bacteria 7745
877 nmdc:mga0sz30_5751_c1 3300050516 Bacteria 4565
878 Ga0495601_0048867 3300053077 Bacteria 2665
879 Ga0495612_0031608 3300053078 Bacteria 2135
880 Ga0495619_0107890 3300053085 Bacteria 1900
881 Ga0500590_007880 3300053148 Bacteria 5293
882 Ga0500616_0001154 3300053153 Bacteria 27009
883 Ga0466962_0015334 3300061719 Bacteria 3695

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046691 Ga0495670_0283717 Ga0495670_0283717_39_872 271
2 3300003323 rootH1_10019948 rootH1_100199488 282
3 3300005340 Ga0070689_100153538 Ga0070689_1001535382 283
4 3300005364 Ga0070673_100501594 Ga0070673_1005015941 283
5 3300005618 Ga0068864_100182348 Ga0068864_1001823482 283
6 3300005842 Ga0068858_100262837 Ga0068858_1002628372 283
7 3300006852 Ga0075433_10015747 Ga0075433_100157476 283
8 3300006871 Ga0075434_100000018 Ga0075434_10000001824 283
9 3300006914 Ga0075436_100015029 Ga0075436_1000150293 283
10 3300007076 Ga0075435_100000675 Ga0075435_10000067510 283
11 3300009094 Ga0111539_10010327 Ga0111539_1001032712 283
12 3300025936 Ga0207670_10096525 Ga0207670_100965252 283
13 3300026078 Ga0207702_10041205 Ga0207702_100412055 283
14 3300026095 Ga0207676_10217181 Ga0207676_102171811 283
15 3300026118 Ga0207675_100100562 Ga0207675_1001005623 283
16 3300050512 nmdc:mga0n895_161_c1 nmdc:mga0n895_161_c1_21735_22673 283
17 3300050514 nmdc:mga08x19_2900_c1 nmdc:mga08x19_2900_c1_6545_7483 283
18 3300050515 nmdc:mga0a205_12927_c1 nmdc:mga0a205_12927_c1_3068_4006 283
19 3300005338 Ga0068868_100218157 Ga0068868_1002181572 287
20 3300005455 Ga0070663_100080571 Ga0070663_1000805713 287
21 3300005459 Ga0068867_100032027 Ga0068867_1000320273 287
22 3300005841 Ga0068863_100583086 Ga0068863_1005830862 287
23 3300025893 Ga0207682_10047377 Ga0207682_100473773 287
24 3300025907 Ga0207645_10263222 Ga0207645_102632222 287
25 3300032002 Ga0307416_100106492 Ga0307416_1001064921 287
26 3300005355 Ga0070671_100033348 Ga0070671_1000333482 288
27 3300025931 Ga0207644_10097091 Ga0207644_100970912 288
28 3300046539 Ga0495621_0022473 Ga0495621_0022473_966_1850 288
29 3300005328 Ga0070676_10000256 Ga0070676_1000025610 292
30 3300005331 Ga0070670_100004507 Ga0070670_10000450710 292
31 3300005333 Ga0070677_10000666 Ga0070677_100006662 292
32 3300005334 Ga0068869_100030693 Ga0068869_1000306934 292
33 3300005335 Ga0070666_10001227 Ga0070666_1000122717 292
34 3300005338 Ga0068868_100000197 Ga0068868_10000019730 292
35 3300005347 Ga0070668_100006076 Ga0070668_1000060764 292
36 3300005353 Ga0070669_100155009 Ga0070669_1001550092 292
37 3300005354 Ga0070675_100000297 Ga0070675_10000029710 292
38 3300005355 Ga0070671_100000622 Ga0070671_10000062216 292
39 3300005356 Ga0070674_100000722 Ga0070674_1000007227 292
40 3300005364 Ga0070673_100000892 Ga0070673_1000008927 292
41 3300005364 Ga0070673_100220008 Ga0070673_1002200082 292
42 3300005367 Ga0070667_100007725 Ga0070667_1000077254 292
43 3300005455 Ga0070663_100066689 Ga0070663_1000666892 292
44 3300005456 Ga0070678_100010378 Ga0070678_1000103782 292
45 3300005457 Ga0070662_100210587 Ga0070662_1002105872 292
46 3300005539 Ga0068853_100045573 Ga0068853_1000455732 292
47 3300005543 Ga0070672_100003947 Ga0070672_1000039472 292
48 3300005615 Ga0070702_100071124 Ga0070702_1000711242 292
49 3300005616 Ga0068852_100000895 Ga0068852_1000008958 292
50 3300005617 Ga0068859_100281934 Ga0068859_1002819342 292
51 3300005719 Ga0068861_100120248 Ga0068861_1001202482 292
52 3300005841 Ga0068863_100077811 Ga0068863_1000778112 292
53 3300005843 Ga0068860_100009885 Ga0068860_1000098857 292
54 3300006358 Ga0068871_100001908 Ga0068871_1000019082 292
55 3300006881 Ga0068865_100047597 Ga0068865_1000475972 292
56 3300006931 Ga0097620_100281920 Ga0097620_1002819202 292
57 3300009094 Ga0111539_10010277 Ga0111539_1001027712 292
58 3300013296 Ga0157374_10204518 Ga0157374_102045182 292
59 3300013306 Ga0163162_10063167 Ga0163162_100631672 292
60 3300013308 Ga0157375_10002932 Ga0157375_1000293210 292
61 3300017792 Ga0163161_10035454 Ga0163161_100354544 292
62 3300025893 Ga0207682_10000418 Ga0207682_100004184 292
63 3300025903 Ga0207680_10066044 Ga0207680_100660442 292
64 3300025907 Ga0207645_10000301 Ga0207645_1000030125 292
65 3300025908 Ga0207643_10002187 Ga0207643_1000218713 292
66 3300025925 Ga0207650_10012639 Ga0207650_100126397 292
67 3300025925 Ga0207650_10094336 Ga0207650_100943362 292
68 3300025926 Ga0207659_10024575 Ga0207659_100245752 292
69 3300025940 Ga0207691_10000029 Ga0207691_1000002925 292
70 3300025972 Ga0207668_10092930 Ga0207668_100929302 292
71 3300025986 Ga0207658_10002598 Ga0207658_1000259810 292
72 3300026041 Ga0207639_10110400 Ga0207639_101104002 292
73 3300026067 Ga0207678_10009966 Ga0207678_1000996612 292
74 3300026088 Ga0207641_10009643 Ga0207641_100096433 292
75 3300026089 Ga0207648_10007124 Ga0207648_1000712414 292
76 3300026118 Ga0207675_100012300 Ga0207675_1000123009 292
77 3300026121 Ga0207683_10000305 Ga0207683_1000030530 292
78 3300026142 Ga0207698_10000543 Ga0207698_100005435 292
79 3300028381 Ga0268264_10020212 Ga0268264_100202124 292
80 3300050511 nmdc:mga08y16_3895_c1 nmdc:mga08y16_3895_c1_10062_10982 292
81 3300053077 Ga0495601_0048867 Ga0495601_0048867_1122_2099 292
82 3300031911 Ga0307412_10000334 Ga0307412_1000033415 293
83 3300041404 Ga0439436_0000003 Ga0439436_0000003_31628_32572 293
84 3300042876 Ga0451577_0053149 Ga0451577_0053149_1269_2219 293
85 3300046460 Ga0495638_0064125 Ga0495638_0064125_232_1173 293
86 3300046512 Ga0495610_0000450 Ga0495610_0000450_22220_23164 293
87 3300048922 Ga0496119_0020446 Ga0496119_0020446_3698_4642 293
88 3300005548 Ga0070665_100137179 Ga0070665_1001371793 294
89 3300005564 Ga0070664_100102425 Ga0070664_1001024253 294
90 3300005719 Ga0068861_100281759 Ga0068861_1002817593 294
91 3300025940 Ga0207691_10009666 Ga0207691_100096664 294
92 3300025945 Ga0207679_10127032 Ga0207679_101270323 294
93 3300026088 Ga0207641_10251851 Ga0207641_102518512 294
94 3300026089 Ga0207648_10054111 Ga0207648_100541113 294
95 3300026118 Ga0207675_100157741 Ga0207675_1001577412 294
96 3300049570 Ga0501033_0061157 Ga0501033_0061157_580_1500 294
97 3300049581 Ga0501047_0173424 Ga0501047_0173424_189_1109 294
98 3300049822 Ga0501035_0422534 Ga0501035_0422534_102_1022 294
99 3300050491 nmdc:mga00v17_59988_c1 nmdc:mga00v17_59988_c1_331_1257 294
100 iso_pu_bacteria 2811994881 2812366799 294
101 iso_pu_bacteria 2923519811 2923520834 294
102 3300005328 Ga0070676_10023646 Ga0070676_100236462 295
103 3300005331 Ga0070670_100002086 Ga0070670_10000208612 295
104 3300005334 Ga0068869_100000242 Ga0068869_10000024218 295
105 3300005336 Ga0070680_100000172 Ga0070680_10000017228 295
106 3300005337 Ga0070682_100002377 Ga0070682_1000023779 295
107 3300005338 Ga0068868_100027785 Ga0068868_1000277855 295
108 3300005339 Ga0070660_100001451 Ga0070660_1000014517 295
109 3300005340 Ga0070689_100089389 Ga0070689_1000893892 295
110 3300005343 Ga0070687_100055963 Ga0070687_1000559632 295
111 3300005344 Ga0070661_100001049 Ga0070661_10000104918 295
112 3300005345 Ga0070692_10000564 Ga0070692_100005644 295
113 3300005366 Ga0070659_100000892 Ga0070659_10000089216 295
114 3300005406 Ga0070703_10025469 Ga0070703_100254691 295
115 3300005438 Ga0070701_10013999 Ga0070701_100139992 295
116 3300005440 Ga0070705_100000829 Ga0070705_10000082917 295
117 3300005441 Ga0070700_100204597 Ga0070700_1002045971 295
118 3300005444 Ga0070694_100001268 Ga0070694_1000012686 295
119 3300005445 Ga0070708_100400638 Ga0070708_1004006382 295
120 3300005455 Ga0070663_100002216 Ga0070663_1000022162 295
121 3300005457 Ga0070662_100015351 Ga0070662_1000153512 295
122 3300005458 Ga0070681_10013452 Ga0070681_100134526 295
123 3300005459 Ga0068867_100002201 Ga0068867_1000022013 295
124 3300005530 Ga0070679_100000185 Ga0070679_10000018530 295
125 3300005539 Ga0068853_100022179 Ga0068853_1000221792 295
126 3300005543 Ga0070672_100099402 Ga0070672_1000994022 295
127 3300005545 Ga0070695_100003882 Ga0070695_1000038826 295
128 3300005546 Ga0070696_100002658 Ga0070696_1000026583 295
129 3300005547 Ga0070693_100000248 Ga0070693_10000024817 295
130 3300005549 Ga0070704_100002912 Ga0070704_1000029122 295
131 3300005563 Ga0068855_100000437 Ga0068855_10000043752 295
132 3300005564 Ga0070664_100004721 Ga0070664_1000047212 295
133 3300005577 Ga0068857_100059742 Ga0068857_1000597422 295
134 3300005578 Ga0068854_100002679 Ga0068854_1000026792 295
135 3300005614 Ga0068856_100000464 Ga0068856_10000046426 295
136 3300005616 Ga0068852_100104118 Ga0068852_1001041182 295
137 3300005617 Ga0068859_100007895 Ga0068859_1000078955 295
138 3300005618 Ga0068864_100001333 Ga0068864_1000013332 295
139 3300005719 Ga0068861_100010099 Ga0068861_1000100992 295
140 3300005840 Ga0068870_10000256 Ga0068870_1000025617 295
141 3300005841 Ga0068863_100050562 Ga0068863_1000505622 295
142 3300005842 Ga0068858_100026341 Ga0068858_1000263412 295
143 3300005843 Ga0068860_100030858 Ga0068860_1000308586 295
144 3300006852 Ga0075433_10075983 Ga0075433_100759832 295
145 3300006871 Ga0075434_100116972 Ga0075434_1001169722 295
146 3300006931 Ga0097620_100007895 Ga0097620_1000078955 295
147 3300011119 Ga0105246_10056982 Ga0105246_100569822 295
148 3300013100 Ga0157373_10000439 Ga0157373_1000043910 295
149 3300013104 Ga0157370_10053337 Ga0157370_100533374 295
150 3300013105 Ga0157369_10007249 Ga0157369_100072497 295
151 3300013307 Ga0157372_10000313 Ga0157372_100003139 295
152 3300013308 Ga0157375_10071599 Ga0157375_100715992 295
153 3300014497 Ga0182008_10052135 Ga0182008_100521351 295
154 3300025885 Ga0207653_10000897 Ga0207653_100008973 295
155 3300025901 Ga0207688_10017055 Ga0207688_100170552 295
156 3300025903 Ga0207680_10110635 Ga0207680_101106351 295
157 3300025907 Ga0207645_10000113 Ga0207645_1000011316 295
158 3300025908 Ga0207643_10000164 Ga0207643_1000016437 295
159 3300025912 Ga0207707_10000305 Ga0207707_1000030549 295
160 3300025917 Ga0207660_10000085 Ga0207660_100000859 295
161 3300025918 Ga0207662_10023326 Ga0207662_100233262 295
162 3300025919 Ga0207657_10000236 Ga0207657_100002367 295
163 3300025920 Ga0207649_10007149 Ga0207649_100071494 295
164 3300025921 Ga0207652_10000572 Ga0207652_1000057229 295
165 3300025925 Ga0207650_10004962 Ga0207650_100049621 295
166 3300025926 Ga0207659_10396910 Ga0207659_103969102 295
167 3300025932 Ga0207690_10006655 Ga0207690_100066552 295
168 3300025933 Ga0207706_10027626 Ga0207706_100276266 295
169 3300025940 Ga0207691_10047077 Ga0207691_100470772 295
170 3300025942 Ga0207689_10000870 Ga0207689_1000087028 295
171 3300025945 Ga0207679_10000918 Ga0207679_1000091818 295
172 3300025949 Ga0207667_10001952 Ga0207667_100019528 295
173 3300025960 Ga0207651_10037969 Ga0207651_100379692 295
174 3300025981 Ga0207640_10019862 Ga0207640_100198622 295
175 3300026035 Ga0207703_10328310 Ga0207703_103283101 295
176 3300026041 Ga0207639_10002377 Ga0207639_100023776 295
177 3300026075 Ga0207708_10153450 Ga0207708_101534501 295
178 3300026078 Ga0207702_10000725 Ga0207702_1000072532 295
179 3300026089 Ga0207648_10000753 Ga0207648_1000075334 295
180 3300026095 Ga0207676_10231970 Ga0207676_102319701 295
181 3300026116 Ga0207674_10000170 Ga0207674_1000017031 295
182 3300026118 Ga0207675_100009324 Ga0207675_1000093248 295
183 3300026142 Ga0207698_10138375 Ga0207698_101383751 295
184 3300028381 Ga0268264_10404144 Ga0268264_104041441 295
185 3300035090 Ga0373949_0017114 Ga0373949_0017114_514_1566 295
186 3300035091 Ga0373951_0007193 Ga0373951_0007193_619_1671 295
187 3300035241 Ga0373961_0012075 Ga0373961_0012075_719_1771 295
188 3300036401 Ga0373937_0019429 Ga0373937_0019429_3945_4931 295
189 3300037418 Ga0395900_0001265 Ga0395900_0001265_11678_12586 295
190 3300037471 Ga0395905_0009794 Ga0395905_0009794_7812_8795 295
191 3300042438 Ga0439459_0001488 Ga0439459_0001488_1196_2248 295
192 3300042876 Ga0451577_0043545 Ga0451577_0043545_937_1989 295
193 3300046535 Ga0495586_0089625 Ga0495586_0089625_37_1023 295
194 3300046543 Ga0495645_0009403 Ga0495645_0009403_3424_4410 295
195 3300046663 Ga0495635_0137180 Ga0495635_0137180_40_1026 295
196 3300046683 Ga0495658_0008234 Ga0495658_0008234_1903_2889 295
197 3300048905 Ga0496102_0138386 Ga0496102_0138386_295_1347 295
198 3300048909 Ga0496106_0126254 Ga0496106_0126254_195_1247 295
199 3300049822 Ga0501035_0022189 Ga0501035_0022189_1037_1942 295
200 3300050490 nmdc:mga03n38_75142_c1 nmdc:mga03n38_75142_c1_452_1360 295
201 3300035116 Ga0373945_0085402 Ga0373945_0085402_282_1202 296
202 3300035692 Ga0373935_0011023 Ga0373935_0011023_656_1576 296
203 3300035725 Ga0373947_0102441 Ga0373947_0102441_391_1311 296
204 3300037466 Ga0395898_0061467 Ga0395898_0061467_244_1152 296
205 3300037471 Ga0395905_0103047 Ga0395905_0103047_1451_2359 296
206 3300038443 Ga0395901_0348188 Ga0395901_0348188_56_964 296
207 3300042435 Ga0439434_0041319 Ga0439434_0041319_243_1157 296
208 3300046615 Ga0495656_0006031 Ga0495656_0006031_3276_4184 296
209 3300053078 Ga0495612_0031608 Ga0495612_0031608_1048_1968 296
210 3300005329 Ga0070683_100131351 Ga0070683_1001313512 297
211 3300005345 Ga0070692_10009685 Ga0070692_100096854 297
212 3300005366 Ga0070659_100128061 Ga0070659_1001280612 297
213 3300005436 Ga0070713_100001451 Ga0070713_10000145110 297
214 3300005437 Ga0070710_10193709 Ga0070710_101937092 297
215 3300005439 Ga0070711_100372519 Ga0070711_1003725191 297
216 3300005455 Ga0070663_100293807 Ga0070663_1002938072 297
217 3300005457 Ga0070662_100388668 Ga0070662_1003886682 297
218 3300005549 Ga0070704_100114219 Ga0070704_1001142191 297
219 3300005578 Ga0068854_100023555 Ga0068854_1000235555 297
220 3300005615 Ga0070702_100069858 Ga0070702_1000698582 297
221 3300005616 Ga0068852_100230640 Ga0068852_1002306402 297
222 3300005834 Ga0068851_10171750 Ga0068851_101717502 297
223 3300006173 Ga0070716_100068725 Ga0070716_1000687253 297
224 3300007076 Ga0075435_100013522 Ga0075435_1000135224 297
225 3300009093 Ga0105240_10182607 Ga0105240_101826073 297
226 3300009098 Ga0105245_10639080 Ga0105245_106390801 297
227 3300009551 Ga0105238_10510656 Ga0105238_105106561 297
228 3300011119 Ga0105246_10248460 Ga0105246_102484602 297
229 3300013307 Ga0157372_10496813 Ga0157372_104968132 297
230 3300014497 Ga0182008_10124202 Ga0182008_101242022 297
231 3300025898 Ga0207692_10072501 Ga0207692_100725012 297
232 3300025919 Ga0207657_10008943 Ga0207657_100089433 297
233 3300025924 Ga0207694_10400970 Ga0207694_104009702 297
234 3300025927 Ga0207687_10061124 Ga0207687_100611242 297
235 3300025929 Ga0207664_10000197 Ga0207664_1000019732 297
236 3300025944 Ga0207661_10145561 Ga0207661_101455612 297
237 3300026067 Ga0207678_10265773 Ga0207678_102657732 297
238 3300026078 Ga0207702_10026211 Ga0207702_100262113 297
239 3300026142 Ga0207698_10486136 Ga0207698_104861362 297
240 3300042438 Ga0439459_0040870 Ga0439459_0040870_52_975 297
241 3300048906 Ga0496103_0103586 Ga0496103_0103586_347_1270 297
242 iso_pu_bacteria 2588253510 2588292744 297
243 iso_pu_bacteria 2643221592 2643967320 297
244 iso_pu_bacteria 2643221625 2644140150 297
245 iso_pu_bacteria 2643221648 2644271389 297
246 3300003320 rootH2_10100170 rootH2_101001701 298
247 3300003794 Ga0055531_10001242 Ga0055531_100012425 298
248 3300005295 Ga0065707_10089760 Ga0065707_100897602 298
249 3300005563 Ga0068855_100016992 Ga0068855_1000169927 298
250 3300005578 Ga0068854_100004830 Ga0068854_1000048302 298
251 3300009092 Ga0105250_10000005 Ga0105250_10000005123 298
252 3300014968 Ga0157379_10003793 Ga0157379_100037933 298
253 3300015261 Ga0182006_1010807 Ga0182006_10108072 298
254 3300025292 Ga0209676_1013635 Ga0209676_10136352 298
255 3300025303 Ga0209051_1000367 Ga0209051_100036740 298
256 3300025304 Ga0209257_1000012 Ga0209257_1000012562 298
257 3300025711 Ga0207696_1000470 Ga0207696_10004705 298
258 3300025913 Ga0207695_10029741 Ga0207695_100297415 298
259 3300025924 Ga0207694_10051255 Ga0207694_100512552 298
260 3300025949 Ga0207667_10000036 Ga0207667_1000003681 298
261 3300031824 Ga0307413_10173723 Ga0307413_101737232 298
262 3300041496 Ga0451839_0071674 Ga0451839_0071674_132_1049 298
263 3300046460 Ga0495638_0140729 Ga0495638_0140729_178_1083 298
264 3300048924 Ga0496121_0171027 Ga0496121_0171027_85_990 298
265 iso_pu_bacteria 2585428057 2587726185 298
266 3300005563 Ga0068855_100008322 Ga0068855_1000083223 299
267 3300005985 Ga0081539_10068401 Ga0081539_100684012 299
268 3300006946 Ga0079104_1005275 Ga0079104_10052755 299
269 3300009093 Ga0105240_10039918 Ga0105240_100399186 299
270 3300025949 Ga0207667_10154499 Ga0207667_101544992 299
271 3300027111 Ga0209281_1011560 Ga0209281_10115602 299
272 3300046525 Ga0495663_0003155 Ga0495663_0003155_1428_2342 299
273 3300047447 Ga0495685_023041 Ga0495685_023041_164_1078 299
274 3300048905 Ga0496102_0000192 Ga0496102_0000192_6675_7589 299
275 3300048906 Ga0496103_0001678 Ga0496103_0001678_10895_11809 299
276 3300005331 Ga0070670_100000274 Ga0070670_10000027437 300
277 3300005334 Ga0068869_100004100 Ga0068869_10000410012 300
278 3300005338 Ga0068868_100049743 Ga0068868_1000497433 300
279 3300005343 Ga0070687_100020042 Ga0070687_1000200423 300
280 3300005347 Ga0070668_100014299 Ga0070668_1000142992 300
281 3300005353 Ga0070669_100074254 Ga0070669_1000742542 300
282 3300005364 Ga0070673_100002101 Ga0070673_1000021012 300
283 3300005367 Ga0070667_100008672 Ga0070667_1000086723 300
284 3300005459 Ga0068867_100007097 Ga0068867_1000070977 300
285 3300005539 Ga0068853_100108970 Ga0068853_1001089702 300
286 3300005543 Ga0070672_100079787 Ga0070672_1000797872 300
287 3300005546 Ga0070696_100148649 Ga0070696_1001486492 300
288 3300005563 Ga0068855_100044952 Ga0068855_1000449526 300
289 3300005564 Ga0070664_100100237 Ga0070664_1001002372 300
290 3300005577 Ga0068857_100003534 Ga0068857_1000035343 300
291 3300005616 Ga0068852_100178897 Ga0068852_1001788972 300
292 3300005617 Ga0068859_100002792 Ga0068859_10000279212 300
293 3300005618 Ga0068864_100008382 Ga0068864_1000083823 300
294 3300005719 Ga0068861_100004435 Ga0068861_1000044356 300
295 3300005840 Ga0068870_10055487 Ga0068870_100554872 300
296 3300005842 Ga0068858_100000345 Ga0068858_10000034535 300
297 3300005843 Ga0068860_100001723 Ga0068860_10000172323 300
298 3300005844 Ga0068862_100008744 Ga0068862_1000087447 300
299 3300006844 Ga0075428_100470065 Ga0075428_1004700651 300
300 3300006880 Ga0075429_100416201 Ga0075429_1004162011 300
301 3300006931 Ga0097620_100002792 Ga0097620_1000027927 300
302 3300013297 Ga0157378_10035469 Ga0157378_100354692 300
303 3300013308 Ga0157375_10016898 Ga0157375_100168987 300
304 3300014325 Ga0163163_10002386 Ga0163163_1000238614 300
305 3300014968 Ga0157379_10000443 Ga0157379_100004432 300
306 3300025907 Ga0207645_10026198 Ga0207645_100261984 300
307 3300025918 Ga0207662_10075942 Ga0207662_100759422 300
308 3300025925 Ga0207650_10005657 Ga0207650_100056573 300
309 3300025938 Ga0207704_10134190 Ga0207704_101341902 300
310 3300025942 Ga0207689_10008166 Ga0207689_1000816612 300
311 3300025945 Ga0207679_10071289 Ga0207679_100712892 300
312 3300025949 Ga0207667_10029665 Ga0207667_100296654 300
313 3300025960 Ga0207651_10071064 Ga0207651_100710642 300
314 3300025972 Ga0207668_10028441 Ga0207668_100284412 300
315 3300025986 Ga0207658_10004916 Ga0207658_100049163 300
316 3300026023 Ga0207677_10044097 Ga0207677_100440972 300
317 3300026035 Ga0207703_10000292 Ga0207703_100002928 300
318 3300026041 Ga0207639_10080988 Ga0207639_100809883 300
319 3300026075 Ga0207708_10417434 Ga0207708_104174341 300
320 3300026089 Ga0207648_10007170 Ga0207648_100071707 300
321 3300026095 Ga0207676_10001693 Ga0207676_1000169310 300
322 3300026116 Ga0207674_10007473 Ga0207674_1000747313 300
323 3300026118 Ga0207675_100001077 Ga0207675_10000107711 300
324 3300027907 Ga0207428_10011958 Ga0207428_100119588 300
325 3300028381 Ga0268264_10000862 Ga0268264_1000086211 300
326 3300035116 Ga0373945_0087234 Ga0373945_0087234_15_935 300
327 3300048905 Ga0496102_0169842 Ga0496102_0169842_528_1451 300
328 3300048911 Ga0496108_0094392 Ga0496108_0094392_1254_2177 300
329 3300049822 Ga0501035_0035441 Ga0501035_0035441_141_1199 300
330 3300050496 nmdc:mga07m45_33614_c1 nmdc:mga07m45_33614_c1_809_1786 300
331 3300005335 Ga0070666_10019284 Ga0070666_100192842 301
332 3300005338 Ga0068868_100170719 Ga0068868_1001707191 301
333 3300005340 Ga0070689_100089976 Ga0070689_1000899762 301
334 3300005354 Ga0070675_100065833 Ga0070675_1000658332 301
335 3300005355 Ga0070671_100001843 Ga0070671_1000018432 301
336 3300005364 Ga0070673_100066019 Ga0070673_1000660191 301
337 3300005367 Ga0070667_100066934 Ga0070667_1000669342 301
338 3300005535 Ga0070684_100103958 Ga0070684_1001039581 301
339 3300005544 Ga0070686_100037582 Ga0070686_1000375822 301
340 3300005548 Ga0070665_100097987 Ga0070665_1000979871 301
341 3300005564 Ga0070664_100022450 Ga0070664_1000224502 301
342 3300005614 Ga0068856_100333968 Ga0068856_1003339682 301
343 3300005615 Ga0070702_100078656 Ga0070702_1000786562 301
344 3300005617 Ga0068859_100658147 Ga0068859_1006581471 301
345 3300005841 Ga0068863_100208949 Ga0068863_1002089492 301
346 3300005842 Ga0068858_100011883 Ga0068858_1000118833 301
347 3300006358 Ga0068871_100159579 Ga0068871_1001595792 301
348 3300006931 Ga0097620_100658223 Ga0097620_1006582231 301
349 3300009093 Ga0105240_10251318 Ga0105240_102513182 301
350 3300009098 Ga0105245_10254344 Ga0105245_102543442 301
351 3300009101 Ga0105247_10012713 Ga0105247_100127132 301
352 3300009551 Ga0105238_10001243 Ga0105238_100012434 301
353 3300009551 Ga0105238_10052924 Ga0105238_100529242 301
354 3300010375 Ga0105239_10142391 Ga0105239_101423912 301
355 3300011119 Ga0105246_10011961 Ga0105246_100119613 301
356 3300013296 Ga0157374_10035714 Ga0157374_100357142 301
357 3300013297 Ga0157378_10136919 Ga0157378_101369192 301
358 3300013306 Ga0163162_10060281 Ga0163162_100602812 301
359 3300013308 Ga0157375_10068128 Ga0157375_100681281 301
360 3300014325 Ga0163163_10085003 Ga0163163_100850032 301
361 3300014968 Ga0157379_10184432 Ga0157379_101844322 301
362 3300014969 Ga0157376_10319378 Ga0157376_103193781 301
363 3300015683 Ga0183362_10001 Ga0183362_10001788 301
364 3300025903 Ga0207680_10077324 Ga0207680_100773242 301
365 3300025924 Ga0207694_10126313 Ga0207694_101263132 301
366 3300025927 Ga0207687_10032857 Ga0207687_100328572 301
367 3300025931 Ga0207644_10008709 Ga0207644_100087094 301
368 3300025936 Ga0207670_10069272 Ga0207670_100692722 301
369 3300025941 Ga0207711_10003120 Ga0207711_1000312012 301
370 3300025945 Ga0207679_10008717 Ga0207679_100087172 301
371 3300025986 Ga0207658_10040972 Ga0207658_100409721 301
372 3300026035 Ga0207703_10095969 Ga0207703_100959691 301
373 3300026088 Ga0207641_10006113 Ga0207641_100061132 301
374 3300026095 Ga0207676_10007242 Ga0207676_100072422 301
375 3300028379 Ga0268266_10029837 Ga0268266_100298372 301
376 3300031548 Ga0307408_100098348 Ga0307408_1000983484 301
377 3300031730 Ga0307516_10001053 Ga0307516_100010534 301
378 3300048905 Ga0496102_0552900 Ga0496102_0552900_78_1064 301
379 3300048912 Ga0496109_0089462 Ga0496109_0089462_1480_2466 301
380 3300048915 Ga0496112_0127400 Ga0496112_0127400_799_1785 301
381 3300048916 Ga0496113_0119634 Ga0496113_0119634_870_1856 301
382 3300005336 Ga0070680_100062213 Ga0070680_1000622134 302
383 3300005458 Ga0070681_10216502 Ga0070681_102165022 302
384 3300005530 Ga0070679_100006933 Ga0070679_1000069334 302
385 3300006048 Ga0075363_100028759 Ga0075363_1000287592 302
386 3300006177 Ga0075362_10005526 Ga0075362_100055263 302
387 3300006353 Ga0075370_10003801 Ga0075370_100038015 302
388 3300025901 Ga0207688_10127630 Ga0207688_101276302 302
389 3300025912 Ga0207707_10225792 Ga0207707_102257922 302
390 3300025917 Ga0207660_10017667 Ga0207660_100176675 302
391 3300025921 Ga0207652_10063689 Ga0207652_100636894 302
392 3300031731 Ga0307405_10115181 Ga0307405_101151812 302
393 3300031901 Ga0307406_10291886 Ga0307406_102918862 302
394 3300032002 Ga0307416_100151369 Ga0307416_1001513692 302
395 3300039437 Ga0436365_1917885 Ga0436365_1917885_692_1672 302
396 3300041404 Ga0439436_0007927 Ga0439436_0007927_2282_3199 302
397 3300041406 Ga0439439_0002493 Ga0439439_0002493_1640_2557 302
398 3300041411 Ga0439466_0028682 Ga0439466_0028682_138_1055 302
399 3300041999 Ga0439433_0016990 Ga0439433_0016990_597_1514 302
400 3300042002 Ga0439442_008923 Ga0439442_008923_219_1136 302
401 3300042006 Ga0439432_027931 Ga0439432_027931_85_1002 302
402 3300042007 Ga0439449_0003417 Ga0439449_0003417_2340_3257 302
403 3300042014 Ga0439457_044293 Ga0439457_044293_47_964 302
404 3300042125 Ga0450923_001505 Ga0450923_001505_916_1833 302
405 3300042131 Ga0450894_009092 Ga0450894_009092_153_1070 302
406 3300042156 Ga0439446_0013170 Ga0439446_0013170_147_1064 302
407 3300042184 Ga0450908_009442 Ga0450908_009442_566_1483 302
408 3300044658 Ga0466972_0004058 Ga0466972_0004058_6015_7013 302
409 3300049742 Ga0501080_0126763 Ga0501080_0126763_330_1310 302
410 3300050490 nmdc:mga03n38_18474_c1 nmdc:mga03n38_18474_c1_1680_2597 302
411 3300050493 nmdc:mga0k408_60488_c1 nmdc:mga0k408_60488_c1_1255_2172 302
412 iso_pu_bacteria 2643221628 2644160021 302
413 iso_pu_bacteria 2842677519 2842680440 302
414 iso_pu_bacteria 2904449895 2904452283 302
415 iso_pu_bacteria 2904456579 2904458571 302
416 iso_pu_bacteria 2919462493 2919466336 302
417 iso_pu_bacteria 2945972063 2945976324 302
418 3300006880 Ga0075429_100019226 Ga0075429_1000192262 303
419 3300009545 Ga0105237_10035501 Ga0105237_100355014 303
420 3300050508 nmdc:mga09592_89510_c1 nmdc:mga09592_89510_c1_19_1056 303
421 3300050509 nmdc:mga0qj67_77025_c1 nmdc:mga0qj67_77025_c1_798_1835 303
422 3300050510 nmdc:mga06r32_16310_c1 nmdc:mga06r32_16310_c1_442_1479 303
423 iso_pu_bacteria 2643221544 2643745180 303
424 iso_pu_bacteria 2838054893 2838061755 303
425 3300049571 Ga0501034_0042352 Ga0501034_0042352_3262_4254 304
426 3300049742 Ga0501080_0003909 Ga0501080_0003909_8825_9817 304
427 3300049823 Ga0501044_0000691 Ga0501044_0000691_2583_3575 304
428 3300003578 Ga0006562J51391_1136022 Ga0006562J51391_11360222 305
429 3300005331 Ga0070670_100201633 Ga0070670_1002016332 305
430 3300005347 Ga0070668_100013298 Ga0070668_1000132982 305
431 3300005354 Ga0070675_100005416 Ga0070675_1000054163 305
432 3300005366 Ga0070659_100327527 Ga0070659_1003275272 305
433 3300013100 Ga0157373_10018978 Ga0157373_100189786 305
434 3300014497 Ga0182008_10051560 Ga0182008_100515602 305
435 3300014969 Ga0157376_10273812 Ga0157376_102738122 305
436 3300025919 Ga0207657_10039155 Ga0207657_100391556 305
437 3300025926 Ga0207659_10005626 Ga0207659_100056267 305
438 3300025940 Ga0207691_10197629 Ga0207691_101976292 305
439 3300044684 Ga0466966_0006654 Ga0466966_0006654_3274_4260 305
440 3300044693 Ga0466961_0008842 Ga0466961_0008842_1551_2537 305
441 3300048924 Ga0496121_0000762 Ga0496121_0000762_47876_48814 305
442 iso_pu_bacteria 2585428062 2587755996 305
443 iso_pu_bacteria 2643221585 2643935673 305
444 iso_pu_bacteria 2643221656 2644317456 305
445 iso_pu_bacteria 2929160207 2929165158 305
446 3300003773 Ga0055537_1000544 Ga0055537_100054413 306
447 3300003784 Ga0055534_1000494 Ga0055534_100049413 306
448 3300003790 Ga0055528_1002350 Ga0055528_10023509 306
449 3300005288 Ga0065714_10071324 Ga0065714_100713243 306
450 3300005548 Ga0070665_100262352 Ga0070665_1002623522 306
451 3300006177 Ga0075362_10006134 Ga0075362_100061342 306
452 3300006353 Ga0075370_10001936 Ga0075370_100019369 306
453 3300006948 Ga0099826_10000408 Ga0099826_1000040813 306
454 3300011119 Ga0105246_10091230 Ga0105246_100912302 306
455 3300025263 Ga0209565_1000138 Ga0209565_100013813 306
456 3300025273 Ga0209673_1000064 Ga0209673_100006413 306
457 3300025273 Ga0209673_1003257 Ga0209673_10032572 306
458 3300025291 Ga0209675_1000036 Ga0209675_100003613 306
459 3300025292 Ga0209676_1048528 Ga0209676_10485281 306
460 3300025303 Ga0209051_1000113 Ga0209051_100011317 306
461 3300025914 Ga0207671_10024778 Ga0207671_100247782 306
462 3300027666 Ga0209282_1000521 Ga0209282_10005218 306
463 3300030731 Ga0316177_1089736 Ga0316177_10897361 306
464 3300030733 Ga0314311_1055507 Ga0314311_10555075 306
465 3300030736 Ga0316180_1039863 Ga0316180_10398631 306
466 3300031649 Ga0307514_10108540 Ga0307514_101085402 306
467 3300031901 Ga0307406_10002407 Ga0307406_100024072 306
468 3300031911 Ga0307412_10215557 Ga0307412_102155572 306
469 3300032004 Ga0307414_10036574 Ga0307414_100365743 306
470 3300041411 Ga0439466_0060726 Ga0439466_0060726_31_993 306
471 3300041413 Ga0439465_0028288 Ga0439465_0028288_450_1412 306
472 3300042002 Ga0439442_007132 Ga0439442_007132_240_1202 306
473 3300042121 Ga0450919_007325 Ga0450919_007325_33_995 306
474 3300042125 Ga0450923_010263 Ga0450923_010263_101_1063 306
475 3300042134 Ga0450898_014796 Ga0450898_014796_33_995 306
476 3300042145 Ga0450906_001314 Ga0450906_001314_300_1262 306
477 3300042185 Ga0450909_011553 Ga0450909_011553_59_1021 306
478 3300046660 Ga0495625_0000057 Ga0495625_0000057_7524_8492 306
479 3300049649 Ga0501198_000015 Ga0501198_000015_54429_55433 306
480 3300049662 Ga0501222_000540 Ga0501222_000540_4335_5339 306
481 3300049705 Ga0501225_0024214 Ga0501225_0024214_335_1297 306
482 3300049759 Ga0501262_000028 Ga0501262_000028_8585_9547 306
483 3300050489 nmdc:mga03683_1056_c1 nmdc:mga03683_1056_c1_6977_7942 306
484 3300050496 nmdc:mga07m45_59_c1 nmdc:mga07m45_59_c1_6882_7844 306
485 3300050516 nmdc:mga0sz30_5751_c1 nmdc:mga0sz30_5751_c1_1472_2437 306
486 3300053148 Ga0500590_007880 Ga0500590_007880_2044_3006 306
487 iso_pu_bacteria 2842733646 2842738934 306
488 3300003316 rootH1_10034705 rootH1_100347054 307
489 3300003323 rootH1_10134544 rootH1_101345444 307
490 3300003323 rootH1_10168926 rootH1_101689263 307
491 3300005616 Ga0068852_100085617 Ga0068852_1000856175 307
492 3300009176 Ga0105242_10076846 Ga0105242_100768463 307
493 3300025934 Ga0207686_10048026 Ga0207686_100480263 307
494 3300026023 Ga0207677_10328371 Ga0207677_103283711 307
495 3300028794 Ga0307515_10197516 Ga0307515_101975162 307
496 3300031548 Ga0307408_100000026 Ga0307408_100000026190 307
497 3300032004 Ga0307414_10370429 Ga0307414_103704292 307
498 3300032005 Ga0307411_10035182 Ga0307411_100351823 307
499 3300037471 Ga0395905_0010349 Ga0395905_0010349_2497_3483 307
500 3300044683 Ga0466965_0010749 Ga0466965_0010749_434_1432 307
501 3300045051 Ga0451576_0578170 Ga0451576_0578170_40_1008 307
502 3300049580 Ga0501046_0000007 Ga0501046_0000007_129595_130602 307
503 3300049582 Ga0501048_0002373 Ga0501048_0002373_11110_12117 307
504 3300049658 Ga0501211_006287 Ga0501211_006287_149_1129 307
505 3300049662 Ga0501222_003387 Ga0501222_003387_1017_1997 307
506 3300049669 Ga0501235_005038 Ga0501235_005038_301_1281 307
507 3300049704 Ga0501221_001344 Ga0501221_001344_1548_2528 307
508 3300049744 Ga0501083_0000046 Ga0501083_0000046_77463_78470 307
509 3300049769 Ga0501272_002337 Ga0501272_002337_441_1421 307
510 3300049822 Ga0501035_0010010 Ga0501035_0010010_5690_6697 307
511 3300049823 Ga0501044_0068317 Ga0501044_0068317_583_1590 307
512 3300050496 nmdc:mga07m45_42289_c1 nmdc:mga07m45_42289_c1_584_1546 307
513 3300005355 Ga0070671_100259234 Ga0070671_1002592341 308
514 3300005543 Ga0070672_100072430 Ga0070672_1000724302 308
515 3300005841 Ga0068863_100105074 Ga0068863_1001050743 308
516 3300006237 Ga0097621_100091399 Ga0097621_1000913993 308
517 3300009177 Ga0105248_10001546 Ga0105248_1000154610 308
518 3300014325 Ga0163163_10677048 Ga0163163_106770481 308
519 3300025940 Ga0207691_10050458 Ga0207691_100504583 308
520 3300025949 Ga0207667_10047017 Ga0207667_100470172 308
521 3300031730 Ga0307516_10177457 Ga0307516_101774572 308
522 iso_pu_bacteria 2945945610 2945946601 308
523 3300003187 JGI25151J46595_10007041 JGI25151J46595_100070416 309
524 3300005334 Ga0068869_100005398 Ga0068869_1000053985 309
525 3300005339 Ga0070660_100018945 Ga0070660_1000189454 309
526 3300005344 Ga0070661_100007506 Ga0070661_1000075066 309
527 3300005354 Ga0070675_100012809 Ga0070675_1000128092 309
528 3300005356 Ga0070674_100119556 Ga0070674_1001195561 309
529 3300005366 Ga0070659_100003263 Ga0070659_1000032635 309
530 3300005366 Ga0070659_100021770 Ga0070659_1000217703 309
531 3300005455 Ga0070663_100113931 Ga0070663_1001139311 309
532 3300005456 Ga0070678_100085005 Ga0070678_1000850051 309
533 3300005457 Ga0070662_100019586 Ga0070662_1000195864 309
534 3300005535 Ga0070684_100015224 Ga0070684_1000152245 309
535 3300005535 Ga0070684_100210820 Ga0070684_1002108203 309
536 3300005543 Ga0070672_100437728 Ga0070672_1004377281 309
537 3300005563 Ga0068855_100097495 Ga0068855_1000974953 309
538 3300005564 Ga0070664_100002952 Ga0070664_10000295216 309
539 3300005578 Ga0068854_100003177 Ga0068854_1000031776 309
540 3300005614 Ga0068856_100121603 Ga0068856_1001216033 309
541 3300005616 Ga0068852_100031572 Ga0068852_1000315726 309
542 3300005616 Ga0068852_100062542 Ga0068852_1000625425 309
543 3300005618 Ga0068864_100006397 Ga0068864_1000063978 309
544 3300005618 Ga0068864_100226386 Ga0068864_1002263862 309
545 3300005834 Ga0068851_10008604 Ga0068851_100086045 309
546 3300005834 Ga0068851_10027727 Ga0068851_100277273 309
547 3300005841 Ga0068863_100291272 Ga0068863_1002912723 309
548 3300006195 Ga0075366_10064581 Ga0075366_100645813 309
549 3300006846 Ga0075430_100035882 Ga0075430_1000358823 309
550 3300006931 Ga0097620_100106515 Ga0097620_1001065154 309
551 3300009098 Ga0105245_10030772 Ga0105245_100307724 309
552 3300009177 Ga0105248_10066735 Ga0105248_100667355 309
553 3300013105 Ga0157369_10026826 Ga0157369_100268267 309
554 3300013296 Ga0157374_10060197 Ga0157374_100601973 309
555 3300013306 Ga0163162_10070135 Ga0163162_100701355 309
556 3300013307 Ga0157372_10013839 Ga0157372_100138394 309
557 3300013307 Ga0157372_10013841 Ga0157372_100138418 309
558 3300013308 Ga0157375_10354687 Ga0157375_103546873 309
559 3300014326 Ga0157380_10062669 Ga0157380_100626692 309
560 3300014745 Ga0157377_10000246 Ga0157377_100002462 309
561 3300014968 Ga0157379_10157266 Ga0157379_101572662 309
562 3300017792 Ga0163161_10027428 Ga0163161_100274285 309
563 3300025294 Ga0209025_1000938 Ga0209025_100093839 309
564 3300025303 Ga0209051_1002717 Ga0209051_10027175 309
565 3300025321 Ga0207656_10023745 Ga0207656_100237453 309
566 3300025901 Ga0207688_10039840 Ga0207688_100398403 309
567 3300025919 Ga0207657_10050479 Ga0207657_100504794 309
568 3300025920 Ga0207649_10008827 Ga0207649_100088276 309
569 3300025921 Ga0207652_10271781 Ga0207652_102717812 309
570 3300025923 Ga0207681_10360780 Ga0207681_103607802 309
571 3300025924 Ga0207694_10055328 Ga0207694_100553284 309
572 3300025926 Ga0207659_10014964 Ga0207659_100149644 309
573 3300025927 Ga0207687_10071446 Ga0207687_100714462 309
574 3300025931 Ga0207644_10000803 Ga0207644_100008035 309
575 3300025932 Ga0207690_10009936 Ga0207690_100099362 309
576 3300025932 Ga0207690_10059497 Ga0207690_100594974 309
577 3300025933 Ga0207706_10002100 Ga0207706_1000210011 309
578 3300025942 Ga0207689_10002362 Ga0207689_100023626 309
579 3300025945 Ga0207679_10328535 Ga0207679_103285352 309
580 3300025949 Ga0207667_10145685 Ga0207667_101456854 309
581 3300025949 Ga0207667_10285819 Ga0207667_102858191 309
582 3300025960 Ga0207651_10050856 Ga0207651_100508561 309
583 3300025981 Ga0207640_10077683 Ga0207640_100776834 309
584 3300026067 Ga0207678_10007096 Ga0207678_100070966 309
585 3300026078 Ga0207702_10012210 Ga0207702_1001221010 309
586 3300026089 Ga0207648_10086547 Ga0207648_100865474 309
587 3300026095 Ga0207676_10107345 Ga0207676_101073452 309
588 3300026095 Ga0207676_10213022 Ga0207676_102130222 309
589 3300026116 Ga0207674_10039028 Ga0207674_100390282 309
590 3300026118 Ga0207675_100000273 Ga0207675_1000002735 309
591 3300026121 Ga0207683_10063103 Ga0207683_100631033 309
592 3300026142 Ga0207698_10012920 Ga0207698_100129202 309
593 3300026142 Ga0207698_10125034 Ga0207698_101250344 309
594 3300028380 Ga0268265_10464344 Ga0268265_104643442 309
595 3300028794 Ga0307515_10082486 Ga0307515_100824862 309
596 3300031456 Ga0307513_10043216 Ga0307513_100432164 309
597 3300031456 Ga0307513_10118073 Ga0307513_101180732 309
598 3300031507 Ga0307509_10008945 Ga0307509_100089453 309
599 3300031616 Ga0307508_10000222 Ga0307508_1000022255 309
600 3300031730 Ga0307516_10042854 Ga0307516_100428543 309
601 3300031911 Ga0307412_10123087 Ga0307412_101230872 309
602 3300033179 Ga0307507_10143225 Ga0307507_101432252 309
603 3300033180 Ga0307510_10216326 Ga0307510_102163262 309
604 3300041404 Ga0439436_0001289 Ga0439436_0001289_2053_3003 309
605 3300041411 Ga0439466_0018193 Ga0439466_0018193_249_1199 309
606 3300041413 Ga0439465_0001535 Ga0439465_0001535_3836_4786 309
607 3300041452 Ga0451793_0233126 Ga0451793_0233126_189_1166 309
608 3300041453 Ga0451797_0100768 Ga0451797_0100768_629_1606 309
609 3300041496 Ga0451839_0654308 Ga0451839_0654308_46_1023 309
610 3300041997 Ga0439431_0000205 Ga0439431_0000205_7706_8656 309
611 3300041999 Ga0439433_0002049 Ga0439433_0002049_1234_2184 309
612 3300042004 Ga0439445_0001824 Ga0439445_0001824_3130_4080 309
613 3300042006 Ga0439432_001895 Ga0439432_001895_4769_5719 309
614 3300042007 Ga0439449_0001384 Ga0439449_0001384_345_1295 309
615 3300042007 Ga0439449_0018173 Ga0439449_0018173_1658_2611 309
616 3300042015 Ga0439462_0018997 Ga0439462_0018997_670_1620 309
617 3300042156 Ga0439446_0002478 Ga0439446_0002478_2774_3724 309
618 3300044683 Ga0466965_0085445 Ga0466965_0085445_291_1250 309
619 3300046512 Ga0495610_0076078 Ga0495610_0076078_465_1442 309
620 3300046660 Ga0495625_0006349 Ga0495625_0006349_6416_7393 309
621 3300048905 Ga0496102_0054088 Ga0496102_0054088_1456_2436 309
622 3300048907 Ga0496104_0052530 Ga0496104_0052530_1255_2235 309
623 3300048909 Ga0496106_0047730 Ga0496106_0047730_1520_2500 309
624 3300048910 Ga0496107_0039482 Ga0496107_0039482_1283_2263 309
625 3300048914 Ga0496111_0049406 Ga0496111_0049406_2018_2998 309
626 3300048917 Ga0496114_0050992 Ga0496114_0050992_852_1832 309
627 3300050508 nmdc:mga09592_43010_c1 nmdc:mga09592_43010_c1_1921_2916 309
628 3300002773 JGI25152J39213_1006552 JGI25152J39213_10065522 310
629 3300003771 Ga0055526_1006587 Ga0055526_10065877 310
630 3300005331 Ga0070670_100142038 Ga0070670_1001420381 310
631 3300005331 Ga0070670_100176784 Ga0070670_1001767842 310
632 3300005334 Ga0068869_100015284 Ga0068869_1000152844 310
633 3300005335 Ga0070666_10000632 Ga0070666_1000063215 310
634 3300005335 Ga0070666_10035838 Ga0070666_100358382 310
635 3300005339 Ga0070660_100132602 Ga0070660_1001326022 310
636 3300005340 Ga0070689_100208444 Ga0070689_1002084442 310
637 3300005343 Ga0070687_100004159 Ga0070687_1000041594 310
638 3300005347 Ga0070668_100003835 Ga0070668_1000038356 310
639 3300005353 Ga0070669_100001974 Ga0070669_1000019749 310
640 3300005354 Ga0070675_100029594 Ga0070675_1000295943 310
641 3300005356 Ga0070674_100000657 Ga0070674_1000006577 310
642 3300005364 Ga0070673_100130092 Ga0070673_1001300922 310
643 3300005367 Ga0070667_100006184 Ga0070667_1000061845 310
644 3300005456 Ga0070678_100036279 Ga0070678_1000362793 310
645 3300005457 Ga0070662_100008473 Ga0070662_1000084735 310
646 3300005459 Ga0068867_100000424 Ga0068867_1000004245 310
647 3300005543 Ga0070672_100003390 Ga0070672_1000033905 310
648 3300005564 Ga0070664_100196618 Ga0070664_1001966183 310
649 3300005616 Ga0068852_100007034 Ga0068852_1000070344 310
650 3300005616 Ga0068852_100062905 Ga0068852_1000629052 310
651 3300005718 Ga0068866_10002303 Ga0068866_100023034 310
652 3300005719 Ga0068861_100001445 Ga0068861_10000144511 310
653 3300005834 Ga0068851_10049347 Ga0068851_100493472 310
654 3300005841 Ga0068863_100000793 Ga0068863_10000079318 310
655 3300005842 Ga0068858_100007270 Ga0068858_1000072704 310
656 3300005843 Ga0068860_100000216 Ga0068860_10000021673 310
657 3300006237 Ga0097621_100324333 Ga0097621_1003243332 310
658 3300006358 Ga0068871_100138408 Ga0068871_1001384082 310
659 3300006358 Ga0068871_100159987 Ga0068871_1001599872 310
660 3300006881 Ga0068865_100042684 Ga0068865_1000426843 310
661 3300009148 Ga0105243_10007628 Ga0105243_100076284 310
662 3300009176 Ga0105242_10020867 Ga0105242_100208674 310
663 3300009545 Ga0105237_10006409 Ga0105237_100064095 310
664 3300009553 Ga0105249_10006350 Ga0105249_100063509 310
665 3300013296 Ga0157374_10165877 Ga0157374_101658772 310
666 3300013306 Ga0163162_10004873 Ga0163162_100048734 310
667 3300013308 Ga0157375_10002130 Ga0157375_100021303 310
668 3300014326 Ga0157380_10002054 Ga0157380_100020543 310
669 3300014968 Ga0157379_10000977 Ga0157379_100009779 310
670 3300025245 Ga0207425_1000254 Ga0207425_10002547 310
671 3300025258 Ga0209129_1000035 Ga0209129_1000035156 310
672 3300025295 Ga0209564_1000024 Ga0209564_1000024350 310
673 3300025297 Ga0209758_1000066 Ga0209758_1000066162 310
674 3300025304 Ga0209257_1036695 Ga0209257_10366952 310
675 3300025315 Ga0207697_10059264 Ga0207697_100592642 310
676 3300025893 Ga0207682_10001443 Ga0207682_100014433 310
677 3300025893 Ga0207682_10070862 Ga0207682_100708622 310
678 3300025899 Ga0207642_10024852 Ga0207642_100248523 310
679 3300025903 Ga0207680_10020860 Ga0207680_100208603 310
680 3300025903 Ga0207680_10063998 Ga0207680_100639982 310
681 3300025907 Ga0207645_10004200 Ga0207645_100042005 310
682 3300025908 Ga0207643_10167634 Ga0207643_101676342 310
683 3300025909 Ga0207705_10060723 Ga0207705_100607232 310
684 3300025918 Ga0207662_10007091 Ga0207662_100070916 310
685 3300025919 Ga0207657_10151052 Ga0207657_101510523 310
686 3300025923 Ga0207681_10000162 Ga0207681_1000016213 310
687 3300025925 Ga0207650_10169565 Ga0207650_101695652 310
688 3300025926 Ga0207659_10012076 Ga0207659_100120763 310
689 3300025931 Ga0207644_10132150 Ga0207644_101321502 310
690 3300025933 Ga0207706_10014083 Ga0207706_100140835 310
691 3300025933 Ga0207706_10048887 Ga0207706_100488873 310
692 3300025934 Ga0207686_10008635 Ga0207686_100086354 310
693 3300025935 Ga0207709_10009952 Ga0207709_100099522 310
694 3300025937 Ga0207669_10001640 Ga0207669_100016404 310
695 3300025938 Ga0207704_10001096 Ga0207704_100010967 310
696 3300025940 Ga0207691_10012987 Ga0207691_100129874 310
697 3300025940 Ga0207691_10030305 Ga0207691_100303054 310
698 3300025942 Ga0207689_10002739 Ga0207689_100027397 310
699 3300025945 Ga0207679_10324393 Ga0207679_103243932 310
700 3300025960 Ga0207651_10082929 Ga0207651_100829292 310
701 3300025972 Ga0207668_10002399 Ga0207668_100023995 310
702 3300025986 Ga0207658_10000181 Ga0207658_1000018135 310
703 3300026023 Ga0207677_10315386 Ga0207677_103153861 310
704 3300026035 Ga0207703_10016526 Ga0207703_100165264 310
705 3300026067 Ga0207678_10256216 Ga0207678_102562162 310
706 3300026075 Ga0207708_10254791 Ga0207708_102547911 310
707 3300026088 Ga0207641_10001206 Ga0207641_1000120621 310
708 3300026089 Ga0207648_10012095 Ga0207648_100120955 310
709 3300026095 Ga0207676_10218481 Ga0207676_102184813 310
710 3300026118 Ga0207675_100015774 Ga0207675_1000157742 310
711 3300026121 Ga0207683_10134011 Ga0207683_101340112 310
712 3300026142 Ga0207698_10007407 Ga0207698_100074074 310
713 3300028381 Ga0268264_10002185 Ga0268264_100021857 310
714 3300028794 Ga0307515_10004838 Ga0307515_100048387 310
715 3300028794 Ga0307515_10066724 Ga0307515_100667245 310
716 3300031730 Ga0307516_10061501 Ga0307516_100615013 310
717 3300031911 Ga0307412_10262098 Ga0307412_102620982 310
718 3300031995 Ga0307409_100011603 Ga0307409_1000116035 310
719 3300032002 Ga0307416_100001205 Ga0307416_10000120517 310
720 3300032126 Ga0307415_100018199 Ga0307415_1000181994 310
721 3300048911 Ga0496108_0038014 Ga0496108_0038014_2615_3577 310
722 3300048924 Ga0496121_0063636 Ga0496121_0063636_1539_2534 310
723 3300048927 Ga0496124_0000086 Ga0496124_0000086_191654_192649 310
724 3300048928 Ga0496125_0029046 Ga0496125_0029046_1631_2626 310
725 3300050511 nmdc:mga08y16_186202_c1 nmdc:mga08y16_186202_c1_142_1128 310
726 3300005331 Ga0070670_100055280 Ga0070670_1000552802 311
727 3300005333 Ga0070677_10018435 Ga0070677_100184352 311
728 3300005354 Ga0070675_100076015 Ga0070675_1000760153 311
729 3300005457 Ga0070662_100094189 Ga0070662_1000941892 311
730 3300005459 Ga0068867_100000047 Ga0068867_10000004720 311
731 3300005543 Ga0070672_100217772 Ga0070672_1002177722 311
732 3300005564 Ga0070664_100195180 Ga0070664_1001951802 311
733 3300005718 Ga0068866_10090767 Ga0068866_100907672 311
734 3300005844 Ga0068862_100334171 Ga0068862_1003341712 311
735 3300006195 Ga0075366_10076142 Ga0075366_100761422 311
736 3300006353 Ga0075370_10077658 Ga0075370_100776582 311
737 3300009148 Ga0105243_10004148 Ga0105243_100041482 311
738 3300014969 Ga0157376_10108867 Ga0157376_101088672 311
739 3300025893 Ga0207682_10003883 Ga0207682_100038832 311
740 3300025926 Ga0207659_10074219 Ga0207659_100742191 311
741 3300025933 Ga0207706_10071755 Ga0207706_100717553 311
742 3300025940 Ga0207691_10037465 Ga0207691_100374652 311
743 3300025941 Ga0207711_10177630 Ga0207711_101776302 311
744 3300025960 Ga0207651_10243076 Ga0207651_102430762 311
745 3300028380 Ga0268265_10125350 Ga0268265_101253502 311
746 3300037418 Ga0395900_0000054 Ga0395900_0000054_209646_210659 311
747 3300037466 Ga0395898_0000485 Ga0395898_0000485_55540_56553 311
748 3300037471 Ga0395905_0028723 Ga0395905_0028723_754_1740 311
749 3300045051 Ga0451576_0197347 Ga0451576_0197347_353_1366 311
750 iso_pu_bacteria 2831265667 2831272083 311
751 3300005455 Ga0070663_100001081 Ga0070663_1000010812 312
752 3300005543 Ga0070672_100013936 Ga0070672_1000139367 312
753 3300005577 Ga0068857_100017776 Ga0068857_1000177767 312
754 3300005616 Ga0068852_100015220 Ga0068852_1000152205 312
755 3300006177 Ga0075362_10117549 Ga0075362_101175491 312
756 3300006195 Ga0075366_10016780 Ga0075366_100167802 312
757 3300006195 Ga0075366_10123972 Ga0075366_101239722 312
758 3300006353 Ga0075370_10014723 Ga0075370_100147232 312
759 3300013308 Ga0157375_10082218 Ga0157375_100822182 312
760 3300025292 Ga0209676_1004374 Ga0209676_10043746 312
761 3300025303 Ga0209051_1009665 Ga0209051_10096652 312
762 3300025907 Ga0207645_10001729 Ga0207645_1000172912 312
763 3300025925 Ga0207650_10123616 Ga0207650_101236162 312
764 3300025933 Ga0207706_10010173 Ga0207706_100101736 312
765 3300025935 Ga0207709_10023354 Ga0207709_100233542 312
766 3300025940 Ga0207691_10062505 Ga0207691_100625054 312
767 3300025942 Ga0207689_10007372 Ga0207689_100073726 312
768 3300025960 Ga0207651_10027488 Ga0207651_100274884 312
769 3300025961 Ga0207712_10381751 Ga0207712_103817512 312
770 3300026023 Ga0207677_10035435 Ga0207677_100354352 312
771 3300026067 Ga0207678_10002867 Ga0207678_100028679 312
772 3300026089 Ga0207648_10003584 Ga0207648_100035844 312
773 3300026116 Ga0207674_10003102 Ga0207674_1000310218 312
774 3300026121 Ga0207683_10031632 Ga0207683_100316325 312
775 3300026142 Ga0207698_10003201 Ga0207698_100032013 312
776 3300031456 Ga0307513_10281371 Ga0307513_102813712 312
777 3300037471 Ga0395905_0003176 Ga0395905_0003176_7530_8504 312
778 3300042134 Ga0450898_006256 Ga0450898_006256_565_1566 312
779 3300044693 Ga0466961_0030141 Ga0466961_0030141_841_1848 312
780 3300044706 Ga0466964_0002963 Ga0466964_0002963_3428_4435 312
781 3300044719 Ga0466971_0078343 Ga0466971_0078343_483_1490 312
782 3300045049 Ga0466959_0016205 Ga0466959_0016205_975_1982 312
783 3300045976 Ga0466967_0019917 Ga0466967_0019917_1778_2785 312
784 3300050489 nmdc:mga03683_63977_c1 nmdc:mga03683_63977_c1_56_1036 312
785 3300053153 Ga0500616_0001154 Ga0500616_0001154_2731_3696 312
786 3300009148 Ga0105243_10001038 Ga0105243_100010384 313
787 3300009148 Ga0105243_10047155 Ga0105243_100471554 313
788 3300014745 Ga0157377_10000083 Ga0157377_1000008312 313
789 3300026089 Ga0207648_10091747 Ga0207648_100917472 313
790 3300027866 Ga0209813_10049692 Ga0209813_100496922 313
791 3300044656 Ga0466969_0017798 Ga0466969_0017798_843_1868 313
792 3300049579 Ga0501043_0110669 Ga0501043_0110669_1033_2043 313
793 3300049580 Ga0501046_0001185 Ga0501046_0001185_24222_25232 313
794 3300049581 Ga0501047_0001232 Ga0501047_0001232_114_1124 313
795 3300049582 Ga0501048_0006947 Ga0501048_0006947_89_1099 313
796 3300049823 Ga0501044_0328662 Ga0501044_0328662_66_1076 313
797 3300049824 Ga0501045_0042015 Ga0501045_0042015_1141_2151 313
798 3300050493 nmdc:mga0k408_135021_c1 nmdc:mga0k408_135021_c1_348_1355 313
799 3300050494 nmdc:mga06z11_86570_c1 nmdc:mga06z11_86570_c1_566_1573 313
800 3300050495 nmdc:mga04h51_25130_c1 nmdc:mga04h51_25130_c1_321_1328 313
801 3300050496 nmdc:mga07m45_156406_c1 nmdc:mga07m45_156406_c1_205_1212 313
802 3300061719 Ga0466962_0015334 Ga0466962_0015334_2632_3657 313
803 3300002773 JGI25152J39213_1006017 JGI25152J39213_10060173 315
804 3300002774 JGI25150J39212_1005920 JGI25150J39212_10059202 315
805 3300003187 JGI25151J46595_10026948 JGI25151J46595_100269482 315
806 3300003215 JGI25153J46596_10022611 JGI25153J46596_100226112 315
807 3300003374 JGI25161J50226_1002151 JGI25161J50226_10021513 315
808 3300003771 Ga0055526_1003917 Ga0055526_10039175 315
809 3300003781 Ga0055536_1001372 Ga0055536_10013722 315
810 3300003784 Ga0055534_1008056 Ga0055534_10080562 315
811 3300003791 Ga0055530_10000110 Ga0055530_1000011044 315
812 3300003792 Ga0055540_1001401 Ga0055540_10014019 315
813 3300003794 Ga0055531_10001413 Ga0055531_100014133 315
814 3300004625 Ga0055543_1000644 Ga0055543_100064415 315
815 3300006177 Ga0075362_10017513 Ga0075362_100175134 315
816 3300006353 Ga0075370_10026589 Ga0075370_100265892 315
817 3300006353 Ga0075370_10110263 Ga0075370_101102633 315
818 3300012505 Ga0157339_1000950 Ga0157339_10009502 315
819 3300025245 Ga0207425_1002288 Ga0207425_10022884 315
820 3300025258 Ga0209129_1001670 Ga0209129_10016704 315
821 3300025273 Ga0209673_1000814 Ga0209673_10008143 315
822 3300025284 Ga0209130_1000468 Ga0209130_10004683 315
823 3300025291 Ga0209675_1007050 Ga0209675_10070502 315
824 3300025292 Ga0209676_1000125 Ga0209676_100012542 315
825 3300025294 Ga0209025_1016025 Ga0209025_10160252 315
826 3300025295 Ga0209564_1000833 Ga0209564_10008333 315
827 3300025298 Ga0209050_1000012 Ga0209050_1000012742 315
828 3300025299 Ga0209256_1000764 Ga0209256_10007643 315
829 3300025302 Ga0207426_1000667 Ga0207426_10006673 315
830 3300025303 Ga0209051_1000332 Ga0209051_100033242 315
831 3300025304 Ga0209257_1000024 Ga0209257_1000024688 315
832 3300050489 nmdc:mga03683_15637_c1 nmdc:mga03683_15637_c1_1840_2814 315
833 3300050493 nmdc:mga0k408_57521_c1 nmdc:mga0k408_57521_c1_850_1851 315
834 3300050496 nmdc:mga07m45_61132_c1 nmdc:mga07m45_61132_c1_787_1746 315
835 3300005367 Ga0070667_100232179 Ga0070667_1002321792 317
836 3300005841 Ga0068863_100019711 Ga0068863_1000197112 317
837 3300009177 Ga0105248_10024066 Ga0105248_100240663 317
838 3300025986 Ga0207658_10203124 Ga0207658_102031242 317
839 3300053085 Ga0495619_0107890 Ga0495619_0107890_11_1021 317
840 3300030735 Ga0316178_1036717 Ga0316178_10367172 318
841 3300030744 Ga0316181_1234386 Ga0316181_12343862 318
842 3300031731 Ga0307405_10007710 Ga0307405_100077102 318
843 3300032002 Ga0307416_100156290 Ga0307416_1001562902 319
844 3300026078 Ga0207702_10444242 Ga0207702_104442421 320
845 3300044656 Ga0466969_0000002 Ga0466969_0000002_16633_17763 320
846 3300002773 JGI25152J39213_1000235 JGI25152J39213_100023522 321
847 3300002774 JGI25150J39212_1002798 JGI25150J39212_10027983 321
848 3300002987 JGI25159J45721_1000103 JGI25159J45721_100010316 321
849 3300003187 JGI25151J46595_10000696 JGI25151J46595_1000069622 321
850 3300003215 JGI25153J46596_10000298 JGI25153J46596_1000029822 321
851 3300003354 JGI25160J50197_1000255 JGI25160J50197_100025526 321
852 3300003374 JGI25161J50226_1002672 JGI25161J50226_10026724 321
853 3300003771 Ga0055526_1000357 Ga0055526_100035716 321
854 3300003773 Ga0055537_1000274 Ga0055537_100027422 321
855 3300003775 Ga0055524_1000400 Ga0055524_100040022 321
856 3300003784 Ga0055534_1000255 Ga0055534_100025522 321
857 3300003790 Ga0055528_1000277 Ga0055528_100027724 321
858 3300003794 Ga0055531_10003669 Ga0055531_100036697 321
859 3300004625 Ga0055543_1000262 Ga0055543_100026226 321
860 3300005262 Ga0065165_1000494 Ga0065165_100049426 321
861 3300005841 Ga0068863_100196143 Ga0068863_1001961432 321
862 3300005843 Ga0068860_100376181 Ga0068860_1003761812 321
863 3300006048 Ga0075363_100025332 Ga0075363_1000253322 321
864 3300014968 Ga0157379_10055099 Ga0157379_100550992 321
865 3300025208 Ga0209436_105818 Ga0209436_1058182 321
866 3300025245 Ga0207425_1000087 Ga0207425_100008736 321
867 3300025258 Ga0209129_1000007 Ga0209129_1000007676 321
868 3300025263 Ga0209565_1000038 Ga0209565_1000038123 321
869 3300025273 Ga0209673_1000080 Ga0209673_1000080138 321
870 3300025284 Ga0209130_1000137 Ga0209130_100013737 321
871 3300025291 Ga0209675_1000102 Ga0209675_100010223 321
872 3300025294 Ga0209025_1000056 Ga0209025_1000056162 321
873 3300025295 Ga0209564_1000073 Ga0209564_1000073198 321
874 3300025297 Ga0209758_1000044 Ga0209758_1000044149 321
875 3300025299 Ga0209256_1000020 Ga0209256_1000020152 321
876 3300025302 Ga0207426_1000001 Ga0207426_1000001787 321
877 3300025303 Ga0209051_1032044 Ga0209051_10320442 321
878 3300025304 Ga0209257_1000222 Ga0209257_100022288 321
879 3300025935 Ga0207709_10002423 Ga0207709_100024239 321
880 3300026089 Ga0207648_10000091 Ga0207648_1000009121 321
881 3300028381 Ga0268264_10311160 Ga0268264_103111601 321
882 3300031911 Ga0307412_10103102 Ga0307412_101031022 321
883 3300032002 Ga0307416_100393049 Ga0307416_1003930491 321
884 3300032004 Ga0307414_10053714 Ga0307414_100537144 321
885 3300032005 Ga0307411_10241423 Ga0307411_102414231 321
886 3300050490 nmdc:mga03n38_7431_c1 nmdc:mga03n38_7431_c1_2591_3688 321
887 iso_pu_bacteria 2899924645 2899928688 324
888 iso_pu_bacteria 2928037797 2928043367 324
889 iso_pu_bacteria 2928044640 2928050809 324
890 iso_pu_bacteria 2928051484 2928056291 324
891 iso_pu_bacteria 2928064002 2928066226 324
892 3300005331 Ga0070670_100027541 Ga0070670_1000275414 327
893 3300005334 Ga0068869_100003103 Ga0068869_1000031036 327
894 3300005456 Ga0070678_100085493 Ga0070678_1000854932 327
895 3300005457 Ga0070662_100019349 Ga0070662_1000193492 327
896 3300005459 Ga0068867_100004082 Ga0068867_1000040824 327
897 3300025933 Ga0207706_10044187 Ga0207706_100441872 327
898 3300003761 Ga0055535_1000075 Ga0055535_100007571 328
899 3300003762 Ga0055542_1000059 Ga0055542_1000059118 328
900 3300013102 Ga0157371_10102595 Ga0157371_101025952 328
901 3300025228 Ga0209672_101676 Ga0209672_1016764 328
902 3300025229 Ga0209147_100323 Ga0209147_10032322 328
903 3300025242 Ga0209258_100078 Ga0209258_10007829 328
904 3300025254 Ga0209148_1000086 Ga0209148_100008629 328
905 3300048928 Ga0496125_0019805 Ga0496125_0019805_174_1181 328
906 3300001979 JGI24740J21852_10014614 JGI24740J21852_100146142 330
907 3300005539 Ga0068853_100003221 Ga0068853_1000032214 330
908 3300026041 Ga0207639_10005201 Ga0207639_100052012 330
909 3300048927 Ga0496124_0027862 Ga0496124_0027862_1441_2454 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01904

DUF72

Protein of unknown function DUF72

71

336

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.8059 25 309
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.7971 25 309
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.7601 21 311
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.7573 21 311
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.7488 26 311
ID Description Score Start End Superfamily
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8059 25 309 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7971 25 309 3.20.20.410
1vpyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7586 23 311 3.20.20.410
af_P37348_1_259_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7533 26 308 3.20.20.410
1vpyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7528 23 311 3.20.20.410
ID Description Score Start End GO Terms
AF-A0A536VSC8-F1-model_v4 DUF72 domain-containing protein 0.9987 24 141
AF-A0A7W5LGV9-F1-model_v4 Uncharacterized protein YecE (DUF72 family) 0.9935 24 168
AF-A0A4Y9S332-F1-model_v4 DUF72 domain-containing protein 0.9928 24 309
AF-A0A7Y7LQ92-F1-model_v4 Uncharacterized protein YecE (DUF72 family) 0.9925 24 308
AF-A0A536VHC3-F1-model_v4 DUF72 domain-containing protein 0.9921 23 316

Feature Viewer

pLDDT pTM Quality
88.53 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map