F485393

General Info

Members Datasets Scaffolds Average Seq Length
908 413 907 249

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0065203|Ga0373934_0065203_15_815
Length 266
Sequence MSDFDRSAGIGPAAPVVGADEGQPRPALPPVPHHGMMSRIRNYFLTGLVLVGPLYITANLTWWFINWVDDLVRPLIPATYRPETYLPMHIPGTGLIIAFLALTVLGFLTANLVGRTLVEFGENILNRMPVVRPIYKSLKQIFETLFSNSGSSFRRVGLVEFPAPGMWSLVFLSQPPGANIAARLPEAEHISAFMPCTPNPTTGFFFYVPRRDVIDLDITVETAMTLLMSAGMAQSGEDDAHKKLAALADIARARASQKPRSVEPVK

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
106 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
107 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
118 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
119 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
124 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
141 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
142 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
143 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
154 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
155 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
156 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
159 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
160 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
235 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
241 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
242 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
244 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
245 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
246 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
247 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
248 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
249 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
250 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
253 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
254 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
255 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
256 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
257 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
258 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
259 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
260 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
261 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
262 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
263 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
264 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
265 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
267 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
268 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
269 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
270 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
271 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
272 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
273 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
274 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
275 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
276 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
277 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
278 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
279 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
281 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
282 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
283 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
284 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
285 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
286 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
287 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
288 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
289 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
290 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
291 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
292 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
293 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
294 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
295 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
296 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
297 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
298 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
299 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
300 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
301 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
302 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
303 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
304 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
305 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
306 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
307 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
308 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
309 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
310 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
311 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
312 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
313 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
314 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
315 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
316 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
317 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
318 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
319 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
320 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
321 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
322 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
323 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
324 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
325 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
326 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
327 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
328 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
329 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
332 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
333 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
334 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
335 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
336 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
337 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
338 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
339 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
340 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
341 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
342 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
343 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
344 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
345 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
346 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
347 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
348 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
349 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
350 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
351 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
352 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
353 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
354 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
355 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
356 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
357 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
358 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
359 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
360 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
361 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
362 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
363 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
364 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
365 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
366 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
367 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
368 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
369 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
370 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
373 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
374 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
375 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
376 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
377 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
378 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
381 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
382 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
383 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
384 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
385 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
386 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
387 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
400 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
403 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
404 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
405 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
406 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
407 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
408 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
409 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
410 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
411 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
412 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
413 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.11
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.62
Nodule 0
Rhizoplane 8.26
Rhizosphere 85.46
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214939630 2209111006 Bacteria 6526
2 ARSoilYngRDRAFT_c00506 3300000042 Bacteria 4548
3 ARcpr5yngRDRAFT_c000242 3300000043 Bacteria 7940
4 ARSoilOldRDRAFT_c000121 3300000044 Bacteria 13868
5 ARCol0yngRDRAFT_1000359 3300000652 Bacteria 6391
6 JGI24741J21665_1007046 3300001915 Bacteria 2207
7 JGI24752J21851_1004877 3300001976 Bacteria 1753
8 JGI24746J21847_1000824 3300001977 Bacteria 4793
9 JGI24747J21853_1002656 3300001978 Bacteria 1479
10 JGI24740J21852_10051412 3300001979 Bacteria 1179
11 JGI24739J22299_10003155 3300001989 Bacteria 6289
12 JGI24737J22298_10001457 3300001990 Bacteria 8439
13 JGI24737J22298_10002963 3300001990 Bacteria 6013
14 JGI24743J22301_10012296 3300001991 Bacteria 1555
15 JGI24750J21931_1000375 3300002070 Bacteria 7573
16 JGI24745J21846_1000315 3300002073 Bacteria 4148
17 JGI24748J21848_1000231 3300002074 Bacteria 6773
18 JGI24738J21930_10000933 3300002075 Bacteria 8401
19 JGI24749J21850_1000549 3300002076 Bacteria 5522
20 JGI24035J26624_1001366 3300002126 Bacteria 2303
21 JGI24033J26618_1001139 3300002155 Bacteria 2589
22 JGI24034J26672_10000576 3300002239 Bacteria 4686
23 JGI24742J22300_10000159 3300002244 Bacteria 9975
24 JGI24751J29686_10003190 3300002459 Bacteria 3305
25 JGI25153J46596_10009748 3300003215 Bacteria 4418
26 rootH1_10324480 3300003323 Bacteria 1049
27 Ga0065716_1003273 3300005277 Bacteria 1283
28 Ga0065712_10004839 3300005290 Bacteria 6780
29 Ga0065712_10076519 3300005290 Bacteria 3643
30 Ga0065712_10089276 3300005290 Bacteria 2478
31 Ga0065715_10000997 3300005293 Bacteria 17501
32 Ga0065715_10089127 3300005293 Bacteria 13881
33 Ga0065715_10183953 3300005293 Bacteria 1457
34 Ga0070658_10037002 3300005327 Bacteria 3932
35 Ga0070658_10039186 3300005327 Bacteria 3822
36 Ga0070658_10056638 3300005327 Bacteria 3187
37 Ga0070676_10000012 3300005328 Bacteria 58061
38 Ga0070676_10051492 3300005328 Bacteria 2418
39 Ga0070683_100000139 3300005329 Bacteria 46987
40 Ga0070683_100047159 3300005329 Bacteria 3981
41 Ga0070683_100360828 3300005329 Bacteria 1384
42 Ga0070690_100000554 3300005330 Bacteria 18687
43 Ga0070690_100013915 3300005330 Bacteria 4769
44 Ga0070690_100079168 3300005330 Bacteria 2148
45 Ga0070670_100005729 3300005331 Bacteria 10492
46 Ga0070670_100012083 3300005331 Bacteria 7385
47 Ga0070670_100166512 3300005331 Bacteria 1911
48 Ga0070677_10001496 3300005333 Bacteria 7389
49 Ga0070677_10086698 3300005333 Bacteria 1353
50 Ga0068869_100000347 3300005334 Bacteria 24812
51 Ga0068869_100101106 3300005334 Bacteria 2181
52 Ga0068869_100247517 3300005334 Bacteria 1422
53 Ga0070666_10003184 3300005335 Bacteria 9972
54 Ga0070666_10093332 3300005335 Bacteria 2069
55 Ga0070666_10205984 3300005335 Bacteria 1384
56 Ga0070680_100000179 3300005336 Bacteria 40975
57 Ga0070680_100045857 3300005336 Bacteria 3554
58 Ga0070680_100086093 3300005336 Bacteria 2597
59 Ga0070680_100200471 3300005336 Bacteria 1683
60 Ga0070680_100345922 3300005336 Bacteria 1264
61 Ga0070682_100000565 3300005337 Bacteria 22802
62 Ga0070682_100057115 3300005337 Bacteria 2458
63 Ga0070682_100106109 3300005337 Bacteria 1864
64 Ga0068868_100001066 3300005338 Bacteria 18793
65 Ga0068868_100115640 3300005338 Bacteria 2184
66 Ga0070660_100000267 3300005339 Bacteria 34641
67 Ga0070660_100082441 3300005339 Bacteria 2525
68 Ga0070660_100092461 3300005339 Bacteria 2388
69 Ga0070689_100000190 3300005340 Bacteria 37316
70 Ga0070689_100079239 3300005340 Bacteria 2576
71 Ga0070689_100112675 3300005340 Bacteria 2165
72 Ga0070689_100140573 3300005340 Bacteria 1942
73 Ga0070689_100383689 3300005340 Bacteria 1185
74 Ga0070691_10001105 3300005341 Bacteria 11214
75 Ga0070691_10066970 3300005341 Bacteria 1736
76 Ga0070687_100000182 3300005343 Bacteria 21913
77 Ga0070687_100050516 3300005343 Bacteria 2148
78 Ga0070687_100139978 3300005343 Bacteria 1408
79 Ga0070687_100376175 3300005343 Bacteria 924
80 Ga0070661_100001231 3300005344 Bacteria 18020
81 Ga0070661_100081585 3300005344 Bacteria 2388
82 Ga0070661_100551002 3300005344 Bacteria 928
83 Ga0070692_10001438 3300005345 Bacteria 8642
84 Ga0070692_10017265 3300005345 Bacteria 3446
85 Ga0070668_100000597 3300005347 Bacteria 24181
86 Ga0070668_100227205 3300005347 Bacteria 1542
87 Ga0070668_100367217 3300005347 Bacteria 1222
88 Ga0070669_100000409 3300005353 Bacteria 32911
89 Ga0070669_100057248 3300005353 Bacteria 2860
90 Ga0070669_100099081 3300005353 Bacteria 2196
91 Ga0070669_100102528 3300005353 Bacteria 2161
92 Ga0070669_100264788 3300005353 Bacteria 1373
93 Ga0070675_100000593 3300005354 Bacteria 24815
94 Ga0070675_100049525 3300005354 Bacteria 3448
95 Ga0070675_100422799 3300005354 Bacteria 1192
96 Ga0070671_100005662 3300005355 Bacteria 9941
97 Ga0070671_100009041 3300005355 Bacteria 7995
98 Ga0070671_100012055 3300005355 Bacteria 6956
99 Ga0070671_100553999 3300005355 Bacteria 992
100 Ga0070674_100000084 3300005356 Bacteria 43585
101 Ga0070674_100033759 3300005356 Bacteria 3410
102 Ga0070674_100038354 3300005356 Bacteria 3228
103 Ga0070673_100000041 3300005364 Bacteria 54096
104 Ga0070673_100006266 3300005364 Bacteria 7715
105 Ga0070673_100206286 3300005364 Bacteria 1695
106 Ga0070673_100676553 3300005364 Bacteria 946
107 Ga0070688_100000320 3300005365 Bacteria 24553
108 Ga0070688_100004329 3300005365 Bacteria 7383
109 Ga0070688_100039871 3300005365 Bacteria 2876
110 Ga0070688_100364842 3300005365 Bacteria 1061
111 Ga0070659_100003151 3300005366 Bacteria 11749
112 Ga0070659_100008866 3300005366 Bacteria 7370
113 Ga0070659_100092725 3300005366 Bacteria 2422
114 Ga0070667_100000365 3300005367 Bacteria 49335
115 Ga0070667_100012887 3300005367 Bacteria 6908
116 Ga0070667_100027988 3300005367 Bacteria 4690
117 Ga0070703_10003890 3300005406 Bacteria 4228
118 Ga0070709_10111811 3300005434 Bacteria 1837
119 Ga0070714_100029189 3300005435 Bacteria 4584
120 Ga0070714_100078722 3300005435 Bacteria 2865
121 Ga0070713_100001020 3300005436 Bacteria 17930
122 Ga0070713_100087894 3300005436 Bacteria 2667
123 Ga0070710_10017282 3300005437 Bacteria 3688
124 Ga0070701_10000110 3300005438 Bacteria 23545
125 Ga0070701_10070064 3300005438 Bacteria 1873
126 Ga0070701_10075723 3300005438 Bacteria 1810
127 Ga0070705_100000938 3300005440 Bacteria 16335
128 Ga0070700_100001112 3300005441 Bacteria 13294
129 Ga0070700_100001991 3300005441 Bacteria 10374
130 Ga0070694_100000065 3300005444 Bacteria 49515
131 Ga0070694_100174772 3300005444 Bacteria 1584
132 Ga0070708_100128395 3300005445 Bacteria 2345
133 Ga0070663_100000654 3300005455 Bacteria 18598
134 Ga0070663_100266364 3300005455 Bacteria 1361
135 Ga0070678_100000091 3300005456 Bacteria 34559
136 Ga0070678_100004855 3300005456 Bacteria 7679
137 Ga0070662_100000629 3300005457 Bacteria 21333
138 Ga0070662_100058296 3300005457 Bacteria 2810
139 Ga0070681_10014301 3300005458 Bacteria 7895
140 Ga0070681_10044378 3300005458 Bacteria 4449
141 Ga0070681_10061531 3300005458 Bacteria 3728
142 Ga0070681_10125469 3300005458 Bacteria 2500
143 Ga0070681_10154716 3300005458 Bacteria 2218
144 Ga0068867_100002763 3300005459 Bacteria 12359
145 Ga0068867_100105534 3300005459 Bacteria 2157
146 Ga0070685_10002711 3300005466 Bacteria 9069
147 Ga0070685_10028236 3300005466 Bacteria 3108
148 Ga0070685_10164459 3300005466 Bacteria 1417
149 Ga0070679_100003726 3300005530 Bacteria 13966
150 Ga0070679_100090574 3300005530 Bacteria 3047
151 Ga0070679_100101766 3300005530 Bacteria 2859
152 Ga0070679_100123233 3300005530 Bacteria 2575
153 Ga0070679_100229224 3300005530 Bacteria 1817
154 Ga0070679_100511397 3300005530 Bacteria 1145
155 Ga0070684_100000219 3300005535 Bacteria 39995
156 Ga0070697_100121293 3300005536 Bacteria 2187
157 Ga0070697_100263154 3300005536 Bacteria 1477
158 Ga0068853_100040876 3300005539 Bacteria 3958
159 Ga0068853_100152638 3300005539 Bacteria 2080
160 Ga0068853_100334427 3300005539 Bacteria 1406
161 Ga0070672_100000019 3300005543 Bacteria 69855
162 Ga0070672_100117646 3300005543 Bacteria 2173
163 Ga0070672_100713150 3300005543 Bacteria 879
164 Ga0070686_100000318 3300005544 Bacteria 31671
165 Ga0070686_100007233 3300005544 Bacteria 6183
166 Ga0070686_100021082 3300005544 Bacteria 3867
167 Ga0070695_100001669 3300005545 Bacteria 12496
168 Ga0070695_100005883 3300005545 Bacteria 7236
169 Ga0070696_100001307 3300005546 Bacteria 16256
170 Ga0070696_100039957 3300005546 Bacteria 3238
171 Ga0070696_100224506 3300005546 Bacteria 1411
172 Ga0070696_100239557 3300005546 Bacteria 1368
173 Ga0070693_100000036 3300005547 Bacteria 50540
174 Ga0070693_100035126 3300005547 Bacteria 2778
175 Ga0070665_100064597 3300005548 Bacteria 3671
176 Ga0070665_100158609 3300005548 Bacteria 2264
177 Ga0070704_100002608 3300005549 Bacteria 10176
178 Ga0070704_100051738 3300005549 Bacteria 2894
179 Ga0068855_100001440 3300005563 Bacteria 29636
180 Ga0068855_100005101 3300005563 Bacteria 16008
181 Ga0070664_100000089 3300005564 Bacteria 58202
182 Ga0070664_100045756 3300005564 Bacteria 3696
183 Ga0070664_100211271 3300005564 Bacteria 1734
184 Ga0070664_100393391 3300005564 Bacteria 1267
185 Ga0068857_100027045 3300005577 Bacteria 5060
186 Ga0068857_100233209 3300005577 Bacteria 1684
187 Ga0068854_100000179 3300005578 Bacteria 43176
188 Ga0068854_100051701 3300005578 Bacteria 2944
189 Ga0068856_100000873 3300005614 Bacteria 32305
190 Ga0068856_100228535 3300005614 Bacteria 1876
191 Ga0070702_100000071 3300005615 Bacteria 28864
192 Ga0070702_100048639 3300005615 Bacteria 2414
193 Ga0068852_100004760 3300005616 Bacteria 9640
194 Ga0068852_100019915 3300005616 Bacteria 5324
195 Ga0068852_100312574 3300005616 Bacteria 1524
196 Ga0068859_100006632 3300005617 Bacteria 11756
197 Ga0068859_100042506 3300005617 Bacteria 4565
198 Ga0068859_100348511 3300005617 Bacteria 1576
199 Ga0068859_100429121 3300005617 Bacteria 1418
200 Ga0068864_100000429 3300005618 Bacteria 36391
201 Ga0068864_100050093 3300005618 Bacteria 3594
202 Ga0068864_100116146 3300005618 Bacteria 2387
203 Ga0068864_100520985 3300005618 Bacteria 1146
204 Ga0068866_10000468 3300005718 Bacteria 18473
205 Ga0068866_10155414 3300005718 Bacteria 1329
206 Ga0068861_100000169 3300005719 Bacteria 34559
207 Ga0068861_100099866 3300005719 Bacteria 2306
208 Ga0068870_10000339 3300005840 Bacteria 17497
209 Ga0068863_100000381 3300005841 Bacteria 45003
210 Ga0068858_100009053 3300005842 Bacteria 9519
211 Ga0068858_100026945 3300005842 Bacteria 5339
212 Ga0068858_100297679 3300005842 Bacteria 1539
213 Ga0068858_100433088 3300005842 Bacteria 1266
214 Ga0068860_100000852 3300005843 Bacteria 34030
215 Ga0068862_100003353 3300005844 Bacteria 13822
216 Ga0068862_100473164 3300005844 Bacteria 1185
217 Ga0081540_1000114 3300005983 Bacteria 85489
218 Ga0081539_10038361 3300005985 Bacteria 2840
219 Ga0070717_10006020 3300006028 Bacteria 8888
220 Ga0070717_10106690 3300006028 Bacteria 2385
221 Ga0075365_10075961 3300006038 Bacteria 2268
222 Ga0075365_10120226 3300006038 Bacteria 1811
223 Ga0075368_10028139 3300006042 Bacteria 2171
224 Ga0075368_10032512 3300006042 Bacteria 2027
225 Ga0075364_10070240 3300006051 Bacteria 2305
226 Ga0075432_10022645 3300006058 Bacteria 2149
227 Ga0070715_10004717 3300006163 Bacteria 4505
228 Ga0070716_100017238 3300006173 Bacteria 3740
229 Ga0070716_100555592 3300006173 Bacteria 857
230 Ga0070712_100177167 3300006175 Bacteria 1658
231 Ga0075362_10014468 3300006177 Bacteria 3186
232 Ga0075367_10147873 3300006178 Bacteria 1457
233 Ga0075367_10263366 3300006178 Bacteria 1082
234 Ga0075369_10024606 3300006186 Bacteria 2496
235 Ga0075369_10066929 3300006186 Bacteria 1576
236 Ga0075369_10117726 3300006186 Bacteria 1201
237 Ga0075366_10003072 3300006195 Bacteria 8715
238 Ga0075366_10114831 3300006195 Bacteria 1621
239 Ga0097621_100000112 3300006237 Bacteria 46077
240 Ga0097621_100002278 3300006237 Bacteria 13143
241 Ga0075370_10042888 3300006353 Bacteria 2556
242 Ga0075370_10182511 3300006353 Bacteria 1235
243 Ga0068871_100000068 3300006358 Bacteria 57531
244 Ga0068871_100025855 3300006358 Bacteria 4573
245 Ga0068871_100105497 3300006358 Bacteria 2365
246 Ga0068871_100812145 3300006358 Bacteria 863
247 Ga0075430_100297637 3300006846 Bacteria 1334
248 Ga0075431_100215392 3300006847 Bacteria 1960
249 Ga0075433_10001324 3300006852 Bacteria 18121
250 Ga0075433_10013574 3300006852 Bacteria 6630
251 Ga0075433_10292308 3300006852 Bacteria 1443
252 Ga0075434_100000614 3300006871 Bacteria 27585
253 Ga0075434_100021261 3300006871 Bacteria 6308
254 Ga0075434_100038150 3300006871 Bacteria 4759
255 Ga0075434_100178933 3300006871 Bacteria 2140
256 Ga0068865_100000294 3300006881 Bacteria 27523
257 Ga0068865_100022649 3300006881 Bacteria 4101
258 Ga0075436_100068342 3300006914 Bacteria 2455
259 Ga0097620_100006632 3300006931 Bacteria 11756
260 Ga0097620_100042507 3300006931 Bacteria 4565
261 Ga0097620_100348512 3300006931 Bacteria 1576
262 Ga0097620_100429088 3300006931 Bacteria 1418
263 Ga0075435_100093500 3300007076 Bacteria 2484
264 Ga0075435_100229571 3300007076 Bacteria 1577
265 Ga0075435_100729284 3300007076 Bacteria 862
266 Ga0099795_10051511 3300007788 Bacteria 1501
267 Ga0105251_10079195 3300009011 Bacteria 1521
268 Ga0105240_10055066 3300009093 Bacteria 4981
269 Ga0105240_10056461 3300009093 Bacteria 4913
270 Ga0111539_10000082 3300009094 Bacteria 96811
271 Ga0111539_10000804 3300009094 Bacteria 40829
272 Ga0111539_10063506 3300009094 Bacteria 4370
273 Ga0111539_10159604 3300009094 Bacteria 2638
274 Ga0111539_10168453 3300009094 Bacteria 2560
275 Ga0111539_10447581 3300009094 Bacteria 1504
276 Ga0105245_10000468 3300009098 Bacteria 36934
277 Ga0105245_10003343 3300009098 Bacteria 14387
278 Ga0105245_10369439 3300009098 Bacteria 1426
279 Ga0105245_10504908 3300009098 Bacteria 1226
280 Ga0105247_10002855 3300009101 Bacteria 11522
281 Ga0105247_10063577 3300009101 Bacteria 2291
282 Ga0105247_10113112 3300009101 Bacteria 1749
283 Ga0114129_10012592 3300009147 Bacteria 12044
284 Ga0114129_10021642 3300009147 Bacteria 9125
285 Ga0114129_10027910 3300009147 Bacteria 7993
286 Ga0114129_10653320 3300009147 Bacteria 1357
287 Ga0105243_10003322 3300009148 Bacteria 13056
288 Ga0105243_10050863 3300009148 Bacteria 3275
289 Ga0105243_10097282 3300009148 Bacteria 2436
290 Ga0105241_10000941 3300009174 Bacteria 21993
291 Ga0105241_10019317 3300009174 Bacteria 5024
292 Ga0105241_10340805 3300009174 Bacteria 1299
293 Ga0105242_10000337 3300009176 Bacteria 37793
294 Ga0105242_10077617 3300009176 Bacteria 2771
295 Ga0105242_10462440 3300009176 Bacteria 1198
296 Ga0105248_10004009 3300009177 Bacteria 16272
297 Ga0105248_10024723 3300009177 Bacteria 6680
298 Ga0105248_10066436 3300009177 Bacteria 4050
299 Ga0105248_10213304 3300009177 Bacteria 2175
300 Ga0105248_10329999 3300009177 Bacteria 1718
301 Ga0105248_10592960 3300009177 Bacteria 1250
302 Ga0105237_10039433 3300009545 Bacteria 4768
303 Ga0105237_10040862 3300009545 Bacteria 4677
304 Ga0105237_10154166 3300009545 Bacteria 2294
305 Ga0105237_10266351 3300009545 Bacteria 1716
306 Ga0105238_10010848 3300009551 Bacteria 9158
307 Ga0105238_10092645 3300009551 Bacteria 3010
308 Ga0105249_10000755 3300009553 Bacteria 29091
309 Ga0105249_10003637 3300009553 Bacteria 13331
310 Ga0105249_10181404 3300009553 Bacteria 2048
311 Ga0105249_10225799 3300009553 Bacteria 1845
312 Ga0105249_10344868 3300009553 Bacteria 1507
313 Ga0105239_10001548 3300010375 Bacteria 30382
314 Ga0105239_10027538 3300010375 Bacteria 6255
315 Ga0105239_10390745 3300010375 Bacteria 1574
316 Ga0105239_10586786 3300010375 Bacteria 1271
317 Ga0105239_10877507 3300010375 Bacteria 1029
318 Ga0105246_10000061 3300011119 Bacteria 44338
319 Ga0157320_1004294 3300012481 Bacteria 904
320 Ga0157343_1003637 3300012488 Bacteria 915
321 Ga0157373_10017197 3300013100 Bacteria 5265
322 Ga0157371_10009867 3300013102 Bacteria 7483
323 Ga0157371_10328319 3300013102 Bacteria 1111
324 Ga0157370_10026836 3300013104 Bacteria 5681
325 Ga0157370_10697532 3300013104 Bacteria 927
326 Ga0157369_10463740 3300013105 Bacteria 1311
327 Ga0157369_10591491 3300013105 Bacteria 1146
328 Ga0157374_10014373 3300013296 Bacteria 6928
329 Ga0157374_10196406 3300013296 Bacteria 1975
330 Ga0157378_10290854 3300013297 Bacteria 1578
331 Ga0163162_10001248 3300013306 Bacteria 23795
332 Ga0163162_10402102 3300013306 Bacteria 1502
333 Ga0163162_10436587 3300013306 Bacteria 1441
334 Ga0163162_10877134 3300013306 Bacteria 1011
335 Ga0157372_10475529 3300013307 Bacteria 1457
336 Ga0157375_10000468 3300013308 Bacteria 36848
337 Ga0157375_10248416 3300013308 Bacteria 1940
338 Ga0163163_10002620 3300014325 Bacteria 15232
339 Ga0163163_10141982 3300014325 Bacteria 2444
340 Ga0157380_10001378 3300014326 Bacteria 15843
341 Ga0157380_10195816 3300014326 Bacteria 1788
342 Ga0157380_10471005 3300014326 Bacteria 1212
343 Ga0182008_10088887 3300014497 Bacteria 1522
344 Ga0157377_10000153 3300014745 Bacteria 42425
345 Ga0157379_10018260 3300014968 Bacteria 6181
346 Ga0157379_10149048 3300014968 Bacteria 2110
347 Ga0157376_10000226 3300014969 Bacteria 39339
348 Ga0157376_10128068 3300014969 Bacteria 2261
349 Ga0157376_10166940 3300014969 Bacteria 2001
350 Ga0157376_10267968 3300014969 Bacteria 1603
351 Ga0157376_10355173 3300014969 Bacteria 1404
352 Ga0163161_10000384 3300017792 Bacteria 37040
353 Ga0163161_10179514 3300017792 Bacteria 1622
354 Ga0213876_10137829 3300021384 Bacteria 1298
355 Ga0209233_1008155 3300025261 Bacteria 3264
356 Ga0207666_1000025 3300025271 Bacteria 36031
357 Ga0207666_1001730 3300025271 Bacteria 2594
358 Ga0207673_1000816 3300025290 Bacteria 3363
359 Ga0209758_1000667 3300025297 Bacteria 51345
360 Ga0207697_10000077 3300025315 Bacteria 42549
361 Ga0207697_10020401 3300025315 Bacteria 2713
362 Ga0207713_1068350 3300025735 Bacteria 1321
363 Ga0207653_10004641 3300025885 Bacteria 4306
364 Ga0207682_10000088 3300025893 Bacteria 41732
365 Ga0207692_10067518 3300025898 Bacteria 1872
366 Ga0207642_10000475 3300025899 Bacteria 12314
367 Ga0207642_10017392 3300025899 Bacteria 2734
368 Ga0207710_10013021 3300025900 Bacteria 3505
369 Ga0207710_10065231 3300025900 Bacteria 1659
370 Ga0207710_10070730 3300025900 Bacteria 1599
371 Ga0207688_10000112 3300025901 Bacteria 32685
372 Ga0207680_10016525 3300025903 Bacteria 3876
373 Ga0207680_10028241 3300025903 Bacteria 3135
374 Ga0207647_10014331 3300025904 Bacteria 5465
375 Ga0207647_10053338 3300025904 Bacteria 2492
376 Ga0207685_10015364 3300025905 Bacteria 2424
377 Ga0207699_10001538 3300025906 Bacteria 10935
378 Ga0207645_10000140 3300025907 Bacteria 55845
379 Ga0207645_10047408 3300025907 Bacteria 2744
380 Ga0207643_10000083 3300025908 Bacteria 62116
381 Ga0207705_10006843 3300025909 Bacteria 8424
382 Ga0207705_10046225 3300025909 Bacteria 3128
383 Ga0207705_10185904 3300025909 Bacteria 1570
384 Ga0207654_10001592 3300025911 Bacteria 11921
385 Ga0207654_10236154 3300025911 Bacteria 1219
386 Ga0207707_10032786 3300025912 Bacteria 4546
387 Ga0207707_10091808 3300025912 Bacteria 2654
388 Ga0207707_10198955 3300025912 Bacteria 1747
389 Ga0207695_10082733 3300025913 Bacteria 3244
390 Ga0207695_10182232 3300025913 Bacteria 2021
391 Ga0207671_10065883 3300025914 Bacteria 2695
392 Ga0207671_10388557 3300025914 Bacteria 1109
393 Ga0207693_10074133 3300025915 Bacteria 2665
394 Ga0207693_10142586 3300025915 Bacteria 1884
395 Ga0207663_10191343 3300025916 Bacteria 1469
396 Ga0207660_10000545 3300025917 Bacteria 25320
397 Ga0207660_10141067 3300025917 Bacteria 1842
398 Ga0207660_10175361 3300025917 Bacteria 1662
399 Ga0207660_10264456 3300025917 Bacteria 1361
400 Ga0207662_10000210 3300025918 Bacteria 27221
401 Ga0207662_10041674 3300025918 Bacteria 2704
402 Ga0207662_10045199 3300025918 Bacteria 2603
403 Ga0207662_10162578 3300025918 Bacteria 1427
404 Ga0207662_10210412 3300025918 Bacteria 1262
405 Ga0207657_10003507 3300025919 Bacteria 16756
406 Ga0207657_10043764 3300025919 Bacteria 3941
407 Ga0207657_10061957 3300025919 Bacteria 3204
408 Ga0207657_10199783 3300025919 Bacteria 1609
409 Ga0207649_10001961 3300025920 Bacteria 11733
410 Ga0207649_10011721 3300025920 Bacteria 4845
411 Ga0207649_10112044 3300025920 Bacteria 1825
412 Ga0207652_10016202 3300025921 Bacteria 6081
413 Ga0207652_10071665 3300025921 Bacteria 3011
414 Ga0207652_10078106 3300025921 Bacteria 2889
415 Ga0207652_10115315 3300025921 Bacteria 2386
416 Ga0207652_10141699 3300025921 Bacteria 2150
417 Ga0207652_10280435 3300025921 Bacteria 1503
418 Ga0207681_10000097 3300025923 Bacteria 73836
419 Ga0207681_10036777 3300025923 Bacteria 3232
420 Ga0207694_10199604 3300025924 Bacteria 1627
421 Ga0207694_10633551 3300025924 Bacteria 900
422 Ga0207650_10000946 3300025925 Bacteria 21828
423 Ga0207650_10001640 3300025925 Bacteria 15939
424 Ga0207650_10105089 3300025925 Bacteria 2179
425 Ga0207659_10000092 3300025926 Bacteria 52642
426 Ga0207659_10098941 3300025926 Bacteria 2195
427 Ga0207687_10000129 3300025927 Bacteria 50592
428 Ga0207687_10217098 3300025927 Bacteria 1504
429 Ga0207700_10000483 3300025928 Bacteria 23397
430 Ga0207700_10312731 3300025928 Bacteria 1359
431 Ga0207664_10068274 3300025929 Bacteria 2855
432 Ga0207644_10009066 3300025931 Bacteria 6523
433 Ga0207644_10009427 3300025931 Bacteria 6409
434 Ga0207644_10056623 3300025931 Bacteria 2829
435 Ga0207644_10085988 3300025931 Bacteria 2334
436 Ga0207690_10003841 3300025932 Bacteria 8886
437 Ga0207690_10112467 3300025932 Bacteria 1963
438 Ga0207690_10142529 3300025932 Bacteria 1768
439 Ga0207706_10001332 3300025933 Bacteria 24722
440 Ga0207706_10088469 3300025933 Bacteria 2723
441 Ga0207686_10000635 3300025934 Bacteria 21719
442 Ga0207686_10142379 3300025934 Bacteria 1659
443 Ga0207709_10000362 3300025935 Bacteria 45886
444 Ga0207709_10060714 3300025935 Bacteria 2358
445 Ga0207670_10000225 3300025936 Bacteria 36971
446 Ga0207670_10042965 3300025936 Bacteria 2982
447 Ga0207670_10058786 3300025936 Bacteria 2613
448 Ga0207670_10310679 3300025936 Bacteria 1237
449 Ga0207670_10340399 3300025936 Bacteria 1185
450 Ga0207669_10000043 3300025937 Bacteria 65025
451 Ga0207669_10028895 3300025937 Bacteria 3057
452 Ga0207669_10185035 3300025937 Bacteria 1497
453 Ga0207704_10000602 3300025938 Bacteria 15871
454 Ga0207704_10008683 3300025938 Bacteria 4872
455 Ga0207704_10080499 3300025938 Bacteria 2103
456 Ga0207704_10130649 3300025938 Bacteria 1738
457 Ga0207704_10598202 3300025938 Bacteria 902
458 Ga0207665_10008168 3300025939 Bacteria 6908
459 Ga0207691_10000283 3300025940 Bacteria 50040
460 Ga0207691_10105570 3300025940 Bacteria 2509
461 Ga0207691_10135723 3300025940 Bacteria 2170
462 Ga0207711_10001023 3300025941 Bacteria 26757
463 Ga0207711_10107998 3300025941 Bacteria 2471
464 Ga0207711_10236664 3300025941 Bacteria 1674
465 Ga0207689_10001131 3300025942 Bacteria 25702
466 Ga0207689_10248997 3300025942 Bacteria 1469
467 Ga0207661_10000245 3300025944 Bacteria 35428
468 Ga0207679_10000030 3300025945 Bacteria 169351
469 Ga0207679_10032562 3300025945 Bacteria 3661
470 Ga0207679_10108986 3300025945 Bacteria 2181
471 Ga0207679_10259408 3300025945 Bacteria 1482
472 Ga0207679_10405854 3300025945 Bacteria 1199
473 Ga0207667_10079278 3300025949 Bacteria 3404
474 Ga0207667_10105691 3300025949 Bacteria 2904
475 Ga0207667_10554517 3300025949 Bacteria 1162
476 Ga0207651_10000088 3300025960 Bacteria 40879
477 Ga0207651_10004647 3300025960 Bacteria 6960
478 Ga0207651_10010467 3300025960 Bacteria 5143
479 Ga0207651_10502856 3300025960 Bacteria 1048
480 Ga0207651_10530617 3300025960 Bacteria 1021
481 Ga0207712_10000924 3300025961 Bacteria 21209
482 Ga0207712_10036353 3300025961 Bacteria 3353
483 Ga0207712_10112192 3300025961 Bacteria 2047
484 Ga0207712_10261854 3300025961 Bacteria 1403
485 Ga0207668_10000114 3300025972 Bacteria 57323
486 Ga0207668_10072600 3300025972 Bacteria 2463
487 Ga0207640_10000616 3300025981 Bacteria 20961
488 Ga0207640_10115794 3300025981 Bacteria 1909
489 Ga0207658_10004201 3300025986 Bacteria 10036
490 Ga0207677_10007396 3300026023 Bacteria 6072
491 Ga0207677_10048287 3300026023 Bacteria 2865
492 Ga0207703_10006170 3300026035 Bacteria 9594
493 Ga0207703_10024255 3300026035 Bacteria 4772
494 Ga0207703_10030929 3300026035 Bacteria 4232
495 Ga0207703_10161340 3300026035 Bacteria 1964
496 Ga0207703_10337337 3300026035 Bacteria 1384
497 Ga0207639_10001529 3300026041 Bacteria 15540
498 Ga0207639_10091275 3300026041 Bacteria 2438
499 Ga0207678_10000125 3300026067 Bacteria 63817
500 Ga0207678_10068972 3300026067 Bacteria 3032
501 Ga0207678_10132054 3300026067 Bacteria 2131
502 Ga0207708_10005075 3300026075 Bacteria 9710
503 Ga0207708_10005233 3300026075 Bacteria 9559
504 Ga0207708_10152141 3300026075 Bacteria 1822
505 Ga0207702_10007265 3300026078 Bacteria 9473
506 Ga0207702_10036008 3300026078 Bacteria 4139
507 Ga0207702_10407689 3300026078 Bacteria 1312
508 Ga0207641_10001951 3300026088 Bacteria 19779
509 Ga0207648_10002235 3300026089 Bacteria 20962
510 Ga0207648_10009401 3300026089 Bacteria 9363
511 Ga0207648_10186273 3300026089 Bacteria 1839
512 Ga0207676_10000074 3300026095 Bacteria 101208
513 Ga0207676_10044234 3300026095 Bacteria 3434
514 Ga0207676_10079802 3300026095 Bacteria 2654
515 Ga0207676_10202999 3300026095 Bacteria 1753
516 Ga0207676_10457777 3300026095 Bacteria 1204
517 Ga0207674_10000750 3300026116 Bacteria 42574
518 Ga0207674_10203427 3300026116 Bacteria 1929
519 Ga0207675_100001312 3300026118 Bacteria 24916
520 Ga0207675_100102565 3300026118 Bacteria 2696
521 Ga0207683_10000014 3300026121 Bacteria 128817
522 Ga0207683_10002446 3300026121 Bacteria 16197
523 Ga0207698_10006673 3300026142 Bacteria 7212
524 Ga0207698_10022216 3300026142 Bacteria 4404
525 Ga0207698_10325949 3300026142 Bacteria 1440
526 Ga0209973_1007128 3300027252 Bacteria 1241
527 Ga0209995_1022189 3300027471 Bacteria 1053
528 Ga0210002_1004043 3300027617 Bacteria 2177
529 Ga0209971_1013394 3300027682 Bacteria 1943
530 Ga0209971_1030169 3300027682 Bacteria 1298
531 Ga0209998_10000650 3300027717 Bacteria 9314
532 Ga0209813_10039518 3300027866 Bacteria 1430
533 Ga0209974_10006501 3300027876 Bacteria 4079
534 Ga0209974_10091760 3300027876 Bacteria 1054
535 Ga0207428_10000467 3300027907 Bacteria 48756
536 Ga0207428_10004971 3300027907 Bacteria 12517
537 Ga0268266_10005646 3300028379 Bacteria 11604
538 Ga0268265_10002706 3300028380 Bacteria 13120
539 Ga0268265_10128778 3300028380 Bacteria 2099
540 Ga0268264_10000469 3300028381 Bacteria 54801
541 Ga0268264_10090183 3300028381 Bacteria 2641
542 Ga0265337_1000937 3300028556 Bacteria 15292
543 Ga0265338_10126321 3300028800 Bacteria 2028
544 Ga0265338_10240698 3300028800 Bacteria 1340
545 Ga0265338_10365706 3300028800 Bacteria 1034
546 Ga0265760_10043236 3300031090 Bacteria 1346
547 Ga0265330_10008372 3300031235 Bacteria 4980
548 Ga0265330_10025586 3300031235 Bacteria 2675
549 Ga0265332_10047640 3300031238 Bacteria 1844
550 Ga0265325_10000784 3300031241 Bacteria 23018
551 Ga0265325_10009965 3300031241 Bacteria 5525
552 Ga0265325_10030064 3300031241 Bacteria 2915
553 Ga0265325_10034777 3300031241 Bacteria 2679
554 Ga0265340_10083718 3300031247 Bacteria 1498
555 Ga0265339_10034520 3300031249 Bacteria 2841
556 Ga0265313_10065540 3300031595 Bacteria 1686
557 Ga0265314_10002142 3300031711 Bacteria 20697
558 Ga0265314_10014070 3300031711 Bacteria 6425
559 Ga0265342_10000540 3300031712 Bacteria 40252
560 Ga0307406_10328527 3300031901 Bacteria 1186
561 Ga0373930_0000284 3300034816 Bacteria 6465
562 Ga0373930_0013420 3300034816 Bacteria 1510
563 Ga0373948_0000299 3300034817 Bacteria 5998
564 Ga0373950_0000315 3300034818 Bacteria 6092
565 Ga0373958_0000765 3300034819 Bacteria 4118
566 Ga0373958_0002537 3300034819 Bacteria 2568
567 Ga0373959_0005961 3300034820 Bacteria 2009
568 Ga0373938_0000035 3300034957 Bacteria 17716
569 Ga0373938_0000130 3300034957 Bacteria 10658
570 Ga0373928_0000643 3300035084 Bacteria 6850
571 Ga0373928_0005103 3300035084 Bacteria 2505
572 Ga0373929_0000258 3300035085 Bacteria 9799
573 Ga0373929_0023565 3300035085 Bacteria 1266
574 Ga0373934_0065203 3300035086 Bacteria 1454
575 Ga0373934_0196992 3300035086 Bacteria 829
576 Ga0373940_0004302 3300035088 Bacteria 3001
577 Ga0373940_0031357 3300035088 Bacteria 1418
578 Ga0373940_0041696 3300035088 Bacteria 1263
579 Ga0373949_0003504 3300035090 Bacteria 3719
580 Ga0373949_0005632 3300035090 Bacteria 2789
581 Ga0373949_0006759 3300035090 Bacteria 2518
582 Ga0373951_0001386 3300035091 Bacteria 6365
583 Ga0373951_0003118 3300035091 Bacteria 4090
584 Ga0373952_0000044 3300035092 Bacteria 15152
585 Ga0373952_0000416 3300035092 Bacteria 7365
586 Ga0373952_0010252 3300035092 Bacteria 1808
587 Ga0373923_0106203 3300035111 Bacteria 1243
588 Ga0373932_0002415 3300035112 Bacteria 4742
589 Ga0373932_0002422 3300035112 Bacteria 4733
590 Ga0373939_0001850 3300035114 Bacteria 5081
591 Ga0373939_0002508 3300035114 Bacteria 4322
592 Ga0373941_0000164 3300035115 Bacteria 12153
593 Ga0373941_0001372 3300035115 Bacteria 5131
594 Ga0373941_0001742 3300035115 Bacteria 4673
595 Ga0373945_0003277 3300035116 Bacteria 5077
596 Ga0373945_0014877 3300035116 Bacteria 2612
597 Ga0373954_0064487 3300035118 Bacteria 1732
598 Ga0373957_0011276 3300035120 Bacteria 2979
599 Ga0373960_0001732 3300035121 Bacteria 4883
600 Ga0373960_0002782 3300035121 Bacteria 3962
601 Ga0373960_0046558 3300035121 Bacteria 1273
602 Ga0373943_0050747 3300035170 Bacteria 2040
603 Ga0373943_0063797 3300035170 Bacteria 1848
604 Ga0373943_0173437 3300035170 Bacteria 1181
605 Ga0373946_0010755 3300035171 Bacteria 3397
606 Ga0373946_0036488 3300035171 Bacteria 1994
607 Ga0373955_0002236 3300035172 Bacteria 8404
608 Ga0373955_0035238 3300035172 Bacteria 2650
609 Ga0373942_0000113 3300035207 Bacteria 18511
610 Ga0373942_0003590 3300035207 Bacteria 3639
611 Ga0373961_0001463 3300035241 Bacteria 6946
612 Ga0373961_0002817 3300035241 Bacteria 4436
613 Ga0373961_0020865 3300035241 Bacteria 1737
614 Ga0373962_0002001 3300035242 Bacteria 4861
615 Ga0373962_0002732 3300035242 Bacteria 4203
616 Ga0373962_0005452 3300035242 Bacteria 3078
617 Ga0373962_0030780 3300035242 Bacteria 1470
618 Ga0373962_0065404 3300035242 Bacteria 1076
619 Ga0373924_0010583 3300035410 Bacteria 3408
620 Ga0373924_0085378 3300035410 Bacteria 1346
621 Ga0373931_0000779 3300035691 Bacteria 13339
622 Ga0373931_0014732 3300035691 Bacteria 3827
623 Ga0373931_0026802 3300035691 Bacteria 2937
624 Ga0373935_0000897 3300035692 Bacteria 16091
625 Ga0373935_0048846 3300035692 Bacteria 2680
626 Ga0373935_0062315 3300035692 Bacteria 2389
627 Ga0373927_0015353 3300035695 Bacteria 5059
628 Ga0373927_0047892 3300035695 Bacteria 2765
629 Ga0373933_0007148 3300035724 Bacteria 6080
630 Ga0373933_0017351 3300035724 Bacteria 4039
631 Ga0373947_0001129 3300035725 Bacteria 16384
632 Ga0373947_0012771 3300035725 Bacteria 4814
633 Ga0373947_0077964 3300035725 Bacteria 2044
634 Ga0373947_0205171 3300035725 Bacteria 1291
635 Ga0373937_0001244 3300036401 Bacteria 21426
636 Ga0373937_0004652 3300036401 Bacteria 11656
637 Ga0373937_0606471 3300036401 Bacteria 1039
638 Ga0373925_0006292 3300037068 Bacteria 8746
639 Ga0373925_0114283 3300037068 Bacteria 2089
640 Ga0436365_0424475 3300039437 Bacteria 1085
641 Ga0436365_0671220 3300039437 Bacteria 1431
642 Ga0436365_1126455 3300039437 Bacteria 19004
643 Ga0439455_0020242 3300042012 Bacteria 1576
644 Ga0439463_009214 3300042016 Bacteria 2430
645 Ga0439464_0022398 3300042439 Bacteria 1740
646 Ga0451577_0117894 3300042876 Bacteria 2378
647 Ga0466966_0031357 3300044684 Bacteria 3448
648 Ga0466963_0027204 3300044694 Bacteria 3661
649 Ga0466963_0080913 3300044694 Bacteria 2200
650 Ga0453684_0357785 3300044712 Bacteria 1644
651 Ga0466957_0016973 3300044842 Bacteria 4259
652 Ga0466957_0181829 3300044842 Bacteria 1373
653 Ga0466957_0371852 3300044842 Bacteria 973
654 Ga0451576_0031881 3300045051 Bacteria 5617
655 Ga0466958_0262076 3300045836 Bacteria 1106
656 Ga0495617_036321 3300046452 Bacteria 1652
657 Ga0495592_0058494 3300046454 Bacteria 2843
658 Ga0495592_0077746 3300046454 Bacteria 2404
659 Ga0495603_0036699 3300046455 Bacteria 2942
660 Ga0495629_0000623 3300046459 Bacteria 28814
661 Ga0495629_0207783 3300046459 Bacteria 1352
662 Ga0495641_0012473 3300046461 Bacteria 4751
663 Ga0495651_0009844 3300046462 Bacteria 7349
664 Ga0495651_0016870 3300046462 Bacteria 5656
665 Ga0495653_0034032 3300046463 Bacteria 4033
666 Ga0495653_0074774 3300046463 Bacteria 2523
667 Ga0495653_0095828 3300046463 Bacteria 2159
668 Ga0495580_0004252 3300046472 Bacteria 12046
669 Ga0495582_0001248 3300046473 Bacteria 14286
670 Ga0495582_0188694 3300046473 Bacteria 1176
671 Ga0495662_0049431 3300046476 Bacteria 2029
672 Ga0495664_0026877 3300046477 Bacteria 3353
673 Ga0495584_0024408 3300046491 Bacteria 3066
674 Ga0495585_0001463 3300046492 Bacteria 18493
675 Ga0495594_0016246 3300046499 Bacteria 3919
676 Ga0495594_0026013 3300046499 Bacteria 3147
677 Ga0495607_0002688 3300046501 Bacteria 14188
678 Ga0495608_0129848 3300046511 Bacteria 1613
679 Ga0495618_0052847 3300046514 Bacteria 2569
680 Ga0495618_0129545 3300046514 Bacteria 1614
681 Ga0495618_0277276 3300046514 Bacteria 1046
682 Ga0495628_0120945 3300046516 Bacteria 2009
683 Ga0495628_0132535 3300046516 Bacteria 1905
684 Ga0495630_0137271 3300046517 Bacteria 1858
685 Ga0495643_0216954 3300046522 Bacteria 910
686 Ga0495644_0001288 3300046523 Bacteria 10287
687 Ga0495652_0036124 3300046529 Bacteria 4297
688 Ga0495665_0008222 3300046531 Bacteria 5657
689 Ga0495665_0097428 3300046531 Bacteria 1544
690 Ga0495640_0036024 3300046533 Bacteria 3499
691 Ga0495640_0178891 3300046533 Bacteria 1352
692 Ga0495586_0051009 3300046535 Bacteria 2239
693 Ga0495587_0015294 3300046536 Bacteria 4794
694 Ga0495609_0045650 3300046538 Bacteria 1963
695 Ga0495645_0066077 3300046543 Bacteria 2615
696 Ga0495645_0078198 3300046543 Bacteria 2378
697 Ga0495622_0025955 3300046557 Bacteria 2738
698 Ga0495667_0004407 3300046559 Bacteria 9493
699 Ga0495656_0000284 3300046615 Bacteria 17684
700 Ga0495634_0029759 3300046642 Bacteria 3779
701 Ga0495634_0213500 3300046642 Bacteria 1193
702 Ga0495635_0003295 3300046663 Bacteria 11154
703 Ga0495635_0033531 3300046663 Bacteria 3562
704 Ga0495588_0001863 3300046674 Bacteria 8990
705 Ga0495657_0005731 3300046675 Bacteria 9781
706 Ga0495657_0275986 3300046675 Bacteria 1007
707 Ga0495599_0042191 3300046678 Bacteria 2863
708 Ga0495623_0038989 3300046679 Bacteria 3037
709 Ga0495623_0169123 3300046679 Bacteria 1278
710 Ga0495646_0026179 3300046680 Bacteria 3664
711 Ga0495647_0000627 3300046681 Bacteria 10409
712 Ga0495647_0006614 3300046681 Bacteria 3847
713 Ga0495658_0001220 3300046683 Bacteria 13489
714 Ga0495658_0009067 3300046683 Bacteria 4946
715 Ga0495658_0107196 3300046683 Bacteria 1676
716 Ga0495613_0003128 3300046689 Bacteria 12397
717 Ga0495613_0126155 3300046689 Bacteria 1835
718 Ga0495624_0012794 3300046690 Bacteria 5729
719 Ga0495624_0236758 3300046690 Bacteria 1105
720 Ga0495670_0000802 3300046691 Bacteria 15114
721 Ga0495600_0003569 3300046809 Bacteria 9155
722 Ga0495600_0241385 3300046809 Bacteria 1151
723 Ga0495581_0110979 3300047315 Bacteria 1595
724 Ga0495581_0125955 3300047315 Bacteria 1491
725 Ga0495604_0020267 3300047317 Bacteria 5314
726 Ga0495636_0087271 3300047318 Bacteria 1350
727 Ga0495674_0072398 3300047319 Bacteria 2972
728 Ga0495674_0130894 3300047319 Bacteria 2114
729 Ga0495674_0224472 3300047319 Bacteria 1552
730 Ga0495674_0289962 3300047319 Bacteria 1338
731 Ga0495676_0021468 3300047321 Bacteria 5637
732 Ga0495676_0200409 3300047321 Bacteria 1387
733 Ga0495680_0005826 3300047322 Bacteria 11532
734 Ga0495680_0015212 3300047322 Bacteria 6643
735 Ga0495680_0097548 3300047322 Bacteria 2194
736 Ga0495680_0098868 3300047322 Bacteria 2176
737 Ga0495680_0104727 3300047322 Bacteria 2104
738 Ga0495675_0007872 3300047444 Bacteria 6585
739 Ga0495675_0028731 3300047444 Bacteria 3544
740 Ga0495675_0138192 3300047444 Bacteria 1512
741 Ga0495677_0058412 3300047445 Bacteria 1427
742 Ga0495684_0002228 3300047471 Bacteria 15529
743 Ga0495684_0063802 3300047471 Bacteria 2800
744 Ga0495593_0014060 3300047673 Bacteria 4556
745 Ga0495593_0044745 3300047673 Bacteria 2366
746 Ga0495602_0028839 3300048088 Bacteria 5303
747 Ga0495602_0202687 3300048088 Bacteria 1512
748 Ga0495602_0286556 3300048088 Bacteria 1211
749 Ga0495614_0034725 3300048089 Bacteria 2167
750 Ga0496100_0005311 3300048903 Bacteria 6922
751 Ga0496100_0059652 3300048903 Bacteria 2508
752 Ga0496100_0079688 3300048903 Bacteria 2207
753 Ga0496100_0118147 3300048903 Bacteria 1852
754 Ga0496101_0000136 3300048904 Bacteria 65392
755 Ga0496101_0003943 3300048904 Bacteria 9278
756 Ga0496101_0009464 3300048904 Bacteria 6405
757 Ga0496101_0294970 3300048904 Bacteria 1269
758 Ga0496101_0415244 3300048904 Bacteria 1060
759 Ga0496102_0001166 3300048905 Bacteria 23991
760 Ga0496102_0002882 3300048905 Bacteria 14594
761 Ga0496102_0099064 3300048905 Bacteria 2705
762 Ga0496102_0134324 3300048905 Bacteria 2318
763 Ga0496103_0000673 3300048906 Bacteria 25699
764 Ga0496103_0020156 3300048906 Bacteria 4003
765 Ga0496103_0025600 3300048906 Bacteria 3567
766 Ga0496103_0151943 3300048906 Bacteria 1483
767 Ga0496104_0009561 3300048907 Bacteria 8630
768 Ga0496104_0082666 3300048907 Bacteria 3062
769 Ga0496104_0084700 3300048907 Bacteria 3025
770 Ga0496104_0161580 3300048907 Bacteria 2149
771 Ga0496104_0472465 3300048907 Bacteria 1165
772 Ga0496105_0001629 3300048908 Bacteria 15964
773 Ga0496105_0032315 3300048908 Bacteria 4293
774 Ga0496105_0307546 3300048908 Bacteria 1273
775 Ga0496105_0358158 3300048908 Bacteria 1164
776 Ga0496106_0000261 3300048909 Bacteria 36987
777 Ga0496106_0008038 3300048909 Bacteria 7791
778 Ga0496107_0000146 3300048910 Bacteria 35573
779 Ga0496107_0037369 3300048910 Bacteria 3484
780 Ga0496107_0048080 3300048910 Bacteria 3072
781 Ga0496107_0050529 3300048910 Bacteria 2997
782 Ga0496107_0104313 3300048910 Bacteria 2080
783 Ga0496108_0000595 3300048911 Bacteria 28321
784 Ga0496108_0002272 3300048911 Bacteria 15398
785 Ga0496108_0005981 3300048911 Bacteria 9857
786 Ga0496108_0022025 3300048911 Bacteria 5239
787 Ga0496108_0145198 3300048911 Bacteria 2045
788 Ga0496109_0002045 3300048912 Bacteria 16719
789 Ga0496109_0006684 3300048912 Bacteria 9709
790 Ga0496109_0031095 3300048912 Bacteria 4788
791 Ga0496109_0065722 3300048912 Bacteria 3320
792 Ga0496109_0074590 3300048912 Bacteria 3118
793 Ga0496109_0092723 3300048912 Bacteria 2794
794 Ga0496109_0275774 3300048912 Bacteria 1584
795 Ga0496109_0637340 3300048912 Bacteria 1002
796 Ga0496110_0007143 3300048913 Bacteria 8893
797 Ga0496110_0042599 3300048913 Bacteria 3963
798 Ga0496110_0049746 3300048913 Bacteria 3678
799 Ga0496110_0055079 3300048913 Bacteria 3499
800 Ga0496110_0158766 3300048913 Bacteria 2049
801 Ga0496111_0007800 3300048914 Bacteria 7048
802 Ga0496111_0015190 3300048914 Bacteria 5279
803 Ga0496111_0030574 3300048914 Bacteria 3830
804 Ga0496111_0060911 3300048914 Bacteria 2736
805 Ga0496111_0134560 3300048914 Bacteria 1830
806 Ga0496111_0147341 3300048914 Bacteria 1745
807 Ga0496112_0008941 3300048915 Bacteria 8993
808 Ga0496112_0063888 3300048915 Bacteria 3631
809 Ga0496112_0087107 3300048915 Bacteria 3090
810 Ga0496112_0118981 3300048915 Bacteria 2611
811 Ga0496112_0450055 3300048915 Bacteria 1225
812 Ga0496113_0003365 3300048916 Bacteria 9556
813 Ga0496113_0012040 3300048916 Bacteria 5801
814 Ga0496113_0061119 3300048916 Bacteria 2842
815 Ga0496113_0061142 3300048916 Bacteria 2841
816 Ga0496113_0090608 3300048916 Bacteria 2356
817 Ga0496113_0149877 3300048916 Bacteria 1839
818 Ga0496113_0378290 3300048916 Bacteria 1136
819 Ga0496114_0010754 3300048917 Bacteria 7283
820 Ga0496114_0022962 3300048917 Bacteria 5085
821 Ga0496114_0127579 3300048917 Bacteria 2194
822 Ga0496115_0031240 3300048918 Bacteria 4194
823 Ga0496115_0073726 3300048918 Bacteria 2771
824 Ga0496115_0304453 3300048918 Bacteria 1305
825 Ga0501034_0014054 3300049571 Bacteria 8246
826 Ga0501034_0070300 3300049571 Bacteria 3512
827 Ga0501047_0020439 3300049581 Bacteria 6358
828 Ga0501067_0018478 3300049583 Bacteria 3861
829 Ga0501068_0047044 3300049584 Bacteria 2602
830 Ga0501069_0109843 3300049585 Bacteria 1569
831 Ga0501070_0060309 3300049586 Bacteria 3144
832 Ga0501070_0339088 3300049586 Bacteria 1221
833 Ga0501072_0549467 3300049588 Bacteria 912
834 Ga0501073_0034211 3300049589 Bacteria 3617
835 Ga0501074_0071216 3300049590 Bacteria 2499
836 Ga0501080_0041456 3300049742 Bacteria 4289
837 Ga0501080_0158733 3300049742 Bacteria 2089
838 Ga0501081_0316911 3300049743 Bacteria 1146
839 Ga0501044_0510609 3300049823 Bacteria 1102
840 nmdc:mga03683_18329_c1 3300050489 Bacteria 2660
841 nmdc:mga03683_32691_c1 3300050489 Bacteria 2094
842 nmdc:mga03683_46947_c1 3300050489 Bacteria 1791
843 nmdc:mga00v17_94675_c1 3300050491 Bacteria 1879
844 nmdc:mga00v17_96663_c1 3300050491 Bacteria 1861
845 nmdc:mga0yw44_99995_c1 3300050492 Bacteria 1846
846 nmdc:mga0k408_131980_c1 3300050493 Bacteria 1483
847 nmdc:mga0k408_158540_c1 3300050493 Bacteria 1348
848 nmdc:mga0k408_296703_c1 3300050493 Bacteria 964
849 nmdc:mga0k408_96561_c1 3300050493 Bacteria 1740
850 nmdc:mga06z11_134950_c1 3300050494 Bacteria 1389
851 nmdc:mga06z11_174357_c1 3300050494 Bacteria 1237
852 nmdc:mga06z11_24117_c1 3300050494 Bacteria 2866
853 nmdc:mga04h51_47241_c1 3300050495 Bacteria 1430
854 nmdc:mga04h51_60655_c1 3300050495 Bacteria 1296
855 nmdc:mga07m45_112389_c1 3300050496 Bacteria 1570
856 nmdc:mga07m45_53724_c1 3300050496 Bacteria 2276
857 nmdc:mga05p37_246885_c1 3300050507 Bacteria 2143
858 nmdc:mga05p37_37269_c1 3300050507 Bacteria 5962
859 nmdc:mga09592_269303_c1 3300050508 Bacteria 1477
860 nmdc:mga06r32_205805_c1 3300050510 Bacteria 1956
861 nmdc:mga06r32_381242_c1 3300050510 Bacteria 1393
862 nmdc:mga08y16_238729_c1 3300050511 Bacteria 1879
863 nmdc:mga08y16_249040_c1 3300050511 Bacteria 1836
864 nmdc:mga08y16_6205_c1 3300050511 Bacteria 12540
865 nmdc:mga0n895_208_c1 3300050512 Bacteria 36701
866 nmdc:mga0n895_212024_c1 3300050512 Bacteria 1967
867 nmdc:mga0n895_266041_c1 3300050512 Bacteria 1739
868 nmdc:mga0n895_60007_c1 3300050512 Bacteria 3753
869 nmdc:mga0n895_76852_c1 3300050512 Bacteria 3320
870 nmdc:mga0rr50_113698_c1 3300050513 Bacteria 2145
871 nmdc:mga0rr50_193053_c1 3300050513 Bacteria 1670
872 nmdc:mga0rr50_19615_c1 3300050513 Bacteria 4570
873 nmdc:mga0rr50_24541_c1 3300050513 Bacteria 4177
874 nmdc:mga08x19_364571_c1 3300050514 Bacteria 1010
875 nmdc:mga0a205_14931_c1 3300050515 Bacteria 7247
876 nmdc:mga0a205_176939_c1 3300050515 Bacteria 2029
877 nmdc:mga0a205_380_c1 3300050515 Bacteria 33747
878 nmdc:mga0sz30_60220_c1 3300050516 Bacteria 1621
879 Ga0495601_0010986 3300053077 Bacteria 5408
880 Ga0495601_0058505 3300053077 Bacteria 2443
881 Ga0495601_0169132 3300053077 Bacteria 1428
882 Ga0495612_0254303 3300053078 Bacteria 782
883 Ga0495595_0003960 3300053084 Bacteria 5919
884 Ga0495595_0008703 3300053084 Bacteria 4177
885 Ga0495595_0016009 3300053084 Bacteria 3202
886 Ga0495595_0131978 3300053084 Bacteria 1221
887 Ga0495619_0000707 3300053085 Bacteria 21759
888 Ga0495619_0000922 3300053085 Bacteria 19316
889 Ga0495619_0010208 3300053085 Bacteria 5915
890 Ga0495619_0027485 3300053085 Bacteria 3664
891 Ga0495619_0215861 3300053085 Bacteria 1329
892 Ga0500643_002051 3300053087 Bacteria 10779
893 Ga0500644_0138993 3300053088 Bacteria 963
894 Ga0500651_0019363 3300053093 Bacteria 4229
895 Ga0500566_0062436 3300053094 Bacteria 2106
896 Ga0500595_000002 3300053119 Bacteria 1074388
897 Ga0500595_024086 3300053119 Bacteria 2129
898 Ga0500595_048070 3300053119 Bacteria 1334
899 Ga0500595_049570 3300053119 Bacteria 1307
900 Ga0500642_0003309 3300053130 Bacteria 4854
901 Ga0500652_000002 3300053131 Bacteria 273315
902 Ga0500652_002800 3300053131 Bacteria 5266
903 Ga0500616_0000002 3300053153 Bacteria 1611257
904 Ga0500636_0010920 3300053177 Bacteria 5310
905 Ga0500645_000471 3300053730 Bacteria 27490
906 Ga0501084_0173493 3300054114 Bacteria 1820
907 Ga0501082_0109193 3300060353 Bacteria 2395

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050494 nmdc:mga06z11_134950_c1 nmdc:mga06z11_134950_c1_31_738 201
2 3300048908 Ga0496105_0358158 Ga0496105_0358158_425_1096 210
3 3300046531 Ga0495665_0097428 Ga0495665_0097428_593_1357 213
4 3300035086 Ga0373934_0196992 Ga0373934_0196992_107_805 214
5 3300035691 Ga0373931_0026802 Ga0373931_0026802_2229_2927 214
6 3300046642 Ga0495634_0029759 Ga0495634_0029759_2510_3274 214
7 3300047471 Ga0495684_0063802 Ga0495684_0063802_957_1721 214
8 3300042439 Ga0439464_0022398 Ga0439464_0022398_1083_1730 215
9 3300005364 Ga0070673_100676553 Ga0070673_1006765531 217
10 3300009094 Ga0111539_10447581 Ga0111539_104475812 217
11 3300005330 Ga0070690_100013915 Ga0070690_1000139153 224
12 3300005340 Ga0070689_100140573 Ga0070689_1001405732 224
13 3300005355 Ga0070671_100553999 Ga0070671_1005539992 224
14 3300005365 Ga0070688_100039871 Ga0070688_1000398712 224
15 3300005618 Ga0068864_100050093 Ga0068864_1000500932 224
16 3300006038 Ga0075365_10075961 Ga0075365_100759612 224
17 3300006042 Ga0075368_10028139 Ga0075368_100281392 224
18 3300006186 Ga0075369_10024606 Ga0075369_100246062 224
19 3300009177 Ga0105248_10592960 Ga0105248_105929602 224
20 3300014325 Ga0163163_10141982 Ga0163163_101419822 224
21 3300048903 Ga0496100_0079688 Ga0496100_0079688_1261_2025 224
22 3300048907 Ga0496104_0009561 Ga0496104_0009561_7309_8073 224
23 3300048912 Ga0496109_0065722 Ga0496109_0065722_1356_2120 224
24 3300048913 Ga0496110_0007143 Ga0496110_0007143_1983_2747 224
25 3300048916 Ga0496113_0149877 Ga0496113_0149877_398_1162 224
26 3300048917 Ga0496114_0022962 Ga0496114_0022962_788_1552 224
27 3300050489 nmdc:mga03683_46947_c1 nmdc:mga03683_46947_c1_315_1073 224
28 3300050492 nmdc:mga0yw44_99995_c1 nmdc:mga0yw44_99995_c1_717_1475 224
29 3300050493 nmdc:mga0k408_296703_c1 nmdc:mga0k408_296703_c1_38_796 224
30 3300050494 nmdc:mga06z11_24117_c1 nmdc:mga06z11_24117_c1_78_836 224
31 3300025918 Ga0207662_10162578 Ga0207662_101625782 225
32 3300025931 Ga0207644_10085988 Ga0207644_100859882 225
33 3300025936 Ga0207670_10058786 Ga0207670_100587862 225
34 3300025937 Ga0207669_10185035 Ga0207669_101850352 225
35 3300025938 Ga0207704_10008683 Ga0207704_100086834 225
36 3300025961 Ga0207712_10036353 Ga0207712_100363532 225
37 3300026035 Ga0207703_10161340 Ga0207703_101613402 225
38 3300026095 Ga0207676_10044234 Ga0207676_100442342 225
39 3300031901 Ga0307406_10328527 Ga0307406_103285272 225
40 3300048904 Ga0496101_0009464 Ga0496101_0009464_1626_2477 225
41 3300048912 Ga0496109_0092723 Ga0496109_0092723_1969_2742 225
42 3300048916 Ga0496113_0061119 Ga0496113_0061119_901_1674 225
43 3300005353 Ga0070669_100057248 Ga0070669_1000572482 226
44 3300013306 Ga0163162_10436587 Ga0163162_104365872 226
45 3300025926 Ga0207659_10098941 Ga0207659_100989412 226
46 3300025934 Ga0207686_10142379 Ga0207686_101423792 226
47 3300035085 Ga0373929_0023565 Ga0373929_0023565_422_1195 226
48 3300048905 Ga0496102_0099064 Ga0496102_0099064_924_1688 226
49 3300048908 Ga0496105_0032315 Ga0496105_0032315_2166_2930 226
50 3300048914 Ga0496111_0015190 Ga0496111_0015190_4457_5221 226
51 3300048915 Ga0496112_0450055 Ga0496112_0450055_164_928 226
52 3300034816 Ga0373930_0013420 Ga0373930_0013420_318_1091 227
53 3300044694 Ga0466963_0027204 Ga0466963_0027204_1207_1989 228
54 3300044842 Ga0466957_0181829 Ga0466957_0181829_212_994 228
55 3300046522 Ga0495643_0216954 Ga0495643_0216954_50_817 228
56 3300053130 Ga0500642_0003309 Ga0500642_0003309_3981_4763 228
57 3300046514 Ga0495618_0129545 Ga0495618_0129545_487_1260 230
58 3300005340 Ga0070689_100383689 Ga0070689_1003836891 231
59 3300005343 Ga0070687_100376175 Ga0070687_1003761751 231
60 3300005355 Ga0070671_100012055 Ga0070671_1000120553 231
61 3300005364 Ga0070673_100006266 Ga0070673_1000062663 231
62 3300005438 Ga0070701_10075723 Ga0070701_100757232 231
63 3300005617 Ga0068859_100429121 Ga0068859_1004291212 231
64 3300006028 Ga0070717_10106690 Ga0070717_101066902 231
65 3300006931 Ga0097620_100429088 Ga0097620_1004290882 231
66 3300009098 Ga0105245_10369439 Ga0105245_103694392 231
67 3300009148 Ga0105243_10097282 Ga0105243_100972823 231
68 3300009553 Ga0105249_10181404 Ga0105249_101814042 231
69 3300014326 Ga0157380_10195816 Ga0157380_101958162 231
70 3300050489 nmdc:mga03683_32691_c1 nmdc:mga03683_32691_c1_568_1368 231
71 3300007788 Ga0099795_10051511 Ga0099795_100515112 232
72 3300009553 Ga0105249_10225799 Ga0105249_102257992 232
73 3300013296 Ga0157374_10196406 Ga0157374_101964063 232
74 3300025900 Ga0207710_10070730 Ga0207710_100707301 232
75 3300025916 Ga0207663_10191343 Ga0207663_101913432 232
76 3300025918 Ga0207662_10210412 Ga0207662_102104121 232
77 3300025928 Ga0207700_10312731 Ga0207700_103127312 232
78 3300025931 Ga0207644_10009066 Ga0207644_100090663 232
79 3300025932 Ga0207690_10142529 Ga0207690_101425291 232
80 3300025936 Ga0207670_10310679 Ga0207670_103106792 232
81 3300025945 Ga0207679_10108986 Ga0207679_101089863 232
82 3300025960 Ga0207651_10004647 Ga0207651_100046474 232
83 3300046491 Ga0495584_0024408 Ga0495584_0024408_1461_2267 232
84 3300048903 Ga0496100_0118147 Ga0496100_0118147_168_923 232
85 3300048907 Ga0496104_0161580 Ga0496104_0161580_225_980 232
86 3300048911 Ga0496108_0145198 Ga0496108_0145198_397_1152 232
87 3300003215 JGI25153J46596_10009748 JGI25153J46596_100097485 233
88 3300005328 Ga0070676_10051492 Ga0070676_100514922 233
89 3300005335 Ga0070666_10003184 Ga0070666_100031842 233
90 3300005355 Ga0070671_100005662 Ga0070671_1000056622 233
91 3300005456 Ga0070678_100004855 Ga0070678_1000048554 233
92 3300005466 Ga0070685_10028236 Ga0070685_100282362 233
93 3300006195 Ga0075366_10003072 Ga0075366_100030722 233
94 3300006353 Ga0075370_10042888 Ga0075370_100428882 233
95 3300009147 Ga0114129_10027910 Ga0114129_100279104 233
96 3300014969 Ga0157376_10355173 Ga0157376_103551732 233
97 3300025297 Ga0209758_1000667 Ga0209758_100066725 233
98 3300025925 Ga0207650_10001640 Ga0207650_100016403 233
99 3300025938 Ga0207704_10598202 Ga0207704_105982021 233
100 3300035170 Ga0373943_0173437 Ga0373943_0173437_54_827 233
101 3300035171 Ga0373946_0036488 Ga0373946_0036488_552_1325 233
102 3300035172 Ga0373955_0035238 Ga0373955_0035238_1042_1815 233
103 3300035242 Ga0373962_0065404 Ga0373962_0065404_104_889 233
104 3300035410 Ga0373924_0085378 Ga0373924_0085378_295_1068 233
105 3300035695 Ga0373927_0047892 Ga0373927_0047892_841_1614 233
106 3300035725 Ga0373947_0205171 Ga0373947_0205171_183_977 233
107 3300036401 Ga0373937_0606471 Ga0373937_0606471_231_1025 233
108 3300046462 Ga0495651_0016870 Ga0495651_0016870_158_931 233
109 3300046463 Ga0495653_0074774 Ga0495653_0074774_920_1693 233
110 3300046473 Ga0495582_0188694 Ga0495582_0188694_199_993 233
111 3300046543 Ga0495645_0066077 Ga0495645_0066077_354_1127 233
112 3300046675 Ga0495657_0275986 Ga0495657_0275986_27_800 233
113 3300046679 Ga0495623_0038989 Ga0495623_0038989_295_1068 233
114 3300046683 Ga0495658_0107196 Ga0495658_0107196_763_1548 233
115 3300046690 Ga0495624_0236758 Ga0495624_0236758_94_879 233
116 3300047319 Ga0495674_0224472 Ga0495674_0224472_598_1392 233
117 3300047321 Ga0495676_0200409 Ga0495676_0200409_264_1058 233
118 3300047444 Ga0495675_0028731 Ga0495675_0028731_2625_3398 233
119 3300048088 Ga0495602_0202687 Ga0495602_0202687_711_1484 233
120 3300048903 Ga0496100_0059652 Ga0496100_0059652_1648_2433 233
121 3300048904 Ga0496101_0415244 Ga0496101_0415244_78_863 233
122 3300048905 Ga0496102_0002882 Ga0496102_0002882_1806_2591 233
123 3300048906 Ga0496103_0025600 Ga0496103_0025600_2512_3297 233
124 3300048907 Ga0496104_0082666 Ga0496104_0082666_809_1594 233
125 3300048908 Ga0496105_0001629 Ga0496105_0001629_959_1744 233
126 3300048909 Ga0496106_0008038 Ga0496106_0008038_4431_5216 233
127 3300048910 Ga0496107_0048080 Ga0496107_0048080_464_1249 233
128 3300048911 Ga0496108_0000595 Ga0496108_0000595_16995_17780 233
129 3300048912 Ga0496109_0002045 Ga0496109_0002045_3930_4715 233
130 3300048914 Ga0496111_0134560 Ga0496111_0134560_896_1681 233
131 3300048915 Ga0496112_0008941 Ga0496112_0008941_1414_2199 233
132 3300049571 Ga0501034_0014054 Ga0501034_0014054_3831_4586 233
133 3300050491 nmdc:mga00v17_94675_c1 nmdc:mga00v17_94675_c1_446_1231 233
134 3300050493 nmdc:mga0k408_96561_c1 nmdc:mga0k408_96561_c1_602_1351 233
135 3300050496 nmdc:mga07m45_53724_c1 nmdc:mga07m45_53724_c1_1245_1994 233
136 3300050508 nmdc:mga09592_269303_c1 nmdc:mga09592_269303_c1_160_945 233
137 3300050510 nmdc:mga06r32_205805_c1 nmdc:mga06r32_205805_c1_159_944 233
138 3300050512 nmdc:mga0n895_76852_c1 nmdc:mga0n895_76852_c1_472_1257 233
139 3300050514 nmdc:mga08x19_364571_c1 nmdc:mga08x19_364571_c1_133_918 233
140 3300053084 Ga0495595_0131978 Ga0495595_0131978_287_1060 233
141 3300053119 Ga0500595_048070 Ga0500595_048070_454_1236 233
142 3300005331 Ga0070670_100005729 Ga0070670_1000057293 234
143 3300005434 Ga0070709_10111811 Ga0070709_101118112 234
144 3300005548 Ga0070665_100064597 Ga0070665_1000645971 234
145 3300005842 Ga0068858_100433088 Ga0068858_1004330881 234
146 3300006175 Ga0070712_100177167 Ga0070712_1001771672 234
147 3300006871 Ga0075434_100038150 Ga0075434_1000381502 234
148 3300009177 Ga0105248_10329999 Ga0105248_103299992 234
149 3300025915 Ga0207693_10142586 Ga0207693_101425862 234
150 3300025941 Ga0207711_10236664 Ga0207711_102366642 234
151 3300026035 Ga0207703_10337337 Ga0207703_103373372 234
152 3300048907 Ga0496104_0472465 Ga0496104_0472465_448_1152 234
153 3300050512 nmdc:mga0n895_266041_c1 nmdc:mga0n895_266041_c1_140_901 234
154 3300005985 Ga0081539_10038361 Ga0081539_100383613 235
155 3300006173 Ga0070716_100555592 Ga0070716_1005555921 235
156 3300039437 Ga0436365_0671220 Ga0436365_0671220_239_973 235
157 3300048917 Ga0496114_0127579 Ga0496114_0127579_964_1749 235
158 3300053131 Ga0500652_002800 Ga0500652_002800_2891_3637 235
159 3300005329 Ga0070683_100360828 Ga0070683_1003608282 236
160 3300005347 Ga0070668_100367217 Ga0070668_1003672172 236
161 3300005458 Ga0070681_10154716 Ga0070681_101547164 236
162 3300005530 Ga0070679_100511397 Ga0070679_1005113972 236
163 3300007076 Ga0075435_100229571 Ga0075435_1002295712 236
164 3300009147 Ga0114129_10021642 Ga0114129_100216422 236
165 3300025912 Ga0207707_10091808 Ga0207707_100918081 236
166 3300035242 Ga0373962_0030780 Ga0373962_0030780_568_1335 236
167 3300050507 nmdc:mga05p37_37269_c1 nmdc:mga05p37_37269_c1_226_1029 236
168 3300053087 Ga0500643_002051 Ga0500643_002051_9979_10725 236
169 3300053094 Ga0500566_0062436 Ga0500566_0062436_193_939 236
170 3300053119 Ga0500595_000002 Ga0500595_000002_24036_24782 236
171 3300053119 Ga0500595_024086 Ga0500595_024086_1304_2044 236
172 3300053730 Ga0500645_000471 Ga0500645_000471_280_1026 236
173 3300005365 Ga0070688_100364842 Ga0070688_1003648421 237
174 3300021384 Ga0213876_10137829 Ga0213876_101378292 237
175 3300039437 Ga0436365_0424475 Ga0436365_0424475_259_996 237
176 3300039437 Ga0436365_1126455 Ga0436365_1126455_16698_17441 237
177 3300053119 Ga0500595_049570 Ga0500595_049570_298_1050 238
178 3300053131 Ga0500652_000002 Ga0500652_000002_21835_22587 238
179 3300053177 Ga0500636_0010920 Ga0500636_0010920_765_1517 238
180 3300005353 Ga0070669_100099081 Ga0070669_1000990812 239
181 3300026075 Ga0207708_10152141 Ga0207708_101521412 239
182 3300046454 Ga0495592_0058494 Ga0495592_0058494_203_973 239
183 3300046463 Ga0495653_0095828 Ga0495653_0095828_17_787 239
184 3300046514 Ga0495618_0052847 Ga0495618_0052847_1616_2386 239
185 3300046533 Ga0495640_0036024 Ga0495640_0036024_884_1654 239
186 3300046663 Ga0495635_0033531 Ga0495635_0033531_2152_2922 239
187 3300047315 Ga0495581_0110979 Ga0495581_0110979_403_1173 239
188 3300047319 Ga0495674_0289962 Ga0495674_0289962_131_901 239
189 3300047322 Ga0495680_0015212 Ga0495680_0015212_5766_6536 239
190 3300053077 Ga0495601_0058505 Ga0495601_0058505_945_1715 239
191 3300053078 Ga0495612_0254303 Ga0495612_0254303_38_766 239
192 3300053084 Ga0495595_0003960 Ga0495595_0003960_2906_3676 239
193 3300053085 Ga0495619_0000707 Ga0495619_0000707_11408_12178 239
194 3300014969 Ga0157376_10166940 Ga0157376_101669403 240
195 3300028556 Ga0265337_1000937 Ga0265337_10009379 240
196 3300042012 Ga0439455_0020242 Ga0439455_0020242_686_1408 240
197 3300048913 Ga0496110_0158766 Ga0496110_0158766_1316_2038 240
198 3300005338 Ga0068868_100115640 Ga0068868_1001156402 241
199 3300005353 Ga0070669_100264788 Ga0070669_1002647882 241
200 3300005618 Ga0068864_100520985 Ga0068864_1005209852 241
201 3300006177 Ga0075362_10014468 Ga0075362_100144682 241
202 3300006358 Ga0068871_100105497 Ga0068871_1001054972 241
203 3300009098 Ga0105245_10003343 Ga0105245_1000334311 241
204 3300009176 Ga0105242_10077617 Ga0105242_100776172 241
205 3300009177 Ga0105248_10066436 Ga0105248_100664362 241
206 3300009545 Ga0105237_10154166 Ga0105237_101541662 241
207 3300013297 Ga0157378_10290854 Ga0157378_102908542 241
208 3300025960 Ga0207651_10530617 Ga0207651_105306171 241
209 3300026095 Ga0207676_10457777 Ga0207676_104577772 241
210 3300031090 Ga0265760_10043236 Ga0265760_100432362 241
211 3300050489 nmdc:mga03683_18329_c1 nmdc:mga03683_18329_c1_323_1078 241
212 3300050493 nmdc:mga0k408_131980_c1 nmdc:mga0k408_131980_c1_658_1413 241
213 3300053085 Ga0495619_0215861 Ga0495619_0215861_203_967 241
214 3300003323 rootH1_10324480 rootH1_103244801 242
215 3300005364 Ga0070673_100206286 Ga0070673_1002062862 242
216 3300005543 Ga0070672_100713150 Ga0070672_1007131501 242
217 3300005547 Ga0070693_100035126 Ga0070693_1000351264 242
218 3300006038 Ga0075365_10120226 Ga0075365_101202262 242
219 3300006051 Ga0075364_10070240 Ga0075364_100702402 242
220 3300006178 Ga0075367_10147873 Ga0075367_101478731 242
221 3300006178 Ga0075367_10263366 Ga0075367_102633661 242
222 3300006186 Ga0075369_10066929 Ga0075369_100669292 242
223 3300006186 Ga0075369_10117726 Ga0075369_101177262 242
224 3300006195 Ga0075366_10114831 Ga0075366_101148312 242
225 3300006353 Ga0075370_10182511 Ga0075370_101825112 242
226 3300006358 Ga0068871_100812145 Ga0068871_1008121451 242
227 3300009176 Ga0105242_10462440 Ga0105242_104624402 242
228 3300017792 Ga0163161_10179514 Ga0163161_101795142 242
229 3300025937 Ga0207669_10028895 Ga0207669_100288953 242
230 3300025940 Ga0207691_10105570 Ga0207691_101055702 242
231 3300050491 nmdc:mga00v17_96663_c1 nmdc:mga00v17_96663_c1_441_1196 242
232 3300050493 nmdc:mga0k408_158540_c1 nmdc:mga0k408_158540_c1_276_1031 242
233 3300050494 nmdc:mga06z11_174357_c1 nmdc:mga06z11_174357_c1_324_1079 242
234 3300050495 nmdc:mga04h51_60655_c1 nmdc:mga04h51_60655_c1_519_1274 242
235 3300050496 nmdc:mga07m45_112389_c1 nmdc:mga07m45_112389_c1_258_1013 242
236 3300050513 nmdc:mga0rr50_113698_c1 nmdc:mga0rr50_113698_c1_26_754 242
237 3300050516 nmdc:mga0sz30_60220_c1 nmdc:mga0sz30_60220_c1_265_1020 242
238 3300005329 Ga0070683_100047159 Ga0070683_1000471593 243
239 3300005333 Ga0070677_10086698 Ga0070677_100866982 243
240 3300005334 Ga0068869_100101106 Ga0068869_1001011062 243
241 3300005337 Ga0070682_100057115 Ga0070682_1000571151 243
242 3300005340 Ga0070689_100112675 Ga0070689_1001126752 243
243 3300005343 Ga0070687_100050516 Ga0070687_1000505162 243
244 3300005354 Ga0070675_100422799 Ga0070675_1004227992 243
245 3300005356 Ga0070674_100038354 Ga0070674_1000383542 243
246 3300005367 Ga0070667_100027988 Ga0070667_1000279882 243
247 3300005435 Ga0070714_100078722 Ga0070714_1000787222 243
248 3300005436 Ga0070713_100001020 Ga0070713_1000010204 243
249 3300005437 Ga0070710_10017282 Ga0070710_100172822 243
250 3300005539 Ga0068853_100334427 Ga0068853_1003344272 243
251 3300005544 Ga0070686_100021082 Ga0070686_1000210822 243
252 3300005546 Ga0070696_100239557 Ga0070696_1002395572 243
253 3300005548 Ga0070665_100158609 Ga0070665_1001586092 243
254 3300005615 Ga0070702_100048639 Ga0070702_1000486392 243
255 3300005617 Ga0068859_100042506 Ga0068859_1000425064 243
256 3300005618 Ga0068864_100116146 Ga0068864_1001161462 243
257 3300005718 Ga0068866_10155414 Ga0068866_101554142 243
258 3300005844 Ga0068862_100473164 Ga0068862_1004731642 243
259 3300006028 Ga0070717_10006020 Ga0070717_100060204 243
260 3300006163 Ga0070715_10004717 Ga0070715_100047173 243
261 3300006173 Ga0070716_100017238 Ga0070716_1000172383 243
262 3300006237 Ga0097621_100002278 Ga0097621_10000227811 243
263 3300006358 Ga0068871_100025855 Ga0068871_1000258554 243
264 3300006871 Ga0075434_100178933 Ga0075434_1001789332 243
265 3300006881 Ga0068865_100022649 Ga0068865_1000226492 243
266 3300006914 Ga0075436_100068342 Ga0075436_1000683422 243
267 3300006931 Ga0097620_100042507 Ga0097620_1000425074 243
268 3300009094 Ga0111539_10168453 Ga0111539_101684532 243
269 3300009101 Ga0105247_10113112 Ga0105247_101131122 243
270 3300009174 Ga0105241_10019317 Ga0105241_100193174 243
271 3300009177 Ga0105248_10213304 Ga0105248_102133042 243
272 3300009545 Ga0105237_10266351 Ga0105237_102663511 243
273 3300009553 Ga0105249_10344868 Ga0105249_103448682 243
274 3300010375 Ga0105239_10586786 Ga0105239_105867861 243
275 3300013105 Ga0157369_10591491 Ga0157369_105914912 243
276 3300014969 Ga0157376_10128068 Ga0157376_101280682 243
277 3300014969 Ga0157376_10267968 Ga0157376_102679682 243
278 3300025735 Ga0207713_1068350 Ga0207713_10683502 243
279 3300025898 Ga0207692_10067518 Ga0207692_100675182 243
280 3300025899 Ga0207642_10017392 Ga0207642_100173922 243
281 3300025900 Ga0207710_10013021 Ga0207710_100130213 243
282 3300025903 Ga0207680_10016525 Ga0207680_100165252 243
283 3300025905 Ga0207685_10015364 Ga0207685_100153642 243
284 3300025906 Ga0207699_10001538 Ga0207699_100015386 243
285 3300025907 Ga0207645_10047408 Ga0207645_100474082 243
286 3300025914 Ga0207671_10065883 Ga0207671_100658832 243
287 3300025915 Ga0207693_10074133 Ga0207693_100741332 243
288 3300025918 Ga0207662_10045199 Ga0207662_100451992 243
289 3300025920 Ga0207649_10011721 Ga0207649_100117213 243
290 3300025924 Ga0207694_10199604 Ga0207694_101996042 243
291 3300025925 Ga0207650_10105089 Ga0207650_101050892 243
292 3300025927 Ga0207687_10217098 Ga0207687_102170982 243
293 3300025928 Ga0207700_10000483 Ga0207700_1000048313 243
294 3300025929 Ga0207664_10068274 Ga0207664_100682742 243
295 3300025931 Ga0207644_10009427 Ga0207644_100094274 243
296 3300025936 Ga0207670_10042965 Ga0207670_100429652 243
297 3300025938 Ga0207704_10080499 Ga0207704_100804992 243
298 3300025939 Ga0207665_10008168 Ga0207665_100081684 243
299 3300025942 Ga0207689_10248997 Ga0207689_102489972 243
300 3300025960 Ga0207651_10010467 Ga0207651_100104672 243
301 3300025961 Ga0207712_10112192 Ga0207712_101121922 243
302 3300026023 Ga0207677_10048287 Ga0207677_100482872 243
303 3300026035 Ga0207703_10024255 Ga0207703_100242552 243
304 3300026067 Ga0207678_10068972 Ga0207678_100689721 243
305 3300026089 Ga0207648_10186273 Ga0207648_101862732 243
306 3300026095 Ga0207676_10079802 Ga0207676_100798022 243
307 3300026121 Ga0207683_10002446 Ga0207683_1000244611 243
308 3300028379 Ga0268266_10005646 Ga0268266_100056467 243
309 3300031241 Ga0265325_10030064 Ga0265325_100300642 243
310 3300031711 Ga0265314_10014070 Ga0265314_100140704 243
311 3300034819 Ga0373958_0002537 Ga0373958_0002537_139_897 243
312 3300034820 Ga0373959_0005961 Ga0373959_0005961_1220_1978 243
313 3300035084 Ga0373928_0005103 Ga0373928_0005103_1616_2374 243
314 3300035088 Ga0373940_0041696 Ga0373940_0041696_287_1045 243
315 3300035090 Ga0373949_0003504 Ga0373949_0003504_1329_2087 243
316 3300035091 Ga0373951_0003118 Ga0373951_0003118_3014_3772 243
317 3300035092 Ga0373952_0010252 Ga0373952_0010252_490_1248 243
318 3300035112 Ga0373932_0002415 Ga0373932_0002415_1573_2331 243
319 3300035115 Ga0373941_0001742 Ga0373941_0001742_1932_2690 243
320 3300035116 Ga0373945_0014877 Ga0373945_0014877_1231_1989 243
321 3300035121 Ga0373960_0002782 Ga0373960_0002782_1682_2440 243
322 3300035170 Ga0373943_0050747 Ga0373943_0050747_253_1011 243
323 3300035241 Ga0373961_0020865 Ga0373961_0020865_755_1513 243
324 3300035242 Ga0373962_0002001 Ga0373962_0002001_2388_3146 243
325 3300035691 Ga0373931_0014732 Ga0373931_0014732_1860_2618 243
326 3300035692 Ga0373935_0000897 Ga0373935_0000897_5205_5963 243
327 3300035725 Ga0373947_0001129 Ga0373947_0001129_11399_12157 243
328 3300037068 Ga0373925_0006292 Ga0373925_0006292_4355_5113 243
329 3300046455 Ga0495603_0036699 Ga0495603_0036699_1155_1913 243
330 3300046459 Ga0495629_0000623 Ga0495629_0000623_11403_12161 243
331 3300046473 Ga0495582_0001248 Ga0495582_0001248_7883_8641 243
332 3300046499 Ga0495594_0026013 Ga0495594_0026013_794_1552 243
333 3300046681 Ga0495647_0000627 Ga0495647_0000627_3317_4075 243
334 3300046683 Ga0495658_0001220 Ga0495658_0001220_1313_2071 243
335 3300046689 Ga0495613_0003128 Ga0495613_0003128_8159_8917 243
336 3300047321 Ga0495676_0021468 Ga0495676_0021468_1249_2007 243
337 3300047322 Ga0495680_0005826 Ga0495680_0005826_9033_9791 243
338 3300047673 Ga0495593_0014060 Ga0495593_0014060_2787_3545 243
339 3300048904 Ga0496101_0003943 Ga0496101_0003943_70_828 243
340 3300048906 Ga0496103_0020156 Ga0496103_0020156_3048_3806 243
341 3300048910 Ga0496107_0104313 Ga0496107_0104313_689_1447 243
342 3300048911 Ga0496108_0005981 Ga0496108_0005981_8323_9081 243
343 3300048912 Ga0496109_0074590 Ga0496109_0074590_777_1535 243
344 3300048912 Ga0496109_0275774 Ga0496109_0275774_41_799 243
345 3300048913 Ga0496110_0049746 Ga0496110_0049746_1681_2439 243
346 3300048914 Ga0496111_0147341 Ga0496111_0147341_777_1535 243
347 3300048915 Ga0496112_0118981 Ga0496112_0118981_198_956 243
348 3300048916 Ga0496113_0003365 Ga0496113_0003365_8013_8771 243
349 3300048916 Ga0496113_0378290 Ga0496113_0378290_251_1009 243
350 3300048918 Ga0496115_0031240 Ga0496115_0031240_2681_3439 243
351 3300048918 Ga0496115_0073726 Ga0496115_0073726_1936_2697 243
352 3300048918 Ga0496115_0304453 Ga0496115_0304453_198_956 243
353 3300050513 nmdc:mga0rr50_24541_c1 nmdc:mga0rr50_24541_c1_1017_1775 243
354 3300053085 Ga0495619_0000922 Ga0495619_0000922_4600_5358 243
355 3300009094 Ga0111539_10063506 Ga0111539_100635064 244
356 3300012488 Ga0157343_1003637 Ga0157343_10036371 244
357 3300031241 Ga0265325_10000784 Ga0265325_100007843 244
358 3300035692 Ga0373935_0062315 Ga0373935_0062315_231_989 244
359 3300037068 Ga0373925_0114283 Ga0373925_0114283_528_1286 244
360 3300046516 Ga0495628_0120945 Ga0495628_0120945_1135_1893 244
361 3300047319 Ga0495674_0130894 Ga0495674_0130894_936_1709 244
362 3300047322 Ga0495680_0097548 Ga0495680_0097548_1263_2039 244
363 3300048088 Ga0495602_0286556 Ga0495602_0286556_131_907 244
364 3300049585 Ga0501069_0109843 Ga0501069_0109843_518_1282 244
365 3300049588 Ga0501072_0549467 Ga0501072_0549467_131_877 244
366 3300049742 Ga0501080_0158733 Ga0501080_0158733_917_1681 244
367 3300050511 nmdc:mga08y16_238729_c1 nmdc:mga08y16_238729_c1_103_858 244
368 3300053077 Ga0495601_0010986 Ga0495601_0010986_1962_2738 244
369 3300053084 Ga0495595_0008703 Ga0495595_0008703_1083_1859 244
370 3300054114 Ga0501084_0173493 Ga0501084_0173493_1010_1774 244
371 3300060353 Ga0501082_0109193 Ga0501082_0109193_752_1516 244
372 3300009147 Ga0114129_10653320 Ga0114129_106533202 245
373 3300005983 Ga0081540_1000114 Ga0081540_100011463 246
374 3300012481 Ga0157320_1004294 Ga0157320_10042942 246
375 3300005327 Ga0070658_10056638 Ga0070658_100566383 247
376 3300005344 Ga0070661_100551002 Ga0070661_1005510021 247
377 3300005435 Ga0070714_100029189 Ga0070714_1000291892 247
378 3300005530 Ga0070679_100123233 Ga0070679_1001232332 247
379 3300005563 Ga0068855_100005101 Ga0068855_1000051015 247
380 3300005616 Ga0068852_100004760 Ga0068852_1000047606 247
381 3300005616 Ga0068852_100312574 Ga0068852_1003125742 247
382 3300006846 Ga0075430_100297637 Ga0075430_1002976372 247
383 3300006847 Ga0075431_100215392 Ga0075431_1002153922 247
384 3300009551 Ga0105238_10010848 Ga0105238_100108488 247
385 3300010375 Ga0105239_10390745 Ga0105239_103907452 247
386 3300025909 Ga0207705_10006843 Ga0207705_100068432 247
387 3300025921 Ga0207652_10280435 Ga0207652_102804352 247
388 3300025924 Ga0207694_10633551 Ga0207694_106335511 247
389 3300025949 Ga0207667_10105691 Ga0207667_101056912 247
390 3300026078 Ga0207702_10036008 Ga0207702_100360083 247
391 3300026142 Ga0207698_10006673 Ga0207698_100066734 247
392 3300028800 Ga0265338_10365706 Ga0265338_103657062 247
393 3300031711 Ga0265314_10002142 Ga0265314_100021428 247
394 3300049571 Ga0501034_0070300 Ga0501034_0070300_2737_3486 247
395 3300049583 Ga0501067_0018478 Ga0501067_0018478_120_869 247
396 3300049584 Ga0501068_0047044 Ga0501068_0047044_163_912 247
397 3300049586 Ga0501070_0060309 Ga0501070_0060309_1600_2349 247
398 3300049589 Ga0501073_0034211 Ga0501073_0034211_1953_2702 247
399 3300049590 Ga0501074_0071216 Ga0501074_0071216_965_1714 247
400 3300049742 Ga0501080_0041456 Ga0501080_0041456_3373_4122 247
401 3300049743 Ga0501081_0316911 Ga0501081_0316911_270_1052 247
402 3300049823 Ga0501044_0510609 Ga0501044_0510609_221_970 247
403 3300050510 nmdc:mga06r32_381242_c1 nmdc:mga06r32_381242_c1_87_848 247
404 3300053088 Ga0500644_0138993 Ga0500644_0138993_56_802 247
405 3300053093 Ga0500651_0019363 Ga0500651_0019363_2122_2868 247
406 3300025909 Ga0207705_10185904 Ga0207705_101859042 248
407 3300031235 Ga0265330_10025586 Ga0265330_100255862 248
408 3300031241 Ga0265325_10009965 Ga0265325_100099653 248
409 3300028800 Ga0265338_10240698 Ga0265338_102406982 249
410 3300035111 Ga0373923_0106203 Ga0373923_0106203_177_935 249
411 3300035118 Ga0373954_0064487 Ga0373954_0064487_439_1197 249
412 3300035120 Ga0373957_0011276 Ga0373957_0011276_787_1545 249
413 3300035172 Ga0373955_0002236 Ga0373955_0002236_6581_7339 249
414 3300035724 Ga0373933_0007148 Ga0373933_0007148_3293_4051 249
415 3300036401 Ga0373937_0004652 Ga0373937_0004652_1744_2502 249
416 3300044842 Ga0466957_0371852 Ga0466957_0371852_86_838 249
417 3300046675 Ga0495657_0005731 Ga0495657_0005731_2086_2844 249
418 3300046679 Ga0495623_0169123 Ga0495623_0169123_132_890 249
419 3300046809 Ga0495600_0241385 Ga0495600_0241385_344_1102 249
420 3300047322 Ga0495680_0104727 Ga0495680_0104727_346_1104 249
421 3300047444 Ga0495675_0007872 Ga0495675_0007872_3408_4166 249
422 3300048088 Ga0495602_0028839 Ga0495602_0028839_2784_3542 249
423 3300053085 Ga0495619_0027485 Ga0495619_0027485_412_1170 249
424 3300053153 Ga0500616_0000002 Ga0500616_0000002_36389_37141 249
425 iso_pu_bacteria 2643221547 2643756410 249
426 3300031238 Ga0265332_10047640 Ga0265332_100476401 250
427 3300044684 Ga0466966_0031357 Ga0466966_0031357_2408_3166 250
428 3300044694 Ga0466963_0080913 Ga0466963_0080913_144_902 250
429 3300044842 Ga0466957_0016973 Ga0466957_0016973_3403_4161 250
430 3300045836 Ga0466958_0262076 Ga0466958_0262076_128_886 250
431 3300048916 Ga0496113_0090608 Ga0496113_0090608_39_839 250
432 3300005327 Ga0070658_10037002 Ga0070658_100370022 251
433 3300005327 Ga0070658_10039186 Ga0070658_100391862 251
434 3300005336 Ga0070680_100086093 Ga0070680_1000860932 251
435 3300005336 Ga0070680_100200471 Ga0070680_1002004711 251
436 3300005339 Ga0070660_100082441 Ga0070660_1000824412 251
437 3300005344 Ga0070661_100081585 Ga0070661_1000815851 251
438 3300005366 Ga0070659_100092725 Ga0070659_1000927252 251
439 3300005436 Ga0070713_100087894 Ga0070713_1000878942 251
440 3300005458 Ga0070681_10061531 Ga0070681_100615312 251
441 3300005458 Ga0070681_10125469 Ga0070681_101254692 251
442 3300005530 Ga0070679_100229224 Ga0070679_1002292242 251
443 3300005578 Ga0068854_100051701 Ga0068854_1000517012 251
444 3300009093 Ga0105240_10056461 Ga0105240_100564612 251
445 3300013104 Ga0157370_10697532 Ga0157370_106975321 251
446 3300013105 Ga0157369_10463740 Ga0157369_104637402 251
447 3300025909 Ga0207705_10046225 Ga0207705_100462252 251
448 3300025912 Ga0207707_10198955 Ga0207707_101989552 251
449 3300025913 Ga0207695_10182232 Ga0207695_101822322 251
450 3300025917 Ga0207660_10141067 Ga0207660_101410672 251
451 3300025917 Ga0207660_10175361 Ga0207660_101753611 251
452 3300025919 Ga0207657_10061957 Ga0207657_100619572 251
453 3300025919 Ga0207657_10199783 Ga0207657_101997832 251
454 3300025920 Ga0207649_10112044 Ga0207649_101120442 251
455 3300025921 Ga0207652_10071665 Ga0207652_100716652 251
456 3300025921 Ga0207652_10115315 Ga0207652_101153152 251
457 3300025932 Ga0207690_10112467 Ga0207690_101124672 251
458 3300025949 Ga0207667_10554517 Ga0207667_105545172 251
459 3300025981 Ga0207640_10115794 Ga0207640_101157942 251
460 3300026142 Ga0207698_10325949 Ga0207698_103259492 251
461 3300028800 Ga0265338_10126321 Ga0265338_101263212 251
462 3300031235 Ga0265330_10008372 Ga0265330_100083724 251
463 3300031241 Ga0265325_10034777 Ga0265325_100347772 251
464 3300031247 Ga0265340_10083718 Ga0265340_100837182 251
465 3300031595 Ga0265313_10065540 Ga0265313_100655402 251
466 3300031712 Ga0265342_10000540 Ga0265342_100005408 251
467 3300035086 Ga0373934_0065203 Ga0373934_0065203_15_815 251
468 3300035725 Ga0373947_0012771 Ga0373947_0012771_3737_4525 251
469 3300036401 Ga0373937_0001244 Ga0373937_0001244_16144_16944 251
470 3300049581 Ga0501047_0020439 Ga0501047_0020439_406_1176 251
471 3300005336 Ga0070680_100345922 Ga0070680_1003459221 252
472 3300005530 Ga0070679_100090574 Ga0070679_1000905743 252
473 3300009098 Ga0105245_10504908 Ga0105245_105049082 252
474 3300010375 Ga0105239_10877507 Ga0105239_108775072 252
475 3300013104 Ga0157370_10026836 Ga0157370_100268364 252
476 3300013306 Ga0163162_10877134 Ga0163162_108771341 252
477 3300025261 Ga0209233_1008155 Ga0209233_10081551 252
478 3300025921 Ga0207652_10141699 Ga0207652_101416992 252
479 3300035116 Ga0373945_0003277 Ga0373945_0003277_1018_1776 252
480 3300035170 Ga0373943_0063797 Ga0373943_0063797_145_915 252
481 3300035171 Ga0373946_0010755 Ga0373946_0010755_1874_2632 252
482 3300035410 Ga0373924_0010583 Ga0373924_0010583_168_926 252
483 3300035692 Ga0373935_0048846 Ga0373935_0048846_968_1726 252
484 3300035695 Ga0373927_0015353 Ga0373927_0015353_2957_3715 252
485 3300035724 Ga0373933_0017351 Ga0373933_0017351_1683_2441 252
486 3300035725 Ga0373947_0077964 Ga0373947_0077964_798_1556 252
487 3300046452 Ga0495617_036321 Ga0495617_036321_684_1442 252
488 3300046454 Ga0495592_0077746 Ga0495592_0077746_998_1756 252
489 3300046459 Ga0495629_0207783 Ga0495629_0207783_220_978 252
490 3300046461 Ga0495641_0012473 Ga0495641_0012473_3478_4236 252
491 3300046462 Ga0495651_0009844 Ga0495651_0009844_857_1615 252
492 3300046463 Ga0495653_0034032 Ga0495653_0034032_79_837 252
493 3300046472 Ga0495580_0004252 Ga0495580_0004252_10718_11476 252
494 3300046476 Ga0495662_0049431 Ga0495662_0049431_1166_1924 252
495 3300046477 Ga0495664_0026877 Ga0495664_0026877_339_1097 252
496 3300046492 Ga0495585_0001463 Ga0495585_0001463_13755_14513 252
497 3300046499 Ga0495594_0016246 Ga0495594_0016246_2663_3421 252
498 3300046501 Ga0495607_0002688 Ga0495607_0002688_2458_3216 252
499 3300046511 Ga0495608_0129848 Ga0495608_0129848_278_1036 252
500 3300046514 Ga0495618_0277276 Ga0495618_0277276_183_941 252
501 3300046516 Ga0495628_0132535 Ga0495628_0132535_51_809 252
502 3300046517 Ga0495630_0137271 Ga0495630_0137271_351_1109 252
503 3300046523 Ga0495644_0001288 Ga0495644_0001288_2162_2920 252
504 3300046529 Ga0495652_0036124 Ga0495652_0036124_3337_4095 252
505 3300046531 Ga0495665_0008222 Ga0495665_0008222_2050_2808 252
506 3300046533 Ga0495640_0178891 Ga0495640_0178891_489_1247 252
507 3300046535 Ga0495586_0051009 Ga0495586_0051009_1388_2146 252
508 3300046536 Ga0495587_0015294 Ga0495587_0015294_192_950 252
509 3300046538 Ga0495609_0045650 Ga0495609_0045650_908_1666 252
510 3300046543 Ga0495645_0078198 Ga0495645_0078198_380_1138 252
511 3300046557 Ga0495622_0025955 Ga0495622_0025955_1355_2113 252
512 3300046559 Ga0495667_0004407 Ga0495667_0004407_1632_2390 252
513 3300046615 Ga0495656_0000284 Ga0495656_0000284_10928_11686 252
514 3300046642 Ga0495634_0213500 Ga0495634_0213500_375_1133 252
515 3300046663 Ga0495635_0003295 Ga0495635_0003295_7336_8094 252
516 3300046674 Ga0495588_0001863 Ga0495588_0001863_5945_6703 252
517 3300046678 Ga0495599_0042191 Ga0495599_0042191_2060_2818 252
518 3300046680 Ga0495646_0026179 Ga0495646_0026179_2303_3061 252
519 3300046681 Ga0495647_0006614 Ga0495647_0006614_2715_3473 252
520 3300046683 Ga0495658_0009067 Ga0495658_0009067_694_1452 252
521 3300046689 Ga0495613_0126155 Ga0495613_0126155_562_1320 252
522 3300046690 Ga0495624_0012794 Ga0495624_0012794_4250_5008 252
523 3300046691 Ga0495670_0000802 Ga0495670_0000802_8109_8867 252
524 3300046809 Ga0495600_0003569 Ga0495600_0003569_632_1390 252
525 3300047315 Ga0495581_0125955 Ga0495581_0125955_628_1386 252
526 3300047317 Ga0495604_0020267 Ga0495604_0020267_2707_3465 252
527 3300047318 Ga0495636_0087271 Ga0495636_0087271_209_967 252
528 3300047319 Ga0495674_0072398 Ga0495674_0072398_365_1123 252
529 3300047322 Ga0495680_0098868 Ga0495680_0098868_220_978 252
530 3300047444 Ga0495675_0138192 Ga0495675_0138192_295_1053 252
531 3300047471 Ga0495684_0002228 Ga0495684_0002228_12272_13030 252
532 3300047673 Ga0495593_0044745 Ga0495593_0044745_488_1246 252
533 3300048089 Ga0495614_0034725 Ga0495614_0034725_196_954 252
534 3300049586 Ga0501070_0339088 Ga0501070_0339088_108_869 252
535 3300050513 nmdc:mga0rr50_193053_c1 nmdc:mga0rr50_193053_c1_170_928 252
536 3300053077 Ga0495601_0169132 Ga0495601_0169132_296_1054 252
537 3300053084 Ga0495595_0016009 Ga0495595_0016009_188_946 252
538 3300053085 Ga0495619_0010208 Ga0495619_0010208_2800_3558 252
539 2209111006 2214939630 2214002920 253
540 3300000042 ARSoilYngRDRAFT_c00506 ARSoilYngRDRAFT_005062 253
541 3300000043 ARcpr5yngRDRAFT_c000242 ARcpr5yngRDRAFT_0002424 253
542 3300000044 ARSoilOldRDRAFT_c000121 ARSoilOldRDRAFT_0001218 253
543 3300000652 ARCol0yngRDRAFT_1000359 ARCol0yngRDRAFT_10003592 253
544 3300001915 JGI24741J21665_1007046 JGI24741J21665_10070462 253
545 3300001976 JGI24752J21851_1004877 JGI24752J21851_10048772 253
546 3300001977 JGI24746J21847_1000824 JGI24746J21847_10008244 253
547 3300001978 JGI24747J21853_1002656 JGI24747J21853_10026562 253
548 3300001979 JGI24740J21852_10051412 JGI24740J21852_100514122 253
549 3300001989 JGI24739J22299_10003155 JGI24739J22299_100031554 253
550 3300001990 JGI24737J22298_10001457 JGI24737J22298_100014572 253
551 3300001990 JGI24737J22298_10002963 JGI24737J22298_100029632 253
552 3300001991 JGI24743J22301_10012296 JGI24743J22301_100122962 253
553 3300002070 JGI24750J21931_1000375 JGI24750J21931_10003754 253
554 3300002073 JGI24745J21846_1000315 JGI24745J21846_10003152 253
555 3300002074 JGI24748J21848_1000231 JGI24748J21848_10002313 253
556 3300002075 JGI24738J21930_10000933 JGI24738J21930_100009337 253
557 3300002076 JGI24749J21850_1000549 JGI24749J21850_10005493 253
558 3300002126 JGI24035J26624_1001366 JGI24035J26624_10013662 253
559 3300002155 JGI24033J26618_1001139 JGI24033J26618_10011392 253
560 3300002239 JGI24034J26672_10000576 JGI24034J26672_100005762 253
561 3300002244 JGI24742J22300_10000159 JGI24742J22300_100001594 253
562 3300002459 JGI24751J29686_10003190 JGI24751J29686_100031902 253
563 3300005277 Ga0065716_1003273 Ga0065716_10032731 253
564 3300005290 Ga0065712_10004839 Ga0065712_100048394 253
565 3300005290 Ga0065712_10076519 Ga0065712_100765192 253
566 3300005290 Ga0065712_10089276 Ga0065712_100892762 253
567 3300005293 Ga0065715_10000997 Ga0065715_100009979 253
568 3300005293 Ga0065715_10089127 Ga0065715_100891274 253
569 3300005293 Ga0065715_10183953 Ga0065715_101839532 253
570 3300005328 Ga0070676_10000012 Ga0070676_1000001231 253
571 3300005329 Ga0070683_100000139 Ga0070683_10000013934 253
572 3300005330 Ga0070690_100000554 Ga0070690_1000005544 253
573 3300005330 Ga0070690_100079168 Ga0070690_1000791682 253
574 3300005331 Ga0070670_100012083 Ga0070670_1000120831 253
575 3300005331 Ga0070670_100166512 Ga0070670_1001665122 253
576 3300005333 Ga0070677_10001496 Ga0070677_100014966 253
577 3300005334 Ga0068869_100000347 Ga0068869_1000003479 253
578 3300005334 Ga0068869_100247517 Ga0068869_1002475172 253
579 3300005335 Ga0070666_10093332 Ga0070666_100933322 253
580 3300005335 Ga0070666_10205984 Ga0070666_102059842 253
581 3300005336 Ga0070680_100000179 Ga0070680_10000017931 253
582 3300005336 Ga0070680_100045857 Ga0070680_1000458572 253
583 3300005337 Ga0070682_100000565 Ga0070682_1000005656 253
584 3300005337 Ga0070682_100106109 Ga0070682_1001061092 253
585 3300005338 Ga0068868_100001066 Ga0068868_1000010664 253
586 3300005339 Ga0070660_100000267 Ga0070660_1000002679 253
587 3300005339 Ga0070660_100092461 Ga0070660_1000924612 253
588 3300005340 Ga0070689_100000190 Ga0070689_10000019021 253
589 3300005340 Ga0070689_100079239 Ga0070689_1000792392 253
590 3300005341 Ga0070691_10001105 Ga0070691_100011056 253
591 3300005341 Ga0070691_10066970 Ga0070691_100669702 253
592 3300005343 Ga0070687_100000182 Ga0070687_1000001827 253
593 3300005343 Ga0070687_100139978 Ga0070687_1001399782 253
594 3300005344 Ga0070661_100001231 Ga0070661_1000012316 253
595 3300005345 Ga0070692_10001438 Ga0070692_100014382 253
596 3300005345 Ga0070692_10017265 Ga0070692_100172652 253
597 3300005347 Ga0070668_100000597 Ga0070668_10000059714 253
598 3300005347 Ga0070668_100227205 Ga0070668_1002272052 253
599 3300005353 Ga0070669_100000409 Ga0070669_10000040925 253
600 3300005353 Ga0070669_100102528 Ga0070669_1001025282 253
601 3300005354 Ga0070675_100000593 Ga0070675_1000005939 253
602 3300005354 Ga0070675_100049525 Ga0070675_1000495252 253
603 3300005355 Ga0070671_100009041 Ga0070671_1000090416 253
604 3300005356 Ga0070674_100000084 Ga0070674_10000008430 253
605 3300005356 Ga0070674_100033759 Ga0070674_1000337593 253
606 3300005364 Ga0070673_100000041 Ga0070673_10000004134 253
607 3300005365 Ga0070688_100000320 Ga0070688_10000032024 253
608 3300005365 Ga0070688_100004329 Ga0070688_1000043291 253
609 3300005366 Ga0070659_100003151 Ga0070659_1000031517 253
610 3300005366 Ga0070659_100008866 Ga0070659_1000088662 253
611 3300005367 Ga0070667_100000365 Ga0070667_10000036524 253
612 3300005367 Ga0070667_100012887 Ga0070667_1000128873 253
613 3300005406 Ga0070703_10003890 Ga0070703_100038902 253
614 3300005438 Ga0070701_10000110 Ga0070701_100001109 253
615 3300005438 Ga0070701_10070064 Ga0070701_100700642 253
616 3300005440 Ga0070705_100000938 Ga0070705_1000009389 253
617 3300005441 Ga0070700_100001112 Ga0070700_1000011125 253
618 3300005441 Ga0070700_100001991 Ga0070700_1000019912 253
619 3300005444 Ga0070694_100000065 Ga0070694_10000006527 253
620 3300005444 Ga0070694_100174772 Ga0070694_1001747722 253
621 3300005445 Ga0070708_100128395 Ga0070708_1001283952 253
622 3300005455 Ga0070663_100000654 Ga0070663_1000006545 253
623 3300005455 Ga0070663_100266364 Ga0070663_1002663642 253
624 3300005456 Ga0070678_100000091 Ga0070678_10000009125 253
625 3300005457 Ga0070662_100000629 Ga0070662_1000006294 253
626 3300005457 Ga0070662_100058296 Ga0070662_1000582962 253
627 3300005458 Ga0070681_10014301 Ga0070681_100143012 253
628 3300005458 Ga0070681_10044378 Ga0070681_100443782 253
629 3300005459 Ga0068867_100002763 Ga0068867_1000027633 253
630 3300005459 Ga0068867_100105534 Ga0068867_1001055342 253
631 3300005466 Ga0070685_10002711 Ga0070685_100027118 253
632 3300005466 Ga0070685_10164459 Ga0070685_101644592 253
633 3300005530 Ga0070679_100003726 Ga0070679_1000037265 253
634 3300005530 Ga0070679_100101766 Ga0070679_1001017662 253
635 3300005535 Ga0070684_100000219 Ga0070684_10000021925 253
636 3300005536 Ga0070697_100121293 Ga0070697_1001212932 253
637 3300005536 Ga0070697_100263154 Ga0070697_1002631542 253
638 3300005539 Ga0068853_100040876 Ga0068853_1000408762 253
639 3300005539 Ga0068853_100152638 Ga0068853_1001526382 253
640 3300005543 Ga0070672_100000019 Ga0070672_10000001934 253
641 3300005543 Ga0070672_100117646 Ga0070672_1001176462 253
642 3300005544 Ga0070686_100000318 Ga0070686_1000003189 253
643 3300005544 Ga0070686_100007233 Ga0070686_1000072334 253
644 3300005545 Ga0070695_100001669 Ga0070695_1000016699 253
645 3300005545 Ga0070695_100005883 Ga0070695_1000058835 253
646 3300005546 Ga0070696_100001307 Ga0070696_10000130713 253
647 3300005546 Ga0070696_100039957 Ga0070696_1000399572 253
648 3300005546 Ga0070696_100224506 Ga0070696_1002245062 253
649 3300005547 Ga0070693_100000036 Ga0070693_10000003615 253
650 3300005549 Ga0070704_100002608 Ga0070704_1000026087 253
651 3300005549 Ga0070704_100051738 Ga0070704_1000517382 253
652 3300005563 Ga0068855_100001440 Ga0068855_1000014406 253
653 3300005564 Ga0070664_100000089 Ga0070664_1000000898 253
654 3300005564 Ga0070664_100045756 Ga0070664_1000457562 253
655 3300005564 Ga0070664_100211271 Ga0070664_1002112712 253
656 3300005564 Ga0070664_100393391 Ga0070664_1003933912 253
657 3300005577 Ga0068857_100027045 Ga0068857_1000270452 253
658 3300005577 Ga0068857_100233209 Ga0068857_1002332092 253
659 3300005578 Ga0068854_100000179 Ga0068854_10000017916 253
660 3300005614 Ga0068856_100000873 Ga0068856_1000008732 253
661 3300005614 Ga0068856_100228535 Ga0068856_1002285352 253
662 3300005615 Ga0070702_100000071 Ga0070702_10000007113 253
663 3300005616 Ga0068852_100019915 Ga0068852_1000199153 253
664 3300005617 Ga0068859_100006632 Ga0068859_1000066323 253
665 3300005617 Ga0068859_100348511 Ga0068859_1003485112 253
666 3300005618 Ga0068864_100000429 Ga0068864_10000042912 253
667 3300005718 Ga0068866_10000468 Ga0068866_100004683 253
668 3300005719 Ga0068861_100000169 Ga0068861_10000016926 253
669 3300005719 Ga0068861_100099866 Ga0068861_1000998662 253
670 3300005840 Ga0068870_10000339 Ga0068870_100003394 253
671 3300005841 Ga0068863_100000381 Ga0068863_1000003819 253
672 3300005842 Ga0068858_100009053 Ga0068858_1000090532 253
673 3300005842 Ga0068858_100026945 Ga0068858_1000269453 253
674 3300005842 Ga0068858_100297679 Ga0068858_1002976792 253
675 3300005843 Ga0068860_100000852 Ga0068860_10000085232 253
676 3300005844 Ga0068862_100003353 Ga0068862_1000033538 253
677 3300006042 Ga0075368_10032512 Ga0075368_100325122 253
678 3300006058 Ga0075432_10022645 Ga0075432_100226452 253
679 3300006237 Ga0097621_100000112 Ga0097621_1000001128 253
680 3300006358 Ga0068871_100000068 Ga0068871_10000006832 253
681 3300006852 Ga0075433_10001324 Ga0075433_100013249 253
682 3300006852 Ga0075433_10013574 Ga0075433_100135742 253
683 3300006852 Ga0075433_10292308 Ga0075433_102923082 253
684 3300006871 Ga0075434_100000614 Ga0075434_10000061428 253
685 3300006871 Ga0075434_100021261 Ga0075434_1000212612 253
686 3300006881 Ga0068865_100000294 Ga0068865_10000029413 253
687 3300006931 Ga0097620_100006632 Ga0097620_1000066323 253
688 3300006931 Ga0097620_100348512 Ga0097620_1003485122 253
689 3300007076 Ga0075435_100093500 Ga0075435_1000935002 253
690 3300007076 Ga0075435_100729284 Ga0075435_1007292841 253
691 3300009011 Ga0105251_10079195 Ga0105251_100791952 253
692 3300009093 Ga0105240_10055066 Ga0105240_100550664 253
693 3300009094 Ga0111539_10000082 Ga0111539_1000008235 253
694 3300009094 Ga0111539_10000804 Ga0111539_1000080430 253
695 3300009094 Ga0111539_10159604 Ga0111539_101596042 253
696 3300009098 Ga0105245_10000468 Ga0105245_100004682 253
697 3300009101 Ga0105247_10002855 Ga0105247_100028552 253
698 3300009101 Ga0105247_10063577 Ga0105247_100635772 253
699 3300009147 Ga0114129_10012592 Ga0114129_100125922 253
700 3300009148 Ga0105243_10003322 Ga0105243_100033223 253
701 3300009148 Ga0105243_10050863 Ga0105243_100508632 253
702 3300009174 Ga0105241_10000941 Ga0105241_100009412 253
703 3300009174 Ga0105241_10340805 Ga0105241_103408052 253
704 3300009176 Ga0105242_10000337 Ga0105242_100003379 253
705 3300009177 Ga0105248_10004009 Ga0105248_1000400912 253
706 3300009177 Ga0105248_10024723 Ga0105248_100247235 253
707 3300009545 Ga0105237_10039433 Ga0105237_100394334 253
708 3300009545 Ga0105237_10040862 Ga0105237_100408623 253
709 3300009551 Ga0105238_10092645 Ga0105238_100926452 253
710 3300009553 Ga0105249_10000755 Ga0105249_1000075513 253
711 3300009553 Ga0105249_10003637 Ga0105249_100036378 253
712 3300010375 Ga0105239_10001548 Ga0105239_100015486 253
713 3300010375 Ga0105239_10027538 Ga0105239_100275383 253
714 3300011119 Ga0105246_10000061 Ga0105246_1000006124 253
715 3300013100 Ga0157373_10017197 Ga0157373_100171972 253
716 3300013102 Ga0157371_10009867 Ga0157371_100098674 253
717 3300013102 Ga0157371_10328319 Ga0157371_103283192 253
718 3300013296 Ga0157374_10014373 Ga0157374_100143732 253
719 3300013306 Ga0163162_10001248 Ga0163162_100012489 253
720 3300013306 Ga0163162_10402102 Ga0163162_104021022 253
721 3300013307 Ga0157372_10475529 Ga0157372_104755292 253
722 3300013308 Ga0157375_10000468 Ga0157375_100004683 253
723 3300013308 Ga0157375_10248416 Ga0157375_102484162 253
724 3300014325 Ga0163163_10002620 Ga0163163_100026204 253
725 3300014326 Ga0157380_10001378 Ga0157380_1000137813 253
726 3300014326 Ga0157380_10471005 Ga0157380_104710052 253
727 3300014497 Ga0182008_10088887 Ga0182008_100888871 253
728 3300014745 Ga0157377_10000153 Ga0157377_100001537 253
729 3300014968 Ga0157379_10018260 Ga0157379_100182602 253
730 3300014968 Ga0157379_10149048 Ga0157379_101490482 253
731 3300014969 Ga0157376_10000226 Ga0157376_1000022635 253
732 3300017792 Ga0163161_10000384 Ga0163161_1000038434 253
733 3300025271 Ga0207666_1000025 Ga0207666_100002524 253
734 3300025271 Ga0207666_1001730 Ga0207666_10017302 253
735 3300025290 Ga0207673_1000816 Ga0207673_10008163 253
736 3300025315 Ga0207697_10000077 Ga0207697_1000007710 253
737 3300025315 Ga0207697_10020401 Ga0207697_100204012 253
738 3300025885 Ga0207653_10004641 Ga0207653_100046414 253
739 3300025893 Ga0207682_10000088 Ga0207682_1000008835 253
740 3300025899 Ga0207642_10000475 Ga0207642_100004759 253
741 3300025900 Ga0207710_10065231 Ga0207710_100652312 253
742 3300025901 Ga0207688_10000112 Ga0207688_100001124 253
743 3300025903 Ga0207680_10028241 Ga0207680_100282413 253
744 3300025904 Ga0207647_10014331 Ga0207647_100143312 253
745 3300025904 Ga0207647_10053338 Ga0207647_100533382 253
746 3300025907 Ga0207645_10000140 Ga0207645_1000014025 253
747 3300025908 Ga0207643_10000083 Ga0207643_1000008325 253
748 3300025911 Ga0207654_10001592 Ga0207654_100015927 253
749 3300025911 Ga0207654_10236154 Ga0207654_102361541 253
750 3300025912 Ga0207707_10032786 Ga0207707_100327862 253
751 3300025913 Ga0207695_10082733 Ga0207695_100827332 253
752 3300025914 Ga0207671_10388557 Ga0207671_103885572 253
753 3300025917 Ga0207660_10000545 Ga0207660_100005453 253
754 3300025917 Ga0207660_10264456 Ga0207660_102644562 253
755 3300025918 Ga0207662_10000210 Ga0207662_100002109 253
756 3300025918 Ga0207662_10041674 Ga0207662_100416742 253
757 3300025919 Ga0207657_10003507 Ga0207657_100035073 253
758 3300025919 Ga0207657_10043764 Ga0207657_100437643 253
759 3300025920 Ga0207649_10001961 Ga0207649_100019616 253
760 3300025921 Ga0207652_10016202 Ga0207652_100162024 253
761 3300025921 Ga0207652_10078106 Ga0207652_100781062 253
762 3300025923 Ga0207681_10000097 Ga0207681_1000009753 253
763 3300025923 Ga0207681_10036777 Ga0207681_100367772 253
764 3300025925 Ga0207650_10000946 Ga0207650_100009467 253
765 3300025926 Ga0207659_10000092 Ga0207659_1000009225 253
766 3300025927 Ga0207687_10000129 Ga0207687_1000012917 253
767 3300025931 Ga0207644_10056623 Ga0207644_100566232 253
768 3300025932 Ga0207690_10003841 Ga0207690_100038413 253
769 3300025933 Ga0207706_10001332 Ga0207706_1000133224 253
770 3300025933 Ga0207706_10088469 Ga0207706_100884692 253
771 3300025934 Ga0207686_10000635 Ga0207686_100006357 253
772 3300025935 Ga0207709_10000362 Ga0207709_100003629 253
773 3300025935 Ga0207709_10060714 Ga0207709_100607142 253
774 3300025936 Ga0207670_10000225 Ga0207670_1000022523 253
775 3300025936 Ga0207670_10340399 Ga0207670_103403992 253
776 3300025937 Ga0207669_10000043 Ga0207669_1000004312 253
777 3300025938 Ga0207704_10000602 Ga0207704_1000060213 253
778 3300025938 Ga0207704_10130649 Ga0207704_101306492 253
779 3300025940 Ga0207691_10000283 Ga0207691_1000028325 253
780 3300025940 Ga0207691_10135723 Ga0207691_101357232 253
781 3300025941 Ga0207711_10001023 Ga0207711_1000102312 253
782 3300025941 Ga0207711_10107998 Ga0207711_101079982 253
783 3300025942 Ga0207689_10001131 Ga0207689_1000113110 253
784 3300025944 Ga0207661_10000245 Ga0207661_1000024529 253
785 3300025945 Ga0207679_10000030 Ga0207679_10000030132 253
786 3300025945 Ga0207679_10032562 Ga0207679_100325622 253
787 3300025945 Ga0207679_10259408 Ga0207679_102594082 253
788 3300025945 Ga0207679_10405854 Ga0207679_104058542 253
789 3300025949 Ga0207667_10079278 Ga0207667_100792782 253
790 3300025960 Ga0207651_10000088 Ga0207651_1000008816 253
791 3300025960 Ga0207651_10502856 Ga0207651_105028563 253
792 3300025961 Ga0207712_10000924 Ga0207712_1000092412 253
793 3300025961 Ga0207712_10261854 Ga0207712_102618542 253
794 3300025972 Ga0207668_10000114 Ga0207668_1000011425 253
795 3300025972 Ga0207668_10072600 Ga0207668_100726002 253
796 3300025981 Ga0207640_10000616 Ga0207640_100006165 253
797 3300025986 Ga0207658_10004201 Ga0207658_100042018 253
798 3300026023 Ga0207677_10007396 Ga0207677_100073963 253
799 3300026035 Ga0207703_10006170 Ga0207703_100061702 253
800 3300026035 Ga0207703_10030929 Ga0207703_100309292 253
801 3300026041 Ga0207639_10001529 Ga0207639_100015292 253
802 3300026041 Ga0207639_10091275 Ga0207639_100912752 253
803 3300026067 Ga0207678_10000125 Ga0207678_1000012532 253
804 3300026067 Ga0207678_10132054 Ga0207678_101320542 253
805 3300026075 Ga0207708_10005075 Ga0207708_100050758 253
806 3300026075 Ga0207708_10005233 Ga0207708_100052338 253
807 3300026078 Ga0207702_10007265 Ga0207702_100072653 253
808 3300026078 Ga0207702_10407689 Ga0207702_104076892 253
809 3300026088 Ga0207641_10001951 Ga0207641_100019513 253
810 3300026089 Ga0207648_10002235 Ga0207648_100022355 253
811 3300026089 Ga0207648_10009401 Ga0207648_100094015 253
812 3300026095 Ga0207676_10000074 Ga0207676_1000007434 253
813 3300026095 Ga0207676_10202999 Ga0207676_102029992 253
814 3300026116 Ga0207674_10000750 Ga0207674_1000075032 253
815 3300026116 Ga0207674_10203427 Ga0207674_102034272 253
816 3300026118 Ga0207675_100001312 Ga0207675_10000131224 253
817 3300026118 Ga0207675_100102565 Ga0207675_1001025652 253
818 3300026121 Ga0207683_10000014 Ga0207683_1000001426 253
819 3300026142 Ga0207698_10022216 Ga0207698_100222163 253
820 3300027252 Ga0209973_1007128 Ga0209973_10071282 253
821 3300027471 Ga0209995_1022189 Ga0209995_10221891 253
822 3300027617 Ga0210002_1004043 Ga0210002_10040432 253
823 3300027682 Ga0209971_1013394 Ga0209971_10133942 253
824 3300027682 Ga0209971_1030169 Ga0209971_10301692 253
825 3300027717 Ga0209998_10000650 Ga0209998_100006508 253
826 3300027866 Ga0209813_10039518 Ga0209813_100395182 253
827 3300027876 Ga0209974_10006501 Ga0209974_100065012 253
828 3300027876 Ga0209974_10091760 Ga0209974_100917601 253
829 3300027907 Ga0207428_10000467 Ga0207428_1000046714 253
830 3300027907 Ga0207428_10004971 Ga0207428_100049717 253
831 3300028380 Ga0268265_10002706 Ga0268265_100027064 253
832 3300028380 Ga0268265_10128778 Ga0268265_101287782 253
833 3300028381 Ga0268264_10000469 Ga0268264_1000046933 253
834 3300028381 Ga0268264_10090183 Ga0268264_100901832 253
835 3300031249 Ga0265339_10034520 Ga0265339_100345202 253
836 3300034816 Ga0373930_0000284 Ga0373930_0000284_4878_5639 253
837 3300034817 Ga0373948_0000299 Ga0373948_0000299_3437_4198 253
838 3300034818 Ga0373950_0000315 Ga0373950_0000315_1980_2741 253
839 3300034819 Ga0373958_0000765 Ga0373958_0000765_301_1062 253
840 3300034957 Ga0373938_0000035 Ga0373938_0000035_6556_7317 253
841 3300034957 Ga0373938_0000130 Ga0373938_0000130_2470_3231 253
842 3300035084 Ga0373928_0000643 Ga0373928_0000643_4152_4913 253
843 3300035085 Ga0373929_0000258 Ga0373929_0000258_5097_5858 253
844 3300035088 Ga0373940_0004302 Ga0373940_0004302_2134_2895 253
845 3300035088 Ga0373940_0031357 Ga0373940_0031357_385_1146 253
846 3300035090 Ga0373949_0005632 Ga0373949_0005632_1835_2596 253
847 3300035090 Ga0373949_0006759 Ga0373949_0006759_1403_2164 253
848 3300035091 Ga0373951_0001386 Ga0373951_0001386_5438_6199 253
849 3300035092 Ga0373952_0000044 Ga0373952_0000044_4270_5031 253
850 3300035092 Ga0373952_0000416 Ga0373952_0000416_1100_1861 253
851 3300035112 Ga0373932_0002422 Ga0373932_0002422_561_1322 253
852 3300035114 Ga0373939_0001850 Ga0373939_0001850_34_795 253
853 3300035114 Ga0373939_0002508 Ga0373939_0002508_1772_2533 253
854 3300035115 Ga0373941_0000164 Ga0373941_0000164_8582_9343 253
855 3300035115 Ga0373941_0001372 Ga0373941_0001372_706_1467 253
856 3300035121 Ga0373960_0001732 Ga0373960_0001732_3956_4717 253
857 3300035121 Ga0373960_0046558 Ga0373960_0046558_200_961 253
858 3300035207 Ga0373942_0000113 Ga0373942_0000113_11221_11982 253
859 3300035207 Ga0373942_0003590 Ga0373942_0003590_1313_2074 253
860 3300035241 Ga0373961_0001463 Ga0373961_0001463_3813_4574 253
861 3300035241 Ga0373961_0002817 Ga0373961_0002817_1826_2587 253
862 3300035242 Ga0373962_0002732 Ga0373962_0002732_3148_3909 253
863 3300035242 Ga0373962_0005452 Ga0373962_0005452_869_1630 253
864 3300035691 Ga0373931_0000779 Ga0373931_0000779_7411_8172 253
865 3300042016 Ga0439463_009214 Ga0439463_009214_1647_2408 253
866 3300042876 Ga0451577_0117894 Ga0451577_0117894_1207_1968 253
867 3300044712 Ga0453684_0357785 Ga0453684_0357785_61_822 253
868 3300045051 Ga0451576_0031881 Ga0451576_0031881_2472_3233 253
869 3300047445 Ga0495677_0058412 Ga0495677_0058412_361_1122 253
870 3300048903 Ga0496100_0005311 Ga0496100_0005311_1530_2291 253
871 3300048904 Ga0496101_0000136 Ga0496101_0000136_49018_49779 253
872 3300048904 Ga0496101_0294970 Ga0496101_0294970_254_1015 253
873 3300048905 Ga0496102_0001166 Ga0496102_0001166_1012_1773 253
874 3300048905 Ga0496102_0134324 Ga0496102_0134324_323_1084 253
875 3300048906 Ga0496103_0000673 Ga0496103_0000673_13627_14388 253
876 3300048906 Ga0496103_0151943 Ga0496103_0151943_702_1463 253
877 3300048907 Ga0496104_0084700 Ga0496104_0084700_1845_2606 253
878 3300048908 Ga0496105_0307546 Ga0496105_0307546_405_1166 253
879 3300048909 Ga0496106_0000261 Ga0496106_0000261_34696_35457 253
880 3300048910 Ga0496107_0000146 Ga0496107_0000146_26283_27044 253
881 3300048910 Ga0496107_0037369 Ga0496107_0037369_732_1493 253
882 3300048910 Ga0496107_0050529 Ga0496107_0050529_1151_1912 253
883 3300048911 Ga0496108_0002272 Ga0496108_0002272_13860_14621 253
884 3300048911 Ga0496108_0022025 Ga0496108_0022025_1442_2203 253
885 3300048912 Ga0496109_0006684 Ga0496109_0006684_1734_2495 253
886 3300048912 Ga0496109_0031095 Ga0496109_0031095_1192_1953 253
887 3300048912 Ga0496109_0637340 Ga0496109_0637340_82_843 253
888 3300048913 Ga0496110_0042599 Ga0496110_0042599_1235_1996 253
889 3300048913 Ga0496110_0055079 Ga0496110_0055079_2431_3192 253
890 3300048914 Ga0496111_0007800 Ga0496111_0007800_1557_2318 253
891 3300048914 Ga0496111_0030574 Ga0496111_0030574_2086_2847 253
892 3300048914 Ga0496111_0060911 Ga0496111_0060911_1864_2625 253
893 3300048915 Ga0496112_0063888 Ga0496112_0063888_1415_2176 253
894 3300048915 Ga0496112_0087107 Ga0496112_0087107_1219_1980 253
895 3300048916 Ga0496113_0012040 Ga0496113_0012040_1567_2328 253
896 3300048916 Ga0496113_0061142 Ga0496113_0061142_1156_1917 253
897 3300048917 Ga0496114_0010754 Ga0496114_0010754_2942_3703 253
898 3300050495 nmdc:mga04h51_47241_c1 nmdc:mga04h51_47241_c1_573_1334 253
899 3300050507 nmdc:mga05p37_246885_c1 nmdc:mga05p37_246885_c1_91_852 253
900 3300050511 nmdc:mga08y16_249040_c1 nmdc:mga08y16_249040_c1_450_1211 253
901 3300050511 nmdc:mga08y16_6205_c1 nmdc:mga08y16_6205_c1_3644_4405 253
902 3300050512 nmdc:mga0n895_208_c1 nmdc:mga0n895_208_c1_25810_26571 253
903 3300050512 nmdc:mga0n895_212024_c1 nmdc:mga0n895_212024_c1_452_1213 253
904 3300050512 nmdc:mga0n895_60007_c1 nmdc:mga0n895_60007_c1_2252_3013 253
905 3300050513 nmdc:mga0rr50_19615_c1 nmdc:mga0rr50_19615_c1_858_1619 253
906 3300050515 nmdc:mga0a205_14931_c1 nmdc:mga0a205_14931_c1_2406_3167 253
907 3300050515 nmdc:mga0a205_176939_c1 nmdc:mga0a205_176939_c1_179_940 253
908 3300050515 nmdc:mga0a205_380_c1 nmdc:mga0a205_380_c1_21405_22166 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04367

DUF502

Protein of unknown function (DUF502)

96

202

0.97

Feature Viewer

pLDDT pTM Quality
70.46 0.35 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map