F485354

General Info

Members Datasets Scaffolds Average Seq Length
907 596 1814 329

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10204791|Ga0157369_102047912
Length 345
Sequence MQLGMIGLGRMGGNIVRRLMRNGHSAVVYDKDTKAVAHLADDGATGAATLEDFVANLEKPRTAWVMLPAGAITEATIDSLSTLMAAGDVIIDGGNTFWQDDVRRGKALKQRGIHYLDVGTSGGVWGIERGYCMMIGGDKAVVDRLDPIFASLAPGAGDIPRTPGRDGRDRRVEQGYIHVGPSGAGHFVKMIHNGIEYGLMQAYAEGFDILKNANSEALPPAHRFDLDIADIAEVWRRGSVIPSWLLDLTATALAESPSLGSYSGYVEDSGEGRWTVNAAIDEAVPAEVLTAALFARFRSRKEHTFAEKILSAMRAGFGGHKEPKQHADPARQNAPDIVKPKAGRS

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
64 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
65 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
91 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
92 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
93 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
152 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
153 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
154 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
168 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
232 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
242 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
260 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
293 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
294 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
320 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
326 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
327 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
328 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
329 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
330 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
331 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
332 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
333 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
334 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
335 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
336 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
337 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
338 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
339 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
340 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
341 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
342 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
343 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
344 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
345 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
346 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
347 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
348 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
349 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
350 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
351 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
352 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
353 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
354 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
355 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
356 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
357 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
358 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
359 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
360 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
361 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
362 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
363 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
364 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
365 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
366 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
367 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
368 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
369 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
370 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
371 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
372 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
373 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
374 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
375 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
376 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
377 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
378 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
379 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
380 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
381 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
382 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
383 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
384 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
385 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
386 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
387 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
388 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
389 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
390 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
391 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
392 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
393 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
394 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
395 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
396 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
397 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
398 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
399 2791355199
400 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
401 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
402 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
403 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
404 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
405 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
406 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
407 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
408 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
409 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
410 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
411 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
412 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
413 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
414 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
415 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
416 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
417 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
418 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
419 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
420 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
421 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
422 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
423 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
424 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
425 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
426 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
427 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
428 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
429 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
430 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
431 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
432 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
433 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
434 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
435 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
436 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
437 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
438 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
439 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
440 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
441 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
442 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
443 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
444 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
445 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
446 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
447 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
448 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
449 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
450 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
451 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
452 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
453 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
454 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
455 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
456 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
457 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
458 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
459 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
460 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
461 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
462 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
463 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
464 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
465 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
466 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
467 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
468 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
469 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
470 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
471 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
472 2904699407
473 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
474 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
475 2906610324
476 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
477 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
478 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
479 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
480 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
481 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
482 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
483 2909042592 Labrys sp. LIt4 Isolate Nodule
484 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
485 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
486 2922368715
487 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
488 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
489 2922425934
490 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
491 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
492 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
493 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
494 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
495 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
496 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
497 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
498 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
499 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
500 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
501 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
502 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
503 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
504 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
505 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
506 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
507 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
508 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
509 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
510 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
511 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
512 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
513 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
514 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
515 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
516 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
517 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
518 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
519 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
520 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
521 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
522 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
523 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
524 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
525 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
526 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
527 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
528 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
529 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
530 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
531 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
532 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
533 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
534 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
535 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
536 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
537 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
538 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
539 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
540 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
541 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
542 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
543 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
544 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
545 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
546 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
547 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
548 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
549 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
550 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
551 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
552 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
553 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
554 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
555 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
556 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
557 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
558 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
559 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
560 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
561 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
562 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
563 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
564 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
565 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
566 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
567 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
568 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
569 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
570 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
571 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
572 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
573 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
574 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
575 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
576 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
577 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
578 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
579 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
580 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
581 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
582 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
583 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
584 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
585 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
586 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
587 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
588 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
589 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
590 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
591 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
592 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
593 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
594 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
595 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
596 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.39
Metatranscriptomes 0.44
Isolates 25.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.02
Nodule 19.63
Rhizoplane 5.84
Rhizosphere 48.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10204791 3300013105 Bacteria 2070
2 JGI24740J21852_10011824 3300001979 Bacteria 3313
3 JGI24739J22299_10023652 3300001989 Bacteria 2169
4 JGI24742J22300_10008188 3300002244 Bacteria 1725
5 JGI25406J46586_10000022 3300003203 Bacteria 79225
6 JGI25165J46597_1003828 3300003214 Bacteria 3510
7 JGI25153J46596_10001454 3300003215 Bacteria 14162
8 JGI25153J46596_10001564 3300003215 Bacteria 13564
9 JGI25153J46596_10008143 3300003215 Bacteria 5050
10 JGI25153J46596_10013778 3300003215 Bacteria 3399
11 JGI25160J50197_1001948 3300003354 Bacteria 9859
12 JGI25160J50197_1002073 3300003354 Bacteria 9535
13 Ga0055542_1006969 3300003762 Bacteria 2349
14 Ga0055543_1003371 3300004625 Bacteria 4754
15 Ga0065165_1002819 3300005262 Bacteria 13606
16 Ga0065165_1003488 3300005262 Bacteria 10971
17 Ga0070658_10044752 3300005327 Bacteria 3578
18 Ga0070683_100004963 3300005329 Bacteria 11039
19 Ga0068869_100065216 3300005334 Bacteria 2680
20 Ga0070680_100398098 3300005336 Bacteria 1174
21 Ga0070689_100116442 3300005340 Bacteria 2131
22 Ga0070661_100242023 3300005344 Bacteria 1390
23 Ga0070668_100027435 3300005347 Bacteria 4323
24 Ga0070668_100028726 3300005347 Bacteria 4220
25 Ga0070668_100057873 3300005347 Bacteria 2997
26 Ga0070671_100060952 3300005355 Bacteria 3141
27 Ga0070674_100012325 3300005356 Bacteria 5248
28 Ga0070659_100075552 3300005366 Bacteria 2685
29 Ga0070709_10029162 3300005434 Bacteria 3298
30 Ga0070709_10076607 3300005434 Bacteria 2173
31 Ga0070709_10315549 3300005434 Bacteria 1146
32 Ga0070714_100097186 3300005435 Bacteria 2588
33 Ga0070714_100152377 3300005435 Bacteria 2084
34 Ga0070714_100264686 3300005435 Bacteria 1593
35 Ga0070713_100026941 3300005436 Bacteria 4520
36 Ga0070713_100049385 3300005436 Bacteria 3471
37 Ga0070711_100091481 3300005439 Bacteria 2193
38 Ga0070663_100050883 3300005455 Bacteria 2948
39 Ga0070678_100142875 3300005456 Bacteria 1917
40 Ga0070662_100027572 3300005457 Bacteria 3944
41 Ga0070681_10021324 3300005458 Bacteria 6494
42 Ga0070681_10053789 3300005458 Bacteria 4011
43 Ga0070681_10130192 3300005458 Bacteria 2448
44 Ga0068867_100171057 3300005459 Bacteria 1721
45 Ga0068867_100228659 3300005459 Bacteria 1502
46 Ga0070679_100079408 3300005530 Bacteria 3270
47 Ga0070679_100080209 3300005530 Bacteria 3253
48 Ga0070684_100011638 3300005535 Bacteria 7012
49 Ga0070684_100014777 3300005535 Bacteria 6335
50 Ga0068853_100017008 3300005539 Bacteria 5996
51 Ga0068853_100076128 3300005539 Bacteria 2929
52 Ga0068853_100162753 3300005539 Bacteria 2014
53 Ga0068853_100307487 3300005539 Bacteria 1467
54 Ga0070672_100165636 3300005543 Bacteria 1836
55 Ga0070693_100026452 3300005547 Bacteria 3133
56 Ga0070665_100010187 3300005548 Bacteria 9509
57 Ga0070665_100064365 3300005548 Bacteria 3677
58 Ga0070665_100216224 3300005548 Bacteria 1917
59 Ga0068855_100008246 3300005563 Bacteria 12595
60 Ga0068855_100059481 3300005563 Bacteria 4470
61 Ga0068855_100088767 3300005563 Bacteria 3571
62 Ga0068855_100370138 3300005563 Bacteria 1575
63 Ga0068855_100452000 3300005563 Bacteria 1402
64 Ga0068857_100024972 3300005577 Bacteria 5263
65 Ga0068857_100029945 3300005577 Bacteria 4803
66 Ga0068856_100000283 3300005614 Bacteria 55412
67 Ga0068856_100028813 3300005614 Bacteria 5425
68 Ga0068856_100114951 3300005614 Bacteria 2690
69 Ga0068856_100117068 3300005614 Bacteria 2665
70 Ga0068856_100149840 3300005614 Bacteria 2341
71 Ga0070702_100037503 3300005615 Bacteria 2693
72 Ga0068852_100079551 3300005616 Bacteria 2904
73 Ga0068859_100343685 3300005617 Bacteria 1586
74 Ga0068864_100031589 3300005618 Bacteria 4494
75 Ga0068866_10026973 3300005718 Bacteria 2719
76 Ga0068861_100117105 3300005719 Bacteria 2143
77 Ga0068858_100022240 3300005842 Bacteria 5921
78 Ga0068858_100080410 3300005842 Bacteria 3028
79 Ga0068858_100142997 3300005842 Bacteria 2246
80 Ga0068858_100210130 3300005842 Bacteria 1842
81 Ga0068858_100260672 3300005842 Bacteria 1648
82 Ga0068862_100041511 3300005844 Bacteria 3914
83 Ga0081455_10002888 3300005937 Bacteria 20196
84 Ga0081455_10004399 3300005937 Bacteria 15836
85 Ga0081455_10007005 3300005937 Bacteria 11980
86 Ga0081455_10074356 3300005937 Bacteria 2807
87 Ga0081455_10078674 3300005937 Bacteria 2709
88 Ga0081455_10111119 3300005937 Bacteria 2178
89 Ga0081540_1003000 3300005983 Bacteria 13531
90 Ga0081540_1003629 3300005983 Bacteria 12111
91 Ga0081540_1007173 3300005983 Bacteria 7995
92 Ga0081540_1009827 3300005983 Bacteria 6544
93 Ga0081540_1012090 3300005983 Bacteria 5711
94 Ga0081540_1014256 3300005983 Bacteria 5105
95 Ga0081540_1022351 3300005983 Bacteria 3736
96 Ga0081540_1025904 3300005983 Bacteria 3362
97 Ga0081539_10000172 3300005985 Bacteria 151505
98 Ga0081539_10000945 3300005985 Bacteria 54444
99 Ga0081539_10032234 3300005985 Bacteria 3213
100 Ga0070717_10000427 3300006028 Bacteria 26764
101 Ga0070717_10102498 3300006028 Bacteria 2432
102 Ga0075365_10237375 3300006038 Bacteria 1280
103 Ga0075363_100008894 3300006048 Bacteria 4699
104 Ga0075363_100120647 3300006048 Bacteria 1464
105 Ga0075364_10032959 3300006051 Bacteria 3332
106 Ga0075362_10017732 3300006177 Bacteria 2936
107 Ga0075362_10043383 3300006177 Bacteria 1991
108 Ga0075367_10029842 3300006178 Bacteria 3122
109 Ga0075367_10086403 3300006178 Bacteria 1904
110 Ga0075367_10088329 3300006178 Bacteria 1883
111 Ga0075369_10003835 3300006186 Bacteria 5514
112 Ga0075369_10051807 3300006186 Bacteria 1778
113 Ga0097621_100046572 3300006237 Bacteria 3509
114 Ga0075370_10039585 3300006353 Bacteria 2656
115 Ga0075434_100027322 3300006871 Bacteria 5602
116 Ga0068865_100084561 3300006881 Bacteria 2286
117 Ga0097620_100343702 3300006931 Bacteria 1586
118 Ga0099825_1024216 3300006941 Bacteria 3589
119 Ga0099825_1025668 3300006941 Bacteria 3247
120 Ga0099824_1016130 3300006942 Bacteria 6857
121 Ga0099822_1000514 3300006943 Bacteria 36429
122 Ga0099795_10020867 3300007788 Bacteria 2140
123 Ga0105240_10003435 3300009093 Bacteria 24607
124 Ga0105240_10015251 3300009093 Bacteria 10455
125 Ga0105240_10017603 3300009093 Bacteria 9626
126 Ga0105240_10167781 3300009093 Bacteria 2602
127 Ga0105245_10009619 3300009098 Bacteria 8432
128 Ga0105245_10492378 3300009098 Bacteria 1241
129 Ga0114129_10038696 3300009147 Bacteria 6725
130 Ga0105241_10013109 3300009174 Bacteria 6081
131 Ga0105242_10024663 3300009176 Bacteria 4751
132 Ga0105248_10219291 3300009177 Bacteria 2142
133 Ga0105237_10017280 3300009545 Bacteria 7479
134 Ga0105237_10019317 3300009545 Bacteria 7039
135 Ga0105237_10150927 3300009545 Bacteria 2320
136 Ga0105238_10001149 3300009551 Bacteria 26729
137 Ga0105238_10016727 3300009551 Bacteria 7432
138 Ga0105238_10095140 3300009551 Bacteria 2966
139 Ga0105238_10141997 3300009551 Bacteria 2378
140 Ga0105249_10041943 3300009553 Bacteria 4161
141 Ga0105239_10018526 3300010375 Bacteria 7689
142 Ga0105239_10019617 3300010375 Bacteria 7463
143 Ga0105239_10140646 3300010375 Bacteria 2689
144 Ga0105239_10166049 3300010375 Bacteria 2468
145 Ga0105246_10278875 3300011119 Bacteria 1340
146 Ga0157373_10018145 3300013100 Bacteria 5125
147 Ga0157370_10137011 3300013104 Bacteria 2281
148 Ga0157369_10006777 3300013105 Bacteria 13217
149 Ga0157369_10014899 3300013105 Bacteria 8775
150 Ga0157369_10024164 3300013105 Bacteria 6764
151 Ga0157369_10097463 3300013105 Bacteria 3137
152 Ga0157374_10036449 3300013296 Bacteria 4505
153 Ga0157374_10468095 3300013296 Bacteria 1263
154 Ga0157378_10018610 3300013297 Bacteria 6107
155 Ga0157378_10181232 3300013297 Bacteria 1982
156 Ga0163162_10043115 3300013306 Bacteria 4517
157 Ga0157372_10135383 3300013307 Bacteria 2837
158 Ga0157372_10143294 3300013307 Bacteria 2755
159 Ga0157375_10077581 3300013308 Bacteria 3353
160 Ga0157375_10166451 3300013308 Bacteria 2349
161 Ga0157375_10195794 3300013308 Bacteria 2176
162 Ga0163163_10056442 3300014325 Bacteria 3881
163 Ga0157380_10146323 3300014326 Bacteria 2037
164 Ga0157377_10126075 3300014745 Bacteria 1558
165 Ga0157376_10018340 3300014969 Bacteria 5363
166 Ga0157376_10043678 3300014969 Bacteria 3679
167 Ga0206350_11261917 3300020080 Bacteria 3871
168 Ga0214544_1000001 3300021320 Bacteria 783667
169 Ga0214542_1000005 3300021321 Bacteria 389646
170 Ga0214545_1000003 3300021324 Bacteria 720274
171 Ga0214543_1000002 3300021327 Bacteria 712733
172 Ga0213872_10010126 3300021361 Bacteria 4498
173 Ga0213876_10076177 3300021384 Bacteria 1772
174 Ga0224712_10001877 3300022467 Bacteria 5050
175 Ga0224712_10003322 3300022467 Bacteria 4160
176 Ga0224712_10008463 3300022467 Bacteria 3052
177 Ga0209563_101843 3300025230 Bacteria 5190
178 Ga0209677_108556 3300025253 Bacteria 1967
179 Ga0209148_1000578 3300025254 Bacteria 33857
180 Ga0209233_1002657 3300025261 Bacteria 6475
181 Ga0209233_1016604 3300025261 Bacteria 2025
182 Ga0209455_1007252 3300025272 Bacteria 3155
183 Ga0209564_1005126 3300025295 Bacteria 7619
184 Ga0209564_1014441 3300025295 Bacteria 3285
185 Ga0209758_1000026 3300025297 Bacteria 582706
186 Ga0209758_1000479 3300025297 Bacteria 65956
187 Ga0209758_1001249 3300025297 Bacteria 31536
188 Ga0209758_1005605 3300025297 Bacteria 9546
189 Ga0209758_1006238 3300025297 Bacteria 8692
190 Ga0209758_1011503 3300025297 Bacteria 5113
191 Ga0207426_1000213 3300025302 Bacteria 137311
192 Ga0207426_1000740 3300025302 Bacteria 36958
193 Ga0207426_1001455 3300025302 Bacteria 19596
194 Ga0209257_1001980 3300025304 Bacteria 22014
195 Ga0209257_1013671 3300025304 Bacteria 3577
196 Ga0207656_10039899 3300025321 Bacteria 1988
197 Ga0207688_10048866 3300025901 Bacteria 2364
198 Ga0207647_10001122 3300025904 Bacteria 20595
199 Ga0207647_10001897 3300025904 Bacteria 16023
200 Ga0207699_10046298 3300025906 Bacteria 2543
201 Ga0207699_10056499 3300025906 Bacteria 2340
202 Ga0207699_10172008 3300025906 Bacteria 1450
203 Ga0207645_10054614 3300025907 Bacteria 2551
204 Ga0207654_10022698 3300025911 Bacteria 3352
205 Ga0207707_10001944 3300025912 Bacteria 18796
206 Ga0207707_10020074 3300025912 Bacteria 5831
207 Ga0207707_10022842 3300025912 Bacteria 5470
208 Ga0207707_10035036 3300025912 Bacteria 4390
209 Ga0207707_10129697 3300025912 Bacteria 2205
210 Ga0207695_10000006 3300025913 Bacteria 1135309
211 Ga0207695_10005212 3300025913 Bacteria 17381
212 Ga0207695_10073690 3300025913 Bacteria 3478
213 Ga0207695_10120135 3300025913 Bacteria 2597
214 Ga0207671_10000774 3300025914 Bacteria 40531
215 Ga0207671_10024275 3300025914 Bacteria 4562
216 Ga0207671_10035025 3300025914 Bacteria 3728
217 Ga0207693_10004594 3300025915 Bacteria 11648
218 Ga0207693_10043388 3300025915 Bacteria 3539
219 Ga0207663_10176420 3300025916 Bacteria 1522
220 Ga0207660_10138636 3300025917 Bacteria 1858
221 Ga0207662_10127227 3300025918 Bacteria 1603
222 Ga0207649_10026643 3300025920 Bacteria 3384
223 Ga0207649_10067191 3300025920 Bacteria 2275
224 Ga0207649_10393881 3300025920 Bacteria 1035
225 Ga0207652_10189220 3300025921 Bacteria 1851
226 Ga0207652_10249564 3300025921 Bacteria 1600
227 Ga0207652_10295312 3300025921 Bacteria 1462
228 Ga0207681_10111058 3300025923 Bacteria 1994
229 Ga0207681_10162551 3300025923 Bacteria 1685
230 Ga0207694_10011848 3300025924 Bacteria 6578
231 Ga0207687_10045955 3300025927 Bacteria 3020
232 Ga0207700_10033489 3300025928 Bacteria 3677
233 Ga0207664_10018792 3300025929 Bacteria 5097
234 Ga0207664_10132650 3300025929 Bacteria 2099
235 Ga0207644_10025344 3300025931 Bacteria 4079
236 Ga0207706_10125279 3300025933 Bacteria 2259
237 Ga0207686_10026415 3300025934 Bacteria 3386
238 Ga0207686_10105323 3300025934 Bacteria 1891
239 Ga0207709_10256847 3300025935 Bacteria 1279
240 Ga0207670_10225400 3300025936 Bacteria 1437
241 Ga0207669_10024919 3300025937 Bacteria 3224
242 Ga0207669_10275286 3300025937 Bacteria 1266
243 Ga0207665_10058123 3300025939 Bacteria 2614
244 Ga0207691_10046161 3300025940 Bacteria 4005
245 Ga0207691_10193552 3300025940 Bacteria 1773
246 Ga0207689_10019675 3300025942 Bacteria 5689
247 Ga0207689_10126706 3300025942 Bacteria 2100
248 Ga0207661_10006017 3300025944 Bacteria 8570
249 Ga0207661_10097531 3300025944 Bacteria 2462
250 Ga0207661_10152167 3300025944 Bacteria 2000
251 Ga0207679_10217355 3300025945 Bacteria 1606
252 Ga0207667_10024730 3300025949 Bacteria 6586
253 Ga0207668_10020006 3300025972 Bacteria 4245
254 Ga0207668_10035164 3300025972 Bacteria 3333
255 Ga0207668_10076717 3300025972 Bacteria 2407
256 Ga0207668_10377171 3300025972 Bacteria 1193
257 Ga0207640_10004918 3300025981 Bacteria 7258
258 Ga0207658_10085087 3300025986 Bacteria 2435
259 Ga0207703_10052514 3300026035 Bacteria 3310
260 Ga0207703_10358198 3300026035 Bacteria 1345
261 Ga0207703_10448110 3300026035 Bacteria 1205
262 Ga0207639_10105229 3300026041 Bacteria 2289
263 Ga0207678_10019339 3300026067 Bacteria 5982
264 Ga0207678_10060994 3300026067 Bacteria 3243
265 Ga0207678_10072500 3300026067 Bacteria 2951
266 Ga0207678_10098166 3300026067 Bacteria 2503
267 Ga0207678_10109589 3300026067 Bacteria 2355
268 Ga0207678_10157821 3300026067 Bacteria 1937
269 Ga0207702_10000022 3300026078 Bacteria 192961
270 Ga0207702_10000052 3300026078 Bacteria 137784
271 Ga0207641_10174555 3300026088 Bacteria 1964
272 Ga0207648_10019164 3300026089 Bacteria 6174
273 Ga0207648_10101323 3300026089 Bacteria 2524
274 Ga0207676_10244911 3300026095 Bacteria 1610
275 Ga0207674_10017555 3300026116 Bacteria 7806
276 Ga0207674_10017566 3300026116 Bacteria 7803
277 Ga0207674_10020164 3300026116 Bacteria 7210
278 Ga0207683_10083713 3300026121 Bacteria 2835
279 Ga0207698_10383000 3300026142 Bacteria 1338
280 Ga0207698_10645317 3300026142 Bacteria 1048
281 Ga0209389_1000057 3300027296 Bacteria 107632
282 Ga0209389_1000083 3300027296 Bacteria 88461
283 Ga0209589_1000007 3300027357 Bacteria 425699
284 Ga0209589_1000097 3300027357 Bacteria 88461
285 Ga0209489_100008 3300027361 Bacteria 425699
286 Ga0209489_100105 3300027361 Bacteria 118979
287 Ga0209489_100226 3300027361 Bacteria 94384
288 Ga0209700_100009 3300027363 Bacteria 425699
289 Ga0209700_100085 3300027363 Bacteria 128517
290 Ga0268266_10001410 3300028379 Bacteria 28680
291 Ga0268266_10007006 3300028379 Bacteria 10236
292 Ga0268266_10124907 3300028379 Bacteria 2295
293 Ga0268266_10245011 3300028379 Bacteria 1655
294 Ga0268266_10252326 3300028379 Bacteria 1632
295 Ga0307517_10000248 3300028786 Bacteria 92084
296 Ga0307515_10009680 3300028794 Bacteria 18590
297 Ga0265325_10012086 3300031241 Bacteria 4945
298 Ga0265339_10088044 3300031249 Bacteria 1632
299 Ga0307509_10163135 3300031507 Bacteria 2122
300 Ga0265314_10001303 3300031711 Bacteria 28283
301 Ga0265342_10049441 3300031712 Bacteria 2516
302 Ga0307516_10005798 3300031730 Bacteria 14633
303 Ga0307516_10301053 3300031730 Bacteria 1279
304 Ga0307516_10381653 3300031730 Bacteria 1070
305 Ga0307409_100309008 3300031995 Bacteria 1474
306 Ga0307411_10023737 3300032005 Bacteria 3640
307 Ga0307411_10104535 3300032005 Bacteria 2011
308 Ga0307510_10005757 3300033180 Bacteria 14771
309 Ga0307510_10032941 3300033180 Bacteria 5831
310 Ga0307510_10143752 3300033180 Bacteria 2023
311 Ga0315911_1000031 3300033442 Bacteria 74171
312 Ga0373926_0008522 3300035083 Bacteria 3414
313 Ga0373934_0082862 3300035086 Bacteria 1289
314 Ga0373923_0007087 3300035111 Bacteria 3922
315 Ga0373936_0008136 3300035113 Bacteria 3943
316 Ga0373936_0020245 3300035113 Bacteria 2584
317 Ga0373954_0030072 3300035118 Bacteria 2503
318 Ga0373956_0028056 3300035119 Bacteria 2448
319 Ga0373957_0017565 3300035120 Bacteria 2494
320 Ga0373946_0012170 3300035171 Bacteria 3217
321 Ga0373955_0017402 3300035172 Bacteria 3558
322 Ga0373931_0040298 3300035691 Bacteria 2450
323 Ga0373927_0008550 3300035695 Bacteria 6883
324 Ga0373927_0049818 3300035695 Bacteria 2707
325 Ga0373927_0060777 3300035695 Bacteria 2445
326 Ga0373927_0074088 3300035695 Bacteria 2204
327 Ga0373933_0000017 3300035724 Bacteria 100816
328 Ga0373947_0094044 3300035725 Bacteria 1874
329 Ga0373937_0019212 3300036401 Bacteria 6118
330 Ga0373925_0342696 3300037068 Bacteria 1212
331 Ga0395899_0103171 3300037312 Bacteria 2057
332 Ga0395900_0001375 3300037418 Bacteria 29263
333 Ga0395900_0026854 3300037418 Bacteria 5892
334 Ga0395898_0007695 3300037466 Bacteria 11438
335 Ga0395898_0010806 3300037466 Bacteria 9538
336 Ga0395898_0026044 3300037466 Bacteria 5889
337 Ga0395898_0037513 3300037466 Bacteria 4806
338 Ga0395898_0072212 3300037466 Bacteria 3334
339 Ga0436364_0360454 3300037853 Bacteria 27225
340 Ga0436364_0663056 3300037853 Bacteria 2141
341 Ga0395901_0010335 3300038443 Bacteria 9455
342 Ga0395901_0018894 3300038443 Bacteria 7046
343 Ga0395901_0061353 3300038443 Bacteria 3912
344 Ga0395901_0081909 3300038443 Bacteria 3371
345 Ga0395901_0150546 3300038443 Bacteria 2445
346 Ga0395901_0194173 3300038443 Bacteria 2129
347 Ga0436365_0177040 3300039437 Bacteria 1719
348 Ga0436365_1703603 3300039437 Bacteria 2256
349 Ga0436361_0846802 3300039447 Bacteria 1689
350 Ga0436361_1054725 3300039447 Bacteria 3849
351 Ga0436363_0440729 3300039450 Bacteria 1011
352 Ga0436363_0790499 3300039450 Bacteria 1849
353 Ga0436362_1206031 3300039453 Bacteria 3791
354 Ga0466972_0000244 3300044658 Bacteria 37027
355 Ga0466966_0000274 3300044684 Bacteria 33698
356 Ga0466961_0000863 3300044693 Bacteria 18927
357 Ga0466961_0136997 3300044693 Bacteria 1533
358 Ga0466963_0197798 3300044694 Bacteria 1405
359 Ga0466964_0045414 3300044706 Bacteria 1788
360 Ga0466968_0034582 3300044735 Bacteria 2109
361 Ga0466968_0111420 3300044735 Bacteria 1231
362 Ga0466957_0026774 3300044842 Bacteria 3423
363 Ga0466957_0094901 3300044842 Bacteria 1873
364 Ga0466960_0023875 3300044901 Bacteria 2751
365 Ga0466959_0002607 3300045049 Bacteria 11575
366 Ga0466959_0065017 3300045049 Bacteria 2647
367 Ga0466967_0072897 3300045976 Bacteria 3079
368 Ga0466967_0098227 3300045976 Bacteria 2673
369 Ga0495617_016880 3300046452 Bacteria 2468
370 Ga0495617_025149 3300046452 Bacteria 2008
371 Ga0495603_0044042 3300046455 Bacteria 2663
372 Ga0495603_0049060 3300046455 Bacteria 2513
373 Ga0495603_0060381 3300046455 Bacteria 2240
374 Ga0495629_0172608 3300046459 Bacteria 1500
375 Ga0495638_0018073 3300046460 Bacteria 4689
376 Ga0495641_0042516 3300046461 Bacteria 2105
377 Ga0495651_0003754 3300046462 Bacteria 11619
378 Ga0495651_0031752 3300046462 Bacteria 4117
379 Ga0495651_0059602 3300046462 Bacteria 2926
380 Ga0495653_0000286 3300046463 Bacteria 40964
381 Ga0495653_0034757 3300046463 Bacteria 3982
382 Ga0495580_0006452 3300046472 Bacteria 9549
383 Ga0495580_0163371 3300046472 Bacteria 1541
384 Ga0495582_0112119 3300046473 Bacteria 1532
385 Ga0495639_0019062 3300046475 Bacteria 2993
386 Ga0495639_0043260 3300046475 Bacteria 2034
387 Ga0495664_0006470 3300046477 Bacteria 6474
388 Ga0495585_0019640 3300046492 Bacteria 3894
389 Ga0495585_0034591 3300046492 Bacteria 2857
390 Ga0495594_0010211 3300046499 Bacteria 4865
391 Ga0495596_0114045 3300046500 Bacteria 1050
392 Ga0495607_0000667 3300046501 Bacteria 33255
393 Ga0495607_0053189 3300046501 Bacteria 2341
394 Ga0495606_0000155 3300046507 Bacteria 119163
395 Ga0495606_0011554 3300046507 Bacteria 7187
396 Ga0495606_0129642 3300046507 Bacteria 1500
397 Ga0495608_0030200 3300046511 Bacteria 3671
398 Ga0495628_0136011 3300046516 Bacteria 1878
399 Ga0495630_0186402 3300046517 Bacteria 1583
400 Ga0495631_0069131 3300046518 Bacteria 1527
401 Ga0495637_0010025 3300046520 Bacteria 4602
402 Ga0495643_0014139 3300046522 Bacteria 4756
403 Ga0495644_0015814 3300046523 Bacteria 2891
404 Ga0495648_0052283 3300046524 Bacteria 2482
405 Ga0495666_0015022 3300046526 Bacteria 3854
406 Ga0495652_0144722 3300046529 Bacteria 1865
407 Ga0495665_0065411 3300046531 Bacteria 1919
408 Ga0495640_0045286 3300046533 Bacteria 3054
409 Ga0495586_0038421 3300046535 Bacteria 2571
410 Ga0495609_0047079 3300046538 Bacteria 1930
411 Ga0495621_0033541 3300046539 Bacteria 1770
412 Ga0495645_0003177 3300046543 Bacteria 11137
413 Ga0495645_0021412 3300046543 Bacteria 4673
414 Ga0495645_0046785 3300046543 Bacteria 3153
415 Ga0495622_0008965 3300046557 Bacteria 4636
416 Ga0495667_0023331 3300046559 Bacteria 4168
417 Ga0495656_0001572 3300046615 Bacteria 7479
418 Ga0495656_0076039 3300046615 Bacteria 1503
419 Ga0495668_0080503 3300046616 Bacteria 1787
420 Ga0495634_0031563 3300046642 Bacteria 3648
421 Ga0495634_0035258 3300046642 Bacteria 3428
422 Ga0495625_0045484 3300046660 Bacteria 3173
423 Ga0495635_0009287 3300046663 Bacteria 6870
424 Ga0495635_0012597 3300046663 Bacteria 5930
425 Ga0495661_0000039 3300046665 Bacteria 153539
426 Ga0495661_0081372 3300046665 Bacteria 1866
427 Ga0495588_0017002 3300046674 Bacteria 3524
428 Ga0495657_0012563 3300046675 Bacteria 6287
429 Ga0495657_0018881 3300046675 Bacteria 4983
430 Ga0495599_0039925 3300046678 Bacteria 2949
431 Ga0495623_0055224 3300046679 Bacteria 2504
432 Ga0495646_0075060 3300046680 Bacteria 1983
433 Ga0495658_0017406 3300046683 Bacteria 3712
434 Ga0495658_0142435 3300046683 Bacteria 1467
435 Ga0495669_0007996 3300046684 Bacteria 4438
436 Ga0495669_0028340 3300046684 Bacteria 2452
437 Ga0495613_0041984 3300046689 Bacteria 3385
438 Ga0495613_0049506 3300046689 Bacteria 3101
439 Ga0495670_0001688 3300046691 Bacteria 10848
440 Ga0495671_0030659 3300046692 Bacteria 2753
441 Ga0495649_0000421 3300046694 Bacteria 36857
442 Ga0495649_0088976 3300046694 Bacteria 1647
443 Ga0495649_0193840 3300046694 Bacteria 1057
444 Ga0495581_0071390 3300047315 Bacteria 2009
445 Ga0495581_0118143 3300047315 Bacteria 1542
446 Ga0495581_0188183 3300047315 Bacteria 1207
447 Ga0495604_0004189 3300047317 Bacteria 11435
448 Ga0495604_0009398 3300047317 Bacteria 7734
449 Ga0495636_0037840 3300047318 Bacteria 1993
450 Ga0495674_0021298 3300047319 Bacteria 5997
451 Ga0495674_0039757 3300047319 Bacteria 4213
452 Ga0495674_0288354 3300047319 Bacteria 1343
453 Ga0495676_0015755 3300047321 Bacteria 6720
454 Ga0495676_0050440 3300047321 Bacteria 3337
455 Ga0495676_0171736 3300047321 Bacteria 1525
456 Ga0495680_0000837 3300047322 Bacteria 34060
457 Ga0495683_0000357 3300047323 Bacteria 37690
458 Ga0495687_059416 3300047443 Bacteria 1582
459 Ga0495675_0007021 3300047444 Bacteria 6924
460 Ga0495684_0014353 3300047471 Bacteria 6095
461 Ga0495686_0129959 3300047472 Bacteria 1494
462 Ga0495593_0009563 3300047673 Bacteria 5627
463 Ga0495602_0019935 3300048088 Bacteria 6640
464 Ga0495626_0065532 3300048091 Bacteria 1644
465 Ga0496100_0238714 3300048903 Bacteria 1340
466 Ga0496101_0013015 3300048904 Bacteria 5567
467 Ga0496101_0054137 3300048904 Bacteria 2897
468 Ga0496101_0096146 3300048904 Bacteria 2211
469 Ga0496101_0184869 3300048904 Bacteria 1606
470 Ga0496102_0038707 3300048905 Bacteria 4305
471 Ga0496102_0286937 3300048905 Bacteria 1551
472 Ga0496102_0297051 3300048905 Bacteria 1522
473 Ga0496102_0314370 3300048905 Bacteria 1476
474 Ga0496103_0010746 3300048906 Bacteria 5416
475 Ga0496103_0144568 3300048906 Bacteria 1522
476 Ga0496104_0042662 3300048907 Bacteria 4258
477 Ga0496104_0053124 3300048907 Bacteria 3827
478 Ga0496104_0063412 3300048907 Bacteria 3504
479 Ga0496104_0070109 3300048907 Bacteria 3332
480 Ga0496104_0133256 3300048907 Bacteria 2387
481 Ga0496105_0026047 3300048908 Bacteria 4766
482 Ga0496106_0001100 3300048909 Bacteria 19988
483 Ga0496106_0019174 3300048909 Bacteria 5072
484 Ga0496106_0083663 3300048909 Bacteria 2454
485 Ga0496107_0001808 3300048910 Bacteria 13487
486 Ga0496107_0079765 3300048910 Bacteria 2386
487 Ga0496107_0150079 3300048910 Bacteria 1723
488 Ga0496107_0239014 3300048910 Bacteria 1352
489 Ga0496108_0000424 3300048911 Bacteria 34409
490 Ga0496108_0052669 3300048911 Bacteria 3412
491 Ga0496108_0493869 3300048911 Bacteria 1069
492 Ga0496109_0000199 3300048912 Bacteria 59773
493 Ga0496109_0116966 3300048912 Bacteria 2481
494 Ga0496109_0121844 3300048912 Bacteria 2430
495 Ga0496110_0018590 3300048913 Bacteria 5830
496 Ga0496110_0124112 3300048913 Bacteria 2329
497 Ga0496110_0203829 3300048913 Bacteria 1797
498 Ga0496111_0032177 3300048914 Bacteria 3739
499 Ga0496112_0000057 3300048915 Bacteria 77700
500 Ga0496112_0003500 3300048915 Bacteria 13013
501 Ga0496112_0167167 3300048915 Bacteria 2165
502 Ga0496113_0018824 3300048916 Bacteria 4817
503 Ga0496113_0026863 3300048916 Bacteria 4120
504 Ga0496113_0062745 3300048916 Bacteria 2807
505 Ga0496113_0114584 3300048916 Bacteria 2102
506 Ga0496113_0126532 3300048916 Bacteria 2002
507 Ga0496114_0009349 3300048917 Bacteria 7781
508 Ga0496114_0084764 3300048917 Bacteria 2683
509 Ga0496114_0268147 3300048917 Bacteria 1504
510 Ga0496115_0001860 3300048918 Bacteria 15092
511 Ga0496115_0016884 3300048918 Bacteria 5567
512 Ga0496115_0065583 3300048918 Bacteria 2933
513 Ga0496115_0080257 3300048918 Bacteria 2656
514 Ga0496115_0142020 3300048918 Bacteria 1981
515 Ga0496115_0193825 3300048918 Bacteria 1679
516 Ga0496116_0009740 3300048919 Bacteria 8156
517 Ga0496117_0217059 3300048920 Bacteria 1067
518 Ga0496118_0049296 3300048921 Bacteria 3244
519 Ga0496118_0079099 3300048921 Bacteria 2322
520 Ga0496118_0082517 3300048921 Bacteria 2252
521 Ga0496119_0008388 3300048922 Bacteria 9086
522 Ga0496119_0030934 3300048922 Bacteria 3600
523 Ga0496121_0002265 3300048924 Bacteria 29946
524 Ga0496121_0002757 3300048924 Bacteria 26099
525 Ga0496121_0012166 3300048924 Bacteria 9441
526 Ga0496121_0014146 3300048924 Bacteria 8499
527 Ga0496121_0044065 3300048924 Bacteria 3855
528 Ga0496121_0053315 3300048924 Bacteria 3389
529 Ga0496121_0074528 3300048924 Bacteria 2714
530 Ga0496121_0098439 3300048924 Bacteria 2263
531 Ga0496121_0110027 3300048924 Bacteria 2103
532 Ga0496122_0078141 3300048925 Bacteria 2319
533 Ga0496122_0096007 3300048925 Bacteria 2001
534 Ga0496124_0079641 3300048927 Bacteria 2697
535 Ga0496124_0211484 3300048927 Bacteria 1467
536 Ga0496124_0214973 3300048927 Bacteria 1451
537 Ga0496124_0288647 3300048927 Bacteria 1192
538 Ga0496125_0000202 3300048928 Bacteria 125963
539 Ga0496125_0002471 3300048928 Bacteria 23978
540 Ga0496125_0011334 3300048928 Bacteria 8927
541 Ga0496125_0042602 3300048928 Bacteria 3864
542 Ga0496125_0052137 3300048928 Bacteria 3366
543 Ga0496125_0085244 3300048928 Bacteria 2394
544 Ga0496126_0001863 3300048929 Bacteria 30707
545 Ga0496126_0003081 3300048929 Bacteria 21560
546 Ga0496126_0007118 3300048929 Bacteria 12322
547 Ga0496126_0013560 3300048929 Bacteria 8279
548 Ga0496126_0018959 3300048929 Bacteria 6796
549 Ga0496126_0077341 3300048929 Bacteria 2950
550 Ga0496126_0087707 3300048929 Bacteria 2742
551 Ga0496126_0087901 3300048929 Bacteria 2739
552 Ga0496126_0101141 3300048929 Bacteria 2522
553 Ga0496126_0101568 3300048929 Bacteria 2515
554 Ga0496126_0165829 3300048929 Bacteria 1885
555 Ga0496126_0199062 3300048929 Bacteria 1692
556 Ga0496126_0200218 3300048929 Bacteria 1687
557 Ga0495678_023205 3300049459 Bacteria 2702
558 Ga0495678_030598 3300049459 Bacteria 2251
559 Ga0495682_0016777 3300049460 Bacteria 2770
560 Ga0501031_0006089 3300049568 Bacteria 7876
561 Ga0501032_0000189 3300049569 Bacteria 50924
562 Ga0501032_0035293 3300049569 Bacteria 3419
563 Ga0501032_0053238 3300049569 Bacteria 2726
564 Ga0501033_0000803 3300049570 Bacteria 28734
565 Ga0501033_0031278 3300049570 Bacteria 4000
566 Ga0501034_0019025 3300049571 Bacteria 7035
567 Ga0501034_0035921 3300049571 Bacteria 5024
568 Ga0501034_0110848 3300049571 Bacteria 2735
569 Ga0501036_0000104 3300049572 Bacteria 52974
570 Ga0501036_0070834 3300049572 Bacteria 2948
571 Ga0501036_0079182 3300049572 Bacteria 2780
572 Ga0501037_0000931 3300049573 Bacteria 21741
573 Ga0501037_0048973 3300049573 Bacteria 3095
574 Ga0501038_0000041 3300049574 Bacteria 120557
575 Ga0501039_0000064 3300049575 Bacteria 83415
576 Ga0501043_0002337 3300049579 Bacteria 16070
577 Ga0501043_0069013 3300049579 Bacteria 2776
578 Ga0501046_0086011 3300049580 Bacteria 2424
579 Ga0501046_0221172 3300049580 Bacteria 1401
580 Ga0501047_0003019 3300049581 Bacteria 15963
581 Ga0501047_0049470 3300049581 Bacteria 4059
582 Ga0501047_0164796 3300049581 Bacteria 2087
583 Ga0501048_0033713 3300049582 Bacteria 3698
584 Ga0501067_0077643 3300049583 Bacteria 1840
585 Ga0501067_0233197 3300049583 Bacteria 1024
586 Ga0501068_0075390 3300049584 Bacteria 2063
587 Ga0501070_0000209 3300049586 Bacteria 55271
588 Ga0501070_0107549 3300049586 Bacteria 2305
589 Ga0501071_0135824 3300049587 Bacteria 1830
590 Ga0501071_0272524 3300049587 Bacteria 1280
591 Ga0501073_0001947 3300049589 Bacteria 15377
592 Ga0501073_0046628 3300049589 Bacteria 3047
593 Ga0501074_0011516 3300049590 Bacteria 6430
594 Ga0501080_0012442 3300049742 Bacteria 7800
595 Ga0501035_0000155 3300049822 Bacteria 84012
596 Ga0501035_0043536 3300049822 Bacteria 4045
597 Ga0501044_0007661 3300049823 Bacteria 11872
598 Ga0501044_0049645 3300049823 Bacteria 4331
599 Ga0501044_0061475 3300049823 Bacteria 3842
600 Ga0501044_0081577 3300049823 Bacteria 3273
601 nmdc:mga03683_26100_c1 3300050489 Bacteria 2302
602 nmdc:mga00v17_27518_c1 3300050491 Bacteria 3320
603 nmdc:mga0yw44_22305_c1 3300050492 Bacteria 3549
604 nmdc:mga0yw44_3283_c1 3300050492 Bacteria 7145
605 nmdc:mga0k408_74000_c1 3300050493 Bacteria 1990
606 nmdc:mga06z11_191200_c1 3300050494 Bacteria 1185
607 nmdc:mga06z11_2462_c1 3300050494 Bacteria 7073
608 nmdc:mga06z11_38800_c1 3300050494 Bacteria 2367
609 nmdc:mga06z11_6882_c1 3300050494 Bacteria 4651
610 nmdc:mga04h51_6855_c1 3300050495 Bacteria 2977
611 nmdc:mga08y16_166484_c1 3300050511 Bacteria 2290
612 nmdc:mga0rr50_26450_c1 3300050513 Bacteria 4048
613 nmdc:mga0sz30_23281_c1 3300050516 Bacteria 2518
614 nmdc:mga0sz30_23478_c1 3300050516 Bacteria 2510
615 nmdc:mga0sz30_6944_c1 3300050516 Bacteria 4229
616 Ga0495601_0019431 3300053077 Bacteria 4143
617 Ga0495601_0165937 3300053077 Bacteria 1443
618 Ga0495612_0040748 3300053078 Bacteria 1893
619 Ga0500635_0049929 3300053080 Bacteria 1429
620 Ga0495595_0006001 3300053084 Bacteria 4934
621 Ga0500643_000185 3300053087 Bacteria 60228
622 Ga0500644_0029572 3300053088 Bacteria 1725
623 Ga0500583_0045952 3300053092 Bacteria 2007
624 Ga0500651_0135026 3300053093 Bacteria 1490
625 Ga0500566_0014798 3300053094 Bacteria 4581
626 Ga0500566_0016255 3300053094 Bacteria 4368
627 Ga0500640_059885 3300053095 Bacteria 1652
628 Ga0500650_0119503 3300053098 Bacteria 1229
629 Ga0500555_031027 3300053103 Bacteria 1515
630 Ga0500556_0000011 3300053104 Bacteria 253393
631 Ga0500557_000103 3300053105 Bacteria 25870
632 Ga0500562_007238 3300053108 Bacteria 2800
633 Ga0500572_009863 3300053111 Bacteria 2269
634 Ga0500594_0043821 3300053118 Bacteria 1235
635 Ga0500594_0061885 3300053118 Bacteria 1081
636 Ga0500595_000393 3300053119 Bacteria 28109
637 Ga0500595_001825 3300053119 Bacteria 11017
638 Ga0500595_003227 3300053119 Bacteria 7697
639 Ga0500595_006282 3300053119 Bacteria 5062
640 Ga0500595_013810 3300053119 Bacteria 3084
641 Ga0500595_033120 3300053119 Bacteria 1717
642 Ga0500607_110980 3300053121 Bacteria 1344
643 Ga0500608_051073 3300053122 Bacteria 1986
644 Ga0500618_001048 3300053125 Bacteria 13785
645 Ga0500642_0000030 3300053130 Bacteria 115114
646 Ga0500642_0000325 3300053130 Bacteria 16616
647 Ga0500642_0022436 3300053130 Bacteria 2519
648 Ga0500642_0060581 3300053130 Bacteria 1698
649 Ga0500652_000505 3300053131 Bacteria 13707
650 Ga0500652_015160 3300053131 Bacteria 2776
651 Ga0500559_0000802 3300053136 Bacteria 20557
652 Ga0500568_0001554 3300053139 Bacteria 14551
653 Ga0500568_0008152 3300053139 Bacteria 5078
654 Ga0500577_0000303 3300053142 Bacteria 12770
655 Ga0500586_001174 3300053145 Bacteria 5450
656 Ga0500590_074384 3300053148 Bacteria 1682
657 Ga0500604_0001620 3300053151 Bacteria 6317
658 Ga0500616_0000026 3300053153 Bacteria 454314
659 Ga0500622_0019541 3300053156 Bacteria 3598
660 Ga0500622_0047628 3300053156 Bacteria 2214
661 Ga0500622_0122042 3300053156 Bacteria 1262
662 Ga0500622_0170484 3300053156 Bacteria 1013
663 Ga0500627_0007291 3300053158 Bacteria 3838
664 Ga0500627_0111619 3300053158 Bacteria 1231
665 Ga0500638_118211 3300053162 Bacteria 1216
666 Ga0500636_0008206 3300053177 Bacteria 6055
667 Ga0500636_0081485 3300053177 Bacteria 1863
668 Ga0500645_033861 3300053730 Bacteria 1527
669 Ga0500609_000865 3300053731 Bacteria 4526
670 Ga0500656_007073 3300053732 Bacteria 1158
671 Ga0500599_000183 3300053736 Bacteria 5778
672 Ga0500601_000677 3300053737 Bacteria 4610
673 Ga0500661_001666 3300055283 Bacteria 4179
674 Ga0466962_0021638 3300061719 Bacteria 3086
675 Ga0466962_0062002 3300061719 Bacteria 1785
676 2507511179 2507262055 Bacteria 8048963
677 2508693724 2508501042 Bacteria 8719808
678 2509146860 2508501128 Bacteria 8613869
679 2511396500 2511231028 Bacteria 8046582
680 2513623627 2513237092 Bacteria 8341956
681 2513637313 2513237094 Bacteria 8789602
682 2513650872 2513237095 Bacteria 8976980
683 2513655178 2513237096 Bacteria 8722461
684 2513676694 2513237098 Bacteria 9902361
685 2513693390 2513237101 Bacteria 7952346
686 2513700462 2513237102 Bacteria 7703324
687 2513719640 2513237104 Bacteria 10034502
688 2513861432 2513237137 Bacteria 9558895
689 2513874801 2513237139 Bacteria 8737671
690 2513892228 2513237141 Bacteria 8496279
691 2513915798 2513237145 Bacteria 8979722
692 2514010481 2513237161 Bacteria 8871253
693 2515625255 2515154112 Bacteria 8294334
694 2517100750 2517093001 Bacteria 9002274
695 2517894898 2517572143 Bacteria 9484767
696 2524438038 2524023205 Bacteria 8918781
697 2524466587 2524023210 Bacteria 9029266
698 2524534669 2524023228 Bacteria 10118060
699 2528849156 2528768022 Bacteria 10457665
700 2596374145 2595698237 Bacteria 6712432
701 2603862488 2602042107 Bacteria 6226103
702 2617350578 2617270735 Bacteria 9163226
703 2617373299 2617270741 Bacteria 8201522
704 2671123006 2667528175 Bacteria 7532676
705 2723848303 2721755755 Bacteria 8322773
706 2728748783 2728368998 Bacteria 8720350
707 2745081005 2744054633 Bacteria 8678936
708 2793061883 2791355196 Bacteria 7323613
709 2793071993 2791355197 Bacteria 8420563
710 2793079617
711 2805916802 2802429603 Bacteria 8777136
712 2818238314 2816332527 Bacteria 8933356
713 2824603973 2824600985 Bacteria 8488197
714 2824611554 2824609381 Bacteria 8672835
715 2824622482 2824617872 Bacteria 8814715
716 2824630338 2824626560 Bacteria 8813858
717 2824638334 2824635225 Bacteria 8785348
718 2824645948 2824644064 Bacteria 8743947
719 2824655422 2824653114 Bacteria 8493680
720 2824663288 2824661429 Bacteria 9877870
721 2824673562 2824671348 Bacteria 8369588
722 2824680936 2824679649 Bacteria 8248951
723 2824690315 2824687955 Bacteria 8360029
724 2824701275 2824696289 Bacteria 8335049
725 2824707099 2824704595 Bacteria 9667483
726 2824716069 2824714736 Bacteria 8717648
727 2824725925 2824723954 Bacteria 8758240
728 2824734739 2824732956 Bacteria 7810675
729 2824747688 2824746037 Bacteria 7911610
730 2824754585 2824753945 Bacteria 9787441
731 2824765369 2824763712 Bacteria 9792355
732 2824773468 2824773399 Bacteria 8360218
733 2829750169 2829745981 Bacteria 5406054
734 2838128048 2838122688 Bacteria 8803140
735 2841943345 2841941048 Bacteria 8688029
736 2841953926 2841949485 Bacteria 8680857
737 2841962042 2841957949 Bacteria 8652217
738 2841968018 2841966195 Bacteria 8673214
739 2841981273 2841974524 Bacteria 8931498
740 2841988144 2841983080 Bacteria 8395090
741 2842042547 2842038055 Bacteria 8002051
742 2842050590 2842045827 Bacteria 8006841
743 2842701092 2842698319 Bacteria 5190321
744 2844316753 2844315083 Bacteria 8138177
745 2847938719 2847930680 Bacteria 9342022
746 2847944083 2847939898 Bacteria 8606328
747 2849081693 2849076700 Bacteria 7039503
748 2857512343 2857509624 Bacteria 7472071
749 2857529828 2857524615 Bacteria 6615449
750 2861692896 2861691609 Bacteria 5628931
751 2874597913 2874590934 Bacteria 8299676
752 2874607483 2874604998 Bacteria 7834745
753 2874619716 2874612657 Bacteria 8252029
754 2874626191 2874620515 Bacteria 8290088
755 2874631390 2874628541 Bacteria 8630250
756 2874651441 2874645413 Bacteria 8214782
757 2876763022 2876761206 Bacteria 10111113
758 2876776513 2876771140 Bacteria 8287509
759 2876814835 2876808645 Bacteria 8824342
760 2876824897 2876818435 Bacteria 8274608
761 2879081624 2879074833 Bacteria 8279565
762 2879088306 2879083081 Bacteria 8587928
763 2879108976 2879099564 Bacteria 10442239
764 2879111033 2879110137 Bacteria 8907982
765 2879134201 2879127579 Bacteria 8294491
766 2879147861 2879142872 Bacteria 8267021
767 2881365929 2881364244 Bacteria 7710352
768 2881667480 2881665667 Bacteria 8175609
769 2885366780 2885366525 Bacteria 8326213
770 2885383103 2885374607 Bacteria 8927485
771 2885415886 2885409591 Bacteria 9235467
772 2888381362 2888378607 Bacteria 9652610
773 2888389276 2888388044 Bacteria 7304136
774 2888421782 2888419890 Bacteria 7857137
775 2889037174 2889033259 Bacteria 9099371
776 2889311416 2889306138 Bacteria 6358934
777 2893069527 2893066018 Bacteria 6158120
778 2903733808 2903727486 Bacteria 8281579
779 2903756569 2903748898 Bacteria 9972761
780 2903769758 2903768456 Bacteria 9749579
781 2904669209 2904666416 Bacteria 8226587
782 2904698070 2904690495 Bacteria 9412302
783 2904706152
784 2904718827 2904711408 Bacteria 9771557
785 2906606745 2906602504 Bacteria 8295279
786 2906611633
787 2906627471 2906626472 Bacteria 8826946
788 2906639612 2906635258 Bacteria 8601019
789 2906644907 2906643746 Bacteria 8722424
790 2906660645 2906660503 Bacteria 8595048
791 2908745218 2908739725 Bacteria 8628932
792 2908763107 2908756301 Bacteria 8864324
793 2908781757 2908775508 Bacteria 8092255
794 2909046020 2909042592 Bacteria 6499737
795 2919077316 2919073203 Bacteria 6531949
796 2922361313 2922361189 Bacteria 7436256
797 2922371009
798 2922392934 2922386360 Bacteria 7017218
799 2922401162 2922393267 Bacteria 8285685
800 2922427714
801 2928129729 2928125067 Bacteria 5937560
802 2929619407 2929615660 Bacteria 9193770
803 2929628123 2929624759 Bacteria 9339455
804 2932785706 2932784394 Bacteria 9704911
805 2932799066 2932794094 Bacteria 7915132
806 2932808518 2932801729 Bacteria 7987968
807 2932813703 2932809354 Bacteria 9135765
808 2932822329 2932818245 Bacteria 9955613
809 2932830770 2932828146 Bacteria 9745859
810 2933581327 2933577622 Bacteria 9116884
811 2935612592 2935608549 Bacteria 8203142
812 2935620817 2935616580 Bacteria 9032984
813 2935632339 2935630451 Bacteria 8169952
814 2935639896 2935638405 Bacteria 10015038
815 2935653511 2935648319 Bacteria 8801166
816 2935662260 2935656913 Bacteria 8965014
817 2935667250 2935665750 Bacteria 9571747
818 2935677671 2935675223 Bacteria 9928132
819 2935690390 2935684952 Bacteria 9590419
820 2935697287 2935694250 Bacteria 9291695
821 2935705006 2935703347 Bacteria 10242284
822 2935717914 2935713505 Bacteria 9608509
823 2935726936 2935722832 Bacteria 9608746
824 2935735706 2935732158 Bacteria 9706831
825 2935745023 2935741537 Bacteria 9707219
826 2935755400 2935750917 Bacteria 9590372
827 2935762093 2935760218 Bacteria 9817913
828 2935776155 2935769743 Bacteria 7878163
829 2935781988 2935777560 Bacteria 8077691
830 2935792012 2935785616 Bacteria 7962367
831 2935800338 2935793552 Bacteria 8012592
832 2935803592 2935801545 Bacteria 9301974
833 2935811512 2935810662 Bacteria 9401221
834 2935824081 2935819856 Bacteria 8261050
835 2935829379 2935827899 Bacteria 10038562
836 2935842643 2935837841 Bacteria 9454360
837 2935852772 2935847175 Bacteria 8228321
838 2935858625 2935855204 Bacteria 9035059
839 2935866954 2935864058 Bacteria 9784707
840 2935877084 2935873716 Bacteria 9632195
841 2935884719 2935883170 Bacteria 7964738
842 2935912076 2935908558 Bacteria 8568796
843 2935922287 2935916978 Bacteria 9113783
844 2935929105 2935926038 Bacteria 8601059
845 2935935736 2935934488 Bacteria 8602579
846 2935947302 2935942939 Bacteria 8599779
847 2935953604 2935951376 Bacteria 8602333
848 2935961884 2935959822 Bacteria 7869783
849 2935968630 2935967501 Bacteria 8603075
850 2935976836 2935975950 Bacteria 8347125
851 2935986202 2935984226 Bacteria 8302647
852 2935995280 2935992306 Bacteria 9802711
853 2936004167 2936002035 Bacteria 9362176
854 2936016562 2936011229 Bacteria 8801034
855 2936025124 2936019824 Bacteria 8804134
856 2936034037 2936028420 Bacteria 8965941
857 2936038094 2936037263 Bacteria 9446081
858 2936052023 2936046547 Bacteria 8903709
859 2936059796 2936055302 Bacteria 8785755
860 2940561319 2940556831 Bacteria 9590747
861 2941508286 2941507105 Bacteria 8166816
862 2941515208 2941515067 Bacteria 8166720
863 2941524217 2941523033 Bacteria 8169134
864 2941533540 2941531003 Bacteria 7653939
865 2941544510 2941538514 Bacteria 9402094
866 3005477429 3005474847 Bacteria 9259049
867 3005487516 3005483717 Bacteria 7877331
868 3005511357 3005506211 Bacteria 6943378
869 3005592922 3005587118 Bacteria 7794411
870 3005596362 3005594810 Bacteria 8716512
871 3005712444 3005710791 Bacteria 7622528
872 3005719518 3005718088 Bacteria 8283608
873 8006930577 8006926726 Bacteria 6749210
874 8006933806 8006933436 Bacteria 10410654
875 8006969604 8006964411 Bacteria 8966052
876 8006983478 8006973647 Bacteria 10679141
877 8006988755 8006984368 Bacteria 9651211
878 8006998684 8006994254 Bacteria 8309700
879 8016516632 8016511872 Bacteria 9921665
880 8016524016 8016522445 Bacteria 8156687
881 8016537558 8016530956 Bacteria 8155261
882 8016541825 8016539877 Bacteria 8155419
883 8016567212 8016566248 Bacteria 8158151
884 8016579925 8016575299 Bacteria 8154085
885 8016588920 8016583857 Bacteria 10421953
886 8016597773 8016595262 Bacteria 8149947
887 8016604539 8016603502 Bacteria 8731218
888 8016620475 8016613128 Bacteria 8794220
889 8016629503 8016622563 Bacteria 7999408
890 8016637893 8016630954 Bacteria 9217207
891 8017059920 8017057580 Bacteria 10023680
892 8019537232 8019530166 Bacteria 8155624
893 8019548441 8019547302 Bacteria 7996444
894 8019559735 8019555841 Bacteria 9642137
895 8019569843 8019565922 Bacteria 9639779
896 8019579416 8019576017 Bacteria 10049540
897 8019597469 8019586578 Bacteria 10212056
898 8019604212 8019597564 Bacteria 10041141
899 8019614317 8019608314 Bacteria 10042931
900 8019624960 8019619141 Bacteria 9218857
901 8019650211 8019648815 Bacteria 10014479
902 8019674614 8019668869 Bacteria 8791617
903 8055749336 8055742211 Bacteria 9226248
904 8056675793 8056673599 Bacteria 7871253
905 8056689676 8056681323 Bacteria 8472857
906 8056693189 8056689827 Bacteria 6712655
907 8056973587 8056967851 Bacteria 9038162
908 Ga0157369_10204791
909 JGI24740J21852_10011824
910 JGI24739J22299_10023652
911 JGI24742J22300_10008188
912 JGI25406J46586_10000022
913 JGI25165J46597_1003828
914 JGI25153J46596_10001454
915 JGI25153J46596_10001564
916 JGI25153J46596_10008143
917 JGI25153J46596_10013778
918 JGI25160J50197_1001948
919 JGI25160J50197_1002073
920 Ga0055542_1006969
921 Ga0055543_1003371
922 Ga0065165_1002819
923 Ga0065165_1003488
924 Ga0070658_10044752
925 Ga0070683_100004963
926 Ga0068869_100065216
927 Ga0070680_100398098
928 Ga0070689_100116442
929 Ga0070661_100242023
930 Ga0070668_100027435
931 Ga0070668_100028726
932 Ga0070668_100057873
933 Ga0070671_100060952
934 Ga0070674_100012325
935 Ga0070659_100075552
936 Ga0070709_10029162
937 Ga0070709_10076607
938 Ga0070709_10315549
939 Ga0070714_100097186
940 Ga0070714_100152377
941 Ga0070714_100264686
942 Ga0070713_100026941
943 Ga0070713_100049385
944 Ga0070711_100091481
945 Ga0070663_100050883
946 Ga0070678_100142875
947 Ga0070662_100027572
948 Ga0070681_10021324
949 Ga0070681_10053789
950 Ga0070681_10130192
951 Ga0068867_100171057
952 Ga0068867_100228659
953 Ga0070679_100079408
954 Ga0070679_100080209
955 Ga0070684_100011638
956 Ga0070684_100014777
957 Ga0068853_100017008
958 Ga0068853_100076128
959 Ga0068853_100162753
960 Ga0068853_100307487
961 Ga0070672_100165636
962 Ga0070693_100026452
963 Ga0070665_100010187
964 Ga0070665_100064365
965 Ga0070665_100216224
966 Ga0068855_100008246
967 Ga0068855_100059481
968 Ga0068855_100088767
969 Ga0068855_100370138
970 Ga0068855_100452000
971 Ga0068857_100024972
972 Ga0068857_100029945
973 Ga0068856_100000283
974 Ga0068856_100028813
975 Ga0068856_100114951
976 Ga0068856_100117068
977 Ga0068856_100149840
978 Ga0070702_100037503
979 Ga0068852_100079551
980 Ga0068859_100343685
981 Ga0068864_100031589
982 Ga0068866_10026973
983 Ga0068861_100117105
984 Ga0068858_100022240
985 Ga0068858_100080410
986 Ga0068858_100142997
987 Ga0068858_100210130
988 Ga0068858_100260672
989 Ga0068862_100041511
990 Ga0081455_10002888
991 Ga0081455_10004399
992 Ga0081455_10007005
993 Ga0081455_10074356
994 Ga0081455_10078674
995 Ga0081455_10111119
996 Ga0081540_1003000
997 Ga0081540_1003629
998 Ga0081540_1007173
999 Ga0081540_1009827
1000 Ga0081540_1012090
1001 Ga0081540_1014256
1002 Ga0081540_1022351
1003 Ga0081540_1025904
1004 Ga0081539_10000172
1005 Ga0081539_10000945
1006 Ga0081539_10032234
1007 Ga0070717_10000427
1008 Ga0070717_10102498
1009 Ga0075365_10237375
1010 Ga0075363_100008894
1011 Ga0075363_100120647
1012 Ga0075364_10032959
1013 Ga0075362_10017732
1014 Ga0075362_10043383
1015 Ga0075367_10029842
1016 Ga0075367_10086403
1017 Ga0075367_10088329
1018 Ga0075369_10003835
1019 Ga0075369_10051807
1020 Ga0097621_100046572
1021 Ga0075370_10039585
1022 Ga0075434_100027322
1023 Ga0068865_100084561
1024 Ga0097620_100343702
1025 Ga0099825_1024216
1026 Ga0099825_1025668
1027 Ga0099824_1016130
1028 Ga0099822_1000514
1029 Ga0099795_10020867
1030 Ga0105240_10003435
1031 Ga0105240_10015251
1032 Ga0105240_10017603
1033 Ga0105240_10167781
1034 Ga0105245_10009619
1035 Ga0105245_10492378
1036 Ga0114129_10038696
1037 Ga0105241_10013109
1038 Ga0105242_10024663
1039 Ga0105248_10219291
1040 Ga0105237_10017280
1041 Ga0105237_10019317
1042 Ga0105237_10150927
1043 Ga0105238_10001149
1044 Ga0105238_10016727
1045 Ga0105238_10095140
1046 Ga0105238_10141997
1047 Ga0105249_10041943
1048 Ga0105239_10018526
1049 Ga0105239_10019617
1050 Ga0105239_10140646
1051 Ga0105239_10166049
1052 Ga0105246_10278875
1053 Ga0157373_10018145
1054 Ga0157370_10137011
1055 Ga0157369_10006777
1056 Ga0157369_10014899
1057 Ga0157369_10024164
1058 Ga0157369_10097463
1059 Ga0157374_10036449
1060 Ga0157374_10468095
1061 Ga0157378_10018610
1062 Ga0157378_10181232
1063 Ga0163162_10043115
1064 Ga0157372_10135383
1065 Ga0157372_10143294
1066 Ga0157375_10077581
1067 Ga0157375_10166451
1068 Ga0157375_10195794
1069 Ga0163163_10056442
1070 Ga0157380_10146323
1071 Ga0157377_10126075
1072 Ga0157376_10018340
1073 Ga0157376_10043678
1074 Ga0206350_11261917
1075 Ga0214544_1000001
1076 Ga0214542_1000005
1077 Ga0214545_1000003
1078 Ga0214543_1000002
1079 Ga0213872_10010126
1080 Ga0213876_10076177
1081 Ga0224712_10001877
1082 Ga0224712_10003322
1083 Ga0224712_10008463
1084 Ga0209563_101843
1085 Ga0209677_108556
1086 Ga0209148_1000578
1087 Ga0209233_1002657
1088 Ga0209233_1016604
1089 Ga0209455_1007252
1090 Ga0209564_1005126
1091 Ga0209564_1014441
1092 Ga0209758_1000026
1093 Ga0209758_1000479
1094 Ga0209758_1001249
1095 Ga0209758_1005605
1096 Ga0209758_1006238
1097 Ga0209758_1011503
1098 Ga0207426_1000213
1099 Ga0207426_1000740
1100 Ga0207426_1001455
1101 Ga0209257_1001980
1102 Ga0209257_1013671
1103 Ga0207656_10039899
1104 Ga0207688_10048866
1105 Ga0207647_10001122
1106 Ga0207647_10001897
1107 Ga0207699_10046298
1108 Ga0207699_10056499
1109 Ga0207699_10172008
1110 Ga0207645_10054614
1111 Ga0207654_10022698
1112 Ga0207707_10001944
1113 Ga0207707_10020074
1114 Ga0207707_10022842
1115 Ga0207707_10035036
1116 Ga0207707_10129697
1117 Ga0207695_10000006
1118 Ga0207695_10005212
1119 Ga0207695_10073690
1120 Ga0207695_10120135
1121 Ga0207671_10000774
1122 Ga0207671_10024275
1123 Ga0207671_10035025
1124 Ga0207693_10004594
1125 Ga0207693_10043388
1126 Ga0207663_10176420
1127 Ga0207660_10138636
1128 Ga0207662_10127227
1129 Ga0207649_10026643
1130 Ga0207649_10067191
1131 Ga0207649_10393881
1132 Ga0207652_10189220
1133 Ga0207652_10249564
1134 Ga0207652_10295312
1135 Ga0207681_10111058
1136 Ga0207681_10162551
1137 Ga0207694_10011848
1138 Ga0207687_10045955
1139 Ga0207700_10033489
1140 Ga0207664_10018792
1141 Ga0207664_10132650
1142 Ga0207644_10025344
1143 Ga0207706_10125279
1144 Ga0207686_10026415
1145 Ga0207686_10105323
1146 Ga0207709_10256847
1147 Ga0207670_10225400
1148 Ga0207669_10024919
1149 Ga0207669_10275286
1150 Ga0207665_10058123
1151 Ga0207691_10046161
1152 Ga0207691_10193552
1153 Ga0207689_10019675
1154 Ga0207689_10126706
1155 Ga0207661_10006017
1156 Ga0207661_10097531
1157 Ga0207661_10152167
1158 Ga0207679_10217355
1159 Ga0207667_10024730
1160 Ga0207668_10020006
1161 Ga0207668_10035164
1162 Ga0207668_10076717
1163 Ga0207668_10377171
1164 Ga0207640_10004918
1165 Ga0207658_10085087
1166 Ga0207703_10052514
1167 Ga0207703_10358198
1168 Ga0207703_10448110
1169 Ga0207639_10105229
1170 Ga0207678_10019339
1171 Ga0207678_10060994
1172 Ga0207678_10072500
1173 Ga0207678_10098166
1174 Ga0207678_10109589
1175 Ga0207678_10157821
1176 Ga0207702_10000022
1177 Ga0207702_10000052
1178 Ga0207641_10174555
1179 Ga0207648_10019164
1180 Ga0207648_10101323
1181 Ga0207676_10244911
1182 Ga0207674_10017555
1183 Ga0207674_10017566
1184 Ga0207674_10020164
1185 Ga0207683_10083713
1186 Ga0207698_10383000
1187 Ga0207698_10645317
1188 Ga0209389_1000057
1189 Ga0209389_1000083
1190 Ga0209589_1000007
1191 Ga0209589_1000097
1192 Ga0209489_100008
1193 Ga0209489_100105
1194 Ga0209489_100226
1195 Ga0209700_100009
1196 Ga0209700_100085
1197 Ga0268266_10001410
1198 Ga0268266_10007006
1199 Ga0268266_10124907
1200 Ga0268266_10245011
1201 Ga0268266_10252326
1202 Ga0307517_10000248
1203 Ga0307515_10009680
1204 Ga0265325_10012086
1205 Ga0265339_10088044
1206 Ga0307509_10163135
1207 Ga0265314_10001303
1208 Ga0265342_10049441
1209 Ga0307516_10005798
1210 Ga0307516_10301053
1211 Ga0307516_10381653
1212 Ga0307409_100309008
1213 Ga0307411_10023737
1214 Ga0307411_10104535
1215 Ga0307510_10005757
1216 Ga0307510_10032941
1217 Ga0307510_10143752
1218 Ga0315911_1000031
1219 Ga0373926_0008522
1220 Ga0373934_0082862
1221 Ga0373923_0007087
1222 Ga0373936_0008136
1223 Ga0373936_0020245
1224 Ga0373954_0030072
1225 Ga0373956_0028056
1226 Ga0373957_0017565
1227 Ga0373946_0012170
1228 Ga0373955_0017402
1229 Ga0373931_0040298
1230 Ga0373927_0008550
1231 Ga0373927_0049818
1232 Ga0373927_0060777
1233 Ga0373927_0074088
1234 Ga0373933_0000017
1235 Ga0373947_0094044
1236 Ga0373937_0019212
1237 Ga0373925_0342696
1238 Ga0395899_0103171
1239 Ga0395900_0001375
1240 Ga0395900_0026854
1241 Ga0395898_0007695
1242 Ga0395898_0010806
1243 Ga0395898_0026044
1244 Ga0395898_0037513
1245 Ga0395898_0072212
1246 Ga0436364_0360454
1247 Ga0436364_0663056
1248 Ga0395901_0010335
1249 Ga0395901_0018894
1250 Ga0395901_0061353
1251 Ga0395901_0081909
1252 Ga0395901_0150546
1253 Ga0395901_0194173
1254 Ga0436365_0177040
1255 Ga0436365_1703603
1256 Ga0436361_0846802
1257 Ga0436361_1054725
1258 Ga0436363_0440729
1259 Ga0436363_0790499
1260 Ga0436362_1206031
1261 Ga0466972_0000244
1262 Ga0466966_0000274
1263 Ga0466961_0000863
1264 Ga0466961_0136997
1265 Ga0466963_0197798
1266 Ga0466964_0045414
1267 Ga0466968_0034582
1268 Ga0466968_0111420
1269 Ga0466957_0026774
1270 Ga0466957_0094901
1271 Ga0466960_0023875
1272 Ga0466959_0002607
1273 Ga0466959_0065017
1274 Ga0466967_0072897
1275 Ga0466967_0098227
1276 Ga0495617_016880
1277 Ga0495617_025149
1278 Ga0495603_0044042
1279 Ga0495603_0049060
1280 Ga0495603_0060381
1281 Ga0495629_0172608
1282 Ga0495638_0018073
1283 Ga0495641_0042516
1284 Ga0495651_0003754
1285 Ga0495651_0031752
1286 Ga0495651_0059602
1287 Ga0495653_0000286
1288 Ga0495653_0034757
1289 Ga0495580_0006452
1290 Ga0495580_0163371
1291 Ga0495582_0112119
1292 Ga0495639_0019062
1293 Ga0495639_0043260
1294 Ga0495664_0006470
1295 Ga0495585_0019640
1296 Ga0495585_0034591
1297 Ga0495594_0010211
1298 Ga0495596_0114045
1299 Ga0495607_0000667
1300 Ga0495607_0053189
1301 Ga0495606_0000155
1302 Ga0495606_0011554
1303 Ga0495606_0129642
1304 Ga0495608_0030200
1305 Ga0495628_0136011
1306 Ga0495630_0186402
1307 Ga0495631_0069131
1308 Ga0495637_0010025
1309 Ga0495643_0014139
1310 Ga0495644_0015814
1311 Ga0495648_0052283
1312 Ga0495666_0015022
1313 Ga0495652_0144722
1314 Ga0495665_0065411
1315 Ga0495640_0045286
1316 Ga0495586_0038421
1317 Ga0495609_0047079
1318 Ga0495621_0033541
1319 Ga0495645_0003177
1320 Ga0495645_0021412
1321 Ga0495645_0046785
1322 Ga0495622_0008965
1323 Ga0495667_0023331
1324 Ga0495656_0001572
1325 Ga0495656_0076039
1326 Ga0495668_0080503
1327 Ga0495634_0031563
1328 Ga0495634_0035258
1329 Ga0495625_0045484
1330 Ga0495635_0009287
1331 Ga0495635_0012597
1332 Ga0495661_0000039
1333 Ga0495661_0081372
1334 Ga0495588_0017002
1335 Ga0495657_0012563
1336 Ga0495657_0018881
1337 Ga0495599_0039925
1338 Ga0495623_0055224
1339 Ga0495646_0075060
1340 Ga0495658_0017406
1341 Ga0495658_0142435
1342 Ga0495669_0007996
1343 Ga0495669_0028340
1344 Ga0495613_0041984
1345 Ga0495613_0049506
1346 Ga0495670_0001688
1347 Ga0495671_0030659
1348 Ga0495649_0000421
1349 Ga0495649_0088976
1350 Ga0495649_0193840
1351 Ga0495581_0071390
1352 Ga0495581_0118143
1353 Ga0495581_0188183
1354 Ga0495604_0004189
1355 Ga0495604_0009398
1356 Ga0495636_0037840
1357 Ga0495674_0021298
1358 Ga0495674_0039757
1359 Ga0495674_0288354
1360 Ga0495676_0015755
1361 Ga0495676_0050440
1362 Ga0495676_0171736
1363 Ga0495680_0000837
1364 Ga0495683_0000357
1365 Ga0495687_059416
1366 Ga0495675_0007021
1367 Ga0495684_0014353
1368 Ga0495686_0129959
1369 Ga0495593_0009563
1370 Ga0495602_0019935
1371 Ga0495626_0065532
1372 Ga0496100_0238714
1373 Ga0496101_0013015
1374 Ga0496101_0054137
1375 Ga0496101_0096146
1376 Ga0496101_0184869
1377 Ga0496102_0038707
1378 Ga0496102_0286937
1379 Ga0496102_0297051
1380 Ga0496102_0314370
1381 Ga0496103_0010746
1382 Ga0496103_0144568
1383 Ga0496104_0042662
1384 Ga0496104_0053124
1385 Ga0496104_0063412
1386 Ga0496104_0070109
1387 Ga0496104_0133256
1388 Ga0496105_0026047
1389 Ga0496106_0001100
1390 Ga0496106_0019174
1391 Ga0496106_0083663
1392 Ga0496107_0001808
1393 Ga0496107_0079765
1394 Ga0496107_0150079
1395 Ga0496107_0239014
1396 Ga0496108_0000424
1397 Ga0496108_0052669
1398 Ga0496108_0493869
1399 Ga0496109_0000199
1400 Ga0496109_0116966
1401 Ga0496109_0121844
1402 Ga0496110_0018590
1403 Ga0496110_0124112
1404 Ga0496110_0203829
1405 Ga0496111_0032177
1406 Ga0496112_0000057
1407 Ga0496112_0003500
1408 Ga0496112_0167167
1409 Ga0496113_0018824
1410 Ga0496113_0026863
1411 Ga0496113_0062745
1412 Ga0496113_0114584
1413 Ga0496113_0126532
1414 Ga0496114_0009349
1415 Ga0496114_0084764
1416 Ga0496114_0268147
1417 Ga0496115_0001860
1418 Ga0496115_0016884
1419 Ga0496115_0065583
1420 Ga0496115_0080257
1421 Ga0496115_0142020
1422 Ga0496115_0193825
1423 Ga0496116_0009740
1424 Ga0496117_0217059
1425 Ga0496118_0049296
1426 Ga0496118_0079099
1427 Ga0496118_0082517
1428 Ga0496119_0008388
1429 Ga0496119_0030934
1430 Ga0496121_0002265
1431 Ga0496121_0002757
1432 Ga0496121_0012166
1433 Ga0496121_0014146
1434 Ga0496121_0044065
1435 Ga0496121_0053315
1436 Ga0496121_0074528
1437 Ga0496121_0098439
1438 Ga0496121_0110027
1439 Ga0496122_0078141
1440 Ga0496122_0096007
1441 Ga0496124_0079641
1442 Ga0496124_0211484
1443 Ga0496124_0214973
1444 Ga0496124_0288647
1445 Ga0496125_0000202
1446 Ga0496125_0002471
1447 Ga0496125_0011334
1448 Ga0496125_0042602
1449 Ga0496125_0052137
1450 Ga0496125_0085244
1451 Ga0496126_0001863
1452 Ga0496126_0003081
1453 Ga0496126_0007118
1454 Ga0496126_0013560
1455 Ga0496126_0018959
1456 Ga0496126_0077341
1457 Ga0496126_0087707
1458 Ga0496126_0087901
1459 Ga0496126_0101141
1460 Ga0496126_0101568
1461 Ga0496126_0165829
1462 Ga0496126_0199062
1463 Ga0496126_0200218
1464 Ga0495678_023205
1465 Ga0495678_030598
1466 Ga0495682_0016777
1467 Ga0501031_0006089
1468 Ga0501032_0000189
1469 Ga0501032_0035293
1470 Ga0501032_0053238
1471 Ga0501033_0000803
1472 Ga0501033_0031278
1473 Ga0501034_0019025
1474 Ga0501034_0035921
1475 Ga0501034_0110848
1476 Ga0501036_0000104
1477 Ga0501036_0070834
1478 Ga0501036_0079182
1479 Ga0501037_0000931
1480 Ga0501037_0048973
1481 Ga0501038_0000041
1482 Ga0501039_0000064
1483 Ga0501043_0002337
1484 Ga0501043_0069013
1485 Ga0501046_0086011
1486 Ga0501046_0221172
1487 Ga0501047_0003019
1488 Ga0501047_0049470
1489 Ga0501047_0164796
1490 Ga0501048_0033713
1491 Ga0501067_0077643
1492 Ga0501067_0233197
1493 Ga0501068_0075390
1494 Ga0501070_0000209
1495 Ga0501070_0107549
1496 Ga0501071_0135824
1497 Ga0501071_0272524
1498 Ga0501073_0001947
1499 Ga0501073_0046628
1500 Ga0501074_0011516
1501 Ga0501080_0012442
1502 Ga0501035_0000155
1503 Ga0501035_0043536
1504 Ga0501044_0007661
1505 Ga0501044_0049645
1506 Ga0501044_0061475
1507 Ga0501044_0081577
1508 nmdc:mga03683_26100_c1
1509 nmdc:mga00v17_27518_c1
1510 nmdc:mga0yw44_22305_c1
1511 nmdc:mga0yw44_3283_c1
1512 nmdc:mga0k408_74000_c1
1513 nmdc:mga06z11_191200_c1
1514 nmdc:mga06z11_2462_c1
1515 nmdc:mga06z11_38800_c1
1516 nmdc:mga06z11_6882_c1
1517 nmdc:mga04h51_6855_c1
1518 nmdc:mga08y16_166484_c1
1519 nmdc:mga0rr50_26450_c1
1520 nmdc:mga0sz30_23281_c1
1521 nmdc:mga0sz30_23478_c1
1522 nmdc:mga0sz30_6944_c1
1523 Ga0495601_0019431
1524 Ga0495601_0165937
1525 Ga0495612_0040748
1526 Ga0500635_0049929
1527 Ga0495595_0006001
1528 Ga0500643_000185
1529 Ga0500644_0029572
1530 Ga0500583_0045952
1531 Ga0500651_0135026
1532 Ga0500566_0014798
1533 Ga0500566_0016255
1534 Ga0500640_059885
1535 Ga0500650_0119503
1536 Ga0500555_031027
1537 Ga0500556_0000011
1538 Ga0500557_000103
1539 Ga0500562_007238
1540 Ga0500572_009863
1541 Ga0500594_0043821
1542 Ga0500594_0061885
1543 Ga0500595_000393
1544 Ga0500595_001825
1545 Ga0500595_003227
1546 Ga0500595_006282
1547 Ga0500595_013810
1548 Ga0500595_033120
1549 Ga0500607_110980
1550 Ga0500608_051073
1551 Ga0500618_001048
1552 Ga0500642_0000030
1553 Ga0500642_0000325
1554 Ga0500642_0022436
1555 Ga0500642_0060581
1556 Ga0500652_000505
1557 Ga0500652_015160
1558 Ga0500559_0000802
1559 Ga0500568_0001554
1560 Ga0500568_0008152
1561 Ga0500577_0000303
1562 Ga0500586_001174
1563 Ga0500590_074384
1564 Ga0500604_0001620
1565 Ga0500616_0000026
1566 Ga0500622_0019541
1567 Ga0500622_0047628
1568 Ga0500622_0122042
1569 Ga0500622_0170484
1570 Ga0500627_0007291
1571 Ga0500627_0111619
1572 Ga0500638_118211
1573 Ga0500636_0008206
1574 Ga0500636_0081485
1575 Ga0500645_033861
1576 Ga0500609_000865
1577 Ga0500656_007073
1578 Ga0500599_000183
1579 Ga0500601_000677
1580 Ga0500661_001666
1581 Ga0466962_0021638
1582 Ga0466962_0062002
1583 2507511179
1584 2508693724
1585 2509146860
1586 2511396500
1587 2513623627
1588 2513637313
1589 2513650872
1590 2513655178
1591 2513676694
1592 2513693390
1593 2513700462
1594 2513719640
1595 2513861432
1596 2513874801
1597 2513892228
1598 2513915798
1599 2514010481
1600 2515625255
1601 2517100750
1602 2517894898
1603 2524438038
1604 2524466587
1605 2524534669
1606 2528849156
1607 2596374145
1608 2603862488
1609 2617350578
1610 2617373299
1611 2671123006
1612 2723848303
1613 2728748783
1614 2745081005
1615 2793061883
1616 2793071993
1617 2793079617
1618 2805916802
1619 2818238314
1620 2824603973
1621 2824611554
1622 2824622482
1623 2824630338
1624 2824638334
1625 2824645948
1626 2824655422
1627 2824663288
1628 2824673562
1629 2824680936
1630 2824690315
1631 2824701275
1632 2824707099
1633 2824716069
1634 2824725925
1635 2824734739
1636 2824747688
1637 2824754585
1638 2824765369
1639 2824773468
1640 2829750169
1641 2838128048
1642 2841943345
1643 2841953926
1644 2841962042
1645 2841968018
1646 2841981273
1647 2841988144
1648 2842042547
1649 2842050590
1650 2842701092
1651 2844316753
1652 2847938719
1653 2847944083
1654 2849081693
1655 2857512343
1656 2857529828
1657 2861692896
1658 2874597913
1659 2874607483
1660 2874619716
1661 2874626191
1662 2874631390
1663 2874651441
1664 2876763022
1665 2876776513
1666 2876814835
1667 2876824897
1668 2879081624
1669 2879088306
1670 2879108976
1671 2879111033
1672 2879134201
1673 2879147861
1674 2881365929
1675 2881667480
1676 2885366780
1677 2885383103
1678 2885415886
1679 2888381362
1680 2888389276
1681 2888421782
1682 2889037174
1683 2889311416
1684 2893069527
1685 2903733808
1686 2903756569
1687 2903769758
1688 2904669209
1689 2904698070
1690 2904706152
1691 2904718827
1692 2906606745
1693 2906611633
1694 2906627471
1695 2906639612
1696 2906644907
1697 2906660645
1698 2908745218
1699 2908763107
1700 2908781757
1701 2909046020
1702 2919077316
1703 2922361313
1704 2922371009
1705 2922392934
1706 2922401162
1707 2922427714
1708 2928129729
1709 2929619407
1710 2929628123
1711 2932785706
1712 2932799066
1713 2932808518
1714 2932813703
1715 2932822329
1716 2932830770
1717 2933581327
1718 2935612592
1719 2935620817
1720 2935632339
1721 2935639896
1722 2935653511
1723 2935662260
1724 2935667250
1725 2935677671
1726 2935690390
1727 2935697287
1728 2935705006
1729 2935717914
1730 2935726936
1731 2935735706
1732 2935745023
1733 2935755400
1734 2935762093
1735 2935776155
1736 2935781988
1737 2935792012
1738 2935800338
1739 2935803592
1740 2935811512
1741 2935824081
1742 2935829379
1743 2935842643
1744 2935852772
1745 2935858625
1746 2935866954
1747 2935877084
1748 2935884719
1749 2935912076
1750 2935922287
1751 2935929105
1752 2935935736
1753 2935947302
1754 2935953604
1755 2935961884
1756 2935968630
1757 2935976836
1758 2935986202
1759 2935995280
1760 2936004167
1761 2936016562
1762 2936025124
1763 2936034037
1764 2936038094
1765 2936052023
1766 2936059796
1767 2940561319
1768 2941508286
1769 2941515208
1770 2941524217
1771 2941533540
1772 2941544510
1773 3005477429
1774 3005487516
1775 3005511357
1776 3005592922
1777 3005596362
1778 3005712444
1779 3005719518
1780 8006930577
1781 8006933806
1782 8006969604
1783 8006983478
1784 8006988755
1785 8006998684
1786 8016516632
1787 8016524016
1788 8016537558
1789 8016541825
1790 8016567212
1791 8016579925
1792 8016588920
1793 8016597773
1794 8016604539
1795 8016620475
1796 8016629503
1797 8016637893
1798 8017059920
1799 8019537232
1800 8019548441
1801 8019559735
1802 8019569843
1803 8019579416
1804 8019597469
1805 8019604212
1806 8019614317
1807 8019624960
1808 8019650211
1809 8019674614
1810 8055749336
1811 8056675793
1812 8056689676
1813 8056693189
1814 8056973587

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

2

159

0.98

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

2

92

0.87

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

185

334

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j39-assembly1.cif.gz_A crystal structure of cmis2 with inhibitor 0.9715 1 32
6j38-assembly1.cif.gz_B-2 crystal structure of cmis2 0.9662 1 32
7zca-assembly1.cif.gz_A-2 crystal structure of the f191m/f201a variant of variovorax paradoxus indole monooxygenase (vpinda1) in complex with benzyl phenyl sulfoxide 0.9619 1 32
6pvi-assembly1.cif.gz_A crystal structure of phqk in complex with paraherquamide l 0.9567 2 32
6pvj-assembly1.cif.gz_A crystal structure of phqk in complex with malbrancheamide c 0.9548 2 32
ID Description Score Start End Superfamily
af_P75728_4_256_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.96 2 28 3.50.50.60
af_F1QDN5_95_460_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9467 3 32 3.50.50.60
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9439 3 30 3.50.50.60
af_Q46904_1_359_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9434 2 28 3.50.50.60
2gqfA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9384 3 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A0L0LZ89-F1-model_v4 deleted 0.9981 1 115
AF-A0A7C2WQY9-F1-model_v4 6-phosphogluconate dehydrogenase 0.9929 1 115 GO:0004616
GO:0050661
AF-A0A2M7WZ84-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9902 1 153 GO:0004616
GO:0050661
AF-A0A525I822-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9889 1 88 GO:0004616
GO:0050661
AF-A0A7W0X915-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9877 1 134 GO:0004616
GO:0050661

Map