F485352

General Info

Members Datasets Scaffolds Average Seq Length
907 511 1814 156

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10198599|Ga0114129_101985993
Length 180
Sequence VTYEGELIMQARIKNPAFVVPGAMQALQALAASAEKGGVPKRTLSLIHLRISQINGCGVCLDLHLRGFHEEETNERLLTVAGWRDAPYFTDAERAALALAEAVTRLADRPDPVPDAIWDEAAKHYDERQLGALVLGISAVNVWNRLNVSTRQVAGEWAAASEGQKRAESRTSNPAATATA

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
115 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
116 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
214 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
215 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
216 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
217 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
218 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
219 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
220 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
221 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
222 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
223 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
224 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
227 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
252 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
253 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
254 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
262 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
263 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
284 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
301 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
302 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
303 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
304 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
305 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
314 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
326 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
329 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
330 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
331 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
348 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
349 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
352 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
353 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
356 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
357 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
358 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
359 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
362 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
363 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
364 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
367 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
368 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
369 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
370 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
371 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
372 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
373 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
374 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
375 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
376 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
379 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
380 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
381 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
382 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
383 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
384 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
385 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
386 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
387 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
388 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
389 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
390 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
391 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
392 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
393 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
394 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
395 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
396 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
397 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
398 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
399 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
400 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
401 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
402 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
403 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
404 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
405 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
406 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
407 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
408 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
409 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
410 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
411 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
412 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
413 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
414 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
415 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
416 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
417 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
418 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
419 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
420 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
421 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
422 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
423 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
424 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
425 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
426 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
427 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
428 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
429 2626541554 Frankia sp. AvcI.1 Isolate Nodule
430 2643221599 Rhizobium sp. Root708 Isolate Unclassified
431 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
432 2718217882 Rhizobium sp. N741 Isolate Nodule
433 2718218009 Rhizobium sp. N561 Isolate Nodule
434 2718218363 Rhizobium sp. N113 Isolate Nodule
435 2718218365 Rhizobium sp. N731 Isolate Nodule
436 2718218366 Rhizobium sp. N621 Isolate Nodule
437 2721755514 Rhizobium sp. N6212 Isolate Nodule
438 2721755810 Rhizobium sp. N871 Isolate Nodule
439 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
440 2728369365 Rhizobium sp. N1341 Isolate Nodule
441 2728369397 Rhizobium sp. N1314 Isolate Nodule
442 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
443 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
444 2791355260 Rhizobium sp. L9 Isolate Nodule
445 2791355264 Rhizobium sp. S9 Isolate Nodule
446 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
447 2802429633 Rhizobium anhuiense J3 Isolate Nodule
448 2802429634 Rhizobium anhuiense S10 Isolate Nodule
449 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
450 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
451 2802429637 Rhizobium anhuiense C15 Isolate Nodule
452 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
453 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
454 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
455 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
456 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
457 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
458 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
459 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
460 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
461 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
462 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
463 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
464 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
465 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
466 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
467 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
468 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
469 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
470 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
471 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
472 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
473 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
474 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
475 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
476 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
477 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
478 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
479 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
480 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
481 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
482 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
483 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
484 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
485 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
486 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
487 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
488 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
489 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
490 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
491 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
492 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
493 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
494 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
495 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
496 2996887358 Rhizobium sp. R711 Isolate Nodule
497 2996893221 Rhizobium sp. R635 Isolate Nodule
498 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
499 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
500 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
501 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
502 8005321885 Rhizobium sp. R72 Isolate Nodule
503 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
504 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
505 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
506 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
507 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
508 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
509 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
510 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
511 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.1
Metatranscriptomes 0.55
Isolates 12.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.46
Nodule 9.92
Rhizoplane 5.07
Rhizosphere 65.16
Stem 0
Stem Tuber 0
Unclassified 3.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10198599 3300009147 Bacteria 2718
2 JGI25158J39367_1001249 3300002739 Bacteria 4549
3 JGI25159J45721_1005399 3300002987 Bacteria 4018
4 JGI25153J46596_10006039 3300003215 Bacteria 6224
5 JGI25153J46596_10021365 3300003215 Bacteria 2414
6 JGI25160J50197_1001537 3300003354 Bacteria 11423
7 JGI25160J50197_1029600 3300003354 Bacteria 1444
8 JGI25161J50226_1000463 3300003374 Bacteria 18654
9 JGI25161J50226_1008346 3300003374 Bacteria 1606
10 Ga0055526_1003736 3300003771 Bacteria 9505
11 Ga0055526_1012487 3300003771 Bacteria 3697
12 Ga0055524_1006013 3300003775 Bacteria 5328
13 Ga0055528_1011201 3300003790 Bacteria 3583
14 Ga0055528_1035642 3300003790 Bacteria 1204
15 Ga0055540_1002996 3300003792 Bacteria 8457
16 Ga0055540_1023510 3300003792 Bacteria 1551
17 Ga0055543_1000021 3300004625 Bacteria 150116
18 Ga0055543_1000591 3300004625 Bacteria 19944
19 Ga0065165_1002401 3300005262 Bacteria 16003
20 Ga0065712_10164627 3300005290 Bacteria 1280
21 Ga0070658_10006016 3300005327 Bacteria 9843
22 Ga0070658_10076404 3300005327 Bacteria 2747
23 Ga0070683_100152100 3300005329 Bacteria 2194
24 Ga0070683_100338461 3300005329 Unclassified 1433
25 Ga0070690_100753207 3300005330 Bacteria 752
26 Ga0068869_100019939 3300005334 Bacteria 4591
27 Ga0068869_100047278 3300005334 Bacteria 3107
28 Ga0068869_100152072 3300005334 Bacteria 1796
29 Ga0070666_10190980 3300005335 Bacteria 1439
30 Ga0070680_100086284 3300005336 Bacteria 2594
31 Ga0070660_100032812 3300005339 Bacteria 3911
32 Ga0070668_100358640 3300005347 Bacteria 1236
33 Ga0070669_100769514 3300005353 Unclassified 817
34 Ga0070675_100291754 3300005354 Bacteria 1435
35 Ga0070675_100622863 3300005354 Bacteria 980
36 Ga0070671_101612622 3300005355 Bacteria 575
37 Ga0070659_101465187 3300005366 Bacteria 608
38 Ga0070714_100095478 3300005435 Bacteria 2611
39 Ga0070714_100137393 3300005435 Bacteria 2190
40 Ga0070713_100396104 3300005436 Bacteria 1289
41 Ga0070713_101384098 3300005436 Bacteria 682
42 Ga0070711_100002332 3300005439 Bacteria 10785
43 Ga0070711_100674830 3300005439 Unclassified 868
44 Ga0070705_100479682 3300005440 Bacteria 939
45 Ga0070663_100667365 3300005455 Bacteria 881
46 Ga0070663_100969648 3300005455 Bacteria 738
47 Ga0070663_102101182 3300005455 Bacteria 509
48 Ga0070678_100015069 3300005456 Bacteria 4901
49 Ga0070662_100145660 3300005457 Bacteria 1839
50 Ga0070681_10057249 3300005458 Bacteria 3878
51 Ga0070681_10077610 3300005458 Bacteria 3279
52 Ga0070681_10242083 3300005458 Bacteria 1717
53 Ga0068867_100941102 3300005459 Bacteria 780
54 Ga0070706_100007435 3300005467 Bacteria 10273
55 Ga0070707_100279434 3300005468 Bacteria 1623
56 Ga0070707_101422746 3300005468 Bacteria 660
57 Ga0070698_100639517 3300005471 Bacteria 1005
58 Ga0070699_100299395 3300005518 Bacteria 1443
59 Ga0070699_100397347 3300005518 Bacteria 1246
60 Ga0070679_100026849 3300005530 Bacteria 5663
61 Ga0070679_100084582 3300005530 Bacteria 3160
62 Ga0070679_100499093 3300005530 Bacteria 1161
63 Ga0070679_101736848 3300005530 Bacteria 572
64 Ga0070684_100036209 3300005535 Bacteria 4228
65 Ga0070684_100168617 3300005535 Bacteria 1988
66 Ga0070684_100644409 3300005535 Bacteria 986
67 Ga0070697_100313233 3300005536 Bacteria 1351
68 Ga0070697_100865924 3300005536 Bacteria 801
69 Ga0068853_100456012 3300005539 Bacteria 1203
70 Ga0068853_101391586 3300005539 Bacteria 678
71 Ga0070686_100420663 3300005544 Bacteria 1021
72 Ga0070665_100000728 3300005548 Bacteria 43882
73 Ga0070665_100000791 3300005548 Bacteria 41601
74 Ga0070665_100298875 3300005548 Bacteria 1612
75 Ga0070665_100469893 3300005548 Bacteria 1268
76 Ga0068855_100008482 3300005563 Bacteria 12423
77 Ga0068855_100028847 3300005563 Bacteria 6640
78 Ga0068855_100229948 3300005563 Bacteria 2077
79 Ga0068855_100383538 3300005563 Bacteria 1543
80 Ga0068855_100422172 3300005563 Bacteria 1458
81 Ga0068855_101137067 3300005563 Bacteria 815
82 Ga0070664_101163525 3300005564 Unclassified 727
83 Ga0068857_100029109 3300005577 Bacteria 4874
84 Ga0068857_100067585 3300005577 Bacteria 3181
85 Ga0068854_100467312 3300005578 Bacteria 1057
86 Ga0068856_100465624 3300005614 Unclassified 1285
87 Ga0068856_101192112 3300005614 Bacteria 778
88 Ga0068856_101920824 3300005614 Bacteria 603
89 Ga0068852_100382396 3300005616 Bacteria 1381
90 Ga0068852_100730430 3300005616 Bacteria 1002
91 Ga0068859_100118930 3300005617 Bacteria 2708
92 Ga0068859_100212397 3300005617 Bacteria 2021
93 Ga0068864_100023676 3300005618 Bacteria 5159
94 Ga0068864_100068003 3300005618 Bacteria 3094
95 Ga0068864_100229661 3300005618 Unclassified 1716
96 Ga0068861_100337047 3300005719 Bacteria 1319
97 Ga0068870_10127815 3300005840 Bacteria 1472
98 Ga0068863_100002809 3300005841 Bacteria 17251
99 Ga0068863_100113646 3300005841 Unclassified 2579
100 Ga0068863_101303125 3300005841 Unclassified 733
101 Ga0068858_100046662 3300005842 Bacteria 4016
102 Ga0068858_100074409 3300005842 Bacteria 3154
103 Ga0068858_100698504 3300005842 Bacteria 987
104 Ga0068860_100102994 3300005843 Bacteria 2724
105 Ga0068862_100076450 3300005844 Bacteria 2898
106 Ga0068862_100122152 3300005844 Unclassified 2296
107 Ga0081455_10225778 3300005937 Bacteria 1385
108 Ga0081455_10291286 3300005937 Bacteria 1175
109 Ga0081539_10004015 3300005985 Bacteria 16914
110 Ga0081539_10010322 3300005985 Bacteria 7604
111 Ga0081539_10028448 3300005985 Bacteria 3514
112 Ga0070717_11317747 3300006028 Bacteria 656
113 Ga0075365_10016164 3300006038 Bacteria 4531
114 Ga0075365_10089833 3300006038 Bacteria 2092
115 Ga0075365_10197780 3300006038 Bacteria 1408
116 Ga0075368_10142881 3300006042 Bacteria 998
117 Ga0075368_10271186 3300006042 Bacteria 728
118 Ga0075363_100299148 3300006048 Bacteria 933
119 Ga0075364_10034376 3300006051 Bacteria 3269
120 Ga0070715_10002024 3300006163 Bacteria 6113
121 Ga0070716_100003137 3300006173 Bacteria 7726
122 Ga0070716_100274077 3300006173 Bacteria 1161
123 Ga0070716_100720123 3300006173 Bacteria 764
124 Ga0070712_100000811 3300006175 Bacteria 18572
125 Ga0070712_100004288 3300006175 Bacteria 8783
126 Ga0070712_100048063 3300006175 Bacteria 2956
127 Ga0075362_10176267 3300006177 Bacteria 1034
128 Ga0075367_10037081 3300006178 Bacteria 2830
129 Ga0075367_10054071 3300006178 Bacteria 2380
130 Ga0075367_10074206 3300006178 Bacteria 2051
131 Ga0075367_10133979 3300006178 Bacteria 1532
132 Ga0075367_10534822 3300006178 Bacteria 744
133 Ga0075366_10013745 3300006195 Bacteria 4612
134 Ga0075366_10058999 3300006195 Bacteria 2279
135 Ga0075366_10177987 3300006195 Bacteria 1291
136 Ga0097621_100494068 3300006237 Bacteria 1108
137 Ga0075370_10011541 3300006353 Bacteria 4646
138 Ga0075370_10168720 3300006353 Bacteria 1286
139 Ga0075370_10299398 3300006353 Bacteria 956
140 Ga0068871_100463377 3300006358 Bacteria 1138
141 Ga0075428_100605178 3300006844 Bacteria 1170
142 Ga0075430_100937093 3300006846 Unclassified 713
143 Ga0075431_100098700 3300006847 Bacteria 3015
144 Ga0075431_100371664 3300006847 Bacteria 1435
145 Ga0075433_10001208 3300006852 Bacteria 18831
146 Ga0075433_10012335 3300006852 Bacteria 6897
147 Ga0075433_10028698 3300006852 Bacteria 4733
148 Ga0075433_11233745 3300006852 Bacteria 648
149 Ga0075434_100003941 3300006871 Bacteria 13299
150 Ga0075434_100011264 3300006871 Bacteria 8424
151 Ga0075434_100040251 3300006871 Bacteria 4629
152 Ga0075434_100052129 3300006871 Bacteria 4065
153 Ga0075434_100056525 3300006871 Bacteria 3900
154 Ga0075434_100373812 3300006871 Bacteria 1446
155 Ga0075429_100088861 3300006880 Bacteria 2693
156 Ga0068865_100108053 3300006881 Bacteria 2047
157 Ga0068865_100346794 3300006881 Bacteria 1202
158 Ga0097620_100118945 3300006931 Bacteria 2708
159 Ga0097620_100212395 3300006931 Bacteria 2021
160 Ga0075435_100022058 3300007076 Bacteria 4908
161 Ga0075435_100130969 3300007076 Bacteria 2099
162 Ga0075435_100466990 3300007076 Bacteria 1089
163 Ga0099794_10003779 3300007265 Bacteria 5840
164 Ga0105251_10014997 3300009011 Bacteria 4252
165 Ga0105240_10000236 3300009093 Bacteria 110204
166 Ga0105240_10027757 3300009093 Bacteria 7409
167 Ga0105240_10146629 3300009093 Bacteria 2816
168 Ga0105240_10694477 3300009093 Bacteria 1111
169 Ga0105240_11205953 3300009093 Bacteria 801
170 Ga0111539_11753926 3300009094 Bacteria 720
171 Ga0105245_10680151 3300009098 Bacteria 1061
172 Ga0105245_11250084 3300009098 Bacteria 791
173 Ga0114129_10001748 3300009147 Bacteria 29570
174 Ga0114129_10184658 3300009147 Bacteria 2835
175 Ga0114129_10499196 3300009147 Bacteria 1590
176 Ga0105243_10057884 3300009148 Bacteria 3088
177 Ga0105243_12015925 3300009148 Bacteria 612
178 Ga0105241_10614057 3300009174 Bacteria 984
179 Ga0105242_10276255 3300009176 Bacteria 1524
180 Ga0105242_10431605 3300009176 Bacteria 1237
181 Ga0105248_10057210 3300009177 Bacteria 4376
182 Ga0105248_10225927 3300009177 Bacteria 2107
183 Ga0105237_10102750 3300009545 Bacteria 2850
184 Ga0105237_10121540 3300009545 Bacteria 2606
185 Ga0105237_10148699 3300009545 Bacteria 2338
186 Ga0105237_10365467 3300009545 Bacteria 1447
187 Ga0105237_10792101 3300009545 Bacteria 955
188 Ga0105238_10018641 3300009551 Bacteria 7067
189 Ga0105238_10681464 3300009551 Bacteria 1039
190 Ga0105238_10706887 3300009551 Bacteria 1020
191 Ga0105238_11721024 3300009551 Bacteria 658
192 Ga0105249_10082992 3300009553 Bacteria 2982
193 Ga0105249_10135024 3300009553 Unclassified 2360
194 Ga0105249_10419582 3300009553 Bacteria 1371
195 Ga0105239_10121061 3300010375 Bacteria 2906
196 Ga0105239_10995605 3300010375 Bacteria 964
197 Ga0105239_11295452 3300010375 Bacteria 840
198 Ga0105239_11369391 3300010375 Bacteria 817
199 Ga0105246_10014526 3300011119 Bacteria 4953
200 Ga0105246_10726432 3300011119 Bacteria 873
201 Ga0157371_10146701 3300013102 Bacteria 1681
202 Ga0157371_10865301 3300013102 Bacteria 684
203 Ga0157370_10007688 3300013104 Bacteria 11695
204 Ga0157370_10034135 3300013104 Bacteria 4957
205 Ga0157370_10250016 3300013104 Bacteria 1640
206 Ga0157370_10619621 3300013104 Bacteria 990
207 Ga0157374_10079900 3300013296 Bacteria 3100
208 Ga0163162_10157402 3300013306 Bacteria 2392
209 Ga0157372_10197434 3300013307 Bacteria 2330
210 Ga0157372_10282003 3300013307 Unclassified 1931
211 Ga0157372_10365459 3300013307 Bacteria 1681
212 Ga0157375_10100228 3300013308 Bacteria 2977
213 Ga0157375_10189132 3300013308 Bacteria 2213
214 Ga0157375_10241809 3300013308 Bacteria 1965
215 Ga0157375_10252261 3300013308 Bacteria 1925
216 Ga0163163_10024959 3300014325 Bacteria 5692
217 Ga0163163_10030962 3300014325 Bacteria 5160
218 Ga0163163_10533614 3300014325 Bacteria 1236
219 Ga0163163_11049830 3300014325 Bacteria 878
220 Ga0163163_11060929 3300014325 Bacteria 873
221 Ga0163163_12210481 3300014325 Bacteria 609
222 Ga0157377_10113719 3300014745 Unclassified 1630
223 Ga0157379_10021508 3300014968 Bacteria 5710
224 Ga0157379_10146089 3300014968 Bacteria 2132
225 Ga0157379_10630833 3300014968 Bacteria 1002
226 Ga0157379_10962201 3300014968 Bacteria 812
227 Ga0197907_11104677 3300020069 Bacteria 701
228 Ga0206356_10551594 3300020070 Bacteria 698
229 Ga0206350_10448529 3300020080 Bacteria 936
230 Ga0206353_11551518 3300020082 Bacteria 783
231 Ga0213875_10181766 3300021388 Bacteria 988
232 Ga0224712_10140603 3300022467 Bacteria 1062
233 Ga0209436_100004 3300025208 Bacteria 196698
234 Ga0207425_1000736 3300025245 Bacteria 17202
235 Ga0207425_1003419 3300025245 Bacteria 5088
236 Ga0209129_1000622 3300025258 Bacteria 23811
237 Ga0209129_1008265 3300025258 Bacteria 2922
238 Ga0209673_1002989 3300025273 Bacteria 10528
239 Ga0209673_1011979 3300025273 Bacteria 3530
240 Ga0209673_1019500 3300025273 Bacteria 2432
241 Ga0209130_1000001 3300025284 Bacteria 831557
242 Ga0209675_1048502 3300025291 Bacteria 888
243 Ga0209676_1080480 3300025292 Bacteria 744
244 Ga0209025_1000072 3300025294 Bacteria 283452
245 Ga0209025_1008821 3300025294 Bacteria 7164
246 Ga0209025_1077979 3300025294 Bacteria 1139
247 Ga0209564_1001641 3300025295 Bacteria 21606
248 Ga0209564_1001805 3300025295 Bacteria 19744
249 Ga0209564_1002167 3300025295 Bacteria 16556
250 Ga0209758_1000053 3300025297 Bacteria 337751
251 Ga0209758_1003660 3300025297 Bacteria 13697
252 Ga0209758_1005280 3300025297 Bacteria 10097
253 Ga0209758_1006260 3300025297 Bacteria 8663
254 Ga0209758_1036886 3300025297 Bacteria 1899
255 Ga0209758_1146557 3300025297 Bacteria 605
256 Ga0209256_1008889 3300025299 Bacteria 4534
257 Ga0209256_1012955 3300025299 Bacteria 3135
258 Ga0209256_1033728 3300025299 Bacteria 1372
259 Ga0207426_1000005 3300025302 Bacteria 1037188
260 Ga0207426_1000035 3300025302 Bacteria 448327
261 Ga0209051_1004166 3300025303 Bacteria 9037
262 Ga0209051_1012390 3300025303 Bacteria 4127
263 Ga0209051_1022802 3300025303 Bacteria 2624
264 Ga0209051_1040134 3300025303 Bacteria 1681
265 Ga0209257_1021221 3300025304 Bacteria 2368
266 Ga0207642_10069267 3300025899 Bacteria 1672
267 Ga0207710_10131906 3300025900 Bacteria 1200
268 Ga0207685_10029134 3300025905 Bacteria 1951
269 Ga0207699_10025679 3300025906 Bacteria 3237
270 Ga0207699_10129378 3300025906 Bacteria 1644
271 Ga0207645_10130102 3300025907 Bacteria 1638
272 Ga0207705_10010749 3300025909 Bacteria 6645
273 Ga0207705_10033327 3300025909 Bacteria 3679
274 Ga0207705_10254393 3300025909 Bacteria 1340
275 Ga0207684_10023669 3300025910 Bacteria 5243
276 Ga0207707_10047727 3300025912 Bacteria 3729
277 Ga0207707_10052017 3300025912 Bacteria 3567
278 Ga0207707_10121000 3300025912 Bacteria 2289
279 Ga0207707_10266303 3300025912 Bacteria 1486
280 Ga0207707_10361175 3300025912 Unclassified 1250
281 Ga0207695_10001342 3300025913 Bacteria 41747
282 Ga0207695_10008466 3300025913 Bacteria 12875
283 Ga0207695_10181605 3300025913 Bacteria 2025
284 Ga0207695_10583333 3300025913 Bacteria 999
285 Ga0207671_10257114 3300025914 Bacteria 1374
286 Ga0207693_10007740 3300025915 Bacteria 8818
287 Ga0207693_10042995 3300025915 Bacteria 3557
288 Ga0207693_10156613 3300025915 Bacteria 1792
289 Ga0207663_10012062 3300025916 Bacteria 4660
290 Ga0207663_10087480 3300025916 Bacteria 2058
291 Ga0207660_10075463 3300025917 Bacteria 2463
292 Ga0207662_10014961 3300025918 Bacteria 4358
293 Ga0207662_10566934 3300025918 Bacteria 787
294 Ga0207657_10042626 3300025919 Bacteria 4002
295 Ga0207652_10052481 3300025921 Bacteria 3499
296 Ga0207652_10359455 3300025921 Bacteria 1314
297 Ga0207652_10725081 3300025921 Bacteria 886
298 Ga0207646_10028312 3300025922 Bacteria 5102
299 Ga0207646_10044882 3300025922 Bacteria 3967
300 Ga0207646_10047226 3300025922 Bacteria 3862
301 Ga0207681_10255482 3300025923 Bacteria 1370
302 Ga0207681_10958131 3300025923 Bacteria 717
303 Ga0207694_10080762 3300025924 Bacteria 2552
304 Ga0207694_10100228 3300025924 Bacteria 2294
305 Ga0207650_10353637 3300025925 Bacteria 1209
306 Ga0207659_10235378 3300025926 Bacteria 1479
307 Ga0207659_11133907 3300025926 Bacteria 673
308 Ga0207700_10172853 3300025928 Bacteria 1804
309 Ga0207700_10538849 3300025928 Bacteria 1035
310 Ga0207700_10636868 3300025928 Bacteria 950
311 Ga0207700_10941549 3300025928 Bacteria 773
312 Ga0207664_10189038 3300025929 Bacteria 1772
313 Ga0207664_10203727 3300025929 Bacteria 1709
314 Ga0207644_10006295 3300025931 Bacteria 7730
315 Ga0207690_10221404 3300025932 Bacteria 1448
316 Ga0207690_10260348 3300025932 Bacteria 1344
317 Ga0207706_10123463 3300025933 Bacteria 2278
318 Ga0207706_10238832 3300025933 Bacteria 1589
319 Ga0207669_10207959 3300025937 Bacteria 1426
320 Ga0207704_10173973 3300025938 Bacteria 1548
321 Ga0207704_10427062 3300025938 Bacteria 1052
322 Ga0207704_10518823 3300025938 Bacteria 963
323 Ga0207665_10006502 3300025939 Bacteria 7748
324 Ga0207665_10154841 3300025939 Bacteria 1644
325 Ga0207691_10706598 3300025940 Bacteria 850
326 Ga0207711_10241084 3300025941 Bacteria 1658
327 Ga0207711_10402706 3300025941 Bacteria 1272
328 Ga0207711_10825449 3300025941 Bacteria 863
329 Ga0207689_10096486 3300025942 Bacteria 2428
330 Ga0207689_10096567 3300025942 Bacteria 2427
331 Ga0207689_10113796 3300025942 Bacteria 2224
332 Ga0207661_10192740 3300025944 Bacteria 1788
333 Ga0207661_11138195 3300025944 Unclassified 718
334 Ga0207679_10456244 3300025945 Bacteria 1134
335 Ga0207679_10920749 3300025945 Unclassified 800
336 Ga0207667_10042630 3300025949 Bacteria 4822
337 Ga0207667_10324169 3300025949 Bacteria 1573
338 Ga0207667_10324704 3300025949 Bacteria 1572
339 Ga0207667_11370360 3300025949 Unclassified 681
340 Ga0207651_10489016 3300025960 Bacteria 1062
341 Ga0207712_10107157 3300025961 Unclassified 2089
342 Ga0207712_11303352 3300025961 Bacteria 649
343 Ga0207668_10299870 3300025972 Bacteria 1326
344 Ga0207658_10336268 3300025986 Bacteria 1311
345 Ga0207703_10017685 3300026035 Bacteria 5566
346 Ga0207703_10083515 3300026035 Bacteria 2669
347 Ga0207639_10489589 3300026041 Bacteria 1122
348 Ga0207678_10207851 3300026067 Bacteria 1674
349 Ga0207678_10264635 3300026067 Bacteria 1474
350 Ga0207678_10717776 3300026067 Bacteria 880
351 Ga0207678_10968642 3300026067 Bacteria 753
352 Ga0207708_10043077 3300026075 Bacteria 3440
353 Ga0207702_10080335 3300026078 Bacteria 2829
354 Ga0207702_10390682 3300026078 Unclassified 1340
355 Ga0207641_10007276 3300026088 Bacteria 9221
356 Ga0207641_10155165 3300026088 Bacteria 2076
357 Ga0207641_10179393 3300026088 Bacteria 1939
358 Ga0207648_10038978 3300026089 Bacteria 4179
359 Ga0207648_10118613 3300026089 Bacteria 2325
360 Ga0207648_10925622 3300026089 Bacteria 815
361 Ga0207676_10115941 3300026095 Unclassified 2250
362 Ga0207676_10633666 3300026095 Bacteria 1030
363 Ga0207674_10006588 3300026116 Bacteria 13651
364 Ga0207674_10075071 3300026116 Bacteria 3391
365 Ga0207674_10103624 3300026116 Bacteria 2824
366 Ga0207674_11747576 3300026116 Bacteria 590
367 Ga0207675_100062979 3300026118 Bacteria 3465
368 Ga0207675_100154707 3300026118 Bacteria 2184
369 Ga0207683_10081047 3300026121 Unclassified 2880
370 Ga0207698_10302307 3300026142 Bacteria 1490
371 Ga0209588_1005097 3300027671 Bacteria 3743
372 Ga0209813_10096829 3300027866 Bacteria 998
373 Ga0268266_10000385 3300028379 Bacteria 67236
374 Ga0268266_10005306 3300028379 Bacteria 12083
375 Ga0268266_10184131 3300028379 Bacteria 1903
376 Ga0268266_10263218 3300028379 Bacteria 1599
377 Ga0268264_10522491 3300028381 Bacteria 1161
378 Ga0268264_10683321 3300028381 Bacteria 1018
379 Ga0265319_1056801 3300028563 Bacteria 1278
380 Ga0307515_10006687 3300028794 Bacteria 22962
381 Ga0307515_10020927 3300028794 Bacteria 11627
382 Ga0307515_10608019 3300028794 Bacteria 704
383 Ga0265338_10045794 3300028800 Bacteria 4018
384 Ga0265338_10047201 3300028800 Bacteria 3936
385 Ga0265332_10014480 3300031238 Bacteria 3489
386 Ga0265320_10186864 3300031240 Bacteria 927
387 Ga0265325_10085388 3300031241 Bacteria 1564
388 Ga0265331_10074271 3300031250 Bacteria 1587
389 Ga0307513_10006532 3300031456 Bacteria 15229
390 Ga0307513_10017597 3300031456 Bacteria 8568
391 Ga0307513_10539324 3300031456 Bacteria 880
392 Ga0307513_10707989 3300031456 Bacteria 713
393 Ga0265313_10100213 3300031595 Bacteria 1286
394 Ga0307508_10068897 3300031616 Bacteria 3108
395 Ga0307508_10226654 3300031616 Bacteria 1468
396 Ga0265314_10030808 3300031711 Bacteria 3967
397 Ga0307405_10911815 3300031731 Bacteria 744
398 Ga0307406_10775090 3300031901 Bacteria 807
399 Ga0307407_10083629 3300031903 Bacteria 1937
400 Ga0307409_100084839 3300031995 Bacteria 2573
401 Ga0307414_10865539 3300032004 Bacteria 827
402 Ga0307415_100230230 3300032126 Bacteria 1492
403 Ga0307415_101891550 3300032126 Bacteria 579
404 Ga0373923_0024781 3300035111 Bacteria 2371
405 Ga0373936_0128281 3300035113 Bacteria 1088
406 Ga0373953_0102334 3300035117 Bacteria 1206
407 Ga0373953_0205047 3300035117 Bacteria 853
408 Ga0373956_0258275 3300035119 Bacteria 828
409 Ga0373943_0135228 3300035170 Bacteria 1323
410 Ga0373943_0419323 3300035170 Bacteria 774
411 Ga0373955_0239248 3300035172 Bacteria 1087
412 Ga0373935_0041914 3300035692 Bacteria 2877
413 Ga0373935_0223968 3300035692 Bacteria 1307
414 Ga0373935_1121596 3300035692 Bacteria 586
415 Ga0395899_0075022 3300037312 Bacteria 2470
416 Ga0395900_0039256 3300037418 Bacteria 4878
417 Ga0395900_0643559 3300037418 Bacteria 997
418 Ga0395900_0684649 3300037418 Bacteria 960
419 Ga0395898_0029479 3300037466 Bacteria 5497
420 Ga0395898_0074177 3300037466 Bacteria 3287
421 Ga0395898_0270911 3300037466 Bacteria 1619
422 Ga0395898_0944145 3300037466 Bacteria 800
423 Ga0395898_1223131 3300037466 Bacteria 682
424 Ga0395905_0068863 3300037471 Bacteria 3315
425 Ga0436364_1105312 3300037853 Bacteria 2417
426 Ga0395901_0008223 3300038443 Bacteria 10541
427 Ga0395901_0010855 3300038443 Bacteria 9233
428 Ga0395901_0027274 3300038443 Bacteria 5867
429 Ga0395901_0075917 3300038443 Bacteria 3506
430 Ga0395901_0843184 3300038443 Bacteria 902
431 Ga0439465_0044599 3300041413 Bacteria 1441
432 Ga0439465_0074331 3300041413 Bacteria 1143
433 Ga0451795_0515187 3300041456 Bacteria 1107
434 Ga0451798_0628373 3300041458 Bacteria 580
435 Ga0451802_0018767 3300041460 Bacteria 1026
436 Ga0451833_0039522 3300041491 Bacteria 552
437 Ga0451835_1244665 3300041492 Bacteria 1175
438 Ga0451837_0636900 3300041494 Bacteria 4002
439 Ga0451837_0648854 3300041494 Bacteria 727
440 Ga0451839_1217916 3300041496 Bacteria 3006
441 Ga0451841_0208921 3300041498 Bacteria 5583
442 Ga0451841_1433549 3300041498 Bacteria 665
443 Ga0451847_0291403 3300041503 Bacteria 1031
444 Ga0451847_0548471 3300041503 Bacteria 1045
445 Ga0451847_0810882 3300041503 Bacteria 1161
446 Ga0451849_1042723 3300041505 Bacteria 1849
447 Ga0451849_1232725 3300041505 Bacteria 727
448 Ga0451851_0003858 3300041507 Bacteria 1758
449 Ga0451855_0798708 3300041511 Bacteria 2535
450 Ga0451855_1111775 3300041511 Bacteria 2740
451 Ga0451853_1646649 3300041512 Bacteria 1175
452 Ga0451853_3517822 3300041512 Bacteria 1143
453 Ga0439449_0070506 3300042007 Bacteria 1288
454 Ga0466969_0046389 3300044656 Bacteria 2155
455 Ga0466961_0140369 3300044693 Bacteria 1513
456 Ga0466963_0015037 3300044694 Bacteria 4784
457 Ga0466963_0036049 3300044694 Bacteria 3224
458 Ga0466963_0949590 3300044694 Bacteria 606
459 Ga0453684_0270104 3300044712 Unclassified 1944
460 Ga0466971_0034965 3300044719 Bacteria 2252
461 Ga0466957_0033468 3300044842 Bacteria 3084
462 Ga0466957_1071136 3300044842 Bacteria 581
463 Ga0466959_0084002 3300045049 Bacteria 2292
464 Ga0451576_0258571 3300045051 Unclassified 1820
465 Ga0466958_0167808 3300045836 Bacteria 1389
466 Ga0466967_0501224 3300045976 Bacteria 1191
467 Ga0466967_1431975 3300045976 Bacteria 688
468 Ga0466967_1545306 3300045976 Bacteria 661
469 Ga0495592_0442873 3300046454 Bacteria 815
470 Ga0495603_0370783 3300046455 Bacteria 821
471 Ga0495590_0113032 3300046457 Bacteria 970
472 Ga0495629_0177464 3300046459 Bacteria 1477
473 Ga0495638_0047808 3300046460 Bacteria 2681
474 Ga0495641_0068198 3300046461 Bacteria 1599
475 Ga0495651_0120370 3300046462 Bacteria 1929
476 Ga0495650_0050972 3300046471 Bacteria 1708
477 Ga0495580_0088261 3300046472 Unclassified 2160
478 Ga0495580_0475582 3300046472 Bacteria 836
479 Ga0495582_0469804 3300046473 Bacteria 727
480 Ga0495582_0624869 3300046473 Bacteria 623
481 Ga0495605_0131350 3300046474 Bacteria 1129
482 Ga0495662_0260710 3300046476 Bacteria 853
483 Ga0495664_0079021 3300046477 Bacteria 1971
484 Ga0495664_0167618 3300046477 Bacteria 1332
485 Ga0495664_0346476 3300046477 Bacteria 895
486 Ga0495584_0177050 3300046491 Bacteria 1084
487 Ga0495585_0039212 3300046492 Bacteria 2663
488 Ga0495594_0561719 3300046499 Unclassified 647
489 Ga0495596_0164197 3300046500 Bacteria 863
490 Ga0495607_0133769 3300046501 Bacteria 1287
491 Ga0495583_0024919 3300046506 Bacteria 2997
492 Ga0495606_0026405 3300046507 Bacteria 4140
493 Ga0495606_0159510 3300046507 Bacteria 1317
494 Ga0495608_0030457 3300046511 Bacteria 3653
495 Ga0495610_0009978 3300046512 Bacteria 5938
496 Ga0495610_0025500 3300046512 Bacteria 3171
497 Ga0495618_0138541 3300046514 Bacteria 1556
498 Ga0495628_0016355 3300046516 Bacteria 6189
499 Ga0495628_0041503 3300046516 Bacteria 3673
500 Ga0495630_0017664 3300046517 Bacteria 5228
501 Ga0495632_0029055 3300046519 Bacteria 2882
502 Ga0495632_0053879 3300046519 Bacteria 1973
503 Ga0495643_0082069 3300046522 Bacteria 1675
504 Ga0495643_0088869 3300046522 Bacteria 1596
505 Ga0495648_0044019 3300046524 Bacteria 2790
506 Ga0495666_0067286 3300046526 Bacteria 1707
507 Ga0495652_0270806 3300046529 Bacteria 1248
508 Ga0495652_0790292 3300046529 Bacteria 632
509 Ga0495665_0113047 3300046531 Bacteria 1424
510 Ga0495665_0192125 3300046531 Bacteria 1059
511 Ga0495640_0037607 3300046533 Bacteria 3413
512 Ga0495640_0141839 3300046533 Bacteria 1548
513 Ga0495640_0607472 3300046533 Bacteria 660
514 Ga0495586_0770474 3300046535 Bacteria 555
515 Ga0495609_0032374 3300046538 Bacteria 2375
516 Ga0495645_0020314 3300046543 Bacteria 4789
517 Ga0495645_0067316 3300046543 Bacteria 2586
518 Ga0495645_0310305 3300046543 Bacteria 1027
519 Ga0495645_0396895 3300046543 Bacteria 880
520 Ga0495633_0027211 3300046558 Bacteria 2796
521 Ga0495667_0024475 3300046559 Bacteria 4065
522 Ga0495656_0236216 3300046615 Bacteria 919
523 Ga0495656_0290091 3300046615 Bacteria 836
524 Ga0495668_0120771 3300046616 Bacteria 1433
525 Ga0495634_0065718 3300046642 Bacteria 2403
526 Ga0495611_0033998 3300046648 Bacteria 2252
527 Ga0495611_0510183 3300046648 Bacteria 546
528 Ga0495625_0012457 3300046660 Bacteria 6891
529 Ga0495625_0317585 3300046660 Bacteria 992
530 Ga0495635_0002552 3300046663 Bacteria 12466
531 Ga0495635_0220023 3300046663 Bacteria 1284
532 Ga0495661_0082457 3300046665 Bacteria 1851
533 Ga0495657_0088066 3300046675 Bacteria 1997
534 Ga0495599_0092297 3300046678 Bacteria 1889
535 Ga0495599_0190108 3300046678 Bacteria 1263
536 Ga0495646_0200692 3300046680 Bacteria 1086
537 Ga0495647_0156202 3300046681 Bacteria 981
538 Ga0495669_0010535 3300046684 Bacteria 3909
539 Ga0495669_0192443 3300046684 Bacteria 974
540 Ga0495613_0013199 3300046689 Bacteria 6139
541 Ga0495613_0545267 3300046689 Bacteria 777
542 Ga0495624_0484400 3300046690 Bacteria 740
543 Ga0495670_0032853 3300046691 Bacteria 2581
544 Ga0495670_0187932 3300046691 Bacteria 1092
545 Ga0495671_0121734 3300046692 Bacteria 1273
546 Ga0495589_0306109 3300046794 Bacteria 736
547 Ga0495600_0096759 3300046809 Bacteria 1924
548 Ga0495660_0033062 3300046810 Bacteria 2902
549 Ga0495581_0194674 3300047315 Bacteria 1186
550 Ga0495636_0056613 3300047318 Bacteria 1651
551 Ga0495674_0022180 3300047319 Bacteria 5858
552 Ga0495674_0720563 3300047319 Bacteria 781
553 Ga0495676_0156971 3300047321 Bacteria 1613
554 Ga0495676_0734481 3300047321 Bacteria 638
555 Ga0495680_0000756 3300047322 Bacteria 36274
556 Ga0495687_045764 3300047443 Bacteria 1893
557 Ga0495675_0535707 3300047444 Bacteria 669
558 Ga0495679_070161 3300047446 Bacteria 1011
559 Ga0495685_183376 3300047447 Bacteria 674
560 Ga0495681_0166282 3300047470 Bacteria 915
561 Ga0495686_0026774 3300047472 Bacteria 3772
562 Ga0495686_0238906 3300047472 Bacteria 1025
563 Ga0495615_0045113 3300048090 Bacteria 1115
564 Ga0495626_0163004 3300048091 Bacteria 934
565 Ga0496100_0004243 3300048903 Bacteria 7576
566 Ga0496100_0056576 3300048903 Bacteria 2566
567 Ga0496101_0012645 3300048904 Bacteria 5639
568 Ga0496101_0015190 3300048904 Bacteria 5183
569 Ga0496101_0239376 3300048904 Bacteria 1412
570 Ga0496101_0927100 3300048904 Bacteria 685
571 Ga0496102_0000708 3300048905 Bacteria 33054
572 Ga0496102_0002815 3300048905 Bacteria 14815
573 Ga0496102_0402758 3300048905 Bacteria 1286
574 Ga0496103_0000018 3300048906 Bacteria 239585
575 Ga0496104_0099517 3300048907 Bacteria 2783
576 Ga0496104_0129735 3300048907 Bacteria 2421
577 Ga0496104_0315073 3300048907 Bacteria 1477
578 Ga0496104_1120492 3300048907 Bacteria 690
579 Ga0496104_1267175 3300048907 Unclassified 640
580 Ga0496105_0001678 3300048908 Bacteria 15793
581 Ga0496105_0093108 3300048908 Bacteria 2488
582 Ga0496106_0000980 3300048909 Bacteria 20817
583 Ga0496106_0006199 3300048909 Bacteria 8844
584 Ga0496107_0004141 3300048910 Bacteria 9779
585 Ga0496107_0204060 3300048910 Bacteria 1469
586 Ga0496107_0271574 3300048910 Bacteria 1262
587 Ga0496108_0060695 3300048911 Unclassified 3182
588 Ga0496108_0071347 3300048911 Bacteria 2930
589 Ga0496109_0060375 3300048912 Bacteria 3464
590 Ga0496109_0206711 3300048912 Unclassified 1846
591 Ga0496109_0564107 3300048912 Bacteria 1074
592 Ga0496109_0834768 3300048912 Bacteria 859
593 Ga0496109_0929205 3300048912 Bacteria 808
594 Ga0496110_0023391 3300048913 Bacteria 5254
595 Ga0496110_0070996 3300048913 Bacteria 3086
596 Ga0496110_0250421 3300048913 Bacteria 1612
597 Ga0496111_0055669 3300048914 Bacteria 2861
598 Ga0496111_0474979 3300048914 Bacteria 921
599 Ga0496112_0008770 3300048915 Bacteria 9072
600 Ga0496112_0128805 3300048915 Bacteria 2501
601 Ga0496113_0023265 3300048916 Bacteria 4393
602 Ga0496113_0027550 3300048916 Unclassified 4075
603 Ga0496113_0735195 3300048916 Bacteria 786
604 Ga0496114_0227454 3300048917 Bacteria 1638
605 Ga0496114_0379473 3300048917 Bacteria 1251
606 Ga0496115_0007450 3300048918 Bacteria 8054
607 Ga0496115_0046227 3300048918 Bacteria 3478
608 Ga0496116_0001070 3300048919 Bacteria 33015
609 Ga0496116_0008239 3300048919 Bacteria 9082
610 Ga0496116_0054024 3300048919 Bacteria 2649
611 Ga0496117_0001527 3300048920 Bacteria 33054
612 Ga0496117_0063956 3300048920 Bacteria 2512
613 Ga0496118_0000172 3300048921 Bacteria 116150
614 Ga0496118_0053901 3300048921 Bacteria 3051
615 Ga0496119_0001107 3300048922 Bacteria 33974
616 Ga0496119_0346548 3300048922 Bacteria 720
617 Ga0496120_0014411 3300048923 Bacteria 5271
618 Ga0496120_0082594 3300048923 Bacteria 1736
619 Ga0496121_0006442 3300048924 Bacteria 14570
620 Ga0496121_0017288 3300048924 Bacteria 7378
621 Ga0496122_0059208 3300048925 Bacteria 2828
622 Ga0496122_0061593 3300048925 Bacteria 2753
623 Ga0496122_0139350 3300048925 Bacteria 1521
624 Ga0496123_0077509 3300048926 Bacteria 2041
625 Ga0496124_0014794 3300048927 Bacteria 7525
626 Ga0496124_0019059 3300048927 Bacteria 6403
627 Ga0496124_0049168 3300048927 Bacteria 3598
628 Ga0496124_0273256 3300048927 Bacteria 1236
629 Ga0496125_0011267 3300048928 Bacteria 8962
630 Ga0496125_0025682 3300048928 Bacteria 5387
631 Ga0496125_0082927 3300048928 Bacteria 2441
632 Ga0496125_0178708 3300048928 Bacteria 1417
633 Ga0496126_0001683 3300048929 Bacteria 33054
634 Ga0496126_0104011 3300048929 Bacteria 2481
635 Ga0496126_0533638 3300048929 Bacteria 933
636 Ga0496126_0563825 3300048929 Bacteria 902
637 Ga0501031_0007537 3300049568 Bacteria 7088
638 Ga0501032_0000196 3300049569 Bacteria 50261
639 Ga0501032_0062314 3300049569 Bacteria 2499
640 Ga0501032_0138922 3300049569 Bacteria 1600
641 Ga0501032_0477523 3300049569 Bacteria 797
642 Ga0501033_0003209 3300049570 Bacteria 13536
643 Ga0501033_0356247 3300049570 Bacteria 1024
644 Ga0501033_0694835 3300049570 Bacteria 692
645 Ga0501033_0789573 3300049570 Bacteria 642
646 Ga0501034_0001151 3300049571 Bacteria 36663
647 Ga0501034_0003462 3300049571 Bacteria 17971
648 Ga0501034_0024163 3300049571 Bacteria 6182
649 Ga0501034_0237707 3300049571 Bacteria 1769
650 Ga0501034_0316051 3300049571 Bacteria 1495
651 Ga0501036_0001626 3300049572 Bacteria 17386
652 Ga0501036_0009212 3300049572 Bacteria 8116
653 Ga0501036_0773600 3300049572 Bacteria 791
654 Ga0501037_0001377 3300049573 Bacteria 17808
655 Ga0501037_0010257 3300049573 Bacteria 6875
656 Ga0501037_0083507 3300049573 Bacteria 2314
657 Ga0501038_0001622 3300049574 Bacteria 20925
658 Ga0501039_0001302 3300049575 Bacteria 18240
659 Ga0501040_0541533 3300049576 Bacteria 840
660 Ga0501042_1191770 3300049578 Bacteria 555
661 Ga0501043_0000409 3300049579 Bacteria 38657
662 Ga0501043_0002131 3300049579 Bacteria 16886
663 Ga0501043_0054990 3300049579 Bacteria 3126
664 Ga0501043_0202230 3300049579 Bacteria 1541
665 Ga0501043_1129224 3300049579 Bacteria 553
666 Ga0501046_0000011 3300049580 Bacteria 326457
667 Ga0501046_0000181 3300049580 Bacteria 64035
668 Ga0501046_0015303 3300049580 Bacteria 6451
669 Ga0501046_0048166 3300049580 Bacteria 3376
670 Ga0501046_0746871 3300049580 Bacteria 687
671 Ga0501047_0000161 3300049581 Bacteria 81928
672 Ga0501047_0002426 3300049581 Bacteria 17808
673 Ga0501047_0476395 3300049581 Bacteria 1076
674 Ga0501047_0846751 3300049581 Bacteria 728
675 Ga0501048_0001687 3300049582 Bacteria 16834
676 Ga0501048_0003595 3300049582 Bacteria 11806
677 Ga0501067_0000145 3300049583 Bacteria 39277
678 Ga0501067_0130999 3300049583 Bacteria 1396
679 Ga0501067_0333142 3300049583 Bacteria 845
680 Ga0501068_0002577 3300049584 Bacteria 9611
681 Ga0501069_0003759 3300049585 Bacteria 7805
682 Ga0501069_0630720 3300049585 Bacteria 644
683 Ga0501070_0028493 3300049586 Bacteria 4684
684 Ga0501070_0055720 3300049586 Bacteria 3277
685 Ga0501071_0094786 3300049587 Bacteria 2196
686 Ga0501072_0017020 3300049588 Bacteria 5585
687 Ga0501073_0000027 3300049589 Bacteria 121860
688 Ga0501073_0034095 3300049589 Bacteria 3624
689 Ga0501073_0043888 3300049589 Bacteria 3152
690 Ga0501073_0157840 3300049589 Bacteria 1572
691 Ga0501073_0453721 3300049589 Bacteria 886
692 Ga0501073_0548848 3300049589 Bacteria 798
693 Ga0501074_0001347 3300049590 Bacteria 16291
694 Ga0501074_0003607 3300049590 Bacteria 10993
695 Ga0501076_0275383 3300049592 Bacteria 1378
696 Ga0501076_1456036 3300049592 Bacteria 562
697 Ga0501080_0002621 3300049742 Bacteria 15752
698 Ga0501080_0003069 3300049742 Bacteria 14746
699 Ga0501080_0520591 3300049742 Bacteria 1061
700 Ga0501080_1863084 3300049742 Bacteria 504
701 Ga0501081_0426003 3300049743 Bacteria 984
702 Ga0501083_0002123 3300049744 Bacteria 13604
703 Ga0501083_0006827 3300049744 Bacteria 8101
704 Ga0501083_0097960 3300049744 Bacteria 1934
705 Ga0501035_0001852 3300049822 Bacteria 21281
706 Ga0501035_0157404 3300049822 Bacteria 1968
707 Ga0501035_0513419 3300049822 Bacteria 985
708 Ga0501044_0001758 3300049823 Bacteria 25308
709 Ga0501044_0003498 3300049823 Bacteria 17680
710 Ga0501044_0069873 3300049823 Bacteria 3574
711 Ga0501044_0142679 3300049823 Bacteria 2383
712 Ga0501044_0478662 3300049823 Bacteria 1148
713 Ga0501045_0014292 3300049824 Bacteria 5626
714 Ga0501045_0068930 3300049824 Bacteria 2599
715 nmdc:mga03n38_176199_c1 3300050490 Bacteria 1093
716 nmdc:mga00v17_174389_c1 3300050491 Bacteria 1387
717 nmdc:mga00v17_42401_c1 3300050491 Bacteria 2737
718 nmdc:mga00v17_469155_c1 3300050491 Bacteria 817
719 nmdc:mga0yw44_249038_c1 3300050492 Bacteria 1182
720 nmdc:mga0yw44_33973_c1 3300050492 Bacteria 2985
721 nmdc:mga0yw44_422136_c1 3300050492 Bacteria 903
722 nmdc:mga0yw44_51203_c1 3300050492 Bacteria 2499
723 nmdc:mga0yw44_75566_c1 3300050492 Bacteria 2101
724 nmdc:mga0k408_19984_c1 3300050493 Bacteria 3748
725 nmdc:mga0k408_764347_c1 3300050493 Bacteria 564
726 nmdc:mga06z11_103722_c1 3300050494 Bacteria 1564
727 nmdc:mga06z11_166516_c1 3300050494 Bacteria 1263
728 nmdc:mga06z11_26431_c1 3300050494 Bacteria 2762
729 nmdc:mga06z11_546294_c1 3300050494 Bacteria 703
730 nmdc:mga04h51_114479_c1 3300050495 Bacteria 998
731 nmdc:mga04h51_98384_c1 3300050495 Bacteria 1063
732 nmdc:mga07m45_296324_c1 3300050496 Bacteria 941
733 nmdc:mga07m45_46561_c1 3300050496 Bacteria 1921
734 nmdc:mga07m45_746266_c1 3300050496 Bacteria 562
735 nmdc:mga05p37_123970_c1 3300050507 Bacteria 3174
736 nmdc:mga05p37_174908_c1 3300050507 Bacteria 2616
737 nmdc:mga05p37_300629_c1 3300050507 Bacteria 1907
738 nmdc:mga05p37_414185_c1 3300050507 Bacteria 1570
739 nmdc:mga09592_90126_c1 3300050508 Bacteria 2620
740 nmdc:mga0qj67_12245_c1 3300050509 Bacteria 6459
741 nmdc:mga0qj67_420171_c1 3300050509 Bacteria 1078
742 nmdc:mga06r32_396103_c1 3300050510 Bacteria 1363
743 nmdc:mga06r32_4162_c1 3300050510 Bacteria 12958
744 nmdc:mga0n895_131371_c1 3300050512 Bacteria 2529
745 nmdc:mga0n895_150460_c1 3300050512 Bacteria 2358
746 nmdc:mga0n895_337627_c1 3300050512 Bacteria 1526
747 nmdc:mga0n895_66587_c1 3300050512 Bacteria 3567
748 nmdc:mga0n895_8089_c1 3300050512 Bacteria 9080
749 nmdc:mga0n895_98890_c1 3300050512 Bacteria 2925
750 nmdc:mga0rr50_178234_c1 3300050513 Bacteria 1736
751 nmdc:mga0rr50_26047_c1 3300050513 Bacteria 4074
752 nmdc:mga0rr50_446149_c1 3300050513 Bacteria 1096
753 nmdc:mga0rr50_653668_c1 3300050513 Bacteria 897
754 nmdc:mga0a205_1624_c1 3300050515 Bacteria 19322
755 nmdc:mga0a205_3536_c1 3300050515 Bacteria 13971
756 nmdc:mga0a205_37613_c1 3300050515 Bacteria 4654
757 nmdc:mga0a205_44757_c1 3300050515 Bacteria 4268
758 nmdc:mga0a205_489914_c1 3300050515 Bacteria 1087
759 nmdc:mga0a205_9896_c1 3300050515 Bacteria 8744
760 nmdc:mga0sz30_443206_c1 3300050516 Bacteria 583
761 Ga0495601_0019454 3300053077 Bacteria 4140
762 Ga0495601_0159538 3300053077 Bacteria 1474
763 Ga0495612_0016451 3300053078 Bacteria 2963
764 Ga0500610_0152431 3300053079 Bacteria 1157
765 Ga0495655_0014889 3300053083 Bacteria 1641
766 Ga0495595_0227493 3300053084 Bacteria 931
767 Ga0500578_0175378 3300053086 Bacteria 1323
768 Ga0500643_051773 3300053087 Bacteria 1172
769 Ga0500651_0068330 3300053093 Bacteria 2213
770 Ga0500555_003122 3300053103 Bacteria 4726
771 Ga0500594_0026187 3300053118 Bacteria 1501
772 Ga0500652_069402 3300053131 Bacteria 1458
773 Ga0500658_0022106 3300053134 Bacteria 2414
774 Ga0500658_0026760 3300053134 Bacteria 2224
775 Ga0500568_0001209 3300053139 Bacteria 17208
776 Ga0500568_0360392 3300053139 Bacteria 527
777 Ga0500616_0000251 3300053153 Bacteria 83237
778 Ga0500616_0000627 3300053153 Bacteria 42906
779 Ga0500616_0036732 3300053153 Bacteria 2657
780 Ga0500620_123787 3300053155 Bacteria 906
781 Ga0500622_0000099 3300053156 Bacteria 86951
782 Ga0500627_0075987 3300053158 Bacteria 1493
783 Ga0500627_0429170 3300053158 Bacteria 559
784 Ga0500633_0000560 3300053160 Bacteria 6053
785 Ga0500639_078842 3300053163 Bacteria 1663
786 Ga0500645_000647 3300053730 Bacteria 22079
787 Ga0501084_0003235 3300054114 Bacteria 13188
788 Ga0501084_0464675 3300054114 Bacteria 1070
789 Ga0501084_0488221 3300054114 Bacteria 1041
790 Ga0501084_1322111 3300054114 Bacteria 604
791 Ga0501084_1374220 3300054114 Bacteria 592
792 Ga0501082_0005376 3300060353 Bacteria 11113
793 Ga0501082_0196049 3300060353 Bacteria 1757
794 Ga0501082_0301848 3300060353 Bacteria 1394
795 Ga0530510_0232518 3300061734 Bacteria 1371
796 2510136550 2510065019 Bacteria 6903379
797 2510900182 2510461076 Bacteria 8618824
798 2511199835 2510917030 Bacteria 7460662
799 2513569595 2513237084 Bacteria 7231967
800 2513576427 2513237085 Bacteria 7695351
801 2513635262 2513237093 Bacteria 7545552
802 2513709838 2513237103 Bacteria 7647401
803 2513870064 2513237138 Bacteria 7368160
804 2514018826 2513237162 Bacteria 7468464
805 2515115122 2515075009 Bacteria 7288508
806 2515633304 2515154113 Bacteria 7807172
807 2515642529 2515154114 Bacteria 7848616
808 2515658506 2515154116 Bacteria 7552979
809 2515741970 2515154134 Bacteria 7220242
810 2517041876 2516653077 Bacteria 7555578
811 2517081088 2516653085 Bacteria 7346596
812 2517098567 2517093000 Bacteria 7412387
813 2517410879 2517287029 Bacteria 6905599
814 2524535378 2524023228 Bacteria 10118060
815 2530644542 2529292951 Bacteria 6916614
816 2535520275 2534681796 Bacteria 7146037
817 2585221567 2582581298 Bacteria 7315509
818 2585392668 2582581866 Bacteria 6859583
819 2585404116 2582581867 Bacteria 7184437
820 2585524216 2585427526 Bacteria 7258840
821 2585539252 2585427528 Bacteria 6842387
822 2585544263 2585427529 Bacteria 7395659
823 2585819998 2585427590 Bacteria 6824633
824 2585837206 2585427593 Bacteria 7141551
825 2626639266 2626541554 Bacteria 7741902
826 2644003455 2643221599 Bacteria 6292121
827 2645719651 2643221961 Bacteria 3919167
828 2719183809 2718217882 Bacteria 6556348
829 2719728250 2718218009 Bacteria 6478651
830 2721145111 2718218363 Bacteria 6524337
831 2721155848 2718218365 Bacteria 6274507
832 2721167198 2718218366 Bacteria 6425255
833 2722838176 2721755514 Bacteria 6424414
834 2724042444 2721755810 Bacteria 6479005
835 2725946272 2724679232 Bacteria 7646494
836 2730161949 2728369365 Bacteria 6555560
837 2730300955 2728369397 Bacteria 6274511
838 2739033702 2738541333 Bacteria 7106503
839 2766068431 2765235942 Bacteria 7445910
840 2793324001 2791355260 Bacteria 6598818
841 2793346286 2791355264 Bacteria 6429314
842 2805929100 2802429605 Bacteria 6875453
843 2806044799 2802429633 Bacteria 7341974
844 2806054041 2802429634 Bacteria 7083200
845 2806059867 2802429635 Bacteria 7650140
846 2806066080 2802429636 Bacteria 7597525
847 2806073338 2802429637 Bacteria 7067217
848 2838027224 2838022645 Bacteria 6494267
849 2838671538 2838668709 Bacteria 6671819
850 2838684452 2838680041 Bacteria 6545511
851 2838693791 2838686498 Bacteria 7807632
852 2838699943 2838694306 Bacteria 6853137
853 2838704195 2838701080 Bacteria 6669771
854 2838711772 2838707686 Bacteria 6619912
855 2838735499 2838729681 Bacteria 7400765
856 2838748401 2838742623 Bacteria 7396178
857 2841858561 2841851746 Bacteria 7532261
858 2842081919 2842077413 Bacteria 6508645
859 2842115764 2842110456 Bacteria 7656360
860 2842122495 2842118031 Bacteria 7033875
861 2842149187 2842146304 Bacteria 5957337
862 2842162713 2842156927 Bacteria 6894975
863 2842167084 2842163707 Bacteria 6916235
864 2842186217 2842180545 Bacteria 6888678
865 2842195304 2842192696 Bacteria 6147454
866 2842203403 2842198810 Bacteria 6608673
867 2842222206 2842217011 Bacteria 7497767
868 2842236609 2842229732 Bacteria 7475766
869 2842241184 2842237096 Bacteria 6620661
870 2842250292 2842243621 Bacteria 7421798
871 2842253646 2842250916 Bacteria 6579627
872 2842263319 2842257432 Bacteria 7401195
873 2842278358 2842271015 Bacteria 7807131
874 2842295574 2842291075 Bacteria 7076806
875 2842310003 2842304105 Bacteria 7023636
876 2842377360 2842370503 Bacteria 7038661
877 2842381650 2842377471 Bacteria 7140707
878 2842389043 2842384541 Bacteria 7057858
879 2842491497 2842489311 Bacteria 6620893
880 2844461061 2844454524 Bacteria 7952546
881 2857519232 2857516855 Bacteria 7787325
882 2862292071 2862290372 Bacteria 7471434
883 2884218895 2884215851 Bacteria 4554841
884 2919103517 2919100787 Bacteria 7710546
885 2923559678 2923556063 Bacteria 6793593
886 2933576444 2933570622 Bacteria 7023390
887 2933591730 2933586486 Bacteria 7667493
888 2935898208 2935894831 Bacteria 6620579
889 2935905796 2935901341 Bacteria 7341747
890 2936370238 2936367885 Bacteria 7324495
891 2936377910 2936375103 Bacteria 6652732
892 2996887671 2996887358 Bacteria 5795980
893 2996896919 2996893221 Bacteria 5823108
894 3002142216 3002141150 Bacteria 5254435
895 3005456852 3005452660 Bacteria 5889319
896 639651766 639633055 Bacteria 7751309
897 8005313076 8005307578 Bacteria 7395396
898 8005322198 8005321885 Bacteria 5795980
899 8005381919 8005376324 Bacteria 6590079
900 8005466849 8005460587 Bacteria 7157962
901 8005562155 8005556819 Bacteria 6908598
902 8005567086 8005563573 Bacteria 7153261
903 8005576341 8005570704 Bacteria 6957481
904 8005689486 8005688590 Bacteria 6610080
905 8023682410 8023680758 Bacteria 7729763
906 8024483741 8024479707 Bacteria 6954785
907 8057878386 8057874678 Bacteria 7494653
908 Ga0114129_10198599
909 JGI25158J39367_1001249
910 JGI25159J45721_1005399
911 JGI25153J46596_10006039
912 JGI25153J46596_10021365
913 JGI25160J50197_1001537
914 JGI25160J50197_1029600
915 JGI25161J50226_1000463
916 JGI25161J50226_1008346
917 Ga0055526_1003736
918 Ga0055526_1012487
919 Ga0055524_1006013
920 Ga0055528_1011201
921 Ga0055528_1035642
922 Ga0055540_1002996
923 Ga0055540_1023510
924 Ga0055543_1000021
925 Ga0055543_1000591
926 Ga0065165_1002401
927 Ga0065712_10164627
928 Ga0070658_10006016
929 Ga0070658_10076404
930 Ga0070683_100152100
931 Ga0070683_100338461
932 Ga0070690_100753207
933 Ga0068869_100019939
934 Ga0068869_100047278
935 Ga0068869_100152072
936 Ga0070666_10190980
937 Ga0070680_100086284
938 Ga0070660_100032812
939 Ga0070668_100358640
940 Ga0070669_100769514
941 Ga0070675_100291754
942 Ga0070675_100622863
943 Ga0070671_101612622
944 Ga0070659_101465187
945 Ga0070714_100095478
946 Ga0070714_100137393
947 Ga0070713_100396104
948 Ga0070713_101384098
949 Ga0070711_100002332
950 Ga0070711_100674830
951 Ga0070705_100479682
952 Ga0070663_100667365
953 Ga0070663_100969648
954 Ga0070663_102101182
955 Ga0070678_100015069
956 Ga0070662_100145660
957 Ga0070681_10057249
958 Ga0070681_10077610
959 Ga0070681_10242083
960 Ga0068867_100941102
961 Ga0070706_100007435
962 Ga0070707_100279434
963 Ga0070707_101422746
964 Ga0070698_100639517
965 Ga0070699_100299395
966 Ga0070699_100397347
967 Ga0070679_100026849
968 Ga0070679_100084582
969 Ga0070679_100499093
970 Ga0070679_101736848
971 Ga0070684_100036209
972 Ga0070684_100168617
973 Ga0070684_100644409
974 Ga0070697_100313233
975 Ga0070697_100865924
976 Ga0068853_100456012
977 Ga0068853_101391586
978 Ga0070686_100420663
979 Ga0070665_100000728
980 Ga0070665_100000791
981 Ga0070665_100298875
982 Ga0070665_100469893
983 Ga0068855_100008482
984 Ga0068855_100028847
985 Ga0068855_100229948
986 Ga0068855_100383538
987 Ga0068855_100422172
988 Ga0068855_101137067
989 Ga0070664_101163525
990 Ga0068857_100029109
991 Ga0068857_100067585
992 Ga0068854_100467312
993 Ga0068856_100465624
994 Ga0068856_101192112
995 Ga0068856_101920824
996 Ga0068852_100382396
997 Ga0068852_100730430
998 Ga0068859_100118930
999 Ga0068859_100212397
1000 Ga0068864_100023676
1001 Ga0068864_100068003
1002 Ga0068864_100229661
1003 Ga0068861_100337047
1004 Ga0068870_10127815
1005 Ga0068863_100002809
1006 Ga0068863_100113646
1007 Ga0068863_101303125
1008 Ga0068858_100046662
1009 Ga0068858_100074409
1010 Ga0068858_100698504
1011 Ga0068860_100102994
1012 Ga0068862_100076450
1013 Ga0068862_100122152
1014 Ga0081455_10225778
1015 Ga0081455_10291286
1016 Ga0081539_10004015
1017 Ga0081539_10010322
1018 Ga0081539_10028448
1019 Ga0070717_11317747
1020 Ga0075365_10016164
1021 Ga0075365_10089833
1022 Ga0075365_10197780
1023 Ga0075368_10142881
1024 Ga0075368_10271186
1025 Ga0075363_100299148
1026 Ga0075364_10034376
1027 Ga0070715_10002024
1028 Ga0070716_100003137
1029 Ga0070716_100274077
1030 Ga0070716_100720123
1031 Ga0070712_100000811
1032 Ga0070712_100004288
1033 Ga0070712_100048063
1034 Ga0075362_10176267
1035 Ga0075367_10037081
1036 Ga0075367_10054071
1037 Ga0075367_10074206
1038 Ga0075367_10133979
1039 Ga0075367_10534822
1040 Ga0075366_10013745
1041 Ga0075366_10058999
1042 Ga0075366_10177987
1043 Ga0097621_100494068
1044 Ga0075370_10011541
1045 Ga0075370_10168720
1046 Ga0075370_10299398
1047 Ga0068871_100463377
1048 Ga0075428_100605178
1049 Ga0075430_100937093
1050 Ga0075431_100098700
1051 Ga0075431_100371664
1052 Ga0075433_10001208
1053 Ga0075433_10012335
1054 Ga0075433_10028698
1055 Ga0075433_11233745
1056 Ga0075434_100003941
1057 Ga0075434_100011264
1058 Ga0075434_100040251
1059 Ga0075434_100052129
1060 Ga0075434_100056525
1061 Ga0075434_100373812
1062 Ga0075429_100088861
1063 Ga0068865_100108053
1064 Ga0068865_100346794
1065 Ga0097620_100118945
1066 Ga0097620_100212395
1067 Ga0075435_100022058
1068 Ga0075435_100130969
1069 Ga0075435_100466990
1070 Ga0099794_10003779
1071 Ga0105251_10014997
1072 Ga0105240_10000236
1073 Ga0105240_10027757
1074 Ga0105240_10146629
1075 Ga0105240_10694477
1076 Ga0105240_11205953
1077 Ga0111539_11753926
1078 Ga0105245_10680151
1079 Ga0105245_11250084
1080 Ga0114129_10001748
1081 Ga0114129_10184658
1082 Ga0114129_10499196
1083 Ga0105243_10057884
1084 Ga0105243_12015925
1085 Ga0105241_10614057
1086 Ga0105242_10276255
1087 Ga0105242_10431605
1088 Ga0105248_10057210
1089 Ga0105248_10225927
1090 Ga0105237_10102750
1091 Ga0105237_10121540
1092 Ga0105237_10148699
1093 Ga0105237_10365467
1094 Ga0105237_10792101
1095 Ga0105238_10018641
1096 Ga0105238_10681464
1097 Ga0105238_10706887
1098 Ga0105238_11721024
1099 Ga0105249_10082992
1100 Ga0105249_10135024
1101 Ga0105249_10419582
1102 Ga0105239_10121061
1103 Ga0105239_10995605
1104 Ga0105239_11295452
1105 Ga0105239_11369391
1106 Ga0105246_10014526
1107 Ga0105246_10726432
1108 Ga0157371_10146701
1109 Ga0157371_10865301
1110 Ga0157370_10007688
1111 Ga0157370_10034135
1112 Ga0157370_10250016
1113 Ga0157370_10619621
1114 Ga0157374_10079900
1115 Ga0163162_10157402
1116 Ga0157372_10197434
1117 Ga0157372_10282003
1118 Ga0157372_10365459
1119 Ga0157375_10100228
1120 Ga0157375_10189132
1121 Ga0157375_10241809
1122 Ga0157375_10252261
1123 Ga0163163_10024959
1124 Ga0163163_10030962
1125 Ga0163163_10533614
1126 Ga0163163_11049830
1127 Ga0163163_11060929
1128 Ga0163163_12210481
1129 Ga0157377_10113719
1130 Ga0157379_10021508
1131 Ga0157379_10146089
1132 Ga0157379_10630833
1133 Ga0157379_10962201
1134 Ga0197907_11104677
1135 Ga0206356_10551594
1136 Ga0206350_10448529
1137 Ga0206353_11551518
1138 Ga0213875_10181766
1139 Ga0224712_10140603
1140 Ga0209436_100004
1141 Ga0207425_1000736
1142 Ga0207425_1003419
1143 Ga0209129_1000622
1144 Ga0209129_1008265
1145 Ga0209673_1002989
1146 Ga0209673_1011979
1147 Ga0209673_1019500
1148 Ga0209130_1000001
1149 Ga0209675_1048502
1150 Ga0209676_1080480
1151 Ga0209025_1000072
1152 Ga0209025_1008821
1153 Ga0209025_1077979
1154 Ga0209564_1001641
1155 Ga0209564_1001805
1156 Ga0209564_1002167
1157 Ga0209758_1000053
1158 Ga0209758_1003660
1159 Ga0209758_1005280
1160 Ga0209758_1006260
1161 Ga0209758_1036886
1162 Ga0209758_1146557
1163 Ga0209256_1008889
1164 Ga0209256_1012955
1165 Ga0209256_1033728
1166 Ga0207426_1000005
1167 Ga0207426_1000035
1168 Ga0209051_1004166
1169 Ga0209051_1012390
1170 Ga0209051_1022802
1171 Ga0209051_1040134
1172 Ga0209257_1021221
1173 Ga0207642_10069267
1174 Ga0207710_10131906
1175 Ga0207685_10029134
1176 Ga0207699_10025679
1177 Ga0207699_10129378
1178 Ga0207645_10130102
1179 Ga0207705_10010749
1180 Ga0207705_10033327
1181 Ga0207705_10254393
1182 Ga0207684_10023669
1183 Ga0207707_10047727
1184 Ga0207707_10052017
1185 Ga0207707_10121000
1186 Ga0207707_10266303
1187 Ga0207707_10361175
1188 Ga0207695_10001342
1189 Ga0207695_10008466
1190 Ga0207695_10181605
1191 Ga0207695_10583333
1192 Ga0207671_10257114
1193 Ga0207693_10007740
1194 Ga0207693_10042995
1195 Ga0207693_10156613
1196 Ga0207663_10012062
1197 Ga0207663_10087480
1198 Ga0207660_10075463
1199 Ga0207662_10014961
1200 Ga0207662_10566934
1201 Ga0207657_10042626
1202 Ga0207652_10052481
1203 Ga0207652_10359455
1204 Ga0207652_10725081
1205 Ga0207646_10028312
1206 Ga0207646_10044882
1207 Ga0207646_10047226
1208 Ga0207681_10255482
1209 Ga0207681_10958131
1210 Ga0207694_10080762
1211 Ga0207694_10100228
1212 Ga0207650_10353637
1213 Ga0207659_10235378
1214 Ga0207659_11133907
1215 Ga0207700_10172853
1216 Ga0207700_10538849
1217 Ga0207700_10636868
1218 Ga0207700_10941549
1219 Ga0207664_10189038
1220 Ga0207664_10203727
1221 Ga0207644_10006295
1222 Ga0207690_10221404
1223 Ga0207690_10260348
1224 Ga0207706_10123463
1225 Ga0207706_10238832
1226 Ga0207669_10207959
1227 Ga0207704_10173973
1228 Ga0207704_10427062
1229 Ga0207704_10518823
1230 Ga0207665_10006502
1231 Ga0207665_10154841
1232 Ga0207691_10706598
1233 Ga0207711_10241084
1234 Ga0207711_10402706
1235 Ga0207711_10825449
1236 Ga0207689_10096486
1237 Ga0207689_10096567
1238 Ga0207689_10113796
1239 Ga0207661_10192740
1240 Ga0207661_11138195
1241 Ga0207679_10456244
1242 Ga0207679_10920749
1243 Ga0207667_10042630
1244 Ga0207667_10324169
1245 Ga0207667_10324704
1246 Ga0207667_11370360
1247 Ga0207651_10489016
1248 Ga0207712_10107157
1249 Ga0207712_11303352
1250 Ga0207668_10299870
1251 Ga0207658_10336268
1252 Ga0207703_10017685
1253 Ga0207703_10083515
1254 Ga0207639_10489589
1255 Ga0207678_10207851
1256 Ga0207678_10264635
1257 Ga0207678_10717776
1258 Ga0207678_10968642
1259 Ga0207708_10043077
1260 Ga0207702_10080335
1261 Ga0207702_10390682
1262 Ga0207641_10007276
1263 Ga0207641_10155165
1264 Ga0207641_10179393
1265 Ga0207648_10038978
1266 Ga0207648_10118613
1267 Ga0207648_10925622
1268 Ga0207676_10115941
1269 Ga0207676_10633666
1270 Ga0207674_10006588
1271 Ga0207674_10075071
1272 Ga0207674_10103624
1273 Ga0207674_11747576
1274 Ga0207675_100062979
1275 Ga0207675_100154707
1276 Ga0207683_10081047
1277 Ga0207698_10302307
1278 Ga0209588_1005097
1279 Ga0209813_10096829
1280 Ga0268266_10000385
1281 Ga0268266_10005306
1282 Ga0268266_10184131
1283 Ga0268266_10263218
1284 Ga0268264_10522491
1285 Ga0268264_10683321
1286 Ga0265319_1056801
1287 Ga0307515_10006687
1288 Ga0307515_10020927
1289 Ga0307515_10608019
1290 Ga0265338_10045794
1291 Ga0265338_10047201
1292 Ga0265332_10014480
1293 Ga0265320_10186864
1294 Ga0265325_10085388
1295 Ga0265331_10074271
1296 Ga0307513_10006532
1297 Ga0307513_10017597
1298 Ga0307513_10539324
1299 Ga0307513_10707989
1300 Ga0265313_10100213
1301 Ga0307508_10068897
1302 Ga0307508_10226654
1303 Ga0265314_10030808
1304 Ga0307405_10911815
1305 Ga0307406_10775090
1306 Ga0307407_10083629
1307 Ga0307409_100084839
1308 Ga0307414_10865539
1309 Ga0307415_100230230
1310 Ga0307415_101891550
1311 Ga0373923_0024781
1312 Ga0373936_0128281
1313 Ga0373953_0102334
1314 Ga0373953_0205047
1315 Ga0373956_0258275
1316 Ga0373943_0135228
1317 Ga0373943_0419323
1318 Ga0373955_0239248
1319 Ga0373935_0041914
1320 Ga0373935_0223968
1321 Ga0373935_1121596
1322 Ga0395899_0075022
1323 Ga0395900_0039256
1324 Ga0395900_0643559
1325 Ga0395900_0684649
1326 Ga0395898_0029479
1327 Ga0395898_0074177
1328 Ga0395898_0270911
1329 Ga0395898_0944145
1330 Ga0395898_1223131
1331 Ga0395905_0068863
1332 Ga0436364_1105312
1333 Ga0395901_0008223
1334 Ga0395901_0010855
1335 Ga0395901_0027274
1336 Ga0395901_0075917
1337 Ga0395901_0843184
1338 Ga0439465_0044599
1339 Ga0439465_0074331
1340 Ga0451795_0515187
1341 Ga0451798_0628373
1342 Ga0451802_0018767
1343 Ga0451833_0039522
1344 Ga0451835_1244665
1345 Ga0451837_0636900
1346 Ga0451837_0648854
1347 Ga0451839_1217916
1348 Ga0451841_0208921
1349 Ga0451841_1433549
1350 Ga0451847_0291403
1351 Ga0451847_0548471
1352 Ga0451847_0810882
1353 Ga0451849_1042723
1354 Ga0451849_1232725
1355 Ga0451851_0003858
1356 Ga0451855_0798708
1357 Ga0451855_1111775
1358 Ga0451853_1646649
1359 Ga0451853_3517822
1360 Ga0439449_0070506
1361 Ga0466969_0046389
1362 Ga0466961_0140369
1363 Ga0466963_0015037
1364 Ga0466963_0036049
1365 Ga0466963_0949590
1366 Ga0453684_0270104
1367 Ga0466971_0034965
1368 Ga0466957_0033468
1369 Ga0466957_1071136
1370 Ga0466959_0084002
1371 Ga0451576_0258571
1372 Ga0466958_0167808
1373 Ga0466967_0501224
1374 Ga0466967_1431975
1375 Ga0466967_1545306
1376 Ga0495592_0442873
1377 Ga0495603_0370783
1378 Ga0495590_0113032
1379 Ga0495629_0177464
1380 Ga0495638_0047808
1381 Ga0495641_0068198
1382 Ga0495651_0120370
1383 Ga0495650_0050972
1384 Ga0495580_0088261
1385 Ga0495580_0475582
1386 Ga0495582_0469804
1387 Ga0495582_0624869
1388 Ga0495605_0131350
1389 Ga0495662_0260710
1390 Ga0495664_0079021
1391 Ga0495664_0167618
1392 Ga0495664_0346476
1393 Ga0495584_0177050
1394 Ga0495585_0039212
1395 Ga0495594_0561719
1396 Ga0495596_0164197
1397 Ga0495607_0133769
1398 Ga0495583_0024919
1399 Ga0495606_0026405
1400 Ga0495606_0159510
1401 Ga0495608_0030457
1402 Ga0495610_0009978
1403 Ga0495610_0025500
1404 Ga0495618_0138541
1405 Ga0495628_0016355
1406 Ga0495628_0041503
1407 Ga0495630_0017664
1408 Ga0495632_0029055
1409 Ga0495632_0053879
1410 Ga0495643_0082069
1411 Ga0495643_0088869
1412 Ga0495648_0044019
1413 Ga0495666_0067286
1414 Ga0495652_0270806
1415 Ga0495652_0790292
1416 Ga0495665_0113047
1417 Ga0495665_0192125
1418 Ga0495640_0037607
1419 Ga0495640_0141839
1420 Ga0495640_0607472
1421 Ga0495586_0770474
1422 Ga0495609_0032374
1423 Ga0495645_0020314
1424 Ga0495645_0067316
1425 Ga0495645_0310305
1426 Ga0495645_0396895
1427 Ga0495633_0027211
1428 Ga0495667_0024475
1429 Ga0495656_0236216
1430 Ga0495656_0290091
1431 Ga0495668_0120771
1432 Ga0495634_0065718
1433 Ga0495611_0033998
1434 Ga0495611_0510183
1435 Ga0495625_0012457
1436 Ga0495625_0317585
1437 Ga0495635_0002552
1438 Ga0495635_0220023
1439 Ga0495661_0082457
1440 Ga0495657_0088066
1441 Ga0495599_0092297
1442 Ga0495599_0190108
1443 Ga0495646_0200692
1444 Ga0495647_0156202
1445 Ga0495669_0010535
1446 Ga0495669_0192443
1447 Ga0495613_0013199
1448 Ga0495613_0545267
1449 Ga0495624_0484400
1450 Ga0495670_0032853
1451 Ga0495670_0187932
1452 Ga0495671_0121734
1453 Ga0495589_0306109
1454 Ga0495600_0096759
1455 Ga0495660_0033062
1456 Ga0495581_0194674
1457 Ga0495636_0056613
1458 Ga0495674_0022180
1459 Ga0495674_0720563
1460 Ga0495676_0156971
1461 Ga0495676_0734481
1462 Ga0495680_0000756
1463 Ga0495687_045764
1464 Ga0495675_0535707
1465 Ga0495679_070161
1466 Ga0495685_183376
1467 Ga0495681_0166282
1468 Ga0495686_0026774
1469 Ga0495686_0238906
1470 Ga0495615_0045113
1471 Ga0495626_0163004
1472 Ga0496100_0004243
1473 Ga0496100_0056576
1474 Ga0496101_0012645
1475 Ga0496101_0015190
1476 Ga0496101_0239376
1477 Ga0496101_0927100
1478 Ga0496102_0000708
1479 Ga0496102_0002815
1480 Ga0496102_0402758
1481 Ga0496103_0000018
1482 Ga0496104_0099517
1483 Ga0496104_0129735
1484 Ga0496104_0315073
1485 Ga0496104_1120492
1486 Ga0496104_1267175
1487 Ga0496105_0001678
1488 Ga0496105_0093108
1489 Ga0496106_0000980
1490 Ga0496106_0006199
1491 Ga0496107_0004141
1492 Ga0496107_0204060
1493 Ga0496107_0271574
1494 Ga0496108_0060695
1495 Ga0496108_0071347
1496 Ga0496109_0060375
1497 Ga0496109_0206711
1498 Ga0496109_0564107
1499 Ga0496109_0834768
1500 Ga0496109_0929205
1501 Ga0496110_0023391
1502 Ga0496110_0070996
1503 Ga0496110_0250421
1504 Ga0496111_0055669
1505 Ga0496111_0474979
1506 Ga0496112_0008770
1507 Ga0496112_0128805
1508 Ga0496113_0023265
1509 Ga0496113_0027550
1510 Ga0496113_0735195
1511 Ga0496114_0227454
1512 Ga0496114_0379473
1513 Ga0496115_0007450
1514 Ga0496115_0046227
1515 Ga0496116_0001070
1516 Ga0496116_0008239
1517 Ga0496116_0054024
1518 Ga0496117_0001527
1519 Ga0496117_0063956
1520 Ga0496118_0000172
1521 Ga0496118_0053901
1522 Ga0496119_0001107
1523 Ga0496119_0346548
1524 Ga0496120_0014411
1525 Ga0496120_0082594
1526 Ga0496121_0006442
1527 Ga0496121_0017288
1528 Ga0496122_0059208
1529 Ga0496122_0061593
1530 Ga0496122_0139350
1531 Ga0496123_0077509
1532 Ga0496124_0014794
1533 Ga0496124_0019059
1534 Ga0496124_0049168
1535 Ga0496124_0273256
1536 Ga0496125_0011267
1537 Ga0496125_0025682
1538 Ga0496125_0082927
1539 Ga0496125_0178708
1540 Ga0496126_0001683
1541 Ga0496126_0104011
1542 Ga0496126_0533638
1543 Ga0496126_0563825
1544 Ga0501031_0007537
1545 Ga0501032_0000196
1546 Ga0501032_0062314
1547 Ga0501032_0138922
1548 Ga0501032_0477523
1549 Ga0501033_0003209
1550 Ga0501033_0356247
1551 Ga0501033_0694835
1552 Ga0501033_0789573
1553 Ga0501034_0001151
1554 Ga0501034_0003462
1555 Ga0501034_0024163
1556 Ga0501034_0237707
1557 Ga0501034_0316051
1558 Ga0501036_0001626
1559 Ga0501036_0009212
1560 Ga0501036_0773600
1561 Ga0501037_0001377
1562 Ga0501037_0010257
1563 Ga0501037_0083507
1564 Ga0501038_0001622
1565 Ga0501039_0001302
1566 Ga0501040_0541533
1567 Ga0501042_1191770
1568 Ga0501043_0000409
1569 Ga0501043_0002131
1570 Ga0501043_0054990
1571 Ga0501043_0202230
1572 Ga0501043_1129224
1573 Ga0501046_0000011
1574 Ga0501046_0000181
1575 Ga0501046_0015303
1576 Ga0501046_0048166
1577 Ga0501046_0746871
1578 Ga0501047_0000161
1579 Ga0501047_0002426
1580 Ga0501047_0476395
1581 Ga0501047_0846751
1582 Ga0501048_0001687
1583 Ga0501048_0003595
1584 Ga0501067_0000145
1585 Ga0501067_0130999
1586 Ga0501067_0333142
1587 Ga0501068_0002577
1588 Ga0501069_0003759
1589 Ga0501069_0630720
1590 Ga0501070_0028493
1591 Ga0501070_0055720
1592 Ga0501071_0094786
1593 Ga0501072_0017020
1594 Ga0501073_0000027
1595 Ga0501073_0034095
1596 Ga0501073_0043888
1597 Ga0501073_0157840
1598 Ga0501073_0453721
1599 Ga0501073_0548848
1600 Ga0501074_0001347
1601 Ga0501074_0003607
1602 Ga0501076_0275383
1603 Ga0501076_1456036
1604 Ga0501080_0002621
1605 Ga0501080_0003069
1606 Ga0501080_0520591
1607 Ga0501080_1863084
1608 Ga0501081_0426003
1609 Ga0501083_0002123
1610 Ga0501083_0006827
1611 Ga0501083_0097960
1612 Ga0501035_0001852
1613 Ga0501035_0157404
1614 Ga0501035_0513419
1615 Ga0501044_0001758
1616 Ga0501044_0003498
1617 Ga0501044_0069873
1618 Ga0501044_0142679
1619 Ga0501044_0478662
1620 Ga0501045_0014292
1621 Ga0501045_0068930
1622 nmdc:mga03n38_176199_c1
1623 nmdc:mga00v17_174389_c1
1624 nmdc:mga00v17_42401_c1
1625 nmdc:mga00v17_469155_c1
1626 nmdc:mga0yw44_249038_c1
1627 nmdc:mga0yw44_33973_c1
1628 nmdc:mga0yw44_422136_c1
1629 nmdc:mga0yw44_51203_c1
1630 nmdc:mga0yw44_75566_c1
1631 nmdc:mga0k408_19984_c1
1632 nmdc:mga0k408_764347_c1
1633 nmdc:mga06z11_103722_c1
1634 nmdc:mga06z11_166516_c1
1635 nmdc:mga06z11_26431_c1
1636 nmdc:mga06z11_546294_c1
1637 nmdc:mga04h51_114479_c1
1638 nmdc:mga04h51_98384_c1
1639 nmdc:mga07m45_296324_c1
1640 nmdc:mga07m45_46561_c1
1641 nmdc:mga07m45_746266_c1
1642 nmdc:mga05p37_123970_c1
1643 nmdc:mga05p37_174908_c1
1644 nmdc:mga05p37_300629_c1
1645 nmdc:mga05p37_414185_c1
1646 nmdc:mga09592_90126_c1
1647 nmdc:mga0qj67_12245_c1
1648 nmdc:mga0qj67_420171_c1
1649 nmdc:mga06r32_396103_c1
1650 nmdc:mga06r32_4162_c1
1651 nmdc:mga0n895_131371_c1
1652 nmdc:mga0n895_150460_c1
1653 nmdc:mga0n895_337627_c1
1654 nmdc:mga0n895_66587_c1
1655 nmdc:mga0n895_8089_c1
1656 nmdc:mga0n895_98890_c1
1657 nmdc:mga0rr50_178234_c1
1658 nmdc:mga0rr50_26047_c1
1659 nmdc:mga0rr50_446149_c1
1660 nmdc:mga0rr50_653668_c1
1661 nmdc:mga0a205_1624_c1
1662 nmdc:mga0a205_3536_c1
1663 nmdc:mga0a205_37613_c1
1664 nmdc:mga0a205_44757_c1
1665 nmdc:mga0a205_489914_c1
1666 nmdc:mga0a205_9896_c1
1667 nmdc:mga0sz30_443206_c1
1668 Ga0495601_0019454
1669 Ga0495601_0159538
1670 Ga0495612_0016451
1671 Ga0500610_0152431
1672 Ga0495655_0014889
1673 Ga0495595_0227493
1674 Ga0500578_0175378
1675 Ga0500643_051773
1676 Ga0500651_0068330
1677 Ga0500555_003122
1678 Ga0500594_0026187
1679 Ga0500652_069402
1680 Ga0500658_0022106
1681 Ga0500658_0026760
1682 Ga0500568_0001209
1683 Ga0500568_0360392
1684 Ga0500616_0000251
1685 Ga0500616_0000627
1686 Ga0500616_0036732
1687 Ga0500620_123787
1688 Ga0500622_0000099
1689 Ga0500627_0075987
1690 Ga0500627_0429170
1691 Ga0500633_0000560
1692 Ga0500639_078842
1693 Ga0500645_000647
1694 Ga0501084_0003235
1695 Ga0501084_0464675
1696 Ga0501084_0488221
1697 Ga0501084_1322111
1698 Ga0501084_1374220
1699 Ga0501082_0005376
1700 Ga0501082_0196049
1701 Ga0501082_0301848
1702 Ga0530510_0232518
1703 2510136550
1704 2510900182
1705 2511199835
1706 2513569595
1707 2513576427
1708 2513635262
1709 2513709838
1710 2513870064
1711 2514018826
1712 2515115122
1713 2515633304
1714 2515642529
1715 2515658506
1716 2515741970
1717 2517041876
1718 2517081088
1719 2517098567
1720 2517410879
1721 2524535378
1722 2530644542
1723 2535520275
1724 2585221567
1725 2585392668
1726 2585404116
1727 2585524216
1728 2585539252
1729 2585544263
1730 2585819998
1731 2585837206
1732 2626639266
1733 2644003455
1734 2645719651
1735 2719183809
1736 2719728250
1737 2721145111
1738 2721155848
1739 2721167198
1740 2722838176
1741 2724042444
1742 2725946272
1743 2730161949
1744 2730300955
1745 2739033702
1746 2766068431
1747 2793324001
1748 2793346286
1749 2805929100
1750 2806044799
1751 2806054041
1752 2806059867
1753 2806066080
1754 2806073338
1755 2838027224
1756 2838671538
1757 2838684452
1758 2838693791
1759 2838699943
1760 2838704195
1761 2838711772
1762 2838735499
1763 2838748401
1764 2841858561
1765 2842081919
1766 2842115764
1767 2842122495
1768 2842149187
1769 2842162713
1770 2842167084
1771 2842186217
1772 2842195304
1773 2842203403
1774 2842222206
1775 2842236609
1776 2842241184
1777 2842250292
1778 2842253646
1779 2842263319
1780 2842278358
1781 2842295574
1782 2842310003
1783 2842377360
1784 2842381650
1785 2842389043
1786 2842491497
1787 2844461061
1788 2857519232
1789 2862292071
1790 2884218895
1791 2919103517
1792 2923559678
1793 2933576444
1794 2933591730
1795 2935898208
1796 2935905796
1797 2936370238
1798 2936377910
1799 2996887671
1800 2996896919
1801 3002142216
1802 3005456852
1803 639651766
1804 8005313076
1805 8005322198
1806 8005381919
1807 8005466849
1808 8005562155
1809 8005567086
1810 8005576341
1811 8005689486
1812 8023682410
1813 8024483741
1814 8057878386

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

21

102

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9632 12 145
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9522 1 147
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9493 12 145
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9396 1 147
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9187 2 150
ID Description Score Start End Superfamily
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9564 9 142 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9554 9 142 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9222 5 145 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9159 5 145 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9135 2 151 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A4V3MQQ2-F1-model_v4 deleted 0.9968 37 134
AF-A0A7Y6PXN4-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9887 1 140 GO:0051920
AF-A0A109K3L9-F1-model_v4 Alkylhydroperoxidase 0.9877 1 152 GO:0051920
AF-Q1IKT6-F1-model_v4 Alkylhydroperoxidase AhpD 0.9867 1 150 GO:0051920
AF-A0A023XRL7-F1-model_v4 deleted 0.9866 1 152

Map