F485393
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 908 | 413 | 907 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300035086|Ga0373934_0065203|Ga0373934_0065203_15_815 |
| Length | 266 |
| Sequence | MSDFDRSAGIGPAAPVVGADEGQPRPALPPVPHHGMMSRIRNYFLTGLVLVGPLYITANLTWWFINWVDDLVRPLIPATYRPETYLPMHIPGTGLIIAFLALTVLGFLTANLVGRTLVEFGENILNRMPVVRPIYKSLKQIFETLFSNSGSSFRRVGLVEFPAPGMWSLVFLSQPPGANIAARLPEAEHISAFMPCTPNPTTGFFFYVPRRDVIDLDITVETAMTLLMSAGMAQSGEDDAHKKLAALADIARARASQKPRSVEPVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 8 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 17 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 20 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 21 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 26 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 27 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 100 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 106 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 112 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 113 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 117 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 118 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 119 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 124 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 125 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 141 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 142 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 154 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 159 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 237 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 241 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 246 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 247 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 249 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 251 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 252 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 254 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 255 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 256 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 257 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 258 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 259 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 260 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 265 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 268 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 272 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 274 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 279 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 280 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 281 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 282 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 283 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 284 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 285 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 288 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 289 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 290 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 291 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 292 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 293 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 294 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 295 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 296 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 297 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 298 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 357 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 358 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 359 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 360 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 361 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 362 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 365 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 366 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 367 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 368 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 369 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 370 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 383 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 384 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 385 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 386 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 403 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 405 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 406 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 407 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 408 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 409 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 410 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 412 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.78 |
| Metatranscriptomes | 0.11 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.62 |
| Nodule | 0 |
| Rhizoplane | 8.26 |
| Rhizosphere | 85.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214939630 | 2209111006 | Bacteria | 6526 |
| 2 | ARSoilYngRDRAFT_c00506 | 3300000042 | Bacteria | 4548 |
| 3 | ARcpr5yngRDRAFT_c000242 | 3300000043 | Bacteria | 7940 |
| 4 | ARSoilOldRDRAFT_c000121 | 3300000044 | Bacteria | 13868 |
| 5 | ARCol0yngRDRAFT_1000359 | 3300000652 | Bacteria | 6391 |
| 6 | JGI24741J21665_1007046 | 3300001915 | Bacteria | 2207 |
| 7 | JGI24752J21851_1004877 | 3300001976 | Bacteria | 1753 |
| 8 | JGI24746J21847_1000824 | 3300001977 | Bacteria | 4793 |
| 9 | JGI24747J21853_1002656 | 3300001978 | Bacteria | 1479 |
| 10 | JGI24740J21852_10051412 | 3300001979 | Bacteria | 1179 |
| 11 | JGI24739J22299_10003155 | 3300001989 | Bacteria | 6289 |
| 12 | JGI24737J22298_10001457 | 3300001990 | Bacteria | 8439 |
| 13 | JGI24737J22298_10002963 | 3300001990 | Bacteria | 6013 |
| 14 | JGI24743J22301_10012296 | 3300001991 | Bacteria | 1555 |
| 15 | JGI24750J21931_1000375 | 3300002070 | Bacteria | 7573 |
| 16 | JGI24745J21846_1000315 | 3300002073 | Bacteria | 4148 |
| 17 | JGI24748J21848_1000231 | 3300002074 | Bacteria | 6773 |
| 18 | JGI24738J21930_10000933 | 3300002075 | Bacteria | 8401 |
| 19 | JGI24749J21850_1000549 | 3300002076 | Bacteria | 5522 |
| 20 | JGI24035J26624_1001366 | 3300002126 | Bacteria | 2303 |
| 21 | JGI24033J26618_1001139 | 3300002155 | Bacteria | 2589 |
| 22 | JGI24034J26672_10000576 | 3300002239 | Bacteria | 4686 |
| 23 | JGI24742J22300_10000159 | 3300002244 | Bacteria | 9975 |
| 24 | JGI24751J29686_10003190 | 3300002459 | Bacteria | 3305 |
| 25 | JGI25153J46596_10009748 | 3300003215 | Bacteria | 4418 |
| 26 | rootH1_10324480 | 3300003323 | Bacteria | 1049 |
| 27 | Ga0065716_1003273 | 3300005277 | Bacteria | 1283 |
| 28 | Ga0065712_10004839 | 3300005290 | Bacteria | 6780 |
| 29 | Ga0065712_10076519 | 3300005290 | Bacteria | 3643 |
| 30 | Ga0065712_10089276 | 3300005290 | Bacteria | 2478 |
| 31 | Ga0065715_10000997 | 3300005293 | Bacteria | 17501 |
| 32 | Ga0065715_10089127 | 3300005293 | Bacteria | 13881 |
| 33 | Ga0065715_10183953 | 3300005293 | Bacteria | 1457 |
| 34 | Ga0070658_10037002 | 3300005327 | Bacteria | 3932 |
| 35 | Ga0070658_10039186 | 3300005327 | Bacteria | 3822 |
| 36 | Ga0070658_10056638 | 3300005327 | Bacteria | 3187 |
| 37 | Ga0070676_10000012 | 3300005328 | Bacteria | 58061 |
| 38 | Ga0070676_10051492 | 3300005328 | Bacteria | 2418 |
| 39 | Ga0070683_100000139 | 3300005329 | Bacteria | 46987 |
| 40 | Ga0070683_100047159 | 3300005329 | Bacteria | 3981 |
| 41 | Ga0070683_100360828 | 3300005329 | Bacteria | 1384 |
| 42 | Ga0070690_100000554 | 3300005330 | Bacteria | 18687 |
| 43 | Ga0070690_100013915 | 3300005330 | Bacteria | 4769 |
| 44 | Ga0070690_100079168 | 3300005330 | Bacteria | 2148 |
| 45 | Ga0070670_100005729 | 3300005331 | Bacteria | 10492 |
| 46 | Ga0070670_100012083 | 3300005331 | Bacteria | 7385 |
| 47 | Ga0070670_100166512 | 3300005331 | Bacteria | 1911 |
| 48 | Ga0070677_10001496 | 3300005333 | Bacteria | 7389 |
| 49 | Ga0070677_10086698 | 3300005333 | Bacteria | 1353 |
| 50 | Ga0068869_100000347 | 3300005334 | Bacteria | 24812 |
| 51 | Ga0068869_100101106 | 3300005334 | Bacteria | 2181 |
| 52 | Ga0068869_100247517 | 3300005334 | Bacteria | 1422 |
| 53 | Ga0070666_10003184 | 3300005335 | Bacteria | 9972 |
| 54 | Ga0070666_10093332 | 3300005335 | Bacteria | 2069 |
| 55 | Ga0070666_10205984 | 3300005335 | Bacteria | 1384 |
| 56 | Ga0070680_100000179 | 3300005336 | Bacteria | 40975 |
| 57 | Ga0070680_100045857 | 3300005336 | Bacteria | 3554 |
| 58 | Ga0070680_100086093 | 3300005336 | Bacteria | 2597 |
| 59 | Ga0070680_100200471 | 3300005336 | Bacteria | 1683 |
| 60 | Ga0070680_100345922 | 3300005336 | Bacteria | 1264 |
| 61 | Ga0070682_100000565 | 3300005337 | Bacteria | 22802 |
| 62 | Ga0070682_100057115 | 3300005337 | Bacteria | 2458 |
| 63 | Ga0070682_100106109 | 3300005337 | Bacteria | 1864 |
| 64 | Ga0068868_100001066 | 3300005338 | Bacteria | 18793 |
| 65 | Ga0068868_100115640 | 3300005338 | Bacteria | 2184 |
| 66 | Ga0070660_100000267 | 3300005339 | Bacteria | 34641 |
| 67 | Ga0070660_100082441 | 3300005339 | Bacteria | 2525 |
| 68 | Ga0070660_100092461 | 3300005339 | Bacteria | 2388 |
| 69 | Ga0070689_100000190 | 3300005340 | Bacteria | 37316 |
| 70 | Ga0070689_100079239 | 3300005340 | Bacteria | 2576 |
| 71 | Ga0070689_100112675 | 3300005340 | Bacteria | 2165 |
| 72 | Ga0070689_100140573 | 3300005340 | Bacteria | 1942 |
| 73 | Ga0070689_100383689 | 3300005340 | Bacteria | 1185 |
| 74 | Ga0070691_10001105 | 3300005341 | Bacteria | 11214 |
| 75 | Ga0070691_10066970 | 3300005341 | Bacteria | 1736 |
| 76 | Ga0070687_100000182 | 3300005343 | Bacteria | 21913 |
| 77 | Ga0070687_100050516 | 3300005343 | Bacteria | 2148 |
| 78 | Ga0070687_100139978 | 3300005343 | Bacteria | 1408 |
| 79 | Ga0070687_100376175 | 3300005343 | Bacteria | 924 |
| 80 | Ga0070661_100001231 | 3300005344 | Bacteria | 18020 |
| 81 | Ga0070661_100081585 | 3300005344 | Bacteria | 2388 |
| 82 | Ga0070661_100551002 | 3300005344 | Bacteria | 928 |
| 83 | Ga0070692_10001438 | 3300005345 | Bacteria | 8642 |
| 84 | Ga0070692_10017265 | 3300005345 | Bacteria | 3446 |
| 85 | Ga0070668_100000597 | 3300005347 | Bacteria | 24181 |
| 86 | Ga0070668_100227205 | 3300005347 | Bacteria | 1542 |
| 87 | Ga0070668_100367217 | 3300005347 | Bacteria | 1222 |
| 88 | Ga0070669_100000409 | 3300005353 | Bacteria | 32911 |
| 89 | Ga0070669_100057248 | 3300005353 | Bacteria | 2860 |
| 90 | Ga0070669_100099081 | 3300005353 | Bacteria | 2196 |
| 91 | Ga0070669_100102528 | 3300005353 | Bacteria | 2161 |
| 92 | Ga0070669_100264788 | 3300005353 | Bacteria | 1373 |
| 93 | Ga0070675_100000593 | 3300005354 | Bacteria | 24815 |
| 94 | Ga0070675_100049525 | 3300005354 | Bacteria | 3448 |
| 95 | Ga0070675_100422799 | 3300005354 | Bacteria | 1192 |
| 96 | Ga0070671_100005662 | 3300005355 | Bacteria | 9941 |
| 97 | Ga0070671_100009041 | 3300005355 | Bacteria | 7995 |
| 98 | Ga0070671_100012055 | 3300005355 | Bacteria | 6956 |
| 99 | Ga0070671_100553999 | 3300005355 | Bacteria | 992 |
| 100 | Ga0070674_100000084 | 3300005356 | Bacteria | 43585 |
| 101 | Ga0070674_100033759 | 3300005356 | Bacteria | 3410 |
| 102 | Ga0070674_100038354 | 3300005356 | Bacteria | 3228 |
| 103 | Ga0070673_100000041 | 3300005364 | Bacteria | 54096 |
| 104 | Ga0070673_100006266 | 3300005364 | Bacteria | 7715 |
| 105 | Ga0070673_100206286 | 3300005364 | Bacteria | 1695 |
| 106 | Ga0070673_100676553 | 3300005364 | Bacteria | 946 |
| 107 | Ga0070688_100000320 | 3300005365 | Bacteria | 24553 |
| 108 | Ga0070688_100004329 | 3300005365 | Bacteria | 7383 |
| 109 | Ga0070688_100039871 | 3300005365 | Bacteria | 2876 |
| 110 | Ga0070688_100364842 | 3300005365 | Bacteria | 1061 |
| 111 | Ga0070659_100003151 | 3300005366 | Bacteria | 11749 |
| 112 | Ga0070659_100008866 | 3300005366 | Bacteria | 7370 |
| 113 | Ga0070659_100092725 | 3300005366 | Bacteria | 2422 |
| 114 | Ga0070667_100000365 | 3300005367 | Bacteria | 49335 |
| 115 | Ga0070667_100012887 | 3300005367 | Bacteria | 6908 |
| 116 | Ga0070667_100027988 | 3300005367 | Bacteria | 4690 |
| 117 | Ga0070703_10003890 | 3300005406 | Bacteria | 4228 |
| 118 | Ga0070709_10111811 | 3300005434 | Bacteria | 1837 |
| 119 | Ga0070714_100029189 | 3300005435 | Bacteria | 4584 |
| 120 | Ga0070714_100078722 | 3300005435 | Bacteria | 2865 |
| 121 | Ga0070713_100001020 | 3300005436 | Bacteria | 17930 |
| 122 | Ga0070713_100087894 | 3300005436 | Bacteria | 2667 |
| 123 | Ga0070710_10017282 | 3300005437 | Bacteria | 3688 |
| 124 | Ga0070701_10000110 | 3300005438 | Bacteria | 23545 |
| 125 | Ga0070701_10070064 | 3300005438 | Bacteria | 1873 |
| 126 | Ga0070701_10075723 | 3300005438 | Bacteria | 1810 |
| 127 | Ga0070705_100000938 | 3300005440 | Bacteria | 16335 |
| 128 | Ga0070700_100001112 | 3300005441 | Bacteria | 13294 |
| 129 | Ga0070700_100001991 | 3300005441 | Bacteria | 10374 |
| 130 | Ga0070694_100000065 | 3300005444 | Bacteria | 49515 |
| 131 | Ga0070694_100174772 | 3300005444 | Bacteria | 1584 |
| 132 | Ga0070708_100128395 | 3300005445 | Bacteria | 2345 |
| 133 | Ga0070663_100000654 | 3300005455 | Bacteria | 18598 |
| 134 | Ga0070663_100266364 | 3300005455 | Bacteria | 1361 |
| 135 | Ga0070678_100000091 | 3300005456 | Bacteria | 34559 |
| 136 | Ga0070678_100004855 | 3300005456 | Bacteria | 7679 |
| 137 | Ga0070662_100000629 | 3300005457 | Bacteria | 21333 |
| 138 | Ga0070662_100058296 | 3300005457 | Bacteria | 2810 |
| 139 | Ga0070681_10014301 | 3300005458 | Bacteria | 7895 |
| 140 | Ga0070681_10044378 | 3300005458 | Bacteria | 4449 |
| 141 | Ga0070681_10061531 | 3300005458 | Bacteria | 3728 |
| 142 | Ga0070681_10125469 | 3300005458 | Bacteria | 2500 |
| 143 | Ga0070681_10154716 | 3300005458 | Bacteria | 2218 |
| 144 | Ga0068867_100002763 | 3300005459 | Bacteria | 12359 |
| 145 | Ga0068867_100105534 | 3300005459 | Bacteria | 2157 |
| 146 | Ga0070685_10002711 | 3300005466 | Bacteria | 9069 |
| 147 | Ga0070685_10028236 | 3300005466 | Bacteria | 3108 |
| 148 | Ga0070685_10164459 | 3300005466 | Bacteria | 1417 |
| 149 | Ga0070679_100003726 | 3300005530 | Bacteria | 13966 |
| 150 | Ga0070679_100090574 | 3300005530 | Bacteria | 3047 |
| 151 | Ga0070679_100101766 | 3300005530 | Bacteria | 2859 |
| 152 | Ga0070679_100123233 | 3300005530 | Bacteria | 2575 |
| 153 | Ga0070679_100229224 | 3300005530 | Bacteria | 1817 |
| 154 | Ga0070679_100511397 | 3300005530 | Bacteria | 1145 |
| 155 | Ga0070684_100000219 | 3300005535 | Bacteria | 39995 |
| 156 | Ga0070697_100121293 | 3300005536 | Bacteria | 2187 |
| 157 | Ga0070697_100263154 | 3300005536 | Bacteria | 1477 |
| 158 | Ga0068853_100040876 | 3300005539 | Bacteria | 3958 |
| 159 | Ga0068853_100152638 | 3300005539 | Bacteria | 2080 |
| 160 | Ga0068853_100334427 | 3300005539 | Bacteria | 1406 |
| 161 | Ga0070672_100000019 | 3300005543 | Bacteria | 69855 |
| 162 | Ga0070672_100117646 | 3300005543 | Bacteria | 2173 |
| 163 | Ga0070672_100713150 | 3300005543 | Bacteria | 879 |
| 164 | Ga0070686_100000318 | 3300005544 | Bacteria | 31671 |
| 165 | Ga0070686_100007233 | 3300005544 | Bacteria | 6183 |
| 166 | Ga0070686_100021082 | 3300005544 | Bacteria | 3867 |
| 167 | Ga0070695_100001669 | 3300005545 | Bacteria | 12496 |
| 168 | Ga0070695_100005883 | 3300005545 | Bacteria | 7236 |
| 169 | Ga0070696_100001307 | 3300005546 | Bacteria | 16256 |
| 170 | Ga0070696_100039957 | 3300005546 | Bacteria | 3238 |
| 171 | Ga0070696_100224506 | 3300005546 | Bacteria | 1411 |
| 172 | Ga0070696_100239557 | 3300005546 | Bacteria | 1368 |
| 173 | Ga0070693_100000036 | 3300005547 | Bacteria | 50540 |
| 174 | Ga0070693_100035126 | 3300005547 | Bacteria | 2778 |
| 175 | Ga0070665_100064597 | 3300005548 | Bacteria | 3671 |
| 176 | Ga0070665_100158609 | 3300005548 | Bacteria | 2264 |
| 177 | Ga0070704_100002608 | 3300005549 | Bacteria | 10176 |
| 178 | Ga0070704_100051738 | 3300005549 | Bacteria | 2894 |
| 179 | Ga0068855_100001440 | 3300005563 | Bacteria | 29636 |
| 180 | Ga0068855_100005101 | 3300005563 | Bacteria | 16008 |
| 181 | Ga0070664_100000089 | 3300005564 | Bacteria | 58202 |
| 182 | Ga0070664_100045756 | 3300005564 | Bacteria | 3696 |
| 183 | Ga0070664_100211271 | 3300005564 | Bacteria | 1734 |
| 184 | Ga0070664_100393391 | 3300005564 | Bacteria | 1267 |
| 185 | Ga0068857_100027045 | 3300005577 | Bacteria | 5060 |
| 186 | Ga0068857_100233209 | 3300005577 | Bacteria | 1684 |
| 187 | Ga0068854_100000179 | 3300005578 | Bacteria | 43176 |
| 188 | Ga0068854_100051701 | 3300005578 | Bacteria | 2944 |
| 189 | Ga0068856_100000873 | 3300005614 | Bacteria | 32305 |
| 190 | Ga0068856_100228535 | 3300005614 | Bacteria | 1876 |
| 191 | Ga0070702_100000071 | 3300005615 | Bacteria | 28864 |
| 192 | Ga0070702_100048639 | 3300005615 | Bacteria | 2414 |
| 193 | Ga0068852_100004760 | 3300005616 | Bacteria | 9640 |
| 194 | Ga0068852_100019915 | 3300005616 | Bacteria | 5324 |
| 195 | Ga0068852_100312574 | 3300005616 | Bacteria | 1524 |
| 196 | Ga0068859_100006632 | 3300005617 | Bacteria | 11756 |
| 197 | Ga0068859_100042506 | 3300005617 | Bacteria | 4565 |
| 198 | Ga0068859_100348511 | 3300005617 | Bacteria | 1576 |
| 199 | Ga0068859_100429121 | 3300005617 | Bacteria | 1418 |
| 200 | Ga0068864_100000429 | 3300005618 | Bacteria | 36391 |
| 201 | Ga0068864_100050093 | 3300005618 | Bacteria | 3594 |
| 202 | Ga0068864_100116146 | 3300005618 | Bacteria | 2387 |
| 203 | Ga0068864_100520985 | 3300005618 | Bacteria | 1146 |
| 204 | Ga0068866_10000468 | 3300005718 | Bacteria | 18473 |
| 205 | Ga0068866_10155414 | 3300005718 | Bacteria | 1329 |
| 206 | Ga0068861_100000169 | 3300005719 | Bacteria | 34559 |
| 207 | Ga0068861_100099866 | 3300005719 | Bacteria | 2306 |
| 208 | Ga0068870_10000339 | 3300005840 | Bacteria | 17497 |
| 209 | Ga0068863_100000381 | 3300005841 | Bacteria | 45003 |
| 210 | Ga0068858_100009053 | 3300005842 | Bacteria | 9519 |
| 211 | Ga0068858_100026945 | 3300005842 | Bacteria | 5339 |
| 212 | Ga0068858_100297679 | 3300005842 | Bacteria | 1539 |
| 213 | Ga0068858_100433088 | 3300005842 | Bacteria | 1266 |
| 214 | Ga0068860_100000852 | 3300005843 | Bacteria | 34030 |
| 215 | Ga0068862_100003353 | 3300005844 | Bacteria | 13822 |
| 216 | Ga0068862_100473164 | 3300005844 | Bacteria | 1185 |
| 217 | Ga0081540_1000114 | 3300005983 | Bacteria | 85489 |
| 218 | Ga0081539_10038361 | 3300005985 | Bacteria | 2840 |
| 219 | Ga0070717_10006020 | 3300006028 | Bacteria | 8888 |
| 220 | Ga0070717_10106690 | 3300006028 | Bacteria | 2385 |
| 221 | Ga0075365_10075961 | 3300006038 | Bacteria | 2268 |
| 222 | Ga0075365_10120226 | 3300006038 | Bacteria | 1811 |
| 223 | Ga0075368_10028139 | 3300006042 | Bacteria | 2171 |
| 224 | Ga0075368_10032512 | 3300006042 | Bacteria | 2027 |
| 225 | Ga0075364_10070240 | 3300006051 | Bacteria | 2305 |
| 226 | Ga0075432_10022645 | 3300006058 | Bacteria | 2149 |
| 227 | Ga0070715_10004717 | 3300006163 | Bacteria | 4505 |
| 228 | Ga0070716_100017238 | 3300006173 | Bacteria | 3740 |
| 229 | Ga0070716_100555592 | 3300006173 | Bacteria | 857 |
| 230 | Ga0070712_100177167 | 3300006175 | Bacteria | 1658 |
| 231 | Ga0075362_10014468 | 3300006177 | Bacteria | 3186 |
| 232 | Ga0075367_10147873 | 3300006178 | Bacteria | 1457 |
| 233 | Ga0075367_10263366 | 3300006178 | Bacteria | 1082 |
| 234 | Ga0075369_10024606 | 3300006186 | Bacteria | 2496 |
| 235 | Ga0075369_10066929 | 3300006186 | Bacteria | 1576 |
| 236 | Ga0075369_10117726 | 3300006186 | Bacteria | 1201 |
| 237 | Ga0075366_10003072 | 3300006195 | Bacteria | 8715 |
| 238 | Ga0075366_10114831 | 3300006195 | Bacteria | 1621 |
| 239 | Ga0097621_100000112 | 3300006237 | Bacteria | 46077 |
| 240 | Ga0097621_100002278 | 3300006237 | Bacteria | 13143 |
| 241 | Ga0075370_10042888 | 3300006353 | Bacteria | 2556 |
| 242 | Ga0075370_10182511 | 3300006353 | Bacteria | 1235 |
| 243 | Ga0068871_100000068 | 3300006358 | Bacteria | 57531 |
| 244 | Ga0068871_100025855 | 3300006358 | Bacteria | 4573 |
| 245 | Ga0068871_100105497 | 3300006358 | Bacteria | 2365 |
| 246 | Ga0068871_100812145 | 3300006358 | Bacteria | 863 |
| 247 | Ga0075430_100297637 | 3300006846 | Bacteria | 1334 |
| 248 | Ga0075431_100215392 | 3300006847 | Bacteria | 1960 |
| 249 | Ga0075433_10001324 | 3300006852 | Bacteria | 18121 |
| 250 | Ga0075433_10013574 | 3300006852 | Bacteria | 6630 |
| 251 | Ga0075433_10292308 | 3300006852 | Bacteria | 1443 |
| 252 | Ga0075434_100000614 | 3300006871 | Bacteria | 27585 |
| 253 | Ga0075434_100021261 | 3300006871 | Bacteria | 6308 |
| 254 | Ga0075434_100038150 | 3300006871 | Bacteria | 4759 |
| 255 | Ga0075434_100178933 | 3300006871 | Bacteria | 2140 |
| 256 | Ga0068865_100000294 | 3300006881 | Bacteria | 27523 |
| 257 | Ga0068865_100022649 | 3300006881 | Bacteria | 4101 |
| 258 | Ga0075436_100068342 | 3300006914 | Bacteria | 2455 |
| 259 | Ga0097620_100006632 | 3300006931 | Bacteria | 11756 |
| 260 | Ga0097620_100042507 | 3300006931 | Bacteria | 4565 |
| 261 | Ga0097620_100348512 | 3300006931 | Bacteria | 1576 |
| 262 | Ga0097620_100429088 | 3300006931 | Bacteria | 1418 |
| 263 | Ga0075435_100093500 | 3300007076 | Bacteria | 2484 |
| 264 | Ga0075435_100229571 | 3300007076 | Bacteria | 1577 |
| 265 | Ga0075435_100729284 | 3300007076 | Bacteria | 862 |
| 266 | Ga0099795_10051511 | 3300007788 | Bacteria | 1501 |
| 267 | Ga0105251_10079195 | 3300009011 | Bacteria | 1521 |
| 268 | Ga0105240_10055066 | 3300009093 | Bacteria | 4981 |
| 269 | Ga0105240_10056461 | 3300009093 | Bacteria | 4913 |
| 270 | Ga0111539_10000082 | 3300009094 | Bacteria | 96811 |
| 271 | Ga0111539_10000804 | 3300009094 | Bacteria | 40829 |
| 272 | Ga0111539_10063506 | 3300009094 | Bacteria | 4370 |
| 273 | Ga0111539_10159604 | 3300009094 | Bacteria | 2638 |
| 274 | Ga0111539_10168453 | 3300009094 | Bacteria | 2560 |
| 275 | Ga0111539_10447581 | 3300009094 | Bacteria | 1504 |
| 276 | Ga0105245_10000468 | 3300009098 | Bacteria | 36934 |
| 277 | Ga0105245_10003343 | 3300009098 | Bacteria | 14387 |
| 278 | Ga0105245_10369439 | 3300009098 | Bacteria | 1426 |
| 279 | Ga0105245_10504908 | 3300009098 | Bacteria | 1226 |
| 280 | Ga0105247_10002855 | 3300009101 | Bacteria | 11522 |
| 281 | Ga0105247_10063577 | 3300009101 | Bacteria | 2291 |
| 282 | Ga0105247_10113112 | 3300009101 | Bacteria | 1749 |
| 283 | Ga0114129_10012592 | 3300009147 | Bacteria | 12044 |
| 284 | Ga0114129_10021642 | 3300009147 | Bacteria | 9125 |
| 285 | Ga0114129_10027910 | 3300009147 | Bacteria | 7993 |
| 286 | Ga0114129_10653320 | 3300009147 | Bacteria | 1357 |
| 287 | Ga0105243_10003322 | 3300009148 | Bacteria | 13056 |
| 288 | Ga0105243_10050863 | 3300009148 | Bacteria | 3275 |
| 289 | Ga0105243_10097282 | 3300009148 | Bacteria | 2436 |
| 290 | Ga0105241_10000941 | 3300009174 | Bacteria | 21993 |
| 291 | Ga0105241_10019317 | 3300009174 | Bacteria | 5024 |
| 292 | Ga0105241_10340805 | 3300009174 | Bacteria | 1299 |
| 293 | Ga0105242_10000337 | 3300009176 | Bacteria | 37793 |
| 294 | Ga0105242_10077617 | 3300009176 | Bacteria | 2771 |
| 295 | Ga0105242_10462440 | 3300009176 | Bacteria | 1198 |
| 296 | Ga0105248_10004009 | 3300009177 | Bacteria | 16272 |
| 297 | Ga0105248_10024723 | 3300009177 | Bacteria | 6680 |
| 298 | Ga0105248_10066436 | 3300009177 | Bacteria | 4050 |
| 299 | Ga0105248_10213304 | 3300009177 | Bacteria | 2175 |
| 300 | Ga0105248_10329999 | 3300009177 | Bacteria | 1718 |
| 301 | Ga0105248_10592960 | 3300009177 | Bacteria | 1250 |
| 302 | Ga0105237_10039433 | 3300009545 | Bacteria | 4768 |
| 303 | Ga0105237_10040862 | 3300009545 | Bacteria | 4677 |
| 304 | Ga0105237_10154166 | 3300009545 | Bacteria | 2294 |
| 305 | Ga0105237_10266351 | 3300009545 | Bacteria | 1716 |
| 306 | Ga0105238_10010848 | 3300009551 | Bacteria | 9158 |
| 307 | Ga0105238_10092645 | 3300009551 | Bacteria | 3010 |
| 308 | Ga0105249_10000755 | 3300009553 | Bacteria | 29091 |
| 309 | Ga0105249_10003637 | 3300009553 | Bacteria | 13331 |
| 310 | Ga0105249_10181404 | 3300009553 | Bacteria | 2048 |
| 311 | Ga0105249_10225799 | 3300009553 | Bacteria | 1845 |
| 312 | Ga0105249_10344868 | 3300009553 | Bacteria | 1507 |
| 313 | Ga0105239_10001548 | 3300010375 | Bacteria | 30382 |
| 314 | Ga0105239_10027538 | 3300010375 | Bacteria | 6255 |
| 315 | Ga0105239_10390745 | 3300010375 | Bacteria | 1574 |
| 316 | Ga0105239_10586786 | 3300010375 | Bacteria | 1271 |
| 317 | Ga0105239_10877507 | 3300010375 | Bacteria | 1029 |
| 318 | Ga0105246_10000061 | 3300011119 | Bacteria | 44338 |
| 319 | Ga0157320_1004294 | 3300012481 | Bacteria | 904 |
| 320 | Ga0157343_1003637 | 3300012488 | Bacteria | 915 |
| 321 | Ga0157373_10017197 | 3300013100 | Bacteria | 5265 |
| 322 | Ga0157371_10009867 | 3300013102 | Bacteria | 7483 |
| 323 | Ga0157371_10328319 | 3300013102 | Bacteria | 1111 |
| 324 | Ga0157370_10026836 | 3300013104 | Bacteria | 5681 |
| 325 | Ga0157370_10697532 | 3300013104 | Bacteria | 927 |
| 326 | Ga0157369_10463740 | 3300013105 | Bacteria | 1311 |
| 327 | Ga0157369_10591491 | 3300013105 | Bacteria | 1146 |
| 328 | Ga0157374_10014373 | 3300013296 | Bacteria | 6928 |
| 329 | Ga0157374_10196406 | 3300013296 | Bacteria | 1975 |
| 330 | Ga0157378_10290854 | 3300013297 | Bacteria | 1578 |
| 331 | Ga0163162_10001248 | 3300013306 | Bacteria | 23795 |
| 332 | Ga0163162_10402102 | 3300013306 | Bacteria | 1502 |
| 333 | Ga0163162_10436587 | 3300013306 | Bacteria | 1441 |
| 334 | Ga0163162_10877134 | 3300013306 | Bacteria | 1011 |
| 335 | Ga0157372_10475529 | 3300013307 | Bacteria | 1457 |
| 336 | Ga0157375_10000468 | 3300013308 | Bacteria | 36848 |
| 337 | Ga0157375_10248416 | 3300013308 | Bacteria | 1940 |
| 338 | Ga0163163_10002620 | 3300014325 | Bacteria | 15232 |
| 339 | Ga0163163_10141982 | 3300014325 | Bacteria | 2444 |
| 340 | Ga0157380_10001378 | 3300014326 | Bacteria | 15843 |
| 341 | Ga0157380_10195816 | 3300014326 | Bacteria | 1788 |
| 342 | Ga0157380_10471005 | 3300014326 | Bacteria | 1212 |
| 343 | Ga0182008_10088887 | 3300014497 | Bacteria | 1522 |
| 344 | Ga0157377_10000153 | 3300014745 | Bacteria | 42425 |
| 345 | Ga0157379_10018260 | 3300014968 | Bacteria | 6181 |
| 346 | Ga0157379_10149048 | 3300014968 | Bacteria | 2110 |
| 347 | Ga0157376_10000226 | 3300014969 | Bacteria | 39339 |
| 348 | Ga0157376_10128068 | 3300014969 | Bacteria | 2261 |
| 349 | Ga0157376_10166940 | 3300014969 | Bacteria | 2001 |
| 350 | Ga0157376_10267968 | 3300014969 | Bacteria | 1603 |
| 351 | Ga0157376_10355173 | 3300014969 | Bacteria | 1404 |
| 352 | Ga0163161_10000384 | 3300017792 | Bacteria | 37040 |
| 353 | Ga0163161_10179514 | 3300017792 | Bacteria | 1622 |
| 354 | Ga0213876_10137829 | 3300021384 | Bacteria | 1298 |
| 355 | Ga0209233_1008155 | 3300025261 | Bacteria | 3264 |
| 356 | Ga0207666_1000025 | 3300025271 | Bacteria | 36031 |
| 357 | Ga0207666_1001730 | 3300025271 | Bacteria | 2594 |
| 358 | Ga0207673_1000816 | 3300025290 | Bacteria | 3363 |
| 359 | Ga0209758_1000667 | 3300025297 | Bacteria | 51345 |
| 360 | Ga0207697_10000077 | 3300025315 | Bacteria | 42549 |
| 361 | Ga0207697_10020401 | 3300025315 | Bacteria | 2713 |
| 362 | Ga0207713_1068350 | 3300025735 | Bacteria | 1321 |
| 363 | Ga0207653_10004641 | 3300025885 | Bacteria | 4306 |
| 364 | Ga0207682_10000088 | 3300025893 | Bacteria | 41732 |
| 365 | Ga0207692_10067518 | 3300025898 | Bacteria | 1872 |
| 366 | Ga0207642_10000475 | 3300025899 | Bacteria | 12314 |
| 367 | Ga0207642_10017392 | 3300025899 | Bacteria | 2734 |
| 368 | Ga0207710_10013021 | 3300025900 | Bacteria | 3505 |
| 369 | Ga0207710_10065231 | 3300025900 | Bacteria | 1659 |
| 370 | Ga0207710_10070730 | 3300025900 | Bacteria | 1599 |
| 371 | Ga0207688_10000112 | 3300025901 | Bacteria | 32685 |
| 372 | Ga0207680_10016525 | 3300025903 | Bacteria | 3876 |
| 373 | Ga0207680_10028241 | 3300025903 | Bacteria | 3135 |
| 374 | Ga0207647_10014331 | 3300025904 | Bacteria | 5465 |
| 375 | Ga0207647_10053338 | 3300025904 | Bacteria | 2492 |
| 376 | Ga0207685_10015364 | 3300025905 | Bacteria | 2424 |
| 377 | Ga0207699_10001538 | 3300025906 | Bacteria | 10935 |
| 378 | Ga0207645_10000140 | 3300025907 | Bacteria | 55845 |
| 379 | Ga0207645_10047408 | 3300025907 | Bacteria | 2744 |
| 380 | Ga0207643_10000083 | 3300025908 | Bacteria | 62116 |
| 381 | Ga0207705_10006843 | 3300025909 | Bacteria | 8424 |
| 382 | Ga0207705_10046225 | 3300025909 | Bacteria | 3128 |
| 383 | Ga0207705_10185904 | 3300025909 | Bacteria | 1570 |
| 384 | Ga0207654_10001592 | 3300025911 | Bacteria | 11921 |
| 385 | Ga0207654_10236154 | 3300025911 | Bacteria | 1219 |
| 386 | Ga0207707_10032786 | 3300025912 | Bacteria | 4546 |
| 387 | Ga0207707_10091808 | 3300025912 | Bacteria | 2654 |
| 388 | Ga0207707_10198955 | 3300025912 | Bacteria | 1747 |
| 389 | Ga0207695_10082733 | 3300025913 | Bacteria | 3244 |
| 390 | Ga0207695_10182232 | 3300025913 | Bacteria | 2021 |
| 391 | Ga0207671_10065883 | 3300025914 | Bacteria | 2695 |
| 392 | Ga0207671_10388557 | 3300025914 | Bacteria | 1109 |
| 393 | Ga0207693_10074133 | 3300025915 | Bacteria | 2665 |
| 394 | Ga0207693_10142586 | 3300025915 | Bacteria | 1884 |
| 395 | Ga0207663_10191343 | 3300025916 | Bacteria | 1469 |
| 396 | Ga0207660_10000545 | 3300025917 | Bacteria | 25320 |
| 397 | Ga0207660_10141067 | 3300025917 | Bacteria | 1842 |
| 398 | Ga0207660_10175361 | 3300025917 | Bacteria | 1662 |
| 399 | Ga0207660_10264456 | 3300025917 | Bacteria | 1361 |
| 400 | Ga0207662_10000210 | 3300025918 | Bacteria | 27221 |
| 401 | Ga0207662_10041674 | 3300025918 | Bacteria | 2704 |
| 402 | Ga0207662_10045199 | 3300025918 | Bacteria | 2603 |
| 403 | Ga0207662_10162578 | 3300025918 | Bacteria | 1427 |
| 404 | Ga0207662_10210412 | 3300025918 | Bacteria | 1262 |
| 405 | Ga0207657_10003507 | 3300025919 | Bacteria | 16756 |
| 406 | Ga0207657_10043764 | 3300025919 | Bacteria | 3941 |
| 407 | Ga0207657_10061957 | 3300025919 | Bacteria | 3204 |
| 408 | Ga0207657_10199783 | 3300025919 | Bacteria | 1609 |
| 409 | Ga0207649_10001961 | 3300025920 | Bacteria | 11733 |
| 410 | Ga0207649_10011721 | 3300025920 | Bacteria | 4845 |
| 411 | Ga0207649_10112044 | 3300025920 | Bacteria | 1825 |
| 412 | Ga0207652_10016202 | 3300025921 | Bacteria | 6081 |
| 413 | Ga0207652_10071665 | 3300025921 | Bacteria | 3011 |
| 414 | Ga0207652_10078106 | 3300025921 | Bacteria | 2889 |
| 415 | Ga0207652_10115315 | 3300025921 | Bacteria | 2386 |
| 416 | Ga0207652_10141699 | 3300025921 | Bacteria | 2150 |
| 417 | Ga0207652_10280435 | 3300025921 | Bacteria | 1503 |
| 418 | Ga0207681_10000097 | 3300025923 | Bacteria | 73836 |
| 419 | Ga0207681_10036777 | 3300025923 | Bacteria | 3232 |
| 420 | Ga0207694_10199604 | 3300025924 | Bacteria | 1627 |
| 421 | Ga0207694_10633551 | 3300025924 | Bacteria | 900 |
| 422 | Ga0207650_10000946 | 3300025925 | Bacteria | 21828 |
| 423 | Ga0207650_10001640 | 3300025925 | Bacteria | 15939 |
| 424 | Ga0207650_10105089 | 3300025925 | Bacteria | 2179 |
| 425 | Ga0207659_10000092 | 3300025926 | Bacteria | 52642 |
| 426 | Ga0207659_10098941 | 3300025926 | Bacteria | 2195 |
| 427 | Ga0207687_10000129 | 3300025927 | Bacteria | 50592 |
| 428 | Ga0207687_10217098 | 3300025927 | Bacteria | 1504 |
| 429 | Ga0207700_10000483 | 3300025928 | Bacteria | 23397 |
| 430 | Ga0207700_10312731 | 3300025928 | Bacteria | 1359 |
| 431 | Ga0207664_10068274 | 3300025929 | Bacteria | 2855 |
| 432 | Ga0207644_10009066 | 3300025931 | Bacteria | 6523 |
| 433 | Ga0207644_10009427 | 3300025931 | Bacteria | 6409 |
| 434 | Ga0207644_10056623 | 3300025931 | Bacteria | 2829 |
| 435 | Ga0207644_10085988 | 3300025931 | Bacteria | 2334 |
| 436 | Ga0207690_10003841 | 3300025932 | Bacteria | 8886 |
| 437 | Ga0207690_10112467 | 3300025932 | Bacteria | 1963 |
| 438 | Ga0207690_10142529 | 3300025932 | Bacteria | 1768 |
| 439 | Ga0207706_10001332 | 3300025933 | Bacteria | 24722 |
| 440 | Ga0207706_10088469 | 3300025933 | Bacteria | 2723 |
| 441 | Ga0207686_10000635 | 3300025934 | Bacteria | 21719 |
| 442 | Ga0207686_10142379 | 3300025934 | Bacteria | 1659 |
| 443 | Ga0207709_10000362 | 3300025935 | Bacteria | 45886 |
| 444 | Ga0207709_10060714 | 3300025935 | Bacteria | 2358 |
| 445 | Ga0207670_10000225 | 3300025936 | Bacteria | 36971 |
| 446 | Ga0207670_10042965 | 3300025936 | Bacteria | 2982 |
| 447 | Ga0207670_10058786 | 3300025936 | Bacteria | 2613 |
| 448 | Ga0207670_10310679 | 3300025936 | Bacteria | 1237 |
| 449 | Ga0207670_10340399 | 3300025936 | Bacteria | 1185 |
| 450 | Ga0207669_10000043 | 3300025937 | Bacteria | 65025 |
| 451 | Ga0207669_10028895 | 3300025937 | Bacteria | 3057 |
| 452 | Ga0207669_10185035 | 3300025937 | Bacteria | 1497 |
| 453 | Ga0207704_10000602 | 3300025938 | Bacteria | 15871 |
| 454 | Ga0207704_10008683 | 3300025938 | Bacteria | 4872 |
| 455 | Ga0207704_10080499 | 3300025938 | Bacteria | 2103 |
| 456 | Ga0207704_10130649 | 3300025938 | Bacteria | 1738 |
| 457 | Ga0207704_10598202 | 3300025938 | Bacteria | 902 |
| 458 | Ga0207665_10008168 | 3300025939 | Bacteria | 6908 |
| 459 | Ga0207691_10000283 | 3300025940 | Bacteria | 50040 |
| 460 | Ga0207691_10105570 | 3300025940 | Bacteria | 2509 |
| 461 | Ga0207691_10135723 | 3300025940 | Bacteria | 2170 |
| 462 | Ga0207711_10001023 | 3300025941 | Bacteria | 26757 |
| 463 | Ga0207711_10107998 | 3300025941 | Bacteria | 2471 |
| 464 | Ga0207711_10236664 | 3300025941 | Bacteria | 1674 |
| 465 | Ga0207689_10001131 | 3300025942 | Bacteria | 25702 |
| 466 | Ga0207689_10248997 | 3300025942 | Bacteria | 1469 |
| 467 | Ga0207661_10000245 | 3300025944 | Bacteria | 35428 |
| 468 | Ga0207679_10000030 | 3300025945 | Bacteria | 169351 |
| 469 | Ga0207679_10032562 | 3300025945 | Bacteria | 3661 |
| 470 | Ga0207679_10108986 | 3300025945 | Bacteria | 2181 |
| 471 | Ga0207679_10259408 | 3300025945 | Bacteria | 1482 |
| 472 | Ga0207679_10405854 | 3300025945 | Bacteria | 1199 |
| 473 | Ga0207667_10079278 | 3300025949 | Bacteria | 3404 |
| 474 | Ga0207667_10105691 | 3300025949 | Bacteria | 2904 |
| 475 | Ga0207667_10554517 | 3300025949 | Bacteria | 1162 |
| 476 | Ga0207651_10000088 | 3300025960 | Bacteria | 40879 |
| 477 | Ga0207651_10004647 | 3300025960 | Bacteria | 6960 |
| 478 | Ga0207651_10010467 | 3300025960 | Bacteria | 5143 |
| 479 | Ga0207651_10502856 | 3300025960 | Bacteria | 1048 |
| 480 | Ga0207651_10530617 | 3300025960 | Bacteria | 1021 |
| 481 | Ga0207712_10000924 | 3300025961 | Bacteria | 21209 |
| 482 | Ga0207712_10036353 | 3300025961 | Bacteria | 3353 |
| 483 | Ga0207712_10112192 | 3300025961 | Bacteria | 2047 |
| 484 | Ga0207712_10261854 | 3300025961 | Bacteria | 1403 |
| 485 | Ga0207668_10000114 | 3300025972 | Bacteria | 57323 |
| 486 | Ga0207668_10072600 | 3300025972 | Bacteria | 2463 |
| 487 | Ga0207640_10000616 | 3300025981 | Bacteria | 20961 |
| 488 | Ga0207640_10115794 | 3300025981 | Bacteria | 1909 |
| 489 | Ga0207658_10004201 | 3300025986 | Bacteria | 10036 |
| 490 | Ga0207677_10007396 | 3300026023 | Bacteria | 6072 |
| 491 | Ga0207677_10048287 | 3300026023 | Bacteria | 2865 |
| 492 | Ga0207703_10006170 | 3300026035 | Bacteria | 9594 |
| 493 | Ga0207703_10024255 | 3300026035 | Bacteria | 4772 |
| 494 | Ga0207703_10030929 | 3300026035 | Bacteria | 4232 |
| 495 | Ga0207703_10161340 | 3300026035 | Bacteria | 1964 |
| 496 | Ga0207703_10337337 | 3300026035 | Bacteria | 1384 |
| 497 | Ga0207639_10001529 | 3300026041 | Bacteria | 15540 |
| 498 | Ga0207639_10091275 | 3300026041 | Bacteria | 2438 |
| 499 | Ga0207678_10000125 | 3300026067 | Bacteria | 63817 |
| 500 | Ga0207678_10068972 | 3300026067 | Bacteria | 3032 |
| 501 | Ga0207678_10132054 | 3300026067 | Bacteria | 2131 |
| 502 | Ga0207708_10005075 | 3300026075 | Bacteria | 9710 |
| 503 | Ga0207708_10005233 | 3300026075 | Bacteria | 9559 |
| 504 | Ga0207708_10152141 | 3300026075 | Bacteria | 1822 |
| 505 | Ga0207702_10007265 | 3300026078 | Bacteria | 9473 |
| 506 | Ga0207702_10036008 | 3300026078 | Bacteria | 4139 |
| 507 | Ga0207702_10407689 | 3300026078 | Bacteria | 1312 |
| 508 | Ga0207641_10001951 | 3300026088 | Bacteria | 19779 |
| 509 | Ga0207648_10002235 | 3300026089 | Bacteria | 20962 |
| 510 | Ga0207648_10009401 | 3300026089 | Bacteria | 9363 |
| 511 | Ga0207648_10186273 | 3300026089 | Bacteria | 1839 |
| 512 | Ga0207676_10000074 | 3300026095 | Bacteria | 101208 |
| 513 | Ga0207676_10044234 | 3300026095 | Bacteria | 3434 |
| 514 | Ga0207676_10079802 | 3300026095 | Bacteria | 2654 |
| 515 | Ga0207676_10202999 | 3300026095 | Bacteria | 1753 |
| 516 | Ga0207676_10457777 | 3300026095 | Bacteria | 1204 |
| 517 | Ga0207674_10000750 | 3300026116 | Bacteria | 42574 |
| 518 | Ga0207674_10203427 | 3300026116 | Bacteria | 1929 |
| 519 | Ga0207675_100001312 | 3300026118 | Bacteria | 24916 |
| 520 | Ga0207675_100102565 | 3300026118 | Bacteria | 2696 |
| 521 | Ga0207683_10000014 | 3300026121 | Bacteria | 128817 |
| 522 | Ga0207683_10002446 | 3300026121 | Bacteria | 16197 |
| 523 | Ga0207698_10006673 | 3300026142 | Bacteria | 7212 |
| 524 | Ga0207698_10022216 | 3300026142 | Bacteria | 4404 |
| 525 | Ga0207698_10325949 | 3300026142 | Bacteria | 1440 |
| 526 | Ga0209973_1007128 | 3300027252 | Bacteria | 1241 |
| 527 | Ga0209995_1022189 | 3300027471 | Bacteria | 1053 |
| 528 | Ga0210002_1004043 | 3300027617 | Bacteria | 2177 |
| 529 | Ga0209971_1013394 | 3300027682 | Bacteria | 1943 |
| 530 | Ga0209971_1030169 | 3300027682 | Bacteria | 1298 |
| 531 | Ga0209998_10000650 | 3300027717 | Bacteria | 9314 |
| 532 | Ga0209813_10039518 | 3300027866 | Bacteria | 1430 |
| 533 | Ga0209974_10006501 | 3300027876 | Bacteria | 4079 |
| 534 | Ga0209974_10091760 | 3300027876 | Bacteria | 1054 |
| 535 | Ga0207428_10000467 | 3300027907 | Bacteria | 48756 |
| 536 | Ga0207428_10004971 | 3300027907 | Bacteria | 12517 |
| 537 | Ga0268266_10005646 | 3300028379 | Bacteria | 11604 |
| 538 | Ga0268265_10002706 | 3300028380 | Bacteria | 13120 |
| 539 | Ga0268265_10128778 | 3300028380 | Bacteria | 2099 |
| 540 | Ga0268264_10000469 | 3300028381 | Bacteria | 54801 |
| 541 | Ga0268264_10090183 | 3300028381 | Bacteria | 2641 |
| 542 | Ga0265337_1000937 | 3300028556 | Bacteria | 15292 |
| 543 | Ga0265338_10126321 | 3300028800 | Bacteria | 2028 |
| 544 | Ga0265338_10240698 | 3300028800 | Bacteria | 1340 |
| 545 | Ga0265338_10365706 | 3300028800 | Bacteria | 1034 |
| 546 | Ga0265760_10043236 | 3300031090 | Bacteria | 1346 |
| 547 | Ga0265330_10008372 | 3300031235 | Bacteria | 4980 |
| 548 | Ga0265330_10025586 | 3300031235 | Bacteria | 2675 |
| 549 | Ga0265332_10047640 | 3300031238 | Bacteria | 1844 |
| 550 | Ga0265325_10000784 | 3300031241 | Bacteria | 23018 |
| 551 | Ga0265325_10009965 | 3300031241 | Bacteria | 5525 |
| 552 | Ga0265325_10030064 | 3300031241 | Bacteria | 2915 |
| 553 | Ga0265325_10034777 | 3300031241 | Bacteria | 2679 |
| 554 | Ga0265340_10083718 | 3300031247 | Bacteria | 1498 |
| 555 | Ga0265339_10034520 | 3300031249 | Bacteria | 2841 |
| 556 | Ga0265313_10065540 | 3300031595 | Bacteria | 1686 |
| 557 | Ga0265314_10002142 | 3300031711 | Bacteria | 20697 |
| 558 | Ga0265314_10014070 | 3300031711 | Bacteria | 6425 |
| 559 | Ga0265342_10000540 | 3300031712 | Bacteria | 40252 |
| 560 | Ga0307406_10328527 | 3300031901 | Bacteria | 1186 |
| 561 | Ga0373930_0000284 | 3300034816 | Bacteria | 6465 |
| 562 | Ga0373930_0013420 | 3300034816 | Bacteria | 1510 |
| 563 | Ga0373948_0000299 | 3300034817 | Bacteria | 5998 |
| 564 | Ga0373950_0000315 | 3300034818 | Bacteria | 6092 |
| 565 | Ga0373958_0000765 | 3300034819 | Bacteria | 4118 |
| 566 | Ga0373958_0002537 | 3300034819 | Bacteria | 2568 |
| 567 | Ga0373959_0005961 | 3300034820 | Bacteria | 2009 |
| 568 | Ga0373938_0000035 | 3300034957 | Bacteria | 17716 |
| 569 | Ga0373938_0000130 | 3300034957 | Bacteria | 10658 |
| 570 | Ga0373928_0000643 | 3300035084 | Bacteria | 6850 |
| 571 | Ga0373928_0005103 | 3300035084 | Bacteria | 2505 |
| 572 | Ga0373929_0000258 | 3300035085 | Bacteria | 9799 |
| 573 | Ga0373929_0023565 | 3300035085 | Bacteria | 1266 |
| 574 | Ga0373934_0065203 | 3300035086 | Bacteria | 1454 |
| 575 | Ga0373934_0196992 | 3300035086 | Bacteria | 829 |
| 576 | Ga0373940_0004302 | 3300035088 | Bacteria | 3001 |
| 577 | Ga0373940_0031357 | 3300035088 | Bacteria | 1418 |
| 578 | Ga0373940_0041696 | 3300035088 | Bacteria | 1263 |
| 579 | Ga0373949_0003504 | 3300035090 | Bacteria | 3719 |
| 580 | Ga0373949_0005632 | 3300035090 | Bacteria | 2789 |
| 581 | Ga0373949_0006759 | 3300035090 | Bacteria | 2518 |
| 582 | Ga0373951_0001386 | 3300035091 | Bacteria | 6365 |
| 583 | Ga0373951_0003118 | 3300035091 | Bacteria | 4090 |
| 584 | Ga0373952_0000044 | 3300035092 | Bacteria | 15152 |
| 585 | Ga0373952_0000416 | 3300035092 | Bacteria | 7365 |
| 586 | Ga0373952_0010252 | 3300035092 | Bacteria | 1808 |
| 587 | Ga0373923_0106203 | 3300035111 | Bacteria | 1243 |
| 588 | Ga0373932_0002415 | 3300035112 | Bacteria | 4742 |
| 589 | Ga0373932_0002422 | 3300035112 | Bacteria | 4733 |
| 590 | Ga0373939_0001850 | 3300035114 | Bacteria | 5081 |
| 591 | Ga0373939_0002508 | 3300035114 | Bacteria | 4322 |
| 592 | Ga0373941_0000164 | 3300035115 | Bacteria | 12153 |
| 593 | Ga0373941_0001372 | 3300035115 | Bacteria | 5131 |
| 594 | Ga0373941_0001742 | 3300035115 | Bacteria | 4673 |
| 595 | Ga0373945_0003277 | 3300035116 | Bacteria | 5077 |
| 596 | Ga0373945_0014877 | 3300035116 | Bacteria | 2612 |
| 597 | Ga0373954_0064487 | 3300035118 | Bacteria | 1732 |
| 598 | Ga0373957_0011276 | 3300035120 | Bacteria | 2979 |
| 599 | Ga0373960_0001732 | 3300035121 | Bacteria | 4883 |
| 600 | Ga0373960_0002782 | 3300035121 | Bacteria | 3962 |
| 601 | Ga0373960_0046558 | 3300035121 | Bacteria | 1273 |
| 602 | Ga0373943_0050747 | 3300035170 | Bacteria | 2040 |
| 603 | Ga0373943_0063797 | 3300035170 | Bacteria | 1848 |
| 604 | Ga0373943_0173437 | 3300035170 | Bacteria | 1181 |
| 605 | Ga0373946_0010755 | 3300035171 | Bacteria | 3397 |
| 606 | Ga0373946_0036488 | 3300035171 | Bacteria | 1994 |
| 607 | Ga0373955_0002236 | 3300035172 | Bacteria | 8404 |
| 608 | Ga0373955_0035238 | 3300035172 | Bacteria | 2650 |
| 609 | Ga0373942_0000113 | 3300035207 | Bacteria | 18511 |
| 610 | Ga0373942_0003590 | 3300035207 | Bacteria | 3639 |
| 611 | Ga0373961_0001463 | 3300035241 | Bacteria | 6946 |
| 612 | Ga0373961_0002817 | 3300035241 | Bacteria | 4436 |
| 613 | Ga0373961_0020865 | 3300035241 | Bacteria | 1737 |
| 614 | Ga0373962_0002001 | 3300035242 | Bacteria | 4861 |
| 615 | Ga0373962_0002732 | 3300035242 | Bacteria | 4203 |
| 616 | Ga0373962_0005452 | 3300035242 | Bacteria | 3078 |
| 617 | Ga0373962_0030780 | 3300035242 | Bacteria | 1470 |
| 618 | Ga0373962_0065404 | 3300035242 | Bacteria | 1076 |
| 619 | Ga0373924_0010583 | 3300035410 | Bacteria | 3408 |
| 620 | Ga0373924_0085378 | 3300035410 | Bacteria | 1346 |
| 621 | Ga0373931_0000779 | 3300035691 | Bacteria | 13339 |
| 622 | Ga0373931_0014732 | 3300035691 | Bacteria | 3827 |
| 623 | Ga0373931_0026802 | 3300035691 | Bacteria | 2937 |
| 624 | Ga0373935_0000897 | 3300035692 | Bacteria | 16091 |
| 625 | Ga0373935_0048846 | 3300035692 | Bacteria | 2680 |
| 626 | Ga0373935_0062315 | 3300035692 | Bacteria | 2389 |
| 627 | Ga0373927_0015353 | 3300035695 | Bacteria | 5059 |
| 628 | Ga0373927_0047892 | 3300035695 | Bacteria | 2765 |
| 629 | Ga0373933_0007148 | 3300035724 | Bacteria | 6080 |
| 630 | Ga0373933_0017351 | 3300035724 | Bacteria | 4039 |
| 631 | Ga0373947_0001129 | 3300035725 | Bacteria | 16384 |
| 632 | Ga0373947_0012771 | 3300035725 | Bacteria | 4814 |
| 633 | Ga0373947_0077964 | 3300035725 | Bacteria | 2044 |
| 634 | Ga0373947_0205171 | 3300035725 | Bacteria | 1291 |
| 635 | Ga0373937_0001244 | 3300036401 | Bacteria | 21426 |
| 636 | Ga0373937_0004652 | 3300036401 | Bacteria | 11656 |
| 637 | Ga0373937_0606471 | 3300036401 | Bacteria | 1039 |
| 638 | Ga0373925_0006292 | 3300037068 | Bacteria | 8746 |
| 639 | Ga0373925_0114283 | 3300037068 | Bacteria | 2089 |
| 640 | Ga0436365_0424475 | 3300039437 | Bacteria | 1085 |
| 641 | Ga0436365_0671220 | 3300039437 | Bacteria | 1431 |
| 642 | Ga0436365_1126455 | 3300039437 | Bacteria | 19004 |
| 643 | Ga0439455_0020242 | 3300042012 | Bacteria | 1576 |
| 644 | Ga0439463_009214 | 3300042016 | Bacteria | 2430 |
| 645 | Ga0439464_0022398 | 3300042439 | Bacteria | 1740 |
| 646 | Ga0451577_0117894 | 3300042876 | Bacteria | 2378 |
| 647 | Ga0466966_0031357 | 3300044684 | Bacteria | 3448 |
| 648 | Ga0466963_0027204 | 3300044694 | Bacteria | 3661 |
| 649 | Ga0466963_0080913 | 3300044694 | Bacteria | 2200 |
| 650 | Ga0453684_0357785 | 3300044712 | Bacteria | 1644 |
| 651 | Ga0466957_0016973 | 3300044842 | Bacteria | 4259 |
| 652 | Ga0466957_0181829 | 3300044842 | Bacteria | 1373 |
| 653 | Ga0466957_0371852 | 3300044842 | Bacteria | 973 |
| 654 | Ga0451576_0031881 | 3300045051 | Bacteria | 5617 |
| 655 | Ga0466958_0262076 | 3300045836 | Bacteria | 1106 |
| 656 | Ga0495617_036321 | 3300046452 | Bacteria | 1652 |
| 657 | Ga0495592_0058494 | 3300046454 | Bacteria | 2843 |
| 658 | Ga0495592_0077746 | 3300046454 | Bacteria | 2404 |
| 659 | Ga0495603_0036699 | 3300046455 | Bacteria | 2942 |
| 660 | Ga0495629_0000623 | 3300046459 | Bacteria | 28814 |
| 661 | Ga0495629_0207783 | 3300046459 | Bacteria | 1352 |
| 662 | Ga0495641_0012473 | 3300046461 | Bacteria | 4751 |
| 663 | Ga0495651_0009844 | 3300046462 | Bacteria | 7349 |
| 664 | Ga0495651_0016870 | 3300046462 | Bacteria | 5656 |
| 665 | Ga0495653_0034032 | 3300046463 | Bacteria | 4033 |
| 666 | Ga0495653_0074774 | 3300046463 | Bacteria | 2523 |
| 667 | Ga0495653_0095828 | 3300046463 | Bacteria | 2159 |
| 668 | Ga0495580_0004252 | 3300046472 | Bacteria | 12046 |
| 669 | Ga0495582_0001248 | 3300046473 | Bacteria | 14286 |
| 670 | Ga0495582_0188694 | 3300046473 | Bacteria | 1176 |
| 671 | Ga0495662_0049431 | 3300046476 | Bacteria | 2029 |
| 672 | Ga0495664_0026877 | 3300046477 | Bacteria | 3353 |
| 673 | Ga0495584_0024408 | 3300046491 | Bacteria | 3066 |
| 674 | Ga0495585_0001463 | 3300046492 | Bacteria | 18493 |
| 675 | Ga0495594_0016246 | 3300046499 | Bacteria | 3919 |
| 676 | Ga0495594_0026013 | 3300046499 | Bacteria | 3147 |
| 677 | Ga0495607_0002688 | 3300046501 | Bacteria | 14188 |
| 678 | Ga0495608_0129848 | 3300046511 | Bacteria | 1613 |
| 679 | Ga0495618_0052847 | 3300046514 | Bacteria | 2569 |
| 680 | Ga0495618_0129545 | 3300046514 | Bacteria | 1614 |
| 681 | Ga0495618_0277276 | 3300046514 | Bacteria | 1046 |
| 682 | Ga0495628_0120945 | 3300046516 | Bacteria | 2009 |
| 683 | Ga0495628_0132535 | 3300046516 | Bacteria | 1905 |
| 684 | Ga0495630_0137271 | 3300046517 | Bacteria | 1858 |
| 685 | Ga0495643_0216954 | 3300046522 | Bacteria | 910 |
| 686 | Ga0495644_0001288 | 3300046523 | Bacteria | 10287 |
| 687 | Ga0495652_0036124 | 3300046529 | Bacteria | 4297 |
| 688 | Ga0495665_0008222 | 3300046531 | Bacteria | 5657 |
| 689 | Ga0495665_0097428 | 3300046531 | Bacteria | 1544 |
| 690 | Ga0495640_0036024 | 3300046533 | Bacteria | 3499 |
| 691 | Ga0495640_0178891 | 3300046533 | Bacteria | 1352 |
| 692 | Ga0495586_0051009 | 3300046535 | Bacteria | 2239 |
| 693 | Ga0495587_0015294 | 3300046536 | Bacteria | 4794 |
| 694 | Ga0495609_0045650 | 3300046538 | Bacteria | 1963 |
| 695 | Ga0495645_0066077 | 3300046543 | Bacteria | 2615 |
| 696 | Ga0495645_0078198 | 3300046543 | Bacteria | 2378 |
| 697 | Ga0495622_0025955 | 3300046557 | Bacteria | 2738 |
| 698 | Ga0495667_0004407 | 3300046559 | Bacteria | 9493 |
| 699 | Ga0495656_0000284 | 3300046615 | Bacteria | 17684 |
| 700 | Ga0495634_0029759 | 3300046642 | Bacteria | 3779 |
| 701 | Ga0495634_0213500 | 3300046642 | Bacteria | 1193 |
| 702 | Ga0495635_0003295 | 3300046663 | Bacteria | 11154 |
| 703 | Ga0495635_0033531 | 3300046663 | Bacteria | 3562 |
| 704 | Ga0495588_0001863 | 3300046674 | Bacteria | 8990 |
| 705 | Ga0495657_0005731 | 3300046675 | Bacteria | 9781 |
| 706 | Ga0495657_0275986 | 3300046675 | Bacteria | 1007 |
| 707 | Ga0495599_0042191 | 3300046678 | Bacteria | 2863 |
| 708 | Ga0495623_0038989 | 3300046679 | Bacteria | 3037 |
| 709 | Ga0495623_0169123 | 3300046679 | Bacteria | 1278 |
| 710 | Ga0495646_0026179 | 3300046680 | Bacteria | 3664 |
| 711 | Ga0495647_0000627 | 3300046681 | Bacteria | 10409 |
| 712 | Ga0495647_0006614 | 3300046681 | Bacteria | 3847 |
| 713 | Ga0495658_0001220 | 3300046683 | Bacteria | 13489 |
| 714 | Ga0495658_0009067 | 3300046683 | Bacteria | 4946 |
| 715 | Ga0495658_0107196 | 3300046683 | Bacteria | 1676 |
| 716 | Ga0495613_0003128 | 3300046689 | Bacteria | 12397 |
| 717 | Ga0495613_0126155 | 3300046689 | Bacteria | 1835 |
| 718 | Ga0495624_0012794 | 3300046690 | Bacteria | 5729 |
| 719 | Ga0495624_0236758 | 3300046690 | Bacteria | 1105 |
| 720 | Ga0495670_0000802 | 3300046691 | Bacteria | 15114 |
| 721 | Ga0495600_0003569 | 3300046809 | Bacteria | 9155 |
| 722 | Ga0495600_0241385 | 3300046809 | Bacteria | 1151 |
| 723 | Ga0495581_0110979 | 3300047315 | Bacteria | 1595 |
| 724 | Ga0495581_0125955 | 3300047315 | Bacteria | 1491 |
| 725 | Ga0495604_0020267 | 3300047317 | Bacteria | 5314 |
| 726 | Ga0495636_0087271 | 3300047318 | Bacteria | 1350 |
| 727 | Ga0495674_0072398 | 3300047319 | Bacteria | 2972 |
| 728 | Ga0495674_0130894 | 3300047319 | Bacteria | 2114 |
| 729 | Ga0495674_0224472 | 3300047319 | Bacteria | 1552 |
| 730 | Ga0495674_0289962 | 3300047319 | Bacteria | 1338 |
| 731 | Ga0495676_0021468 | 3300047321 | Bacteria | 5637 |
| 732 | Ga0495676_0200409 | 3300047321 | Bacteria | 1387 |
| 733 | Ga0495680_0005826 | 3300047322 | Bacteria | 11532 |
| 734 | Ga0495680_0015212 | 3300047322 | Bacteria | 6643 |
| 735 | Ga0495680_0097548 | 3300047322 | Bacteria | 2194 |
| 736 | Ga0495680_0098868 | 3300047322 | Bacteria | 2176 |
| 737 | Ga0495680_0104727 | 3300047322 | Bacteria | 2104 |
| 738 | Ga0495675_0007872 | 3300047444 | Bacteria | 6585 |
| 739 | Ga0495675_0028731 | 3300047444 | Bacteria | 3544 |
| 740 | Ga0495675_0138192 | 3300047444 | Bacteria | 1512 |
| 741 | Ga0495677_0058412 | 3300047445 | Bacteria | 1427 |
| 742 | Ga0495684_0002228 | 3300047471 | Bacteria | 15529 |
| 743 | Ga0495684_0063802 | 3300047471 | Bacteria | 2800 |
| 744 | Ga0495593_0014060 | 3300047673 | Bacteria | 4556 |
| 745 | Ga0495593_0044745 | 3300047673 | Bacteria | 2366 |
| 746 | Ga0495602_0028839 | 3300048088 | Bacteria | 5303 |
| 747 | Ga0495602_0202687 | 3300048088 | Bacteria | 1512 |
| 748 | Ga0495602_0286556 | 3300048088 | Bacteria | 1211 |
| 749 | Ga0495614_0034725 | 3300048089 | Bacteria | 2167 |
| 750 | Ga0496100_0005311 | 3300048903 | Bacteria | 6922 |
| 751 | Ga0496100_0059652 | 3300048903 | Bacteria | 2508 |
| 752 | Ga0496100_0079688 | 3300048903 | Bacteria | 2207 |
| 753 | Ga0496100_0118147 | 3300048903 | Bacteria | 1852 |
| 754 | Ga0496101_0000136 | 3300048904 | Bacteria | 65392 |
| 755 | Ga0496101_0003943 | 3300048904 | Bacteria | 9278 |
| 756 | Ga0496101_0009464 | 3300048904 | Bacteria | 6405 |
| 757 | Ga0496101_0294970 | 3300048904 | Bacteria | 1269 |
| 758 | Ga0496101_0415244 | 3300048904 | Bacteria | 1060 |
| 759 | Ga0496102_0001166 | 3300048905 | Bacteria | 23991 |
| 760 | Ga0496102_0002882 | 3300048905 | Bacteria | 14594 |
| 761 | Ga0496102_0099064 | 3300048905 | Bacteria | 2705 |
| 762 | Ga0496102_0134324 | 3300048905 | Bacteria | 2318 |
| 763 | Ga0496103_0000673 | 3300048906 | Bacteria | 25699 |
| 764 | Ga0496103_0020156 | 3300048906 | Bacteria | 4003 |
| 765 | Ga0496103_0025600 | 3300048906 | Bacteria | 3567 |
| 766 | Ga0496103_0151943 | 3300048906 | Bacteria | 1483 |
| 767 | Ga0496104_0009561 | 3300048907 | Bacteria | 8630 |
| 768 | Ga0496104_0082666 | 3300048907 | Bacteria | 3062 |
| 769 | Ga0496104_0084700 | 3300048907 | Bacteria | 3025 |
| 770 | Ga0496104_0161580 | 3300048907 | Bacteria | 2149 |
| 771 | Ga0496104_0472465 | 3300048907 | Bacteria | 1165 |
| 772 | Ga0496105_0001629 | 3300048908 | Bacteria | 15964 |
| 773 | Ga0496105_0032315 | 3300048908 | Bacteria | 4293 |
| 774 | Ga0496105_0307546 | 3300048908 | Bacteria | 1273 |
| 775 | Ga0496105_0358158 | 3300048908 | Bacteria | 1164 |
| 776 | Ga0496106_0000261 | 3300048909 | Bacteria | 36987 |
| 777 | Ga0496106_0008038 | 3300048909 | Bacteria | 7791 |
| 778 | Ga0496107_0000146 | 3300048910 | Bacteria | 35573 |
| 779 | Ga0496107_0037369 | 3300048910 | Bacteria | 3484 |
| 780 | Ga0496107_0048080 | 3300048910 | Bacteria | 3072 |
| 781 | Ga0496107_0050529 | 3300048910 | Bacteria | 2997 |
| 782 | Ga0496107_0104313 | 3300048910 | Bacteria | 2080 |
| 783 | Ga0496108_0000595 | 3300048911 | Bacteria | 28321 |
| 784 | Ga0496108_0002272 | 3300048911 | Bacteria | 15398 |
| 785 | Ga0496108_0005981 | 3300048911 | Bacteria | 9857 |
| 786 | Ga0496108_0022025 | 3300048911 | Bacteria | 5239 |
| 787 | Ga0496108_0145198 | 3300048911 | Bacteria | 2045 |
| 788 | Ga0496109_0002045 | 3300048912 | Bacteria | 16719 |
| 789 | Ga0496109_0006684 | 3300048912 | Bacteria | 9709 |
| 790 | Ga0496109_0031095 | 3300048912 | Bacteria | 4788 |
| 791 | Ga0496109_0065722 | 3300048912 | Bacteria | 3320 |
| 792 | Ga0496109_0074590 | 3300048912 | Bacteria | 3118 |
| 793 | Ga0496109_0092723 | 3300048912 | Bacteria | 2794 |
| 794 | Ga0496109_0275774 | 3300048912 | Bacteria | 1584 |
| 795 | Ga0496109_0637340 | 3300048912 | Bacteria | 1002 |
| 796 | Ga0496110_0007143 | 3300048913 | Bacteria | 8893 |
| 797 | Ga0496110_0042599 | 3300048913 | Bacteria | 3963 |
| 798 | Ga0496110_0049746 | 3300048913 | Bacteria | 3678 |
| 799 | Ga0496110_0055079 | 3300048913 | Bacteria | 3499 |
| 800 | Ga0496110_0158766 | 3300048913 | Bacteria | 2049 |
| 801 | Ga0496111_0007800 | 3300048914 | Bacteria | 7048 |
| 802 | Ga0496111_0015190 | 3300048914 | Bacteria | 5279 |
| 803 | Ga0496111_0030574 | 3300048914 | Bacteria | 3830 |
| 804 | Ga0496111_0060911 | 3300048914 | Bacteria | 2736 |
| 805 | Ga0496111_0134560 | 3300048914 | Bacteria | 1830 |
| 806 | Ga0496111_0147341 | 3300048914 | Bacteria | 1745 |
| 807 | Ga0496112_0008941 | 3300048915 | Bacteria | 8993 |
| 808 | Ga0496112_0063888 | 3300048915 | Bacteria | 3631 |
| 809 | Ga0496112_0087107 | 3300048915 | Bacteria | 3090 |
| 810 | Ga0496112_0118981 | 3300048915 | Bacteria | 2611 |
| 811 | Ga0496112_0450055 | 3300048915 | Bacteria | 1225 |
| 812 | Ga0496113_0003365 | 3300048916 | Bacteria | 9556 |
| 813 | Ga0496113_0012040 | 3300048916 | Bacteria | 5801 |
| 814 | Ga0496113_0061119 | 3300048916 | Bacteria | 2842 |
| 815 | Ga0496113_0061142 | 3300048916 | Bacteria | 2841 |
| 816 | Ga0496113_0090608 | 3300048916 | Bacteria | 2356 |
| 817 | Ga0496113_0149877 | 3300048916 | Bacteria | 1839 |
| 818 | Ga0496113_0378290 | 3300048916 | Bacteria | 1136 |
| 819 | Ga0496114_0010754 | 3300048917 | Bacteria | 7283 |
| 820 | Ga0496114_0022962 | 3300048917 | Bacteria | 5085 |
| 821 | Ga0496114_0127579 | 3300048917 | Bacteria | 2194 |
| 822 | Ga0496115_0031240 | 3300048918 | Bacteria | 4194 |
| 823 | Ga0496115_0073726 | 3300048918 | Bacteria | 2771 |
| 824 | Ga0496115_0304453 | 3300048918 | Bacteria | 1305 |
| 825 | Ga0501034_0014054 | 3300049571 | Bacteria | 8246 |
| 826 | Ga0501034_0070300 | 3300049571 | Bacteria | 3512 |
| 827 | Ga0501047_0020439 | 3300049581 | Bacteria | 6358 |
| 828 | Ga0501067_0018478 | 3300049583 | Bacteria | 3861 |
| 829 | Ga0501068_0047044 | 3300049584 | Bacteria | 2602 |
| 830 | Ga0501069_0109843 | 3300049585 | Bacteria | 1569 |
| 831 | Ga0501070_0060309 | 3300049586 | Bacteria | 3144 |
| 832 | Ga0501070_0339088 | 3300049586 | Bacteria | 1221 |
| 833 | Ga0501072_0549467 | 3300049588 | Bacteria | 912 |
| 834 | Ga0501073_0034211 | 3300049589 | Bacteria | 3617 |
| 835 | Ga0501074_0071216 | 3300049590 | Bacteria | 2499 |
| 836 | Ga0501080_0041456 | 3300049742 | Bacteria | 4289 |
| 837 | Ga0501080_0158733 | 3300049742 | Bacteria | 2089 |
| 838 | Ga0501081_0316911 | 3300049743 | Bacteria | 1146 |
| 839 | Ga0501044_0510609 | 3300049823 | Bacteria | 1102 |
| 840 | nmdc:mga03683_18329_c1 | 3300050489 | Bacteria | 2660 |
| 841 | nmdc:mga03683_32691_c1 | 3300050489 | Bacteria | 2094 |
| 842 | nmdc:mga03683_46947_c1 | 3300050489 | Bacteria | 1791 |
| 843 | nmdc:mga00v17_94675_c1 | 3300050491 | Bacteria | 1879 |
| 844 | nmdc:mga00v17_96663_c1 | 3300050491 | Bacteria | 1861 |
| 845 | nmdc:mga0yw44_99995_c1 | 3300050492 | Bacteria | 1846 |
| 846 | nmdc:mga0k408_131980_c1 | 3300050493 | Bacteria | 1483 |
| 847 | nmdc:mga0k408_158540_c1 | 3300050493 | Bacteria | 1348 |
| 848 | nmdc:mga0k408_296703_c1 | 3300050493 | Bacteria | 964 |
| 849 | nmdc:mga0k408_96561_c1 | 3300050493 | Bacteria | 1740 |
| 850 | nmdc:mga06z11_134950_c1 | 3300050494 | Bacteria | 1389 |
| 851 | nmdc:mga06z11_174357_c1 | 3300050494 | Bacteria | 1237 |
| 852 | nmdc:mga06z11_24117_c1 | 3300050494 | Bacteria | 2866 |
| 853 | nmdc:mga04h51_47241_c1 | 3300050495 | Bacteria | 1430 |
| 854 | nmdc:mga04h51_60655_c1 | 3300050495 | Bacteria | 1296 |
| 855 | nmdc:mga07m45_112389_c1 | 3300050496 | Bacteria | 1570 |
| 856 | nmdc:mga07m45_53724_c1 | 3300050496 | Bacteria | 2276 |
| 857 | nmdc:mga05p37_246885_c1 | 3300050507 | Bacteria | 2143 |
| 858 | nmdc:mga05p37_37269_c1 | 3300050507 | Bacteria | 5962 |
| 859 | nmdc:mga09592_269303_c1 | 3300050508 | Bacteria | 1477 |
| 860 | nmdc:mga06r32_205805_c1 | 3300050510 | Bacteria | 1956 |
| 861 | nmdc:mga06r32_381242_c1 | 3300050510 | Bacteria | 1393 |
| 862 | nmdc:mga08y16_238729_c1 | 3300050511 | Bacteria | 1879 |
| 863 | nmdc:mga08y16_249040_c1 | 3300050511 | Bacteria | 1836 |
| 864 | nmdc:mga08y16_6205_c1 | 3300050511 | Bacteria | 12540 |
| 865 | nmdc:mga0n895_208_c1 | 3300050512 | Bacteria | 36701 |
| 866 | nmdc:mga0n895_212024_c1 | 3300050512 | Bacteria | 1967 |
| 867 | nmdc:mga0n895_266041_c1 | 3300050512 | Bacteria | 1739 |
| 868 | nmdc:mga0n895_60007_c1 | 3300050512 | Bacteria | 3753 |
| 869 | nmdc:mga0n895_76852_c1 | 3300050512 | Bacteria | 3320 |
| 870 | nmdc:mga0rr50_113698_c1 | 3300050513 | Bacteria | 2145 |
| 871 | nmdc:mga0rr50_193053_c1 | 3300050513 | Bacteria | 1670 |
| 872 | nmdc:mga0rr50_19615_c1 | 3300050513 | Bacteria | 4570 |
| 873 | nmdc:mga0rr50_24541_c1 | 3300050513 | Bacteria | 4177 |
| 874 | nmdc:mga08x19_364571_c1 | 3300050514 | Bacteria | 1010 |
| 875 | nmdc:mga0a205_14931_c1 | 3300050515 | Bacteria | 7247 |
| 876 | nmdc:mga0a205_176939_c1 | 3300050515 | Bacteria | 2029 |
| 877 | nmdc:mga0a205_380_c1 | 3300050515 | Bacteria | 33747 |
| 878 | nmdc:mga0sz30_60220_c1 | 3300050516 | Bacteria | 1621 |
| 879 | Ga0495601_0010986 | 3300053077 | Bacteria | 5408 |
| 880 | Ga0495601_0058505 | 3300053077 | Bacteria | 2443 |
| 881 | Ga0495601_0169132 | 3300053077 | Bacteria | 1428 |
| 882 | Ga0495612_0254303 | 3300053078 | Bacteria | 782 |
| 883 | Ga0495595_0003960 | 3300053084 | Bacteria | 5919 |
| 884 | Ga0495595_0008703 | 3300053084 | Bacteria | 4177 |
| 885 | Ga0495595_0016009 | 3300053084 | Bacteria | 3202 |
| 886 | Ga0495595_0131978 | 3300053084 | Bacteria | 1221 |
| 887 | Ga0495619_0000707 | 3300053085 | Bacteria | 21759 |
| 888 | Ga0495619_0000922 | 3300053085 | Bacteria | 19316 |
| 889 | Ga0495619_0010208 | 3300053085 | Bacteria | 5915 |
| 890 | Ga0495619_0027485 | 3300053085 | Bacteria | 3664 |
| 891 | Ga0495619_0215861 | 3300053085 | Bacteria | 1329 |
| 892 | Ga0500643_002051 | 3300053087 | Bacteria | 10779 |
| 893 | Ga0500644_0138993 | 3300053088 | Bacteria | 963 |
| 894 | Ga0500651_0019363 | 3300053093 | Bacteria | 4229 |
| 895 | Ga0500566_0062436 | 3300053094 | Bacteria | 2106 |
| 896 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 897 | Ga0500595_024086 | 3300053119 | Bacteria | 2129 |
| 898 | Ga0500595_048070 | 3300053119 | Bacteria | 1334 |
| 899 | Ga0500595_049570 | 3300053119 | Bacteria | 1307 |
| 900 | Ga0500642_0003309 | 3300053130 | Bacteria | 4854 |
| 901 | Ga0500652_000002 | 3300053131 | Bacteria | 273315 |
| 902 | Ga0500652_002800 | 3300053131 | Bacteria | 5266 |
| 903 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 904 | Ga0500636_0010920 | 3300053177 | Bacteria | 5310 |
| 905 | Ga0500645_000471 | 3300053730 | Bacteria | 27490 |
| 906 | Ga0501084_0173493 | 3300054114 | Bacteria | 1820 |
| 907 | Ga0501082_0109193 | 3300060353 | Bacteria | 2395 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050494 | nmdc:mga06z11_134950_c1 | nmdc:mga06z11_134950_c1_31_738 | 201 |
| 2 | 3300048908 | Ga0496105_0358158 | Ga0496105_0358158_425_1096 | 210 |
| 3 | 3300046531 | Ga0495665_0097428 | Ga0495665_0097428_593_1357 | 213 |
| 4 | 3300035086 | Ga0373934_0196992 | Ga0373934_0196992_107_805 | 214 |
| 5 | 3300035691 | Ga0373931_0026802 | Ga0373931_0026802_2229_2927 | 214 |
| 6 | 3300046642 | Ga0495634_0029759 | Ga0495634_0029759_2510_3274 | 214 |
| 7 | 3300047471 | Ga0495684_0063802 | Ga0495684_0063802_957_1721 | 214 |
| 8 | 3300042439 | Ga0439464_0022398 | Ga0439464_0022398_1083_1730 | 215 |
| 9 | 3300005364 | Ga0070673_100676553 | Ga0070673_1006765531 | 217 |
| 10 | 3300009094 | Ga0111539_10447581 | Ga0111539_104475812 | 217 |
| 11 | 3300005330 | Ga0070690_100013915 | Ga0070690_1000139153 | 224 |
| 12 | 3300005340 | Ga0070689_100140573 | Ga0070689_1001405732 | 224 |
| 13 | 3300005355 | Ga0070671_100553999 | Ga0070671_1005539992 | 224 |
| 14 | 3300005365 | Ga0070688_100039871 | Ga0070688_1000398712 | 224 |
| 15 | 3300005618 | Ga0068864_100050093 | Ga0068864_1000500932 | 224 |
| 16 | 3300006038 | Ga0075365_10075961 | Ga0075365_100759612 | 224 |
| 17 | 3300006042 | Ga0075368_10028139 | Ga0075368_100281392 | 224 |
| 18 | 3300006186 | Ga0075369_10024606 | Ga0075369_100246062 | 224 |
| 19 | 3300009177 | Ga0105248_10592960 | Ga0105248_105929602 | 224 |
| 20 | 3300014325 | Ga0163163_10141982 | Ga0163163_101419822 | 224 |
| 21 | 3300048903 | Ga0496100_0079688 | Ga0496100_0079688_1261_2025 | 224 |
| 22 | 3300048907 | Ga0496104_0009561 | Ga0496104_0009561_7309_8073 | 224 |
| 23 | 3300048912 | Ga0496109_0065722 | Ga0496109_0065722_1356_2120 | 224 |
| 24 | 3300048913 | Ga0496110_0007143 | Ga0496110_0007143_1983_2747 | 224 |
| 25 | 3300048916 | Ga0496113_0149877 | Ga0496113_0149877_398_1162 | 224 |
| 26 | 3300048917 | Ga0496114_0022962 | Ga0496114_0022962_788_1552 | 224 |
| 27 | 3300050489 | nmdc:mga03683_46947_c1 | nmdc:mga03683_46947_c1_315_1073 | 224 |
| 28 | 3300050492 | nmdc:mga0yw44_99995_c1 | nmdc:mga0yw44_99995_c1_717_1475 | 224 |
| 29 | 3300050493 | nmdc:mga0k408_296703_c1 | nmdc:mga0k408_296703_c1_38_796 | 224 |
| 30 | 3300050494 | nmdc:mga06z11_24117_c1 | nmdc:mga06z11_24117_c1_78_836 | 224 |
| 31 | 3300025918 | Ga0207662_10162578 | Ga0207662_101625782 | 225 |
| 32 | 3300025931 | Ga0207644_10085988 | Ga0207644_100859882 | 225 |
| 33 | 3300025936 | Ga0207670_10058786 | Ga0207670_100587862 | 225 |
| 34 | 3300025937 | Ga0207669_10185035 | Ga0207669_101850352 | 225 |
| 35 | 3300025938 | Ga0207704_10008683 | Ga0207704_100086834 | 225 |
| 36 | 3300025961 | Ga0207712_10036353 | Ga0207712_100363532 | 225 |
| 37 | 3300026035 | Ga0207703_10161340 | Ga0207703_101613402 | 225 |
| 38 | 3300026095 | Ga0207676_10044234 | Ga0207676_100442342 | 225 |
| 39 | 3300031901 | Ga0307406_10328527 | Ga0307406_103285272 | 225 |
| 40 | 3300048904 | Ga0496101_0009464 | Ga0496101_0009464_1626_2477 | 225 |
| 41 | 3300048912 | Ga0496109_0092723 | Ga0496109_0092723_1969_2742 | 225 |
| 42 | 3300048916 | Ga0496113_0061119 | Ga0496113_0061119_901_1674 | 225 |
| 43 | 3300005353 | Ga0070669_100057248 | Ga0070669_1000572482 | 226 |
| 44 | 3300013306 | Ga0163162_10436587 | Ga0163162_104365872 | 226 |
| 45 | 3300025926 | Ga0207659_10098941 | Ga0207659_100989412 | 226 |
| 46 | 3300025934 | Ga0207686_10142379 | Ga0207686_101423792 | 226 |
| 47 | 3300035085 | Ga0373929_0023565 | Ga0373929_0023565_422_1195 | 226 |
| 48 | 3300048905 | Ga0496102_0099064 | Ga0496102_0099064_924_1688 | 226 |
| 49 | 3300048908 | Ga0496105_0032315 | Ga0496105_0032315_2166_2930 | 226 |
| 50 | 3300048914 | Ga0496111_0015190 | Ga0496111_0015190_4457_5221 | 226 |
| 51 | 3300048915 | Ga0496112_0450055 | Ga0496112_0450055_164_928 | 226 |
| 52 | 3300034816 | Ga0373930_0013420 | Ga0373930_0013420_318_1091 | 227 |
| 53 | 3300044694 | Ga0466963_0027204 | Ga0466963_0027204_1207_1989 | 228 |
| 54 | 3300044842 | Ga0466957_0181829 | Ga0466957_0181829_212_994 | 228 |
| 55 | 3300046522 | Ga0495643_0216954 | Ga0495643_0216954_50_817 | 228 |
| 56 | 3300053130 | Ga0500642_0003309 | Ga0500642_0003309_3981_4763 | 228 |
| 57 | 3300046514 | Ga0495618_0129545 | Ga0495618_0129545_487_1260 | 230 |
| 58 | 3300005340 | Ga0070689_100383689 | Ga0070689_1003836891 | 231 |
| 59 | 3300005343 | Ga0070687_100376175 | Ga0070687_1003761751 | 231 |
| 60 | 3300005355 | Ga0070671_100012055 | Ga0070671_1000120553 | 231 |
| 61 | 3300005364 | Ga0070673_100006266 | Ga0070673_1000062663 | 231 |
| 62 | 3300005438 | Ga0070701_10075723 | Ga0070701_100757232 | 231 |
| 63 | 3300005617 | Ga0068859_100429121 | Ga0068859_1004291212 | 231 |
| 64 | 3300006028 | Ga0070717_10106690 | Ga0070717_101066902 | 231 |
| 65 | 3300006931 | Ga0097620_100429088 | Ga0097620_1004290882 | 231 |
| 66 | 3300009098 | Ga0105245_10369439 | Ga0105245_103694392 | 231 |
| 67 | 3300009148 | Ga0105243_10097282 | Ga0105243_100972823 | 231 |
| 68 | 3300009553 | Ga0105249_10181404 | Ga0105249_101814042 | 231 |
| 69 | 3300014326 | Ga0157380_10195816 | Ga0157380_101958162 | 231 |
| 70 | 3300050489 | nmdc:mga03683_32691_c1 | nmdc:mga03683_32691_c1_568_1368 | 231 |
| 71 | 3300007788 | Ga0099795_10051511 | Ga0099795_100515112 | 232 |
| 72 | 3300009553 | Ga0105249_10225799 | Ga0105249_102257992 | 232 |
| 73 | 3300013296 | Ga0157374_10196406 | Ga0157374_101964063 | 232 |
| 74 | 3300025900 | Ga0207710_10070730 | Ga0207710_100707301 | 232 |
| 75 | 3300025916 | Ga0207663_10191343 | Ga0207663_101913432 | 232 |
| 76 | 3300025918 | Ga0207662_10210412 | Ga0207662_102104121 | 232 |
| 77 | 3300025928 | Ga0207700_10312731 | Ga0207700_103127312 | 232 |
| 78 | 3300025931 | Ga0207644_10009066 | Ga0207644_100090663 | 232 |
| 79 | 3300025932 | Ga0207690_10142529 | Ga0207690_101425291 | 232 |
| 80 | 3300025936 | Ga0207670_10310679 | Ga0207670_103106792 | 232 |
| 81 | 3300025945 | Ga0207679_10108986 | Ga0207679_101089863 | 232 |
| 82 | 3300025960 | Ga0207651_10004647 | Ga0207651_100046474 | 232 |
| 83 | 3300046491 | Ga0495584_0024408 | Ga0495584_0024408_1461_2267 | 232 |
| 84 | 3300048903 | Ga0496100_0118147 | Ga0496100_0118147_168_923 | 232 |
| 85 | 3300048907 | Ga0496104_0161580 | Ga0496104_0161580_225_980 | 232 |
| 86 | 3300048911 | Ga0496108_0145198 | Ga0496108_0145198_397_1152 | 232 |
| 87 | 3300003215 | JGI25153J46596_10009748 | JGI25153J46596_100097485 | 233 |
| 88 | 3300005328 | Ga0070676_10051492 | Ga0070676_100514922 | 233 |
| 89 | 3300005335 | Ga0070666_10003184 | Ga0070666_100031842 | 233 |
| 90 | 3300005355 | Ga0070671_100005662 | Ga0070671_1000056622 | 233 |
| 91 | 3300005456 | Ga0070678_100004855 | Ga0070678_1000048554 | 233 |
| 92 | 3300005466 | Ga0070685_10028236 | Ga0070685_100282362 | 233 |
| 93 | 3300006195 | Ga0075366_10003072 | Ga0075366_100030722 | 233 |
| 94 | 3300006353 | Ga0075370_10042888 | Ga0075370_100428882 | 233 |
| 95 | 3300009147 | Ga0114129_10027910 | Ga0114129_100279104 | 233 |
| 96 | 3300014969 | Ga0157376_10355173 | Ga0157376_103551732 | 233 |
| 97 | 3300025297 | Ga0209758_1000667 | Ga0209758_100066725 | 233 |
| 98 | 3300025925 | Ga0207650_10001640 | Ga0207650_100016403 | 233 |
| 99 | 3300025938 | Ga0207704_10598202 | Ga0207704_105982021 | 233 |
| 100 | 3300035170 | Ga0373943_0173437 | Ga0373943_0173437_54_827 | 233 |
| 101 | 3300035171 | Ga0373946_0036488 | Ga0373946_0036488_552_1325 | 233 |
| 102 | 3300035172 | Ga0373955_0035238 | Ga0373955_0035238_1042_1815 | 233 |
| 103 | 3300035242 | Ga0373962_0065404 | Ga0373962_0065404_104_889 | 233 |
| 104 | 3300035410 | Ga0373924_0085378 | Ga0373924_0085378_295_1068 | 233 |
| 105 | 3300035695 | Ga0373927_0047892 | Ga0373927_0047892_841_1614 | 233 |
| 106 | 3300035725 | Ga0373947_0205171 | Ga0373947_0205171_183_977 | 233 |
| 107 | 3300036401 | Ga0373937_0606471 | Ga0373937_0606471_231_1025 | 233 |
| 108 | 3300046462 | Ga0495651_0016870 | Ga0495651_0016870_158_931 | 233 |
| 109 | 3300046463 | Ga0495653_0074774 | Ga0495653_0074774_920_1693 | 233 |
| 110 | 3300046473 | Ga0495582_0188694 | Ga0495582_0188694_199_993 | 233 |
| 111 | 3300046543 | Ga0495645_0066077 | Ga0495645_0066077_354_1127 | 233 |
| 112 | 3300046675 | Ga0495657_0275986 | Ga0495657_0275986_27_800 | 233 |
| 113 | 3300046679 | Ga0495623_0038989 | Ga0495623_0038989_295_1068 | 233 |
| 114 | 3300046683 | Ga0495658_0107196 | Ga0495658_0107196_763_1548 | 233 |
| 115 | 3300046690 | Ga0495624_0236758 | Ga0495624_0236758_94_879 | 233 |
| 116 | 3300047319 | Ga0495674_0224472 | Ga0495674_0224472_598_1392 | 233 |
| 117 | 3300047321 | Ga0495676_0200409 | Ga0495676_0200409_264_1058 | 233 |
| 118 | 3300047444 | Ga0495675_0028731 | Ga0495675_0028731_2625_3398 | 233 |
| 119 | 3300048088 | Ga0495602_0202687 | Ga0495602_0202687_711_1484 | 233 |
| 120 | 3300048903 | Ga0496100_0059652 | Ga0496100_0059652_1648_2433 | 233 |
| 121 | 3300048904 | Ga0496101_0415244 | Ga0496101_0415244_78_863 | 233 |
| 122 | 3300048905 | Ga0496102_0002882 | Ga0496102_0002882_1806_2591 | 233 |
| 123 | 3300048906 | Ga0496103_0025600 | Ga0496103_0025600_2512_3297 | 233 |
| 124 | 3300048907 | Ga0496104_0082666 | Ga0496104_0082666_809_1594 | 233 |
| 125 | 3300048908 | Ga0496105_0001629 | Ga0496105_0001629_959_1744 | 233 |
| 126 | 3300048909 | Ga0496106_0008038 | Ga0496106_0008038_4431_5216 | 233 |
| 127 | 3300048910 | Ga0496107_0048080 | Ga0496107_0048080_464_1249 | 233 |
| 128 | 3300048911 | Ga0496108_0000595 | Ga0496108_0000595_16995_17780 | 233 |
| 129 | 3300048912 | Ga0496109_0002045 | Ga0496109_0002045_3930_4715 | 233 |
| 130 | 3300048914 | Ga0496111_0134560 | Ga0496111_0134560_896_1681 | 233 |
| 131 | 3300048915 | Ga0496112_0008941 | Ga0496112_0008941_1414_2199 | 233 |
| 132 | 3300049571 | Ga0501034_0014054 | Ga0501034_0014054_3831_4586 | 233 |
| 133 | 3300050491 | nmdc:mga00v17_94675_c1 | nmdc:mga00v17_94675_c1_446_1231 | 233 |
| 134 | 3300050493 | nmdc:mga0k408_96561_c1 | nmdc:mga0k408_96561_c1_602_1351 | 233 |
| 135 | 3300050496 | nmdc:mga07m45_53724_c1 | nmdc:mga07m45_53724_c1_1245_1994 | 233 |
| 136 | 3300050508 | nmdc:mga09592_269303_c1 | nmdc:mga09592_269303_c1_160_945 | 233 |
| 137 | 3300050510 | nmdc:mga06r32_205805_c1 | nmdc:mga06r32_205805_c1_159_944 | 233 |
| 138 | 3300050512 | nmdc:mga0n895_76852_c1 | nmdc:mga0n895_76852_c1_472_1257 | 233 |
| 139 | 3300050514 | nmdc:mga08x19_364571_c1 | nmdc:mga08x19_364571_c1_133_918 | 233 |
| 140 | 3300053084 | Ga0495595_0131978 | Ga0495595_0131978_287_1060 | 233 |
| 141 | 3300053119 | Ga0500595_048070 | Ga0500595_048070_454_1236 | 233 |
| 142 | 3300005331 | Ga0070670_100005729 | Ga0070670_1000057293 | 234 |
| 143 | 3300005434 | Ga0070709_10111811 | Ga0070709_101118112 | 234 |
| 144 | 3300005548 | Ga0070665_100064597 | Ga0070665_1000645971 | 234 |
| 145 | 3300005842 | Ga0068858_100433088 | Ga0068858_1004330881 | 234 |
| 146 | 3300006175 | Ga0070712_100177167 | Ga0070712_1001771672 | 234 |
| 147 | 3300006871 | Ga0075434_100038150 | Ga0075434_1000381502 | 234 |
| 148 | 3300009177 | Ga0105248_10329999 | Ga0105248_103299992 | 234 |
| 149 | 3300025915 | Ga0207693_10142586 | Ga0207693_101425862 | 234 |
| 150 | 3300025941 | Ga0207711_10236664 | Ga0207711_102366642 | 234 |
| 151 | 3300026035 | Ga0207703_10337337 | Ga0207703_103373372 | 234 |
| 152 | 3300048907 | Ga0496104_0472465 | Ga0496104_0472465_448_1152 | 234 |
| 153 | 3300050512 | nmdc:mga0n895_266041_c1 | nmdc:mga0n895_266041_c1_140_901 | 234 |
| 154 | 3300005985 | Ga0081539_10038361 | Ga0081539_100383613 | 235 |
| 155 | 3300006173 | Ga0070716_100555592 | Ga0070716_1005555921 | 235 |
| 156 | 3300039437 | Ga0436365_0671220 | Ga0436365_0671220_239_973 | 235 |
| 157 | 3300048917 | Ga0496114_0127579 | Ga0496114_0127579_964_1749 | 235 |
| 158 | 3300053131 | Ga0500652_002800 | Ga0500652_002800_2891_3637 | 235 |
| 159 | 3300005329 | Ga0070683_100360828 | Ga0070683_1003608282 | 236 |
| 160 | 3300005347 | Ga0070668_100367217 | Ga0070668_1003672172 | 236 |
| 161 | 3300005458 | Ga0070681_10154716 | Ga0070681_101547164 | 236 |
| 162 | 3300005530 | Ga0070679_100511397 | Ga0070679_1005113972 | 236 |
| 163 | 3300007076 | Ga0075435_100229571 | Ga0075435_1002295712 | 236 |
| 164 | 3300009147 | Ga0114129_10021642 | Ga0114129_100216422 | 236 |
| 165 | 3300025912 | Ga0207707_10091808 | Ga0207707_100918081 | 236 |
| 166 | 3300035242 | Ga0373962_0030780 | Ga0373962_0030780_568_1335 | 236 |
| 167 | 3300050507 | nmdc:mga05p37_37269_c1 | nmdc:mga05p37_37269_c1_226_1029 | 236 |
| 168 | 3300053087 | Ga0500643_002051 | Ga0500643_002051_9979_10725 | 236 |
| 169 | 3300053094 | Ga0500566_0062436 | Ga0500566_0062436_193_939 | 236 |
| 170 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_24036_24782 | 236 |
| 171 | 3300053119 | Ga0500595_024086 | Ga0500595_024086_1304_2044 | 236 |
| 172 | 3300053730 | Ga0500645_000471 | Ga0500645_000471_280_1026 | 236 |
| 173 | 3300005365 | Ga0070688_100364842 | Ga0070688_1003648421 | 237 |
| 174 | 3300021384 | Ga0213876_10137829 | Ga0213876_101378292 | 237 |
| 175 | 3300039437 | Ga0436365_0424475 | Ga0436365_0424475_259_996 | 237 |
| 176 | 3300039437 | Ga0436365_1126455 | Ga0436365_1126455_16698_17441 | 237 |
| 177 | 3300053119 | Ga0500595_049570 | Ga0500595_049570_298_1050 | 238 |
| 178 | 3300053131 | Ga0500652_000002 | Ga0500652_000002_21835_22587 | 238 |
| 179 | 3300053177 | Ga0500636_0010920 | Ga0500636_0010920_765_1517 | 238 |
| 180 | 3300005353 | Ga0070669_100099081 | Ga0070669_1000990812 | 239 |
| 181 | 3300026075 | Ga0207708_10152141 | Ga0207708_101521412 | 239 |
| 182 | 3300046454 | Ga0495592_0058494 | Ga0495592_0058494_203_973 | 239 |
| 183 | 3300046463 | Ga0495653_0095828 | Ga0495653_0095828_17_787 | 239 |
| 184 | 3300046514 | Ga0495618_0052847 | Ga0495618_0052847_1616_2386 | 239 |
| 185 | 3300046533 | Ga0495640_0036024 | Ga0495640_0036024_884_1654 | 239 |
| 186 | 3300046663 | Ga0495635_0033531 | Ga0495635_0033531_2152_2922 | 239 |
| 187 | 3300047315 | Ga0495581_0110979 | Ga0495581_0110979_403_1173 | 239 |
| 188 | 3300047319 | Ga0495674_0289962 | Ga0495674_0289962_131_901 | 239 |
| 189 | 3300047322 | Ga0495680_0015212 | Ga0495680_0015212_5766_6536 | 239 |
| 190 | 3300053077 | Ga0495601_0058505 | Ga0495601_0058505_945_1715 | 239 |
| 191 | 3300053078 | Ga0495612_0254303 | Ga0495612_0254303_38_766 | 239 |
| 192 | 3300053084 | Ga0495595_0003960 | Ga0495595_0003960_2906_3676 | 239 |
| 193 | 3300053085 | Ga0495619_0000707 | Ga0495619_0000707_11408_12178 | 239 |
| 194 | 3300014969 | Ga0157376_10166940 | Ga0157376_101669403 | 240 |
| 195 | 3300028556 | Ga0265337_1000937 | Ga0265337_10009379 | 240 |
| 196 | 3300042012 | Ga0439455_0020242 | Ga0439455_0020242_686_1408 | 240 |
| 197 | 3300048913 | Ga0496110_0158766 | Ga0496110_0158766_1316_2038 | 240 |
| 198 | 3300005338 | Ga0068868_100115640 | Ga0068868_1001156402 | 241 |
| 199 | 3300005353 | Ga0070669_100264788 | Ga0070669_1002647882 | 241 |
| 200 | 3300005618 | Ga0068864_100520985 | Ga0068864_1005209852 | 241 |
| 201 | 3300006177 | Ga0075362_10014468 | Ga0075362_100144682 | 241 |
| 202 | 3300006358 | Ga0068871_100105497 | Ga0068871_1001054972 | 241 |
| 203 | 3300009098 | Ga0105245_10003343 | Ga0105245_1000334311 | 241 |
| 204 | 3300009176 | Ga0105242_10077617 | Ga0105242_100776172 | 241 |
| 205 | 3300009177 | Ga0105248_10066436 | Ga0105248_100664362 | 241 |
| 206 | 3300009545 | Ga0105237_10154166 | Ga0105237_101541662 | 241 |
| 207 | 3300013297 | Ga0157378_10290854 | Ga0157378_102908542 | 241 |
| 208 | 3300025960 | Ga0207651_10530617 | Ga0207651_105306171 | 241 |
| 209 | 3300026095 | Ga0207676_10457777 | Ga0207676_104577772 | 241 |
| 210 | 3300031090 | Ga0265760_10043236 | Ga0265760_100432362 | 241 |
| 211 | 3300050489 | nmdc:mga03683_18329_c1 | nmdc:mga03683_18329_c1_323_1078 | 241 |
| 212 | 3300050493 | nmdc:mga0k408_131980_c1 | nmdc:mga0k408_131980_c1_658_1413 | 241 |
| 213 | 3300053085 | Ga0495619_0215861 | Ga0495619_0215861_203_967 | 241 |
| 214 | 3300003323 | rootH1_10324480 | rootH1_103244801 | 242 |
| 215 | 3300005364 | Ga0070673_100206286 | Ga0070673_1002062862 | 242 |
| 216 | 3300005543 | Ga0070672_100713150 | Ga0070672_1007131501 | 242 |
| 217 | 3300005547 | Ga0070693_100035126 | Ga0070693_1000351264 | 242 |
| 218 | 3300006038 | Ga0075365_10120226 | Ga0075365_101202262 | 242 |
| 219 | 3300006051 | Ga0075364_10070240 | Ga0075364_100702402 | 242 |
| 220 | 3300006178 | Ga0075367_10147873 | Ga0075367_101478731 | 242 |
| 221 | 3300006178 | Ga0075367_10263366 | Ga0075367_102633661 | 242 |
| 222 | 3300006186 | Ga0075369_10066929 | Ga0075369_100669292 | 242 |
| 223 | 3300006186 | Ga0075369_10117726 | Ga0075369_101177262 | 242 |
| 224 | 3300006195 | Ga0075366_10114831 | Ga0075366_101148312 | 242 |
| 225 | 3300006353 | Ga0075370_10182511 | Ga0075370_101825112 | 242 |
| 226 | 3300006358 | Ga0068871_100812145 | Ga0068871_1008121451 | 242 |
| 227 | 3300009176 | Ga0105242_10462440 | Ga0105242_104624402 | 242 |
| 228 | 3300017792 | Ga0163161_10179514 | Ga0163161_101795142 | 242 |
| 229 | 3300025937 | Ga0207669_10028895 | Ga0207669_100288953 | 242 |
| 230 | 3300025940 | Ga0207691_10105570 | Ga0207691_101055702 | 242 |
| 231 | 3300050491 | nmdc:mga00v17_96663_c1 | nmdc:mga00v17_96663_c1_441_1196 | 242 |
| 232 | 3300050493 | nmdc:mga0k408_158540_c1 | nmdc:mga0k408_158540_c1_276_1031 | 242 |
| 233 | 3300050494 | nmdc:mga06z11_174357_c1 | nmdc:mga06z11_174357_c1_324_1079 | 242 |
| 234 | 3300050495 | nmdc:mga04h51_60655_c1 | nmdc:mga04h51_60655_c1_519_1274 | 242 |
| 235 | 3300050496 | nmdc:mga07m45_112389_c1 | nmdc:mga07m45_112389_c1_258_1013 | 242 |
| 236 | 3300050513 | nmdc:mga0rr50_113698_c1 | nmdc:mga0rr50_113698_c1_26_754 | 242 |
| 237 | 3300050516 | nmdc:mga0sz30_60220_c1 | nmdc:mga0sz30_60220_c1_265_1020 | 242 |
| 238 | 3300005329 | Ga0070683_100047159 | Ga0070683_1000471593 | 243 |
| 239 | 3300005333 | Ga0070677_10086698 | Ga0070677_100866982 | 243 |
| 240 | 3300005334 | Ga0068869_100101106 | Ga0068869_1001011062 | 243 |
| 241 | 3300005337 | Ga0070682_100057115 | Ga0070682_1000571151 | 243 |
| 242 | 3300005340 | Ga0070689_100112675 | Ga0070689_1001126752 | 243 |
| 243 | 3300005343 | Ga0070687_100050516 | Ga0070687_1000505162 | 243 |
| 244 | 3300005354 | Ga0070675_100422799 | Ga0070675_1004227992 | 243 |
| 245 | 3300005356 | Ga0070674_100038354 | Ga0070674_1000383542 | 243 |
| 246 | 3300005367 | Ga0070667_100027988 | Ga0070667_1000279882 | 243 |
| 247 | 3300005435 | Ga0070714_100078722 | Ga0070714_1000787222 | 243 |
| 248 | 3300005436 | Ga0070713_100001020 | Ga0070713_1000010204 | 243 |
| 249 | 3300005437 | Ga0070710_10017282 | Ga0070710_100172822 | 243 |
| 250 | 3300005539 | Ga0068853_100334427 | Ga0068853_1003344272 | 243 |
| 251 | 3300005544 | Ga0070686_100021082 | Ga0070686_1000210822 | 243 |
| 252 | 3300005546 | Ga0070696_100239557 | Ga0070696_1002395572 | 243 |
| 253 | 3300005548 | Ga0070665_100158609 | Ga0070665_1001586092 | 243 |
| 254 | 3300005615 | Ga0070702_100048639 | Ga0070702_1000486392 | 243 |
| 255 | 3300005617 | Ga0068859_100042506 | Ga0068859_1000425064 | 243 |
| 256 | 3300005618 | Ga0068864_100116146 | Ga0068864_1001161462 | 243 |
| 257 | 3300005718 | Ga0068866_10155414 | Ga0068866_101554142 | 243 |
| 258 | 3300005844 | Ga0068862_100473164 | Ga0068862_1004731642 | 243 |
| 259 | 3300006028 | Ga0070717_10006020 | Ga0070717_100060204 | 243 |
| 260 | 3300006163 | Ga0070715_10004717 | Ga0070715_100047173 | 243 |
| 261 | 3300006173 | Ga0070716_100017238 | Ga0070716_1000172383 | 243 |
| 262 | 3300006237 | Ga0097621_100002278 | Ga0097621_10000227811 | 243 |
| 263 | 3300006358 | Ga0068871_100025855 | Ga0068871_1000258554 | 243 |
| 264 | 3300006871 | Ga0075434_100178933 | Ga0075434_1001789332 | 243 |
| 265 | 3300006881 | Ga0068865_100022649 | Ga0068865_1000226492 | 243 |
| 266 | 3300006914 | Ga0075436_100068342 | Ga0075436_1000683422 | 243 |
| 267 | 3300006931 | Ga0097620_100042507 | Ga0097620_1000425074 | 243 |
| 268 | 3300009094 | Ga0111539_10168453 | Ga0111539_101684532 | 243 |
| 269 | 3300009101 | Ga0105247_10113112 | Ga0105247_101131122 | 243 |
| 270 | 3300009174 | Ga0105241_10019317 | Ga0105241_100193174 | 243 |
| 271 | 3300009177 | Ga0105248_10213304 | Ga0105248_102133042 | 243 |
| 272 | 3300009545 | Ga0105237_10266351 | Ga0105237_102663511 | 243 |
| 273 | 3300009553 | Ga0105249_10344868 | Ga0105249_103448682 | 243 |
| 274 | 3300010375 | Ga0105239_10586786 | Ga0105239_105867861 | 243 |
| 275 | 3300013105 | Ga0157369_10591491 | Ga0157369_105914912 | 243 |
| 276 | 3300014969 | Ga0157376_10128068 | Ga0157376_101280682 | 243 |
| 277 | 3300014969 | Ga0157376_10267968 | Ga0157376_102679682 | 243 |
| 278 | 3300025735 | Ga0207713_1068350 | Ga0207713_10683502 | 243 |
| 279 | 3300025898 | Ga0207692_10067518 | Ga0207692_100675182 | 243 |
| 280 | 3300025899 | Ga0207642_10017392 | Ga0207642_100173922 | 243 |
| 281 | 3300025900 | Ga0207710_10013021 | Ga0207710_100130213 | 243 |
| 282 | 3300025903 | Ga0207680_10016525 | Ga0207680_100165252 | 243 |
| 283 | 3300025905 | Ga0207685_10015364 | Ga0207685_100153642 | 243 |
| 284 | 3300025906 | Ga0207699_10001538 | Ga0207699_100015386 | 243 |
| 285 | 3300025907 | Ga0207645_10047408 | Ga0207645_100474082 | 243 |
| 286 | 3300025914 | Ga0207671_10065883 | Ga0207671_100658832 | 243 |
| 287 | 3300025915 | Ga0207693_10074133 | Ga0207693_100741332 | 243 |
| 288 | 3300025918 | Ga0207662_10045199 | Ga0207662_100451992 | 243 |
| 289 | 3300025920 | Ga0207649_10011721 | Ga0207649_100117213 | 243 |
| 290 | 3300025924 | Ga0207694_10199604 | Ga0207694_101996042 | 243 |
| 291 | 3300025925 | Ga0207650_10105089 | Ga0207650_101050892 | 243 |
| 292 | 3300025927 | Ga0207687_10217098 | Ga0207687_102170982 | 243 |
| 293 | 3300025928 | Ga0207700_10000483 | Ga0207700_1000048313 | 243 |
| 294 | 3300025929 | Ga0207664_10068274 | Ga0207664_100682742 | 243 |
| 295 | 3300025931 | Ga0207644_10009427 | Ga0207644_100094274 | 243 |
| 296 | 3300025936 | Ga0207670_10042965 | Ga0207670_100429652 | 243 |
| 297 | 3300025938 | Ga0207704_10080499 | Ga0207704_100804992 | 243 |
| 298 | 3300025939 | Ga0207665_10008168 | Ga0207665_100081684 | 243 |
| 299 | 3300025942 | Ga0207689_10248997 | Ga0207689_102489972 | 243 |
| 300 | 3300025960 | Ga0207651_10010467 | Ga0207651_100104672 | 243 |
| 301 | 3300025961 | Ga0207712_10112192 | Ga0207712_101121922 | 243 |
| 302 | 3300026023 | Ga0207677_10048287 | Ga0207677_100482872 | 243 |
| 303 | 3300026035 | Ga0207703_10024255 | Ga0207703_100242552 | 243 |
| 304 | 3300026067 | Ga0207678_10068972 | Ga0207678_100689721 | 243 |
| 305 | 3300026089 | Ga0207648_10186273 | Ga0207648_101862732 | 243 |
| 306 | 3300026095 | Ga0207676_10079802 | Ga0207676_100798022 | 243 |
| 307 | 3300026121 | Ga0207683_10002446 | Ga0207683_1000244611 | 243 |
| 308 | 3300028379 | Ga0268266_10005646 | Ga0268266_100056467 | 243 |
| 309 | 3300031241 | Ga0265325_10030064 | Ga0265325_100300642 | 243 |
| 310 | 3300031711 | Ga0265314_10014070 | Ga0265314_100140704 | 243 |
| 311 | 3300034819 | Ga0373958_0002537 | Ga0373958_0002537_139_897 | 243 |
| 312 | 3300034820 | Ga0373959_0005961 | Ga0373959_0005961_1220_1978 | 243 |
| 313 | 3300035084 | Ga0373928_0005103 | Ga0373928_0005103_1616_2374 | 243 |
| 314 | 3300035088 | Ga0373940_0041696 | Ga0373940_0041696_287_1045 | 243 |
| 315 | 3300035090 | Ga0373949_0003504 | Ga0373949_0003504_1329_2087 | 243 |
| 316 | 3300035091 | Ga0373951_0003118 | Ga0373951_0003118_3014_3772 | 243 |
| 317 | 3300035092 | Ga0373952_0010252 | Ga0373952_0010252_490_1248 | 243 |
| 318 | 3300035112 | Ga0373932_0002415 | Ga0373932_0002415_1573_2331 | 243 |
| 319 | 3300035115 | Ga0373941_0001742 | Ga0373941_0001742_1932_2690 | 243 |
| 320 | 3300035116 | Ga0373945_0014877 | Ga0373945_0014877_1231_1989 | 243 |
| 321 | 3300035121 | Ga0373960_0002782 | Ga0373960_0002782_1682_2440 | 243 |
| 322 | 3300035170 | Ga0373943_0050747 | Ga0373943_0050747_253_1011 | 243 |
| 323 | 3300035241 | Ga0373961_0020865 | Ga0373961_0020865_755_1513 | 243 |
| 324 | 3300035242 | Ga0373962_0002001 | Ga0373962_0002001_2388_3146 | 243 |
| 325 | 3300035691 | Ga0373931_0014732 | Ga0373931_0014732_1860_2618 | 243 |
| 326 | 3300035692 | Ga0373935_0000897 | Ga0373935_0000897_5205_5963 | 243 |
| 327 | 3300035725 | Ga0373947_0001129 | Ga0373947_0001129_11399_12157 | 243 |
| 328 | 3300037068 | Ga0373925_0006292 | Ga0373925_0006292_4355_5113 | 243 |
| 329 | 3300046455 | Ga0495603_0036699 | Ga0495603_0036699_1155_1913 | 243 |
| 330 | 3300046459 | Ga0495629_0000623 | Ga0495629_0000623_11403_12161 | 243 |
| 331 | 3300046473 | Ga0495582_0001248 | Ga0495582_0001248_7883_8641 | 243 |
| 332 | 3300046499 | Ga0495594_0026013 | Ga0495594_0026013_794_1552 | 243 |
| 333 | 3300046681 | Ga0495647_0000627 | Ga0495647_0000627_3317_4075 | 243 |
| 334 | 3300046683 | Ga0495658_0001220 | Ga0495658_0001220_1313_2071 | 243 |
| 335 | 3300046689 | Ga0495613_0003128 | Ga0495613_0003128_8159_8917 | 243 |
| 336 | 3300047321 | Ga0495676_0021468 | Ga0495676_0021468_1249_2007 | 243 |
| 337 | 3300047322 | Ga0495680_0005826 | Ga0495680_0005826_9033_9791 | 243 |
| 338 | 3300047673 | Ga0495593_0014060 | Ga0495593_0014060_2787_3545 | 243 |
| 339 | 3300048904 | Ga0496101_0003943 | Ga0496101_0003943_70_828 | 243 |
| 340 | 3300048906 | Ga0496103_0020156 | Ga0496103_0020156_3048_3806 | 243 |
| 341 | 3300048910 | Ga0496107_0104313 | Ga0496107_0104313_689_1447 | 243 |
| 342 | 3300048911 | Ga0496108_0005981 | Ga0496108_0005981_8323_9081 | 243 |
| 343 | 3300048912 | Ga0496109_0074590 | Ga0496109_0074590_777_1535 | 243 |
| 344 | 3300048912 | Ga0496109_0275774 | Ga0496109_0275774_41_799 | 243 |
| 345 | 3300048913 | Ga0496110_0049746 | Ga0496110_0049746_1681_2439 | 243 |
| 346 | 3300048914 | Ga0496111_0147341 | Ga0496111_0147341_777_1535 | 243 |
| 347 | 3300048915 | Ga0496112_0118981 | Ga0496112_0118981_198_956 | 243 |
| 348 | 3300048916 | Ga0496113_0003365 | Ga0496113_0003365_8013_8771 | 243 |
| 349 | 3300048916 | Ga0496113_0378290 | Ga0496113_0378290_251_1009 | 243 |
| 350 | 3300048918 | Ga0496115_0031240 | Ga0496115_0031240_2681_3439 | 243 |
| 351 | 3300048918 | Ga0496115_0073726 | Ga0496115_0073726_1936_2697 | 243 |
| 352 | 3300048918 | Ga0496115_0304453 | Ga0496115_0304453_198_956 | 243 |
| 353 | 3300050513 | nmdc:mga0rr50_24541_c1 | nmdc:mga0rr50_24541_c1_1017_1775 | 243 |
| 354 | 3300053085 | Ga0495619_0000922 | Ga0495619_0000922_4600_5358 | 243 |
| 355 | 3300009094 | Ga0111539_10063506 | Ga0111539_100635064 | 244 |
| 356 | 3300012488 | Ga0157343_1003637 | Ga0157343_10036371 | 244 |
| 357 | 3300031241 | Ga0265325_10000784 | Ga0265325_100007843 | 244 |
| 358 | 3300035692 | Ga0373935_0062315 | Ga0373935_0062315_231_989 | 244 |
| 359 | 3300037068 | Ga0373925_0114283 | Ga0373925_0114283_528_1286 | 244 |
| 360 | 3300046516 | Ga0495628_0120945 | Ga0495628_0120945_1135_1893 | 244 |
| 361 | 3300047319 | Ga0495674_0130894 | Ga0495674_0130894_936_1709 | 244 |
| 362 | 3300047322 | Ga0495680_0097548 | Ga0495680_0097548_1263_2039 | 244 |
| 363 | 3300048088 | Ga0495602_0286556 | Ga0495602_0286556_131_907 | 244 |
| 364 | 3300049585 | Ga0501069_0109843 | Ga0501069_0109843_518_1282 | 244 |
| 365 | 3300049588 | Ga0501072_0549467 | Ga0501072_0549467_131_877 | 244 |
| 366 | 3300049742 | Ga0501080_0158733 | Ga0501080_0158733_917_1681 | 244 |
| 367 | 3300050511 | nmdc:mga08y16_238729_c1 | nmdc:mga08y16_238729_c1_103_858 | 244 |
| 368 | 3300053077 | Ga0495601_0010986 | Ga0495601_0010986_1962_2738 | 244 |
| 369 | 3300053084 | Ga0495595_0008703 | Ga0495595_0008703_1083_1859 | 244 |
| 370 | 3300054114 | Ga0501084_0173493 | Ga0501084_0173493_1010_1774 | 244 |
| 371 | 3300060353 | Ga0501082_0109193 | Ga0501082_0109193_752_1516 | 244 |
| 372 | 3300009147 | Ga0114129_10653320 | Ga0114129_106533202 | 245 |
| 373 | 3300005983 | Ga0081540_1000114 | Ga0081540_100011463 | 246 |
| 374 | 3300012481 | Ga0157320_1004294 | Ga0157320_10042942 | 246 |
| 375 | 3300005327 | Ga0070658_10056638 | Ga0070658_100566383 | 247 |
| 376 | 3300005344 | Ga0070661_100551002 | Ga0070661_1005510021 | 247 |
| 377 | 3300005435 | Ga0070714_100029189 | Ga0070714_1000291892 | 247 |
| 378 | 3300005530 | Ga0070679_100123233 | Ga0070679_1001232332 | 247 |
| 379 | 3300005563 | Ga0068855_100005101 | Ga0068855_1000051015 | 247 |
| 380 | 3300005616 | Ga0068852_100004760 | Ga0068852_1000047606 | 247 |
| 381 | 3300005616 | Ga0068852_100312574 | Ga0068852_1003125742 | 247 |
| 382 | 3300006846 | Ga0075430_100297637 | Ga0075430_1002976372 | 247 |
| 383 | 3300006847 | Ga0075431_100215392 | Ga0075431_1002153922 | 247 |
| 384 | 3300009551 | Ga0105238_10010848 | Ga0105238_100108488 | 247 |
| 385 | 3300010375 | Ga0105239_10390745 | Ga0105239_103907452 | 247 |
| 386 | 3300025909 | Ga0207705_10006843 | Ga0207705_100068432 | 247 |
| 387 | 3300025921 | Ga0207652_10280435 | Ga0207652_102804352 | 247 |
| 388 | 3300025924 | Ga0207694_10633551 | Ga0207694_106335511 | 247 |
| 389 | 3300025949 | Ga0207667_10105691 | Ga0207667_101056912 | 247 |
| 390 | 3300026078 | Ga0207702_10036008 | Ga0207702_100360083 | 247 |
| 391 | 3300026142 | Ga0207698_10006673 | Ga0207698_100066734 | 247 |
| 392 | 3300028800 | Ga0265338_10365706 | Ga0265338_103657062 | 247 |
| 393 | 3300031711 | Ga0265314_10002142 | Ga0265314_100021428 | 247 |
| 394 | 3300049571 | Ga0501034_0070300 | Ga0501034_0070300_2737_3486 | 247 |
| 395 | 3300049583 | Ga0501067_0018478 | Ga0501067_0018478_120_869 | 247 |
| 396 | 3300049584 | Ga0501068_0047044 | Ga0501068_0047044_163_912 | 247 |
| 397 | 3300049586 | Ga0501070_0060309 | Ga0501070_0060309_1600_2349 | 247 |
| 398 | 3300049589 | Ga0501073_0034211 | Ga0501073_0034211_1953_2702 | 247 |
| 399 | 3300049590 | Ga0501074_0071216 | Ga0501074_0071216_965_1714 | 247 |
| 400 | 3300049742 | Ga0501080_0041456 | Ga0501080_0041456_3373_4122 | 247 |
| 401 | 3300049743 | Ga0501081_0316911 | Ga0501081_0316911_270_1052 | 247 |
| 402 | 3300049823 | Ga0501044_0510609 | Ga0501044_0510609_221_970 | 247 |
| 403 | 3300050510 | nmdc:mga06r32_381242_c1 | nmdc:mga06r32_381242_c1_87_848 | 247 |
| 404 | 3300053088 | Ga0500644_0138993 | Ga0500644_0138993_56_802 | 247 |
| 405 | 3300053093 | Ga0500651_0019363 | Ga0500651_0019363_2122_2868 | 247 |
| 406 | 3300025909 | Ga0207705_10185904 | Ga0207705_101859042 | 248 |
| 407 | 3300031235 | Ga0265330_10025586 | Ga0265330_100255862 | 248 |
| 408 | 3300031241 | Ga0265325_10009965 | Ga0265325_100099653 | 248 |
| 409 | 3300028800 | Ga0265338_10240698 | Ga0265338_102406982 | 249 |
| 410 | 3300035111 | Ga0373923_0106203 | Ga0373923_0106203_177_935 | 249 |
| 411 | 3300035118 | Ga0373954_0064487 | Ga0373954_0064487_439_1197 | 249 |
| 412 | 3300035120 | Ga0373957_0011276 | Ga0373957_0011276_787_1545 | 249 |
| 413 | 3300035172 | Ga0373955_0002236 | Ga0373955_0002236_6581_7339 | 249 |
| 414 | 3300035724 | Ga0373933_0007148 | Ga0373933_0007148_3293_4051 | 249 |
| 415 | 3300036401 | Ga0373937_0004652 | Ga0373937_0004652_1744_2502 | 249 |
| 416 | 3300044842 | Ga0466957_0371852 | Ga0466957_0371852_86_838 | 249 |
| 417 | 3300046675 | Ga0495657_0005731 | Ga0495657_0005731_2086_2844 | 249 |
| 418 | 3300046679 | Ga0495623_0169123 | Ga0495623_0169123_132_890 | 249 |
| 419 | 3300046809 | Ga0495600_0241385 | Ga0495600_0241385_344_1102 | 249 |
| 420 | 3300047322 | Ga0495680_0104727 | Ga0495680_0104727_346_1104 | 249 |
| 421 | 3300047444 | Ga0495675_0007872 | Ga0495675_0007872_3408_4166 | 249 |
| 422 | 3300048088 | Ga0495602_0028839 | Ga0495602_0028839_2784_3542 | 249 |
| 423 | 3300053085 | Ga0495619_0027485 | Ga0495619_0027485_412_1170 | 249 |
| 424 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_36389_37141 | 249 |
| 425 | iso_pu_bacteria | 2643221547 | 2643756410 | 249 |
| 426 | 3300031238 | Ga0265332_10047640 | Ga0265332_100476401 | 250 |
| 427 | 3300044684 | Ga0466966_0031357 | Ga0466966_0031357_2408_3166 | 250 |
| 428 | 3300044694 | Ga0466963_0080913 | Ga0466963_0080913_144_902 | 250 |
| 429 | 3300044842 | Ga0466957_0016973 | Ga0466957_0016973_3403_4161 | 250 |
| 430 | 3300045836 | Ga0466958_0262076 | Ga0466958_0262076_128_886 | 250 |
| 431 | 3300048916 | Ga0496113_0090608 | Ga0496113_0090608_39_839 | 250 |
| 432 | 3300005327 | Ga0070658_10037002 | Ga0070658_100370022 | 251 |
| 433 | 3300005327 | Ga0070658_10039186 | Ga0070658_100391862 | 251 |
| 434 | 3300005336 | Ga0070680_100086093 | Ga0070680_1000860932 | 251 |
| 435 | 3300005336 | Ga0070680_100200471 | Ga0070680_1002004711 | 251 |
| 436 | 3300005339 | Ga0070660_100082441 | Ga0070660_1000824412 | 251 |
| 437 | 3300005344 | Ga0070661_100081585 | Ga0070661_1000815851 | 251 |
| 438 | 3300005366 | Ga0070659_100092725 | Ga0070659_1000927252 | 251 |
| 439 | 3300005436 | Ga0070713_100087894 | Ga0070713_1000878942 | 251 |
| 440 | 3300005458 | Ga0070681_10061531 | Ga0070681_100615312 | 251 |
| 441 | 3300005458 | Ga0070681_10125469 | Ga0070681_101254692 | 251 |
| 442 | 3300005530 | Ga0070679_100229224 | Ga0070679_1002292242 | 251 |
| 443 | 3300005578 | Ga0068854_100051701 | Ga0068854_1000517012 | 251 |
| 444 | 3300009093 | Ga0105240_10056461 | Ga0105240_100564612 | 251 |
| 445 | 3300013104 | Ga0157370_10697532 | Ga0157370_106975321 | 251 |
| 446 | 3300013105 | Ga0157369_10463740 | Ga0157369_104637402 | 251 |
| 447 | 3300025909 | Ga0207705_10046225 | Ga0207705_100462252 | 251 |
| 448 | 3300025912 | Ga0207707_10198955 | Ga0207707_101989552 | 251 |
| 449 | 3300025913 | Ga0207695_10182232 | Ga0207695_101822322 | 251 |
| 450 | 3300025917 | Ga0207660_10141067 | Ga0207660_101410672 | 251 |
| 451 | 3300025917 | Ga0207660_10175361 | Ga0207660_101753611 | 251 |
| 452 | 3300025919 | Ga0207657_10061957 | Ga0207657_100619572 | 251 |
| 453 | 3300025919 | Ga0207657_10199783 | Ga0207657_101997832 | 251 |
| 454 | 3300025920 | Ga0207649_10112044 | Ga0207649_101120442 | 251 |
| 455 | 3300025921 | Ga0207652_10071665 | Ga0207652_100716652 | 251 |
| 456 | 3300025921 | Ga0207652_10115315 | Ga0207652_101153152 | 251 |
| 457 | 3300025932 | Ga0207690_10112467 | Ga0207690_101124672 | 251 |
| 458 | 3300025949 | Ga0207667_10554517 | Ga0207667_105545172 | 251 |
| 459 | 3300025981 | Ga0207640_10115794 | Ga0207640_101157942 | 251 |
| 460 | 3300026142 | Ga0207698_10325949 | Ga0207698_103259492 | 251 |
| 461 | 3300028800 | Ga0265338_10126321 | Ga0265338_101263212 | 251 |
| 462 | 3300031235 | Ga0265330_10008372 | Ga0265330_100083724 | 251 |
| 463 | 3300031241 | Ga0265325_10034777 | Ga0265325_100347772 | 251 |
| 464 | 3300031247 | Ga0265340_10083718 | Ga0265340_100837182 | 251 |
| 465 | 3300031595 | Ga0265313_10065540 | Ga0265313_100655402 | 251 |
| 466 | 3300031712 | Ga0265342_10000540 | Ga0265342_100005408 | 251 |
| 467 | 3300035086 | Ga0373934_0065203 | Ga0373934_0065203_15_815 | 251 |
| 468 | 3300035725 | Ga0373947_0012771 | Ga0373947_0012771_3737_4525 | 251 |
| 469 | 3300036401 | Ga0373937_0001244 | Ga0373937_0001244_16144_16944 | 251 |
| 470 | 3300049581 | Ga0501047_0020439 | Ga0501047_0020439_406_1176 | 251 |
| 471 | 3300005336 | Ga0070680_100345922 | Ga0070680_1003459221 | 252 |
| 472 | 3300005530 | Ga0070679_100090574 | Ga0070679_1000905743 | 252 |
| 473 | 3300009098 | Ga0105245_10504908 | Ga0105245_105049082 | 252 |
| 474 | 3300010375 | Ga0105239_10877507 | Ga0105239_108775072 | 252 |
| 475 | 3300013104 | Ga0157370_10026836 | Ga0157370_100268364 | 252 |
| 476 | 3300013306 | Ga0163162_10877134 | Ga0163162_108771341 | 252 |
| 477 | 3300025261 | Ga0209233_1008155 | Ga0209233_10081551 | 252 |
| 478 | 3300025921 | Ga0207652_10141699 | Ga0207652_101416992 | 252 |
| 479 | 3300035116 | Ga0373945_0003277 | Ga0373945_0003277_1018_1776 | 252 |
| 480 | 3300035170 | Ga0373943_0063797 | Ga0373943_0063797_145_915 | 252 |
| 481 | 3300035171 | Ga0373946_0010755 | Ga0373946_0010755_1874_2632 | 252 |
| 482 | 3300035410 | Ga0373924_0010583 | Ga0373924_0010583_168_926 | 252 |
| 483 | 3300035692 | Ga0373935_0048846 | Ga0373935_0048846_968_1726 | 252 |
| 484 | 3300035695 | Ga0373927_0015353 | Ga0373927_0015353_2957_3715 | 252 |
| 485 | 3300035724 | Ga0373933_0017351 | Ga0373933_0017351_1683_2441 | 252 |
| 486 | 3300035725 | Ga0373947_0077964 | Ga0373947_0077964_798_1556 | 252 |
| 487 | 3300046452 | Ga0495617_036321 | Ga0495617_036321_684_1442 | 252 |
| 488 | 3300046454 | Ga0495592_0077746 | Ga0495592_0077746_998_1756 | 252 |
| 489 | 3300046459 | Ga0495629_0207783 | Ga0495629_0207783_220_978 | 252 |
| 490 | 3300046461 | Ga0495641_0012473 | Ga0495641_0012473_3478_4236 | 252 |
| 491 | 3300046462 | Ga0495651_0009844 | Ga0495651_0009844_857_1615 | 252 |
| 492 | 3300046463 | Ga0495653_0034032 | Ga0495653_0034032_79_837 | 252 |
| 493 | 3300046472 | Ga0495580_0004252 | Ga0495580_0004252_10718_11476 | 252 |
| 494 | 3300046476 | Ga0495662_0049431 | Ga0495662_0049431_1166_1924 | 252 |
| 495 | 3300046477 | Ga0495664_0026877 | Ga0495664_0026877_339_1097 | 252 |
| 496 | 3300046492 | Ga0495585_0001463 | Ga0495585_0001463_13755_14513 | 252 |
| 497 | 3300046499 | Ga0495594_0016246 | Ga0495594_0016246_2663_3421 | 252 |
| 498 | 3300046501 | Ga0495607_0002688 | Ga0495607_0002688_2458_3216 | 252 |
| 499 | 3300046511 | Ga0495608_0129848 | Ga0495608_0129848_278_1036 | 252 |
| 500 | 3300046514 | Ga0495618_0277276 | Ga0495618_0277276_183_941 | 252 |
| 501 | 3300046516 | Ga0495628_0132535 | Ga0495628_0132535_51_809 | 252 |
| 502 | 3300046517 | Ga0495630_0137271 | Ga0495630_0137271_351_1109 | 252 |
| 503 | 3300046523 | Ga0495644_0001288 | Ga0495644_0001288_2162_2920 | 252 |
| 504 | 3300046529 | Ga0495652_0036124 | Ga0495652_0036124_3337_4095 | 252 |
| 505 | 3300046531 | Ga0495665_0008222 | Ga0495665_0008222_2050_2808 | 252 |
| 506 | 3300046533 | Ga0495640_0178891 | Ga0495640_0178891_489_1247 | 252 |
| 507 | 3300046535 | Ga0495586_0051009 | Ga0495586_0051009_1388_2146 | 252 |
| 508 | 3300046536 | Ga0495587_0015294 | Ga0495587_0015294_192_950 | 252 |
| 509 | 3300046538 | Ga0495609_0045650 | Ga0495609_0045650_908_1666 | 252 |
| 510 | 3300046543 | Ga0495645_0078198 | Ga0495645_0078198_380_1138 | 252 |
| 511 | 3300046557 | Ga0495622_0025955 | Ga0495622_0025955_1355_2113 | 252 |
| 512 | 3300046559 | Ga0495667_0004407 | Ga0495667_0004407_1632_2390 | 252 |
| 513 | 3300046615 | Ga0495656_0000284 | Ga0495656_0000284_10928_11686 | 252 |
| 514 | 3300046642 | Ga0495634_0213500 | Ga0495634_0213500_375_1133 | 252 |
| 515 | 3300046663 | Ga0495635_0003295 | Ga0495635_0003295_7336_8094 | 252 |
| 516 | 3300046674 | Ga0495588_0001863 | Ga0495588_0001863_5945_6703 | 252 |
| 517 | 3300046678 | Ga0495599_0042191 | Ga0495599_0042191_2060_2818 | 252 |
| 518 | 3300046680 | Ga0495646_0026179 | Ga0495646_0026179_2303_3061 | 252 |
| 519 | 3300046681 | Ga0495647_0006614 | Ga0495647_0006614_2715_3473 | 252 |
| 520 | 3300046683 | Ga0495658_0009067 | Ga0495658_0009067_694_1452 | 252 |
| 521 | 3300046689 | Ga0495613_0126155 | Ga0495613_0126155_562_1320 | 252 |
| 522 | 3300046690 | Ga0495624_0012794 | Ga0495624_0012794_4250_5008 | 252 |
| 523 | 3300046691 | Ga0495670_0000802 | Ga0495670_0000802_8109_8867 | 252 |
| 524 | 3300046809 | Ga0495600_0003569 | Ga0495600_0003569_632_1390 | 252 |
| 525 | 3300047315 | Ga0495581_0125955 | Ga0495581_0125955_628_1386 | 252 |
| 526 | 3300047317 | Ga0495604_0020267 | Ga0495604_0020267_2707_3465 | 252 |
| 527 | 3300047318 | Ga0495636_0087271 | Ga0495636_0087271_209_967 | 252 |
| 528 | 3300047319 | Ga0495674_0072398 | Ga0495674_0072398_365_1123 | 252 |
| 529 | 3300047322 | Ga0495680_0098868 | Ga0495680_0098868_220_978 | 252 |
| 530 | 3300047444 | Ga0495675_0138192 | Ga0495675_0138192_295_1053 | 252 |
| 531 | 3300047471 | Ga0495684_0002228 | Ga0495684_0002228_12272_13030 | 252 |
| 532 | 3300047673 | Ga0495593_0044745 | Ga0495593_0044745_488_1246 | 252 |
| 533 | 3300048089 | Ga0495614_0034725 | Ga0495614_0034725_196_954 | 252 |
| 534 | 3300049586 | Ga0501070_0339088 | Ga0501070_0339088_108_869 | 252 |
| 535 | 3300050513 | nmdc:mga0rr50_193053_c1 | nmdc:mga0rr50_193053_c1_170_928 | 252 |
| 536 | 3300053077 | Ga0495601_0169132 | Ga0495601_0169132_296_1054 | 252 |
| 537 | 3300053084 | Ga0495595_0016009 | Ga0495595_0016009_188_946 | 252 |
| 538 | 3300053085 | Ga0495619_0010208 | Ga0495619_0010208_2800_3558 | 252 |
| 539 | 2209111006 | 2214939630 | 2214002920 | 253 |
| 540 | 3300000042 | ARSoilYngRDRAFT_c00506 | ARSoilYngRDRAFT_005062 | 253 |
| 541 | 3300000043 | ARcpr5yngRDRAFT_c000242 | ARcpr5yngRDRAFT_0002424 | 253 |
| 542 | 3300000044 | ARSoilOldRDRAFT_c000121 | ARSoilOldRDRAFT_0001218 | 253 |
| 543 | 3300000652 | ARCol0yngRDRAFT_1000359 | ARCol0yngRDRAFT_10003592 | 253 |
| 544 | 3300001915 | JGI24741J21665_1007046 | JGI24741J21665_10070462 | 253 |
| 545 | 3300001976 | JGI24752J21851_1004877 | JGI24752J21851_10048772 | 253 |
| 546 | 3300001977 | JGI24746J21847_1000824 | JGI24746J21847_10008244 | 253 |
| 547 | 3300001978 | JGI24747J21853_1002656 | JGI24747J21853_10026562 | 253 |
| 548 | 3300001979 | JGI24740J21852_10051412 | JGI24740J21852_100514122 | 253 |
| 549 | 3300001989 | JGI24739J22299_10003155 | JGI24739J22299_100031554 | 253 |
| 550 | 3300001990 | JGI24737J22298_10001457 | JGI24737J22298_100014572 | 253 |
| 551 | 3300001990 | JGI24737J22298_10002963 | JGI24737J22298_100029632 | 253 |
| 552 | 3300001991 | JGI24743J22301_10012296 | JGI24743J22301_100122962 | 253 |
| 553 | 3300002070 | JGI24750J21931_1000375 | JGI24750J21931_10003754 | 253 |
| 554 | 3300002073 | JGI24745J21846_1000315 | JGI24745J21846_10003152 | 253 |
| 555 | 3300002074 | JGI24748J21848_1000231 | JGI24748J21848_10002313 | 253 |
| 556 | 3300002075 | JGI24738J21930_10000933 | JGI24738J21930_100009337 | 253 |
| 557 | 3300002076 | JGI24749J21850_1000549 | JGI24749J21850_10005493 | 253 |
| 558 | 3300002126 | JGI24035J26624_1001366 | JGI24035J26624_10013662 | 253 |
| 559 | 3300002155 | JGI24033J26618_1001139 | JGI24033J26618_10011392 | 253 |
| 560 | 3300002239 | JGI24034J26672_10000576 | JGI24034J26672_100005762 | 253 |
| 561 | 3300002244 | JGI24742J22300_10000159 | JGI24742J22300_100001594 | 253 |
| 562 | 3300002459 | JGI24751J29686_10003190 | JGI24751J29686_100031902 | 253 |
| 563 | 3300005277 | Ga0065716_1003273 | Ga0065716_10032731 | 253 |
| 564 | 3300005290 | Ga0065712_10004839 | Ga0065712_100048394 | 253 |
| 565 | 3300005290 | Ga0065712_10076519 | Ga0065712_100765192 | 253 |
| 566 | 3300005290 | Ga0065712_10089276 | Ga0065712_100892762 | 253 |
| 567 | 3300005293 | Ga0065715_10000997 | Ga0065715_100009979 | 253 |
| 568 | 3300005293 | Ga0065715_10089127 | Ga0065715_100891274 | 253 |
| 569 | 3300005293 | Ga0065715_10183953 | Ga0065715_101839532 | 253 |
| 570 | 3300005328 | Ga0070676_10000012 | Ga0070676_1000001231 | 253 |
| 571 | 3300005329 | Ga0070683_100000139 | Ga0070683_10000013934 | 253 |
| 572 | 3300005330 | Ga0070690_100000554 | Ga0070690_1000005544 | 253 |
| 573 | 3300005330 | Ga0070690_100079168 | Ga0070690_1000791682 | 253 |
| 574 | 3300005331 | Ga0070670_100012083 | Ga0070670_1000120831 | 253 |
| 575 | 3300005331 | Ga0070670_100166512 | Ga0070670_1001665122 | 253 |
| 576 | 3300005333 | Ga0070677_10001496 | Ga0070677_100014966 | 253 |
| 577 | 3300005334 | Ga0068869_100000347 | Ga0068869_1000003479 | 253 |
| 578 | 3300005334 | Ga0068869_100247517 | Ga0068869_1002475172 | 253 |
| 579 | 3300005335 | Ga0070666_10093332 | Ga0070666_100933322 | 253 |
| 580 | 3300005335 | Ga0070666_10205984 | Ga0070666_102059842 | 253 |
| 581 | 3300005336 | Ga0070680_100000179 | Ga0070680_10000017931 | 253 |
| 582 | 3300005336 | Ga0070680_100045857 | Ga0070680_1000458572 | 253 |
| 583 | 3300005337 | Ga0070682_100000565 | Ga0070682_1000005656 | 253 |
| 584 | 3300005337 | Ga0070682_100106109 | Ga0070682_1001061092 | 253 |
| 585 | 3300005338 | Ga0068868_100001066 | Ga0068868_1000010664 | 253 |
| 586 | 3300005339 | Ga0070660_100000267 | Ga0070660_1000002679 | 253 |
| 587 | 3300005339 | Ga0070660_100092461 | Ga0070660_1000924612 | 253 |
| 588 | 3300005340 | Ga0070689_100000190 | Ga0070689_10000019021 | 253 |
| 589 | 3300005340 | Ga0070689_100079239 | Ga0070689_1000792392 | 253 |
| 590 | 3300005341 | Ga0070691_10001105 | Ga0070691_100011056 | 253 |
| 591 | 3300005341 | Ga0070691_10066970 | Ga0070691_100669702 | 253 |
| 592 | 3300005343 | Ga0070687_100000182 | Ga0070687_1000001827 | 253 |
| 593 | 3300005343 | Ga0070687_100139978 | Ga0070687_1001399782 | 253 |
| 594 | 3300005344 | Ga0070661_100001231 | Ga0070661_1000012316 | 253 |
| 595 | 3300005345 | Ga0070692_10001438 | Ga0070692_100014382 | 253 |
| 596 | 3300005345 | Ga0070692_10017265 | Ga0070692_100172652 | 253 |
| 597 | 3300005347 | Ga0070668_100000597 | Ga0070668_10000059714 | 253 |
| 598 | 3300005347 | Ga0070668_100227205 | Ga0070668_1002272052 | 253 |
| 599 | 3300005353 | Ga0070669_100000409 | Ga0070669_10000040925 | 253 |
| 600 | 3300005353 | Ga0070669_100102528 | Ga0070669_1001025282 | 253 |
| 601 | 3300005354 | Ga0070675_100000593 | Ga0070675_1000005939 | 253 |
| 602 | 3300005354 | Ga0070675_100049525 | Ga0070675_1000495252 | 253 |
| 603 | 3300005355 | Ga0070671_100009041 | Ga0070671_1000090416 | 253 |
| 604 | 3300005356 | Ga0070674_100000084 | Ga0070674_10000008430 | 253 |
| 605 | 3300005356 | Ga0070674_100033759 | Ga0070674_1000337593 | 253 |
| 606 | 3300005364 | Ga0070673_100000041 | Ga0070673_10000004134 | 253 |
| 607 | 3300005365 | Ga0070688_100000320 | Ga0070688_10000032024 | 253 |
| 608 | 3300005365 | Ga0070688_100004329 | Ga0070688_1000043291 | 253 |
| 609 | 3300005366 | Ga0070659_100003151 | Ga0070659_1000031517 | 253 |
| 610 | 3300005366 | Ga0070659_100008866 | Ga0070659_1000088662 | 253 |
| 611 | 3300005367 | Ga0070667_100000365 | Ga0070667_10000036524 | 253 |
| 612 | 3300005367 | Ga0070667_100012887 | Ga0070667_1000128873 | 253 |
| 613 | 3300005406 | Ga0070703_10003890 | Ga0070703_100038902 | 253 |
| 614 | 3300005438 | Ga0070701_10000110 | Ga0070701_100001109 | 253 |
| 615 | 3300005438 | Ga0070701_10070064 | Ga0070701_100700642 | 253 |
| 616 | 3300005440 | Ga0070705_100000938 | Ga0070705_1000009389 | 253 |
| 617 | 3300005441 | Ga0070700_100001112 | Ga0070700_1000011125 | 253 |
| 618 | 3300005441 | Ga0070700_100001991 | Ga0070700_1000019912 | 253 |
| 619 | 3300005444 | Ga0070694_100000065 | Ga0070694_10000006527 | 253 |
| 620 | 3300005444 | Ga0070694_100174772 | Ga0070694_1001747722 | 253 |
| 621 | 3300005445 | Ga0070708_100128395 | Ga0070708_1001283952 | 253 |
| 622 | 3300005455 | Ga0070663_100000654 | Ga0070663_1000006545 | 253 |
| 623 | 3300005455 | Ga0070663_100266364 | Ga0070663_1002663642 | 253 |
| 624 | 3300005456 | Ga0070678_100000091 | Ga0070678_10000009125 | 253 |
| 625 | 3300005457 | Ga0070662_100000629 | Ga0070662_1000006294 | 253 |
| 626 | 3300005457 | Ga0070662_100058296 | Ga0070662_1000582962 | 253 |
| 627 | 3300005458 | Ga0070681_10014301 | Ga0070681_100143012 | 253 |
| 628 | 3300005458 | Ga0070681_10044378 | Ga0070681_100443782 | 253 |
| 629 | 3300005459 | Ga0068867_100002763 | Ga0068867_1000027633 | 253 |
| 630 | 3300005459 | Ga0068867_100105534 | Ga0068867_1001055342 | 253 |
| 631 | 3300005466 | Ga0070685_10002711 | Ga0070685_100027118 | 253 |
| 632 | 3300005466 | Ga0070685_10164459 | Ga0070685_101644592 | 253 |
| 633 | 3300005530 | Ga0070679_100003726 | Ga0070679_1000037265 | 253 |
| 634 | 3300005530 | Ga0070679_100101766 | Ga0070679_1001017662 | 253 |
| 635 | 3300005535 | Ga0070684_100000219 | Ga0070684_10000021925 | 253 |
| 636 | 3300005536 | Ga0070697_100121293 | Ga0070697_1001212932 | 253 |
| 637 | 3300005536 | Ga0070697_100263154 | Ga0070697_1002631542 | 253 |
| 638 | 3300005539 | Ga0068853_100040876 | Ga0068853_1000408762 | 253 |
| 639 | 3300005539 | Ga0068853_100152638 | Ga0068853_1001526382 | 253 |
| 640 | 3300005543 | Ga0070672_100000019 | Ga0070672_10000001934 | 253 |
| 641 | 3300005543 | Ga0070672_100117646 | Ga0070672_1001176462 | 253 |
| 642 | 3300005544 | Ga0070686_100000318 | Ga0070686_1000003189 | 253 |
| 643 | 3300005544 | Ga0070686_100007233 | Ga0070686_1000072334 | 253 |
| 644 | 3300005545 | Ga0070695_100001669 | Ga0070695_1000016699 | 253 |
| 645 | 3300005545 | Ga0070695_100005883 | Ga0070695_1000058835 | 253 |
| 646 | 3300005546 | Ga0070696_100001307 | Ga0070696_10000130713 | 253 |
| 647 | 3300005546 | Ga0070696_100039957 | Ga0070696_1000399572 | 253 |
| 648 | 3300005546 | Ga0070696_100224506 | Ga0070696_1002245062 | 253 |
| 649 | 3300005547 | Ga0070693_100000036 | Ga0070693_10000003615 | 253 |
| 650 | 3300005549 | Ga0070704_100002608 | Ga0070704_1000026087 | 253 |
| 651 | 3300005549 | Ga0070704_100051738 | Ga0070704_1000517382 | 253 |
| 652 | 3300005563 | Ga0068855_100001440 | Ga0068855_1000014406 | 253 |
| 653 | 3300005564 | Ga0070664_100000089 | Ga0070664_1000000898 | 253 |
| 654 | 3300005564 | Ga0070664_100045756 | Ga0070664_1000457562 | 253 |
| 655 | 3300005564 | Ga0070664_100211271 | Ga0070664_1002112712 | 253 |
| 656 | 3300005564 | Ga0070664_100393391 | Ga0070664_1003933912 | 253 |
| 657 | 3300005577 | Ga0068857_100027045 | Ga0068857_1000270452 | 253 |
| 658 | 3300005577 | Ga0068857_100233209 | Ga0068857_1002332092 | 253 |
| 659 | 3300005578 | Ga0068854_100000179 | Ga0068854_10000017916 | 253 |
| 660 | 3300005614 | Ga0068856_100000873 | Ga0068856_1000008732 | 253 |
| 661 | 3300005614 | Ga0068856_100228535 | Ga0068856_1002285352 | 253 |
| 662 | 3300005615 | Ga0070702_100000071 | Ga0070702_10000007113 | 253 |
| 663 | 3300005616 | Ga0068852_100019915 | Ga0068852_1000199153 | 253 |
| 664 | 3300005617 | Ga0068859_100006632 | Ga0068859_1000066323 | 253 |
| 665 | 3300005617 | Ga0068859_100348511 | Ga0068859_1003485112 | 253 |
| 666 | 3300005618 | Ga0068864_100000429 | Ga0068864_10000042912 | 253 |
| 667 | 3300005718 | Ga0068866_10000468 | Ga0068866_100004683 | 253 |
| 668 | 3300005719 | Ga0068861_100000169 | Ga0068861_10000016926 | 253 |
| 669 | 3300005719 | Ga0068861_100099866 | Ga0068861_1000998662 | 253 |
| 670 | 3300005840 | Ga0068870_10000339 | Ga0068870_100003394 | 253 |
| 671 | 3300005841 | Ga0068863_100000381 | Ga0068863_1000003819 | 253 |
| 672 | 3300005842 | Ga0068858_100009053 | Ga0068858_1000090532 | 253 |
| 673 | 3300005842 | Ga0068858_100026945 | Ga0068858_1000269453 | 253 |
| 674 | 3300005842 | Ga0068858_100297679 | Ga0068858_1002976792 | 253 |
| 675 | 3300005843 | Ga0068860_100000852 | Ga0068860_10000085232 | 253 |
| 676 | 3300005844 | Ga0068862_100003353 | Ga0068862_1000033538 | 253 |
| 677 | 3300006042 | Ga0075368_10032512 | Ga0075368_100325122 | 253 |
| 678 | 3300006058 | Ga0075432_10022645 | Ga0075432_100226452 | 253 |
| 679 | 3300006237 | Ga0097621_100000112 | Ga0097621_1000001128 | 253 |
| 680 | 3300006358 | Ga0068871_100000068 | Ga0068871_10000006832 | 253 |
| 681 | 3300006852 | Ga0075433_10001324 | Ga0075433_100013249 | 253 |
| 682 | 3300006852 | Ga0075433_10013574 | Ga0075433_100135742 | 253 |
| 683 | 3300006852 | Ga0075433_10292308 | Ga0075433_102923082 | 253 |
| 684 | 3300006871 | Ga0075434_100000614 | Ga0075434_10000061428 | 253 |
| 685 | 3300006871 | Ga0075434_100021261 | Ga0075434_1000212612 | 253 |
| 686 | 3300006881 | Ga0068865_100000294 | Ga0068865_10000029413 | 253 |
| 687 | 3300006931 | Ga0097620_100006632 | Ga0097620_1000066323 | 253 |
| 688 | 3300006931 | Ga0097620_100348512 | Ga0097620_1003485122 | 253 |
| 689 | 3300007076 | Ga0075435_100093500 | Ga0075435_1000935002 | 253 |
| 690 | 3300007076 | Ga0075435_100729284 | Ga0075435_1007292841 | 253 |
| 691 | 3300009011 | Ga0105251_10079195 | Ga0105251_100791952 | 253 |
| 692 | 3300009093 | Ga0105240_10055066 | Ga0105240_100550664 | 253 |
| 693 | 3300009094 | Ga0111539_10000082 | Ga0111539_1000008235 | 253 |
| 694 | 3300009094 | Ga0111539_10000804 | Ga0111539_1000080430 | 253 |
| 695 | 3300009094 | Ga0111539_10159604 | Ga0111539_101596042 | 253 |
| 696 | 3300009098 | Ga0105245_10000468 | Ga0105245_100004682 | 253 |
| 697 | 3300009101 | Ga0105247_10002855 | Ga0105247_100028552 | 253 |
| 698 | 3300009101 | Ga0105247_10063577 | Ga0105247_100635772 | 253 |
| 699 | 3300009147 | Ga0114129_10012592 | Ga0114129_100125922 | 253 |
| 700 | 3300009148 | Ga0105243_10003322 | Ga0105243_100033223 | 253 |
| 701 | 3300009148 | Ga0105243_10050863 | Ga0105243_100508632 | 253 |
| 702 | 3300009174 | Ga0105241_10000941 | Ga0105241_100009412 | 253 |
| 703 | 3300009174 | Ga0105241_10340805 | Ga0105241_103408052 | 253 |
| 704 | 3300009176 | Ga0105242_10000337 | Ga0105242_100003379 | 253 |
| 705 | 3300009177 | Ga0105248_10004009 | Ga0105248_1000400912 | 253 |
| 706 | 3300009177 | Ga0105248_10024723 | Ga0105248_100247235 | 253 |
| 707 | 3300009545 | Ga0105237_10039433 | Ga0105237_100394334 | 253 |
| 708 | 3300009545 | Ga0105237_10040862 | Ga0105237_100408623 | 253 |
| 709 | 3300009551 | Ga0105238_10092645 | Ga0105238_100926452 | 253 |
| 710 | 3300009553 | Ga0105249_10000755 | Ga0105249_1000075513 | 253 |
| 711 | 3300009553 | Ga0105249_10003637 | Ga0105249_100036378 | 253 |
| 712 | 3300010375 | Ga0105239_10001548 | Ga0105239_100015486 | 253 |
| 713 | 3300010375 | Ga0105239_10027538 | Ga0105239_100275383 | 253 |
| 714 | 3300011119 | Ga0105246_10000061 | Ga0105246_1000006124 | 253 |
| 715 | 3300013100 | Ga0157373_10017197 | Ga0157373_100171972 | 253 |
| 716 | 3300013102 | Ga0157371_10009867 | Ga0157371_100098674 | 253 |
| 717 | 3300013102 | Ga0157371_10328319 | Ga0157371_103283192 | 253 |
| 718 | 3300013296 | Ga0157374_10014373 | Ga0157374_100143732 | 253 |
| 719 | 3300013306 | Ga0163162_10001248 | Ga0163162_100012489 | 253 |
| 720 | 3300013306 | Ga0163162_10402102 | Ga0163162_104021022 | 253 |
| 721 | 3300013307 | Ga0157372_10475529 | Ga0157372_104755292 | 253 |
| 722 | 3300013308 | Ga0157375_10000468 | Ga0157375_100004683 | 253 |
| 723 | 3300013308 | Ga0157375_10248416 | Ga0157375_102484162 | 253 |
| 724 | 3300014325 | Ga0163163_10002620 | Ga0163163_100026204 | 253 |
| 725 | 3300014326 | Ga0157380_10001378 | Ga0157380_1000137813 | 253 |
| 726 | 3300014326 | Ga0157380_10471005 | Ga0157380_104710052 | 253 |
| 727 | 3300014497 | Ga0182008_10088887 | Ga0182008_100888871 | 253 |
| 728 | 3300014745 | Ga0157377_10000153 | Ga0157377_100001537 | 253 |
| 729 | 3300014968 | Ga0157379_10018260 | Ga0157379_100182602 | 253 |
| 730 | 3300014968 | Ga0157379_10149048 | Ga0157379_101490482 | 253 |
| 731 | 3300014969 | Ga0157376_10000226 | Ga0157376_1000022635 | 253 |
| 732 | 3300017792 | Ga0163161_10000384 | Ga0163161_1000038434 | 253 |
| 733 | 3300025271 | Ga0207666_1000025 | Ga0207666_100002524 | 253 |
| 734 | 3300025271 | Ga0207666_1001730 | Ga0207666_10017302 | 253 |
| 735 | 3300025290 | Ga0207673_1000816 | Ga0207673_10008163 | 253 |
| 736 | 3300025315 | Ga0207697_10000077 | Ga0207697_1000007710 | 253 |
| 737 | 3300025315 | Ga0207697_10020401 | Ga0207697_100204012 | 253 |
| 738 | 3300025885 | Ga0207653_10004641 | Ga0207653_100046414 | 253 |
| 739 | 3300025893 | Ga0207682_10000088 | Ga0207682_1000008835 | 253 |
| 740 | 3300025899 | Ga0207642_10000475 | Ga0207642_100004759 | 253 |
| 741 | 3300025900 | Ga0207710_10065231 | Ga0207710_100652312 | 253 |
| 742 | 3300025901 | Ga0207688_10000112 | Ga0207688_100001124 | 253 |
| 743 | 3300025903 | Ga0207680_10028241 | Ga0207680_100282413 | 253 |
| 744 | 3300025904 | Ga0207647_10014331 | Ga0207647_100143312 | 253 |
| 745 | 3300025904 | Ga0207647_10053338 | Ga0207647_100533382 | 253 |
| 746 | 3300025907 | Ga0207645_10000140 | Ga0207645_1000014025 | 253 |
| 747 | 3300025908 | Ga0207643_10000083 | Ga0207643_1000008325 | 253 |
| 748 | 3300025911 | Ga0207654_10001592 | Ga0207654_100015927 | 253 |
| 749 | 3300025911 | Ga0207654_10236154 | Ga0207654_102361541 | 253 |
| 750 | 3300025912 | Ga0207707_10032786 | Ga0207707_100327862 | 253 |
| 751 | 3300025913 | Ga0207695_10082733 | Ga0207695_100827332 | 253 |
| 752 | 3300025914 | Ga0207671_10388557 | Ga0207671_103885572 | 253 |
| 753 | 3300025917 | Ga0207660_10000545 | Ga0207660_100005453 | 253 |
| 754 | 3300025917 | Ga0207660_10264456 | Ga0207660_102644562 | 253 |
| 755 | 3300025918 | Ga0207662_10000210 | Ga0207662_100002109 | 253 |
| 756 | 3300025918 | Ga0207662_10041674 | Ga0207662_100416742 | 253 |
| 757 | 3300025919 | Ga0207657_10003507 | Ga0207657_100035073 | 253 |
| 758 | 3300025919 | Ga0207657_10043764 | Ga0207657_100437643 | 253 |
| 759 | 3300025920 | Ga0207649_10001961 | Ga0207649_100019616 | 253 |
| 760 | 3300025921 | Ga0207652_10016202 | Ga0207652_100162024 | 253 |
| 761 | 3300025921 | Ga0207652_10078106 | Ga0207652_100781062 | 253 |
| 762 | 3300025923 | Ga0207681_10000097 | Ga0207681_1000009753 | 253 |
| 763 | 3300025923 | Ga0207681_10036777 | Ga0207681_100367772 | 253 |
| 764 | 3300025925 | Ga0207650_10000946 | Ga0207650_100009467 | 253 |
| 765 | 3300025926 | Ga0207659_10000092 | Ga0207659_1000009225 | 253 |
| 766 | 3300025927 | Ga0207687_10000129 | Ga0207687_1000012917 | 253 |
| 767 | 3300025931 | Ga0207644_10056623 | Ga0207644_100566232 | 253 |
| 768 | 3300025932 | Ga0207690_10003841 | Ga0207690_100038413 | 253 |
| 769 | 3300025933 | Ga0207706_10001332 | Ga0207706_1000133224 | 253 |
| 770 | 3300025933 | Ga0207706_10088469 | Ga0207706_100884692 | 253 |
| 771 | 3300025934 | Ga0207686_10000635 | Ga0207686_100006357 | 253 |
| 772 | 3300025935 | Ga0207709_10000362 | Ga0207709_100003629 | 253 |
| 773 | 3300025935 | Ga0207709_10060714 | Ga0207709_100607142 | 253 |
| 774 | 3300025936 | Ga0207670_10000225 | Ga0207670_1000022523 | 253 |
| 775 | 3300025936 | Ga0207670_10340399 | Ga0207670_103403992 | 253 |
| 776 | 3300025937 | Ga0207669_10000043 | Ga0207669_1000004312 | 253 |
| 777 | 3300025938 | Ga0207704_10000602 | Ga0207704_1000060213 | 253 |
| 778 | 3300025938 | Ga0207704_10130649 | Ga0207704_101306492 | 253 |
| 779 | 3300025940 | Ga0207691_10000283 | Ga0207691_1000028325 | 253 |
| 780 | 3300025940 | Ga0207691_10135723 | Ga0207691_101357232 | 253 |
| 781 | 3300025941 | Ga0207711_10001023 | Ga0207711_1000102312 | 253 |
| 782 | 3300025941 | Ga0207711_10107998 | Ga0207711_101079982 | 253 |
| 783 | 3300025942 | Ga0207689_10001131 | Ga0207689_1000113110 | 253 |
| 784 | 3300025944 | Ga0207661_10000245 | Ga0207661_1000024529 | 253 |
| 785 | 3300025945 | Ga0207679_10000030 | Ga0207679_10000030132 | 253 |
| 786 | 3300025945 | Ga0207679_10032562 | Ga0207679_100325622 | 253 |
| 787 | 3300025945 | Ga0207679_10259408 | Ga0207679_102594082 | 253 |
| 788 | 3300025945 | Ga0207679_10405854 | Ga0207679_104058542 | 253 |
| 789 | 3300025949 | Ga0207667_10079278 | Ga0207667_100792782 | 253 |
| 790 | 3300025960 | Ga0207651_10000088 | Ga0207651_1000008816 | 253 |
| 791 | 3300025960 | Ga0207651_10502856 | Ga0207651_105028563 | 253 |
| 792 | 3300025961 | Ga0207712_10000924 | Ga0207712_1000092412 | 253 |
| 793 | 3300025961 | Ga0207712_10261854 | Ga0207712_102618542 | 253 |
| 794 | 3300025972 | Ga0207668_10000114 | Ga0207668_1000011425 | 253 |
| 795 | 3300025972 | Ga0207668_10072600 | Ga0207668_100726002 | 253 |
| 796 | 3300025981 | Ga0207640_10000616 | Ga0207640_100006165 | 253 |
| 797 | 3300025986 | Ga0207658_10004201 | Ga0207658_100042018 | 253 |
| 798 | 3300026023 | Ga0207677_10007396 | Ga0207677_100073963 | 253 |
| 799 | 3300026035 | Ga0207703_10006170 | Ga0207703_100061702 | 253 |
| 800 | 3300026035 | Ga0207703_10030929 | Ga0207703_100309292 | 253 |
| 801 | 3300026041 | Ga0207639_10001529 | Ga0207639_100015292 | 253 |
| 802 | 3300026041 | Ga0207639_10091275 | Ga0207639_100912752 | 253 |
| 803 | 3300026067 | Ga0207678_10000125 | Ga0207678_1000012532 | 253 |
| 804 | 3300026067 | Ga0207678_10132054 | Ga0207678_101320542 | 253 |
| 805 | 3300026075 | Ga0207708_10005075 | Ga0207708_100050758 | 253 |
| 806 | 3300026075 | Ga0207708_10005233 | Ga0207708_100052338 | 253 |
| 807 | 3300026078 | Ga0207702_10007265 | Ga0207702_100072653 | 253 |
| 808 | 3300026078 | Ga0207702_10407689 | Ga0207702_104076892 | 253 |
| 809 | 3300026088 | Ga0207641_10001951 | Ga0207641_100019513 | 253 |
| 810 | 3300026089 | Ga0207648_10002235 | Ga0207648_100022355 | 253 |
| 811 | 3300026089 | Ga0207648_10009401 | Ga0207648_100094015 | 253 |
| 812 | 3300026095 | Ga0207676_10000074 | Ga0207676_1000007434 | 253 |
| 813 | 3300026095 | Ga0207676_10202999 | Ga0207676_102029992 | 253 |
| 814 | 3300026116 | Ga0207674_10000750 | Ga0207674_1000075032 | 253 |
| 815 | 3300026116 | Ga0207674_10203427 | Ga0207674_102034272 | 253 |
| 816 | 3300026118 | Ga0207675_100001312 | Ga0207675_10000131224 | 253 |
| 817 | 3300026118 | Ga0207675_100102565 | Ga0207675_1001025652 | 253 |
| 818 | 3300026121 | Ga0207683_10000014 | Ga0207683_1000001426 | 253 |
| 819 | 3300026142 | Ga0207698_10022216 | Ga0207698_100222163 | 253 |
| 820 | 3300027252 | Ga0209973_1007128 | Ga0209973_10071282 | 253 |
| 821 | 3300027471 | Ga0209995_1022189 | Ga0209995_10221891 | 253 |
| 822 | 3300027617 | Ga0210002_1004043 | Ga0210002_10040432 | 253 |
| 823 | 3300027682 | Ga0209971_1013394 | Ga0209971_10133942 | 253 |
| 824 | 3300027682 | Ga0209971_1030169 | Ga0209971_10301692 | 253 |
| 825 | 3300027717 | Ga0209998_10000650 | Ga0209998_100006508 | 253 |
| 826 | 3300027866 | Ga0209813_10039518 | Ga0209813_100395182 | 253 |
| 827 | 3300027876 | Ga0209974_10006501 | Ga0209974_100065012 | 253 |
| 828 | 3300027876 | Ga0209974_10091760 | Ga0209974_100917601 | 253 |
| 829 | 3300027907 | Ga0207428_10000467 | Ga0207428_1000046714 | 253 |
| 830 | 3300027907 | Ga0207428_10004971 | Ga0207428_100049717 | 253 |
| 831 | 3300028380 | Ga0268265_10002706 | Ga0268265_100027064 | 253 |
| 832 | 3300028380 | Ga0268265_10128778 | Ga0268265_101287782 | 253 |
| 833 | 3300028381 | Ga0268264_10000469 | Ga0268264_1000046933 | 253 |
| 834 | 3300028381 | Ga0268264_10090183 | Ga0268264_100901832 | 253 |
| 835 | 3300031249 | Ga0265339_10034520 | Ga0265339_100345202 | 253 |
| 836 | 3300034816 | Ga0373930_0000284 | Ga0373930_0000284_4878_5639 | 253 |
| 837 | 3300034817 | Ga0373948_0000299 | Ga0373948_0000299_3437_4198 | 253 |
| 838 | 3300034818 | Ga0373950_0000315 | Ga0373950_0000315_1980_2741 | 253 |
| 839 | 3300034819 | Ga0373958_0000765 | Ga0373958_0000765_301_1062 | 253 |
| 840 | 3300034957 | Ga0373938_0000035 | Ga0373938_0000035_6556_7317 | 253 |
| 841 | 3300034957 | Ga0373938_0000130 | Ga0373938_0000130_2470_3231 | 253 |
| 842 | 3300035084 | Ga0373928_0000643 | Ga0373928_0000643_4152_4913 | 253 |
| 843 | 3300035085 | Ga0373929_0000258 | Ga0373929_0000258_5097_5858 | 253 |
| 844 | 3300035088 | Ga0373940_0004302 | Ga0373940_0004302_2134_2895 | 253 |
| 845 | 3300035088 | Ga0373940_0031357 | Ga0373940_0031357_385_1146 | 253 |
| 846 | 3300035090 | Ga0373949_0005632 | Ga0373949_0005632_1835_2596 | 253 |
| 847 | 3300035090 | Ga0373949_0006759 | Ga0373949_0006759_1403_2164 | 253 |
| 848 | 3300035091 | Ga0373951_0001386 | Ga0373951_0001386_5438_6199 | 253 |
| 849 | 3300035092 | Ga0373952_0000044 | Ga0373952_0000044_4270_5031 | 253 |
| 850 | 3300035092 | Ga0373952_0000416 | Ga0373952_0000416_1100_1861 | 253 |
| 851 | 3300035112 | Ga0373932_0002422 | Ga0373932_0002422_561_1322 | 253 |
| 852 | 3300035114 | Ga0373939_0001850 | Ga0373939_0001850_34_795 | 253 |
| 853 | 3300035114 | Ga0373939_0002508 | Ga0373939_0002508_1772_2533 | 253 |
| 854 | 3300035115 | Ga0373941_0000164 | Ga0373941_0000164_8582_9343 | 253 |
| 855 | 3300035115 | Ga0373941_0001372 | Ga0373941_0001372_706_1467 | 253 |
| 856 | 3300035121 | Ga0373960_0001732 | Ga0373960_0001732_3956_4717 | 253 |
| 857 | 3300035121 | Ga0373960_0046558 | Ga0373960_0046558_200_961 | 253 |
| 858 | 3300035207 | Ga0373942_0000113 | Ga0373942_0000113_11221_11982 | 253 |
| 859 | 3300035207 | Ga0373942_0003590 | Ga0373942_0003590_1313_2074 | 253 |
| 860 | 3300035241 | Ga0373961_0001463 | Ga0373961_0001463_3813_4574 | 253 |
| 861 | 3300035241 | Ga0373961_0002817 | Ga0373961_0002817_1826_2587 | 253 |
| 862 | 3300035242 | Ga0373962_0002732 | Ga0373962_0002732_3148_3909 | 253 |
| 863 | 3300035242 | Ga0373962_0005452 | Ga0373962_0005452_869_1630 | 253 |
| 864 | 3300035691 | Ga0373931_0000779 | Ga0373931_0000779_7411_8172 | 253 |
| 865 | 3300042016 | Ga0439463_009214 | Ga0439463_009214_1647_2408 | 253 |
| 866 | 3300042876 | Ga0451577_0117894 | Ga0451577_0117894_1207_1968 | 253 |
| 867 | 3300044712 | Ga0453684_0357785 | Ga0453684_0357785_61_822 | 253 |
| 868 | 3300045051 | Ga0451576_0031881 | Ga0451576_0031881_2472_3233 | 253 |
| 869 | 3300047445 | Ga0495677_0058412 | Ga0495677_0058412_361_1122 | 253 |
| 870 | 3300048903 | Ga0496100_0005311 | Ga0496100_0005311_1530_2291 | 253 |
| 871 | 3300048904 | Ga0496101_0000136 | Ga0496101_0000136_49018_49779 | 253 |
| 872 | 3300048904 | Ga0496101_0294970 | Ga0496101_0294970_254_1015 | 253 |
| 873 | 3300048905 | Ga0496102_0001166 | Ga0496102_0001166_1012_1773 | 253 |
| 874 | 3300048905 | Ga0496102_0134324 | Ga0496102_0134324_323_1084 | 253 |
| 875 | 3300048906 | Ga0496103_0000673 | Ga0496103_0000673_13627_14388 | 253 |
| 876 | 3300048906 | Ga0496103_0151943 | Ga0496103_0151943_702_1463 | 253 |
| 877 | 3300048907 | Ga0496104_0084700 | Ga0496104_0084700_1845_2606 | 253 |
| 878 | 3300048908 | Ga0496105_0307546 | Ga0496105_0307546_405_1166 | 253 |
| 879 | 3300048909 | Ga0496106_0000261 | Ga0496106_0000261_34696_35457 | 253 |
| 880 | 3300048910 | Ga0496107_0000146 | Ga0496107_0000146_26283_27044 | 253 |
| 881 | 3300048910 | Ga0496107_0037369 | Ga0496107_0037369_732_1493 | 253 |
| 882 | 3300048910 | Ga0496107_0050529 | Ga0496107_0050529_1151_1912 | 253 |
| 883 | 3300048911 | Ga0496108_0002272 | Ga0496108_0002272_13860_14621 | 253 |
| 884 | 3300048911 | Ga0496108_0022025 | Ga0496108_0022025_1442_2203 | 253 |
| 885 | 3300048912 | Ga0496109_0006684 | Ga0496109_0006684_1734_2495 | 253 |
| 886 | 3300048912 | Ga0496109_0031095 | Ga0496109_0031095_1192_1953 | 253 |
| 887 | 3300048912 | Ga0496109_0637340 | Ga0496109_0637340_82_843 | 253 |
| 888 | 3300048913 | Ga0496110_0042599 | Ga0496110_0042599_1235_1996 | 253 |
| 889 | 3300048913 | Ga0496110_0055079 | Ga0496110_0055079_2431_3192 | 253 |
| 890 | 3300048914 | Ga0496111_0007800 | Ga0496111_0007800_1557_2318 | 253 |
| 891 | 3300048914 | Ga0496111_0030574 | Ga0496111_0030574_2086_2847 | 253 |
| 892 | 3300048914 | Ga0496111_0060911 | Ga0496111_0060911_1864_2625 | 253 |
| 893 | 3300048915 | Ga0496112_0063888 | Ga0496112_0063888_1415_2176 | 253 |
| 894 | 3300048915 | Ga0496112_0087107 | Ga0496112_0087107_1219_1980 | 253 |
| 895 | 3300048916 | Ga0496113_0012040 | Ga0496113_0012040_1567_2328 | 253 |
| 896 | 3300048916 | Ga0496113_0061142 | Ga0496113_0061142_1156_1917 | 253 |
| 897 | 3300048917 | Ga0496114_0010754 | Ga0496114_0010754_2942_3703 | 253 |
| 898 | 3300050495 | nmdc:mga04h51_47241_c1 | nmdc:mga04h51_47241_c1_573_1334 | 253 |
| 899 | 3300050507 | nmdc:mga05p37_246885_c1 | nmdc:mga05p37_246885_c1_91_852 | 253 |
| 900 | 3300050511 | nmdc:mga08y16_249040_c1 | nmdc:mga08y16_249040_c1_450_1211 | 253 |
| 901 | 3300050511 | nmdc:mga08y16_6205_c1 | nmdc:mga08y16_6205_c1_3644_4405 | 253 |
| 902 | 3300050512 | nmdc:mga0n895_208_c1 | nmdc:mga0n895_208_c1_25810_26571 | 253 |
| 903 | 3300050512 | nmdc:mga0n895_212024_c1 | nmdc:mga0n895_212024_c1_452_1213 | 253 |
| 904 | 3300050512 | nmdc:mga0n895_60007_c1 | nmdc:mga0n895_60007_c1_2252_3013 | 253 |
| 905 | 3300050513 | nmdc:mga0rr50_19615_c1 | nmdc:mga0rr50_19615_c1_858_1619 | 253 |
| 906 | 3300050515 | nmdc:mga0a205_14931_c1 | nmdc:mga0a205_14931_c1_2406_3167 | 253 |
| 907 | 3300050515 | nmdc:mga0a205_176939_c1 | nmdc:mga0a205_176939_c1_179_940 | 253 |
| 908 | 3300050515 | nmdc:mga0a205_380_c1 | nmdc:mga0a205_380_c1_21405_22166 | 253 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar