F485338

General Info

Members Datasets Scaffolds Average Seq Length
906 429 865 244

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0115006|Ga0466960_0115006_271_1089
Length 272
Sequence MTIQTTHTSQTAATTGTRFLGEAVVLTKRSLRHILRSPDTIITTAITPVAMLLLFVYVFGGAIDISGAPNDKYVDYLLPGILLITVASGVAYTSYRLFLDLQGGIFQRFESMPIARSAALWAHVLTSLVANLLSLALVVIVALVMGFRSGAGPLAWLGVLGILVLFTLALTWLAVIAGLTAKSTDGAGGFAYPLLFLPFLSSAFVPTDGMPPPVRWFAEHQPVTPLVDALRSLYAEQPLGNDVWTALAWCSALLAVAYALAMRAYHRRMKAC

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
3 2643221617 Nocardioides sp. Root79 Isolate Unclassified
4 2643221619 Agromyces sp. Root81 Isolate Unclassified
5 2643221620 Nocardioides sp. Root240 Isolate Unclassified
6 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
7 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
8 2738541305 Nocardioides sp. CF167 Isolate Unclassified
9 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
10 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
11 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
12 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
13 2808606372 Agromyces sp. 23-23 Isolate Unclassified
14 2808606394 Promicromonospora sp. C35 Isolate Unclassified
15 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
16 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
17 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
18 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
19 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
20 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
21 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
22 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
23 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
24 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
25 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
26 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
27 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
28 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
29 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
30 2928153084 Leifsonia sp. 563 Isolate Unclassified
31 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
32 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
33 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
34 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
35 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
36 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
39 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
40 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
41 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
43 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
44 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
45 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
46 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
48 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
49 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
50 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
51 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
140 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
215 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
216 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
217 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
218 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
222 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
241 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
242 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
243 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
244 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
245 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
246 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
247 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
248 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
249 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
250 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
251 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
252 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
253 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
254 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
255 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
256 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
257 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
258 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
259 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
265 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
266 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
267 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
268 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
273 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
274 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
275 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
278 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
283 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
284 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
285 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
286 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
287 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
288 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
289 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
293 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
294 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
295 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
298 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
301 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
302 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
303 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
304 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
305 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
306 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
307 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
308 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
309 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
310 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
311 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
312 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
313 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
316 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
317 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
318 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
319 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
320 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
325 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
326 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
327 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
328 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
329 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
330 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
331 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
332 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
333 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
351 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
352 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
353 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
354 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
355 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
356 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
357 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
358 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
359 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
373 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
374 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
375 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
376 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
377 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
378 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
379 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
380 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
381 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
382 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
383 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
384 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
385 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
388 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
389 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
390 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
391 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
392 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
393 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
394 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
395 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
396 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
397 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
398 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
399 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
400 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
401 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
402 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
403 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
404 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
405 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
406 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
407 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
408 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
409 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
410 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
411 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
412 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
413 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
414 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
415 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
416 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
417 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
418 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
419 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
420 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
421 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
422 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
423 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
424 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
425 649633069 Micromonospora sp. L5 Isolate Unclassified
426 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
427 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
428 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
429 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.7
Metatranscriptomes 0.77
Isolates 4.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.29
Nodule 0
Rhizoplane 8.5
Rhizosphere 77.26
Stem 0
Stem Tuber 0
Unclassified 7.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001702 3300001979 Bacteria 10095
2 JGI24739J22299_10085499 3300001989 Bacteria 964
3 JGI24735J21928_10032757 3300002067 Bacteria 1537
4 JGI25158J39367_1012116 3300002739 Bacteria 1141
5 JGI25406J46586_10008542 3300003203 Bacteria 4631
6 rootH2_10175217 3300003320 Bacteria 2876
7 rootL2_10077234 3300003322 Bacteria 10064
8 rootL2_10271871 3300003322 Bacteria 2842
9 rootH1_10192662 3300003323 Bacteria 1952
10 Ga0006562J51391_1095727 3300003578 Bacteria 2947
11 Ga0006562J51391_1095728 3300003578 Bacteria 2480
12 Ga0006562J51391_1096029 3300003578 Bacteria 10820
13 Ga0006562J51391_1096030 3300003578 Bacteria 8210
14 JGI25404J52841_10004405 3300003659 Bacteria 2851
15 Ga0055539_1000008 3300003752 Bacteria 537665
16 Ga0055533_1000001 3300003756 Bacteria 1863437
17 Ga0055525_1000497 3300003759 Bacteria 19910
18 Ga0055525_1001592 3300003759 Bacteria 3657
19 Ga0055527_1000001 3300003760 Bacteria 850044
20 Ga0055529_1000019 3300003763 Bacteria 332786
21 Ga0070658_10012817 3300005327 Bacteria 6727
22 Ga0070658_10100252 3300005327 Bacteria 2394
23 Ga0070658_10161304 3300005327 Bacteria 1881
24 Ga0068869_100071921 3300005334 Bacteria 2562
25 Ga0068869_100396194 3300005334 Bacteria 1135
26 Ga0070666_10147942 3300005335 Bacteria 1638
27 Ga0068868_100538527 3300005338 Bacteria 1027
28 Ga0070668_100018010 3300005347 Bacteria 5299
29 Ga0070668_100302545 3300005347 Bacteria 1342
30 Ga0070668_100407740 3300005347 Bacteria 1162
31 Ga0070675_100171344 3300005354 Bacteria 1872
32 Ga0070675_100252163 3300005354 Bacteria 1545
33 Ga0070674_100023271 3300005356 Bacteria 4007
34 Ga0070659_100305275 3300005366 Bacteria 1328
35 Ga0070709_10011385 3300005434 Bacteria 4957
36 Ga0070709_10057356 3300005434 Bacteria 2466
37 Ga0070709_10152671 3300005434 Bacteria 1597
38 Ga0070709_10153556 3300005434 Bacteria 1593
39 Ga0070709_10614000 3300005434 Bacteria 838
40 Ga0070714_100087980 3300005435 Bacteria 2717
41 Ga0070714_100125574 3300005435 Bacteria 2287
42 Ga0070714_100136889 3300005435 Bacteria 2194
43 Ga0070714_100290659 3300005435 Bacteria 1521
44 Ga0070713_100032487 3300005436 Bacteria 4169
45 Ga0070713_100742706 3300005436 Bacteria 938
46 Ga0070713_100909786 3300005436 Bacteria 846
47 Ga0070710_10002785 3300005437 Bacteria 8330
48 Ga0070710_10046663 3300005437 Bacteria 2413
49 Ga0070710_10091923 3300005437 Bacteria 1791
50 Ga0070710_10229399 3300005437 Bacteria 1185
51 Ga0070711_100386124 3300005439 Bacteria 1133
52 Ga0070711_100440035 3300005439 Bacteria 1065
53 Ga0070678_100032235 3300005456 Bacteria 3625
54 Ga0070681_10689803 3300005458 Bacteria 937
55 Ga0070681_10708326 3300005458 Bacteria 923
56 Ga0070706_100029829 3300005467 Bacteria 5024
57 Ga0070706_100192730 3300005467 Bacteria 1904
58 Ga0070698_100037624 3300005471 Bacteria 4988
59 Ga0070684_100361616 3300005535 Bacteria 1336
60 Ga0068853_100192656 3300005539 Bacteria 1853
61 Ga0068853_100248732 3300005539 Bacteria 1631
62 Ga0070695_100233505 3300005545 Bacteria 1331
63 Ga0070665_100000001 3300005548 Bacteria 1083363
64 Ga0068855_100026576 3300005563 Bacteria 6925
65 Ga0068855_100581140 3300005563 Bacteria 1210
66 Ga0070664_100430223 3300005564 Bacteria 1210
67 Ga0068857_100236890 3300005577 Bacteria 1670
68 Ga0068856_100063130 3300005614 Bacteria 3659
69 Ga0068856_100071837 3300005614 Bacteria 3426
70 Ga0070702_100235904 3300005615 Bacteria 1232
71 Ga0068852_100636402 3300005616 Bacteria 1073
72 Ga0068864_100891835 3300005618 Bacteria 878
73 Ga0068861_100264343 3300005719 Bacteria 1474
74 Ga0068858_100036408 3300005842 Bacteria 4563
75 Ga0068858_100244311 3300005842 Bacteria 1704
76 Ga0068860_100021498 3300005843 Bacteria 6247
77 Ga0068862_100009224 3300005844 Bacteria 8172
78 Ga0081455_10005778 3300005937 Bacteria 13485
79 Ga0081455_10016895 3300005937 Bacteria 7017
80 Ga0081455_10025093 3300005937 Bacteria 5508
81 Ga0081455_10108782 3300005937 Bacteria 2207
82 Ga0081455_10158262 3300005937 Bacteria 1739
83 Ga0081538_10004076 3300005981 Bacteria 13588
84 Ga0081538_10006653 3300005981 Bacteria 10129
85 Ga0081538_10043181 3300005981 Bacteria 2835
86 Ga0081540_1000051 3300005983 Bacteria 126311
87 Ga0081540_1143877 3300005983 Bacteria 952
88 Ga0081539_10004561 3300005985 Bacteria 15152
89 Ga0081539_10054051 3300005985 Bacteria 2245
90 Ga0070717_10310350 3300006028 Bacteria 1403
91 Ga0075365_10039746 3300006038 Bacteria 3065
92 Ga0075365_10376742 3300006038 Bacteria 1001
93 Ga0075368_10022375 3300006042 Bacteria 2407
94 Ga0075364_10001762 3300006051 Bacteria 11960
95 Ga0070715_10056596 3300006163 Bacteria 1706
96 Ga0070716_100015172 3300006173 Bacteria 3953
97 Ga0070716_100031205 3300006173 Bacteria 2896
98 Ga0070716_100334139 3300006173 Bacteria 1066
99 Ga0070712_100092712 3300006175 Bacteria 2215
100 Ga0075362_10177068 3300006177 Bacteria 1032
101 Ga0075367_10019889 3300006178 Bacteria 3730
102 Ga0075369_10033394 3300006186 Bacteria 2180
103 Ga0075369_10135007 3300006186 Bacteria 1123
104 Ga0075427_10008791 3300006194 Bacteria 1501
105 Ga0075366_10112694 3300006195 Bacteria 1637
106 Ga0075428_100042705 3300006844 Bacteria 4985
107 Ga0075428_100045332 3300006844 Bacteria 4831
108 Ga0075428_100075810 3300006844 Bacteria 3672
109 Ga0075428_100160108 3300006844 Bacteria 2443
110 Ga0075428_100220034 3300006844 Bacteria 2050
111 Ga0075430_100004837 3300006846 Bacteria 11338
112 Ga0075430_100052817 3300006846 Bacteria 3422
113 Ga0075430_100067055 3300006846 Bacteria 3013
114 Ga0075430_100076663 3300006846 Bacteria 2802
115 Ga0075430_100373830 3300006846 Bacteria 1176
116 Ga0075431_100004579 3300006847 Bacteria 13572
117 Ga0075431_100021347 3300006847 Bacteria 6620
118 Ga0075431_100057283 3300006847 Bacteria 4019
119 Ga0075431_100070873 3300006847 Bacteria 3596
120 Ga0075431_100410472 3300006847 Bacteria 1354
121 Ga0075433_10007152 3300006852 Bacteria 8838
122 Ga0075434_100004021 3300006871 Bacteria 13177
123 Ga0075434_100013750 3300006871 Bacteria 7717
124 Ga0075429_100024498 3300006880 Bacteria 5235
125 Ga0075429_100105764 3300006880 Bacteria 2458
126 Ga0075429_100255353 3300006880 Bacteria 1535
127 Ga0075429_100364433 3300006880 Bacteria 1265
128 Ga0068865_100208611 3300006881 Bacteria 1521
129 Ga0068865_100592533 3300006881 Bacteria 936
130 Ga0075436_100205839 3300006914 Bacteria 1394
131 Ga0105251_10132951 3300009011 Bacteria 1127
132 Ga0105240_10170212 3300009093 Bacteria 2581
133 Ga0105240_10357485 3300009093 Bacteria 1655
134 Ga0105240_10484420 3300009093 Bacteria 1378
135 Ga0105245_10040193 3300009098 Bacteria 4166
136 Ga0105245_10042613 3300009098 Bacteria 4050
137 Ga0105245_10438494 3300009098 Bacteria 1312
138 Ga0105247_10129913 3300009101 Bacteria 1641
139 Ga0114129_10003310 3300009147 Bacteria 22631
140 Ga0114129_10006580 3300009147 Bacteria 16496
141 Ga0114129_10008508 3300009147 Bacteria 14627
142 Ga0114129_10014539 3300009147 Bacteria 11216
143 Ga0114129_10088561 3300009147 Bacteria 4291
144 Ga0114129_10711916 3300009147 Bacteria 1289
145 Ga0105243_10078580 3300009148 Bacteria 2687
146 Ga0105243_10084550 3300009148 Bacteria 2599
147 Ga0105243_10123441 3300009148 Bacteria 2187
148 Ga0105243_10886801 3300009148 Bacteria 886
149 Ga0105241_10702090 3300009174 Bacteria 923
150 Ga0105248_10054648 3300009177 Bacteria 4478
151 Ga0105248_10383794 3300009177 Bacteria 1582
152 Ga0105248_10516539 3300009177 Bacteria 1347
153 Ga0105237_10298877 3300009545 Bacteria 1613
154 Ga0105237_10367179 3300009545 Bacteria 1444
155 Ga0105237_10431060 3300009545 Bacteria 1324
156 Ga0105237_10637934 3300009545 Bacteria 1072
157 Ga0105237_11075278 3300009545 Bacteria 811
158 Ga0105238_10043572 3300009551 Bacteria 4540
159 Ga0105238_10113875 3300009551 Bacteria 2684
160 Ga0105249_10093856 3300009553 Bacteria 2812
161 Ga0105249_10873759 3300009553 Bacteria 965
162 Ga0105239_10042641 3300010375 Bacteria 4972
163 Ga0105239_10081330 3300010375 Bacteria 3565
164 Ga0105239_10246387 3300010375 Bacteria 2006
165 Ga0105246_10002245 3300011119 Bacteria 11650
166 Ga0105246_10003457 3300011119 Bacteria 9574
167 Ga0157371_10028551 3300013102 Bacteria 4039
168 Ga0157370_10184200 3300013104 Bacteria 1939
169 Ga0157369_10026473 3300013105 Bacteria 6432
170 Ga0157369_10103973 3300013105 Bacteria 3025
171 Ga0157369_10150911 3300013105 Bacteria 2456
172 Ga0157369_10593704 3300013105 Bacteria 1143
173 Ga0171462_1003 3300013250 Bacteria 853796
174 Ga0157374_10000003 3300013296 Bacteria 854471
175 Ga0157374_10594417 3300013296 Bacteria 1116
176 Ga0157378_10207220 3300013297 Bacteria 1857
177 Ga0157378_10575323 3300013297 Bacteria 1135
178 Ga0163162_10001277 3300013306 Bacteria 23565
179 Ga0163162_10378299 3300013306 Bacteria 1549
180 Ga0163162_10469334 3300013306 Bacteria 1390
181 Ga0163162_10499997 3300013306 Bacteria 1346
182 Ga0163162_10830894 3300013306 Bacteria 1040
183 Ga0157372_10077075 3300013307 Bacteria 3764
184 Ga0157372_10136632 3300013307 Bacteria 2823
185 Ga0157372_10437843 3300013307 Bacteria 1524
186 Ga0157372_10452185 3300013307 Bacteria 1497
187 Ga0157372_10561414 3300013307 Bacteria 1331
188 Ga0157372_10954889 3300013307 Bacteria 994
189 Ga0157375_10042755 3300013308 Bacteria 4388
190 Ga0157375_10239218 3300013308 Bacteria 1975
191 Ga0157375_10594215 3300013308 Bacteria 1266
192 Ga0157375_10807836 3300013308 Bacteria 1086
193 Ga0157375_11166980 3300013308 Bacteria 903
194 Ga0163163_10618679 3300014325 Bacteria 1146
195 Ga0163163_10650195 3300014325 Bacteria 1118
196 Ga0182008_10000001 3300014497 Bacteria 540790
197 Ga0182008_10012803 3300014497 Bacteria 4422
198 Ga0157377_10206578 3300014745 Bacteria 1250
199 Ga0157379_10046656 3300014968 Bacteria 3865
200 Ga0157376_10366729 3300014969 Bacteria 1383
201 Ga0157376_10612214 3300014969 Bacteria 1085
202 Ga0157376_10769538 3300014969 Bacteria 973
203 Ga0182007_10002103 3300015262 Bacteria 10193
204 Ga0163161_10098660 3300017792 Bacteria 2172
205 Ga0163161_10122253 3300017792 Bacteria 1957
206 Ga0163161_10252190 3300017792 Bacteria 1376
207 Ga0206354_11335766 3300020081 Bacteria 2021
208 Ga0206353_11910771 3300020082 Bacteria 4430
209 Ga0213875_10000220 3300021388 Bacteria 57921
210 Ga0213875_10000386 3300021388 Bacteria 39534
211 Ga0213875_10055967 3300021388 Bacteria 1847
212 Ga0209436_100233 3300025208 Bacteria 25515
213 Ga0209566_100050 3300025225 Bacteria 234653
214 Ga0209674_100001 3300025226 Bacteria 4013750
215 Ga0209672_100006 3300025228 Bacteria 1004497
216 Ga0209147_100677 3300025229 Bacteria 17561
217 Ga0209563_100001 3300025230 Bacteria 4013775
218 Ga0209563_100276 3300025230 Bacteria 21685
219 Ga0209677_100001 3300025253 Bacteria 4013787
220 Ga0209677_101239 3300025253 Bacteria 11548
221 Ga0209148_1000015 3300025254 Bacteria 850103
222 Ga0209455_1000013 3300025272 Bacteria 850103
223 Ga0209455_1001463 3300025272 Bacteria 10632
224 Ga0209130_1002047 3300025284 Bacteria 10968
225 Ga0207426_1000539 3300025302 Bacteria 54198
226 Ga0207710_10158591 3300025900 Bacteria 1101
227 Ga0207688_10224365 3300025901 Bacteria 1133
228 Ga0207680_10036903 3300025903 Bacteria 2817
229 Ga0207647_10072786 3300025904 Bacteria 2072
230 Ga0207647_10163243 3300025904 Bacteria 1299
231 Ga0207647_10216658 3300025904 Bacteria 1104
232 Ga0207685_10020248 3300025905 Bacteria 2207
233 Ga0207699_10009759 3300025906 Bacteria 4792
234 Ga0207699_10015597 3300025906 Bacteria 3951
235 Ga0207699_10156208 3300025906 Bacteria 1514
236 Ga0207643_10045380 3300025908 Bacteria 2482
237 Ga0207705_10081202 3300025909 Bacteria 2363
238 Ga0207705_10218060 3300025909 Bacteria 1448
239 Ga0207684_10256236 3300025910 Bacteria 1510
240 Ga0207684_10319441 3300025910 Bacteria 1338
241 Ga0207695_10139908 3300025913 Bacteria 2370
242 Ga0207693_10001639 3300025915 Bacteria 19763
243 Ga0207693_10026140 3300025915 Bacteria 4622
244 Ga0207693_10130757 3300025915 Bacteria 1973
245 Ga0207663_10042421 3300025916 Bacteria 2779
246 Ga0207663_10423650 3300025916 Bacteria 1022
247 Ga0207659_10447535 3300025926 Bacteria 1087
248 Ga0207687_10452655 3300025927 Bacteria 1065
249 Ga0207700_10018357 3300025928 Bacteria 4697
250 Ga0207700_10173141 3300025928 Bacteria 1802
251 Ga0207700_10235697 3300025928 Bacteria 1558
252 Ga0207664_10022882 3300025929 Bacteria 4674
253 Ga0207664_10168738 3300025929 Bacteria 1871
254 Ga0207664_10382299 3300025929 Bacteria 1250
255 Ga0207690_10286122 3300025932 Bacteria 1285
256 Ga0207709_10018497 3300025935 Bacteria 3903
257 Ga0207669_10043606 3300025937 Bacteria 2628
258 Ga0207669_10316313 3300025937 Bacteria 1193
259 Ga0207665_10006024 3300025939 Bacteria 8052
260 Ga0207665_10012540 3300025939 Bacteria 5569
261 Ga0207665_10277934 3300025939 Bacteria 1245
262 Ga0207691_10144008 3300025940 Bacteria 2099
263 Ga0207711_10173752 3300025941 Bacteria 1956
264 Ga0207711_10253779 3300025941 Bacteria 1615
265 Ga0207689_10057501 3300025942 Bacteria 3199
266 Ga0207679_10181498 3300025945 Bacteria 1742
267 Ga0207667_10035862 3300025949 Bacteria 5320
268 Ga0207667_10283221 3300025949 Bacteria 1694
269 Ga0207712_10006450 3300025961 Bacteria 7397
270 Ga0207668_10012416 3300025972 Bacteria 5216
271 Ga0207668_10692455 3300025972 Bacteria 895
272 Ga0207658_10253458 3300025986 Bacteria 1496
273 Ga0207677_10489478 3300026023 Bacteria 1061
274 Ga0207702_10052785 3300026078 Bacteria 3441
275 Ga0207702_10144748 3300026078 Bacteria 2155
276 Ga0207648_10019076 3300026089 Bacteria 6193
277 Ga0207648_10334325 3300026089 Bacteria 1363
278 Ga0207676_10257891 3300026095 Bacteria 1573
279 Ga0207674_10370711 3300026116 Bacteria 1384
280 Ga0207675_100050341 3300026118 Bacteria 3887
281 Ga0207683_10027099 3300026121 Bacteria 4953
282 Ga0207683_10177752 3300026121 Bacteria 1929
283 Ga0207698_10124834 3300026142 Bacteria 2187
284 Ga0207428_10001525 3300027907 Bacteria 24188
285 Ga0207428_10007572 3300027907 Bacteria 9897
286 Ga0268266_10000102 3300028379 Bacteria 179754
287 Ga0268266_10009660 3300028379 Bacteria 8481
288 Ga0268265_10089239 3300028380 Bacteria 2458
289 Ga0268264_10015344 3300028381 Bacteria 6283
290 Ga0265336_10002352 3300028666 Bacteria 7861
291 Ga0307517_10269917 3300028786 Bacteria 979
292 Ga0307515_10000941 3300028794 Bacteria 66641
293 Ga0307515_10030339 3300028794 Bacteria 9085
294 Ga0307515_10054239 3300028794 Bacteria 5890
295 Ga0265338_10002819 3300028800 Bacteria 25378
296 Ga0307511_10080776 3300030521 Bacteria 2288
297 Ga0307513_10025506 3300031456 Bacteria 6844
298 Ga0307509_10114990 3300031507 Bacteria 2684
299 Ga0307408_100007323 3300031548 Bacteria 7300
300 Ga0307408_100015791 3300031548 Bacteria 5031
301 Ga0307408_100069259 3300031548 Bacteria 2601
302 Ga0307408_100590798 3300031548 Bacteria 985
303 Ga0307508_10020499 3300031616 Bacteria 6003
304 Ga0307508_10181359 3300031616 Bacteria 1708
305 Ga0307514_10254043 3300031649 Bacteria 1037
306 Ga0307516_10003156 3300031730 Bacteria 21453
307 Ga0307516_10032377 3300031730 Bacteria 5266
308 Ga0307405_10001416 3300031731 Bacteria 10090
309 Ga0307405_10036526 3300031731 Bacteria 2945
310 Ga0307405_10224046 3300031731 Bacteria 1382
311 Ga0307413_10109358 3300031824 Bacteria 1847
312 Ga0307413_10179415 3300031824 Bacteria 1508
313 Ga0307413_10209587 3300031824 Bacteria 1414
314 Ga0307413_10270273 3300031824 Bacteria 1272
315 Ga0307410_10005220 3300031852 Bacteria 6841
316 Ga0307410_10008763 3300031852 Bacteria 5632
317 Ga0307410_10109263 3300031852 Bacteria 1998
318 Ga0307410_10125250 3300031852 Bacteria 1880
319 Ga0307410_10182517 3300031852 Bacteria 1590
320 Ga0307410_10231779 3300031852 Bacteria 1426
321 Ga0307406_10050198 3300031901 Bacteria 2643
322 Ga0307406_10150122 3300031901 Bacteria 1661
323 Ga0307406_10155325 3300031901 Bacteria 1638
324 Ga0307406_10357034 3300031901 Bacteria 1144
325 Ga0307407_10007799 3300031903 Bacteria 4871
326 Ga0307407_10041438 3300031903 Bacteria 2575
327 Ga0307407_10077907 3300031903 Bacteria 1995
328 Ga0307407_10150609 3300031903 Bacteria 1511
329 Ga0307412_10002338 3300031911 Bacteria 10503
330 Ga0307412_10015415 3300031911 Bacteria 4533
331 Ga0307412_10034617 3300031911 Bacteria 3220
332 Ga0307412_10094398 3300031911 Bacteria 2100
333 Ga0307412_10095669 3300031911 Bacteria 2088
334 Ga0307412_10343150 3300031911 Bacteria 1196
335 Ga0307412_10673254 3300031911 Bacteria 885
336 Ga0307409_100003467 3300031995 Bacteria 8569
337 Ga0307409_100026415 3300031995 Bacteria 4094
338 Ga0307409_100076499 3300031995 Bacteria 2684
339 Ga0307409_100111656 3300031995 Bacteria 2293
340 Ga0307409_100115348 3300031995 Bacteria 2261
341 Ga0307409_100278559 3300031995 Bacteria 1544
342 Ga0307409_100438363 3300031995 Bacteria 1258
343 Ga0307416_100000369 3300032002 Bacteria 23398
344 Ga0307416_100139529 3300032002 Bacteria 2200
345 Ga0307416_100254248 3300032002 Bacteria 1712
346 Ga0307411_10118240 3300032005 Bacteria 1912
347 Ga0307415_100000025 3300032126 Bacteria 62892
348 Ga0307415_100058923 3300032126 Bacteria 2646
349 Ga0307415_100060115 3300032126 Bacteria 2624
350 Ga0307415_100125101 3300032126 Bacteria 1936
351 Ga0307415_100165857 3300032126 Bacteria 1717
352 Ga0307415_100230987 3300032126 Bacteria 1490
353 Ga0307415_100313681 3300032126 Bacteria 1304
354 Ga0307507_10104699 3300033179 Bacteria 2347
355 Ga0307507_10265178 3300033179 Bacteria 1092
356 Ga0307510_10001560 3300033180 Bacteria 25328
357 Ga0373938_0019466 3300034957 Bacteria 1358
358 Ga0373926_0016809 3300035083 Bacteria 2507
359 Ga0373934_0130488 3300035086 Bacteria 1025
360 Ga0373944_0008359 3300035089 Bacteria 2796
361 Ga0373951_0000079 3300035091 Bacteria 38464
362 Ga0373923_0041771 3300035111 Bacteria 1892
363 Ga0373936_0008251 3300035113 Bacteria 3916
364 Ga0373936_0047025 3300035113 Bacteria 1740
365 Ga0373945_0001638 3300035116 Bacteria 6866
366 Ga0373953_0086052 3300035117 Bacteria 1312
367 Ga0373953_0105577 3300035117 Bacteria 1188
368 Ga0373943_0000237 3300035170 Bacteria 22674
369 Ga0373943_0043065 3300035170 Bacteria 2191
370 Ga0373946_0000406 3300035171 Bacteria 14067
371 Ga0373924_0002210 3300035410 Bacteria 6520
372 Ga0373931_0288488 3300035691 Bacteria 1010
373 Ga0373935_0015284 3300035692 Bacteria 4637
374 Ga0373935_0016330 3300035692 Bacteria 4492
375 Ga0373935_0070001 3300035692 Bacteria 2261
376 Ga0373927_0027168 3300035695 Bacteria 3738
377 Ga0373927_0144623 3300035695 Bacteria 1556
378 Ga0373933_0006388 3300035724 Bacteria 6416
379 Ga0373933_0112783 3300035724 Bacteria 1697
380 Ga0373933_0128406 3300035724 Bacteria 1592
381 Ga0373947_0000027 3300035725 Bacteria 81186
382 Ga0373947_0080988 3300035725 Bacteria 2009
383 Ga0373937_0013181 3300036401 Bacteria 7279
384 Ga0373937_0183625 3300036401 Bacteria 1964
385 Ga0373925_0001410 3300037068 Bacteria 20874
386 Ga0373925_0117552 3300037068 Bacteria 2060
387 Ga0373925_0238280 3300037068 Bacteria 1456
388 Ga0373925_0492685 3300037068 Bacteria 1006
389 Ga0395899_0018679 3300037312 Bacteria 5268
390 Ga0395899_0070354 3300037312 Bacteria 2561
391 Ga0395899_0179366 3300037312 Bacteria 1488
392 Ga0395900_0003464 3300037418 Bacteria 17036
393 Ga0395900_0072675 3300037418 Bacteria 3536
394 Ga0395900_0172883 3300037418 Bacteria 2198
395 Ga0395900_0177757 3300037418 Bacteria 2164
396 Ga0395900_0220293 3300037418 Bacteria 1913
397 Ga0395900_0985284 3300037418 Bacteria 763
398 Ga0395898_0000015 3300037466 Bacteria 439819
399 Ga0395898_0043300 3300037466 Bacteria 4436
400 Ga0395898_0047481 3300037466 Bacteria 4214
401 Ga0395898_0123869 3300037466 Bacteria 2477
402 Ga0395898_0236047 3300037466 Bacteria 1744
403 Ga0395898_0558151 3300037466 Bacteria 1087
404 Ga0395898_0728205 3300037466 Bacteria 933
405 Ga0395898_1081321 3300037466 Bacteria 736
406 Ga0395905_0069401 3300037471 Bacteria 3301
407 Ga0395905_0167107 3300037471 Bacteria 2067
408 Ga0436364_0361998 3300037853 Bacteria 1499
409 Ga0436364_0501302 3300037853 Bacteria 94330
410 Ga0436364_0764179 3300037853 Bacteria 57419
411 Ga0395901_0007766 3300038443 Bacteria 10824
412 Ga0395901_0034104 3300038443 Bacteria 5256
413 Ga0395901_0352598 3300038443 Bacteria 1518
414 Ga0395901_0449780 3300038443 Bacteria 1317
415 Ga0395901_0706430 3300038443 Bacteria 1005
416 Ga0436365_1565935 3300039437 Bacteria 1697
417 Ga0436362_1141557 3300039453 Bacteria 1053
418 Ga0451791_0529767 3300041451 Bacteria 1933
419 Ga0451847_0075466 3300041503 Bacteria 868
420 Ga0451853_0632895 3300041512 Bacteria 1210
421 Ga0439442_000270 3300042002 Bacteria 12664
422 Ga0439448_0078105 3300042005 Bacteria 1109
423 Ga0439449_0001862 3300042007 Bacteria 8307
424 Ga0439450_014163 3300042008 Bacteria 1613
425 Ga0439454_008528 3300042011 Bacteria 1311
426 Ga0439463_002010 3300042016 Bacteria 5284
427 Ga0450888_009637 3300042126 Bacteria 1107
428 Ga0450907_002416 3300042146 Bacteria 3566
429 Ga0450907_014856 3300042146 Bacteria 1299
430 Ga0439434_0000397 3300042435 Bacteria 12414
431 Ga0439434_0053989 3300042435 Bacteria 1249
432 Ga0450918_000574 3300042531 Bacteria 7815
433 Ga0451577_0068052 3300042876 Bacteria 3176
434 Ga0451577_0100538 3300042876 Bacteria 2583
435 Ga0439440_0031880 3300042993 Bacteria 1248
436 Ga0466972_0008570 3300044658 Bacteria 5131
437 Ga0466972_0012105 3300044658 Bacteria 4334
438 Ga0466972_0022532 3300044658 Bacteria 3136
439 Ga0466972_0092777 3300044658 Bacteria 1431
440 Ga0453683_0046533 3300044673 Bacteria 2720
441 Ga0466965_0012050 3300044683 Bacteria 4060
442 Ga0466965_0026789 3300044683 Bacteria 2795
443 Ga0466966_0035728 3300044684 Bacteria 3209
444 Ga0466966_0123848 3300044684 Bacteria 1586
445 Ga0466961_0016693 3300044693 Bacteria 4721
446 Ga0466961_0019240 3300044693 Bacteria 4395
447 Ga0466961_0022427 3300044693 Bacteria 4061
448 Ga0466961_0048034 3300044693 Bacteria 2728
449 Ga0466964_0095329 3300044706 Bacteria 1302
450 Ga0466964_0176863 3300044706 Bacteria 1009
451 Ga0466964_0368414 3300044706 Bacteria 743
452 Ga0453684_0000007 3300044712 Bacteria 1301482
453 Ga0466971_0016902 3300044719 Bacteria 3224
454 Ga0466968_0056699 3300044735 Bacteria 1683
455 Ga0466968_0101214 3300044735 Bacteria 1286
456 Ga0466970_0000096 3300044765 Bacteria 37750
457 Ga0466970_0008859 3300044765 Bacteria 5072
458 Ga0466970_0011864 3300044765 Bacteria 4444
459 Ga0466970_0014509 3300044765 Bacteria 4046
460 Ga0466970_0070401 3300044765 Bacteria 1880
461 Ga0466970_0097927 3300044765 Bacteria 1596
462 Ga0466957_0013971 3300044842 Bacteria 4669
463 Ga0466957_0144631 3300044842 Bacteria 1534
464 Ga0466957_0604073 3300044842 Bacteria 768
465 Ga0466960_0003842 3300044901 Bacteria 5823
466 Ga0466960_0015060 3300044901 Bacteria 3328
467 Ga0466960_0115006 3300044901 Bacteria 1402
468 Ga0466960_0161546 3300044901 Bacteria 1203
469 Ga0466959_0028311 3300045049 Bacteria 4155
470 Ga0451576_0000188 3300045051 Bacteria 155095
471 Ga0466958_0088508 3300045836 Bacteria 1913
472 Ga0466967_0024099 3300045976 Bacteria 4998
473 Ga0466967_0282974 3300045976 Bacteria 1591
474 Ga0495617_008068 3300046452 Bacteria 3638
475 Ga0495592_0011443 3300046454 Bacteria 6713
476 Ga0495592_0152527 3300046454 Bacteria 1597
477 Ga0495603_0279305 3300046455 Bacteria 960
478 Ga0495591_041037 3300046458 Bacteria 1316
479 Ga0495629_0174925 3300046459 Bacteria 1489
480 Ga0495629_0251877 3300046459 Bacteria 1215
481 Ga0495641_0017919 3300046461 Bacteria 3670
482 Ga0495641_0019160 3300046461 Bacteria 3510
483 Ga0495651_0002619 3300046462 Bacteria 13925
484 Ga0495651_0009846 3300046462 Bacteria 7349
485 Ga0495651_0047874 3300046462 Bacteria 3303
486 Ga0495651_0110998 3300046462 Bacteria 2027
487 Ga0495651_0151410 3300046462 Bacteria 1671
488 Ga0495653_0001000 3300046463 Bacteria 21793
489 Ga0495653_0001148 3300046463 Bacteria 20379
490 Ga0495653_0018240 3300046463 Bacteria 5702
491 Ga0495653_0022798 3300046463 Bacteria 5064
492 Ga0495653_0071166 3300046463 Bacteria 2601
493 Ga0495653_0077631 3300046463 Bacteria 2465
494 Ga0495653_0078142 3300046463 Bacteria 2455
495 Ga0495653_0118280 3300046463 Bacteria 1893
496 Ga0495653_0160610 3300046463 Bacteria 1560
497 Ga0495650_0000591 3300046471 Bacteria 50174
498 Ga0495650_0152817 3300046471 Bacteria 828
499 Ga0495580_0023045 3300046472 Bacteria 4577
500 Ga0495605_0019533 3300046474 Bacteria 3617
501 Ga0495662_0001362 3300046476 Bacteria 12078
502 Ga0495662_0012812 3300046476 Bacteria 4087
503 Ga0495662_0030409 3300046476 Bacteria 2607
504 Ga0495664_0001467 3300046477 Bacteria 12499
505 Ga0495664_0004919 3300046477 Bacteria 7310
506 Ga0495664_0017558 3300046477 Bacteria 4092
507 Ga0495585_0031085 3300046492 Bacteria 3034
508 Ga0495607_0082143 3300046501 Bacteria 1769
509 Ga0495607_0158492 3300046501 Bacteria 1152
510 Ga0495583_0034906 3300046506 Bacteria 2405
511 Ga0495608_0003361 3300046511 Bacteria 11438
512 Ga0495608_0022571 3300046511 Bacteria 4315
513 Ga0495608_0032396 3300046511 Bacteria 3533
514 Ga0495608_0056119 3300046511 Bacteria 2602
515 Ga0495608_0116091 3300046511 Bacteria 1718
516 Ga0495608_0193636 3300046511 Bacteria 1283
517 Ga0495608_0253609 3300046511 Bacteria 1096
518 Ga0495608_0328156 3300046511 Bacteria 944
519 Ga0495618_0083963 3300046514 Bacteria 2035
520 Ga0495618_0092254 3300046514 Bacteria 1936
521 Ga0495618_0113924 3300046514 Bacteria 1731
522 Ga0495618_0153803 3300046514 Bacteria 1469
523 Ga0495628_0057651 3300046516 Bacteria 3055
524 Ga0495628_0082004 3300046516 Bacteria 2505
525 Ga0495628_0113053 3300046516 Bacteria 2087
526 Ga0495628_0113987 3300046516 Bacteria 2077
527 Ga0495630_0011793 3300046517 Bacteria 6335
528 Ga0495630_0052690 3300046517 Bacteria 3047
529 Ga0495630_0185011 3300046517 Bacteria 1589
530 Ga0495630_0253858 3300046517 Bacteria 1343
531 Ga0495630_0318102 3300046517 Bacteria 1190
532 Ga0495630_0318685 3300046517 Bacteria 1188
533 Ga0495631_0195944 3300046518 Bacteria 864
534 Ga0495643_0003638 3300046522 Bacteria 11196
535 Ga0495648_0056461 3300046524 Bacteria 2362
536 Ga0495666_0002838 3300046526 Bacteria 8670
537 Ga0495652_0003969 3300046529 Bacteria 14333
538 Ga0495652_0039712 3300046529 Bacteria 4069
539 Ga0495665_0024932 3300046531 Bacteria 3213
540 Ga0495665_0035159 3300046531 Bacteria 2677
541 Ga0495665_0053310 3300046531 Bacteria 2139
542 Ga0495640_0051892 3300046533 Bacteria 2817
543 Ga0495640_0054437 3300046533 Bacteria 2740
544 Ga0495640_0094336 3300046533 Bacteria 1971
545 Ga0495640_0138290 3300046533 Bacteria 1571
546 Ga0495640_0175865 3300046533 Bacteria 1366
547 Ga0495640_0215301 3300046533 Bacteria 1213
548 Ga0495586_0023658 3300046535 Bacteria 3281
549 Ga0495587_0001643 3300046536 Bacteria 14911
550 Ga0495587_0024641 3300046536 Bacteria 3684
551 Ga0495587_0034941 3300046536 Bacteria 3029
552 Ga0495587_0073208 3300046536 Bacteria 1991
553 Ga0495587_0191634 3300046536 Bacteria 1157
554 Ga0495597_0036105 3300046542 Bacteria 2227
555 Ga0495645_0000314 3300046543 Bacteria 34802
556 Ga0495645_0008208 3300046543 Bacteria 7282
557 Ga0495645_0120763 3300046543 Bacteria 1845
558 Ga0495645_0453638 3300046543 Bacteria 808
559 Ga0495633_0278735 3300046558 Bacteria 761
560 Ga0495667_0000209 3300046559 Bacteria 39226
561 Ga0495667_0000419 3300046559 Bacteria 27279
562 Ga0495667_0026141 3300046559 Bacteria 3932
563 Ga0495667_0049358 3300046559 Bacteria 2778
564 Ga0495667_0062008 3300046559 Bacteria 2450
565 Ga0495667_0066861 3300046559 Bacteria 2349
566 Ga0495667_0075069 3300046559 Bacteria 2201
567 Ga0495667_0080360 3300046559 Bacteria 2119
568 Ga0495668_0009864 3300046616 Bacteria 5825
569 Ga0495634_0179020 3300046642 Bacteria 1328
570 Ga0495625_0146718 3300046660 Bacteria 1588
571 Ga0495625_0234695 3300046660 Bacteria 1196
572 Ga0495635_0003863 3300046663 Bacteria 10411
573 Ga0495635_0006159 3300046663 Bacteria 8362
574 Ga0495635_0009878 3300046663 Bacteria 6670
575 Ga0495635_0060624 3300046663 Bacteria 2599
576 Ga0495635_0084732 3300046663 Bacteria 2168
577 Ga0495635_0241939 3300046663 Bacteria 1217
578 Ga0495635_0413101 3300046663 Bacteria 895
579 Ga0495661_0081491 3300046665 Bacteria 1865
580 Ga0495657_0001846 3300046675 Bacteria 18067
581 Ga0495657_0005301 3300046675 Bacteria 10199
582 Ga0495657_0005508 3300046675 Bacteria 10006
583 Ga0495657_0037941 3300046675 Bacteria 3317
584 Ga0495657_0071075 3300046675 Bacteria 2273
585 Ga0495657_0290023 3300046675 Bacteria 977
586 Ga0495599_0001193 3300046678 Bacteria 14754
587 Ga0495599_0003120 3300046678 Bacteria 9656
588 Ga0495599_0138386 3300046678 Bacteria 1511
589 Ga0495623_0040914 3300046679 Bacteria 2958
590 Ga0495623_0176784 3300046679 Bacteria 1243
591 Ga0495646_0115885 3300046680 Bacteria 1521
592 Ga0495658_0120290 3300046683 Bacteria 1588
593 Ga0495613_0003928 3300046689 Bacteria 11132
594 Ga0495613_0061004 3300046689 Bacteria 2762
595 Ga0495613_0159448 3300046689 Bacteria 1605
596 Ga0495613_0226026 3300046689 Bacteria 1312
597 Ga0495624_0004760 3300046690 Bacteria 9875
598 Ga0495649_0159021 3300046694 Bacteria 1185
599 Ga0495589_0013643 3300046794 Bacteria 4189
600 Ga0495600_0004319 3300046809 Bacteria 8498
601 Ga0495600_0014992 3300046809 Bacteria 4894
602 Ga0495600_0019627 3300046809 Bacteria 4319
603 Ga0495600_0020658 3300046809 Bacteria 4211
604 Ga0495600_0047982 3300046809 Bacteria 2786
605 Ga0495600_0111266 3300046809 Bacteria 1783
606 Ga0495660_0030479 3300046810 Bacteria 3038
607 Ga0495660_0067730 3300046810 Bacteria 1901
608 Ga0495581_0003074 3300047315 Bacteria 9544
609 Ga0495581_0025613 3300047315 Bacteria 3420
610 Ga0495581_0038407 3300047315 Bacteria 2771
611 Ga0495581_0055046 3300047315 Bacteria 2296
612 Ga0495604_0005472 3300047317 Bacteria 10074
613 Ga0495604_0100801 3300047317 Bacteria 2122
614 Ga0495604_0118431 3300047317 Bacteria 1920
615 Ga0495604_0196340 3300047317 Bacteria 1403
616 Ga0495674_0004890 3300047319 Bacteria 12878
617 Ga0495674_0022999 3300047319 Bacteria 5742
618 Ga0495674_0024860 3300047319 Bacteria 5499
619 Ga0495674_0045064 3300047319 Bacteria 3918
620 Ga0495674_0080640 3300047319 Bacteria 2792
621 Ga0495674_0113360 3300047319 Bacteria 2296
622 Ga0495674_0269931 3300047319 Bacteria 1396
623 Ga0495674_0324441 3300047319 Bacteria 1254
624 Ga0495674_0539667 3300047319 Bacteria 929
625 Ga0495672_0008252 3300047320 Bacteria 7714
626 Ga0495676_0002009 3300047321 Bacteria 17914
627 Ga0495680_0000782 3300047322 Bacteria 35634
628 Ga0495680_0003102 3300047322 Bacteria 16553
629 Ga0495680_0024753 3300047322 Bacteria 4974
630 Ga0495680_0039758 3300047322 Bacteria 3750
631 Ga0495680_0063314 3300047322 Bacteria 2840
632 Ga0495680_0099106 3300047322 Bacteria 2173
633 Ga0495680_0408078 3300047322 Bacteria 937
634 Ga0495683_0015124 3300047323 Bacteria 4019
635 Ga0495687_145820 3300047443 Bacteria 816
636 Ga0495675_0040133 3300047444 Bacteria 2981
637 Ga0495675_0188424 3300047444 Bacteria 1260
638 Ga0495685_002535 3300047447 Bacteria 5739
639 Ga0495684_0015428 3300047471 Bacteria 5880
640 Ga0495684_0018012 3300047471 Bacteria 5442
641 Ga0495684_0018851 3300047471 Bacteria 5315
642 Ga0495684_0072454 3300047471 Bacteria 2617
643 Ga0495684_0138444 3300047471 Bacteria 1826
644 Ga0495684_0189276 3300047471 Bacteria 1522
645 Ga0495593_0004861 3300047673 Bacteria 7977
646 Ga0495593_0042986 3300047673 Bacteria 2424
647 Ga0495593_0196450 3300047673 Bacteria 1014
648 Ga0495602_0003177 3300048088 Bacteria 16945
649 Ga0495602_0013811 3300048088 Bacteria 8233
650 Ga0495602_0331312 3300048088 Bacteria 1104
651 Ga0496100_0010412 3300048903 Bacteria 5262
652 Ga0496100_0078590 3300048903 Bacteria 2221
653 Ga0496100_0129972 3300048903 Bacteria 1773
654 Ga0496100_0333718 3300048903 Bacteria 1142
655 Ga0496101_0008779 3300048904 Bacteria 6614
656 Ga0496101_0041856 3300048904 Bacteria 3268
657 Ga0496101_0087556 3300048904 Bacteria 2312
658 Ga0496101_0242304 3300048904 Bacteria 1403
659 Ga0496102_0001614 3300048905 Bacteria 19876
660 Ga0496102_0008838 3300048905 Bacteria 8642
661 Ga0496102_0056757 3300048905 Bacteria 3573
662 Ga0496102_0229644 3300048905 Bacteria 1750
663 Ga0496102_0323270 3300048905 Bacteria 1453
664 Ga0496102_0366851 3300048905 Bacteria 1355
665 Ga0496102_0402479 3300048905 Bacteria 1287
666 Ga0496103_0007504 3300048906 Bacteria 6498
667 Ga0496103_0014831 3300048906 Bacteria 4633
668 Ga0496103_0128878 3300048906 Bacteria 1615
669 Ga0496104_0010849 3300048907 Bacteria 8147
670 Ga0496104_0068414 3300048907 Bacteria 3375
671 Ga0496104_0095059 3300048907 Bacteria 2851
672 Ga0496104_0542616 3300048907 Bacteria 1074
673 Ga0496104_0649258 3300048907 Bacteria 964
674 Ga0496105_0011381 3300048908 Bacteria 7027
675 Ga0496105_0037487 3300048908 Bacteria 3992
676 Ga0496105_0058765 3300048908 Bacteria 3174
677 Ga0496105_0079966 3300048908 Bacteria 2699
678 Ga0496106_0006289 3300048909 Bacteria 8792
679 Ga0496106_0013055 3300048909 Bacteria 6130
680 Ga0496106_0274644 3300048909 Bacteria 1350
681 Ga0496107_0018120 3300048910 Bacteria 4954
682 Ga0496107_0116186 3300048910 Bacteria 1969
683 Ga0496107_0122546 3300048910 Bacteria 1916
684 Ga0496107_0151231 3300048910 Bacteria 1717
685 Ga0496107_0389988 3300048910 Bacteria 1036
686 Ga0496108_0002013 3300048911 Bacteria 16278
687 Ga0496108_0009832 3300048911 Bacteria 7751
688 Ga0496108_0271617 3300048911 Bacteria 1476
689 Ga0496108_0310503 3300048911 Bacteria 1374
690 Ga0496108_0356140 3300048911 Bacteria 1277
691 Ga0496109_0001256 3300048912 Bacteria 21057
692 Ga0496109_0007380 3300048912 Bacteria 9304
693 Ga0496109_0015218 3300048912 Bacteria 6697
694 Ga0496109_0015301 3300048912 Bacteria 6682
695 Ga0496109_0075678 3300048912 Bacteria 3095
696 Ga0496109_0165103 3300048912 Bacteria 2075
697 Ga0496109_0318972 3300048912 Bacteria 1466
698 Ga0496109_0983479 3300048912 Bacteria 781
699 Ga0496110_0002211 3300048913 Bacteria 14540
700 Ga0496110_0092001 3300048913 Bacteria 2714
701 Ga0496110_0159773 3300048913 Bacteria 2042
702 Ga0496110_0407213 3300048913 Bacteria 1240
703 Ga0496111_0112449 3300048914 Bacteria 2006
704 Ga0496111_0137197 3300048914 Bacteria 1812
705 Ga0496111_0385211 3300048914 Bacteria 1037
706 Ga0496112_0027451 3300048915 Bacteria 5488
707 Ga0496112_0083481 3300048915 Bacteria 3160
708 Ga0496112_0571818 3300048915 Bacteria 1063
709 Ga0496112_0588106 3300048915 Bacteria 1045
710 Ga0496113_0205045 3300048916 Bacteria 1568
711 Ga0496113_0242420 3300048916 Bacteria 1438
712 Ga0496113_0255798 3300048916 Bacteria 1399
713 Ga0496113_0290436 3300048916 Bacteria 1308
714 Ga0496113_0339790 3300048916 Bacteria 1204
715 Ga0496114_0020109 3300048917 Bacteria 5416
716 Ga0496114_0035459 3300048917 Bacteria 4119
717 Ga0496114_0057430 3300048917 Bacteria 3249
718 Ga0496114_0088886 3300048917 Bacteria 2621
719 Ga0496114_0095005 3300048917 Bacteria 2536
720 Ga0496114_0163424 3300048917 Bacteria 1937
721 Ga0496115_0014868 3300048918 Bacteria 5902
722 Ga0496115_0021354 3300048918 Bacteria 5001
723 Ga0496115_0036198 3300048918 Bacteria 3907
724 Ga0496115_0090496 3300048918 Bacteria 2499
725 Ga0496115_0095578 3300048918 Bacteria 2432
726 Ga0496115_0115861 3300048918 Bacteria 2203
727 Ga0496117_0055240 3300048920 Bacteria 2776
728 Ga0496118_0007218 3300048921 Bacteria 11866
729 Ga0496118_0199450 3300048921 Bacteria 1187
730 Ga0496119_0003001 3300048922 Bacteria 17894
731 Ga0496119_0055837 3300048922 Bacteria 2396
732 Ga0496119_0142836 3300048922 Bacteria 1291
733 Ga0496120_0019728 3300048923 Bacteria 4305
734 Ga0496121_0003923 3300048924 Bacteria 20623
735 Ga0496121_0037879 3300048924 Bacteria 4278
736 Ga0496121_0071186 3300048924 Bacteria 2798
737 Ga0496121_0354367 3300048924 Bacteria 976
738 Ga0496122_0009222 3300048925 Bacteria 10443
739 Ga0496123_0010117 3300048926 Bacteria 8386
740 Ga0496126_0013859 3300048929 Bacteria 8178
741 Ga0496126_0049478 3300048929 Bacteria 3837
742 Ga0496126_0162176 3300048929 Bacteria 1909
743 Ga0495678_074963 3300049459 Bacteria 1230
744 Ga0501318_022048 3300049534 Bacteria 814
745 Ga0501031_0029186 3300049568 Bacteria 3598
746 Ga0501031_0118600 3300049568 Bacteria 1729
747 Ga0501034_0111028 3300049571 Bacteria 2732
748 Ga0501034_0832773 3300049571 Bacteria 814
749 Ga0501036_0147254 3300049572 Bacteria 1986
750 Ga0501037_0030311 3300049573 Bacteria 3998
751 Ga0501037_0134802 3300049573 Bacteria 1769
752 Ga0501038_0001094 3300049574 Bacteria 24528
753 Ga0501038_0034588 3300049574 Bacteria 4442
754 Ga0501038_0136226 3300049574 Bacteria 2012
755 Ga0501038_0403667 3300049574 Bacteria 1057
756 Ga0501039_0125264 3300049575 Bacteria 2015
757 Ga0501039_0162544 3300049575 Bacteria 1755
758 Ga0501040_0050261 3300049576 Bacteria 2851
759 Ga0501041_0259085 3300049577 Bacteria 1093
760 Ga0501042_0086941 3300049578 Bacteria 2242
761 Ga0501042_0193766 3300049578 Bacteria 1466
762 Ga0501043_0236438 3300049579 Bacteria 1410
763 Ga0501047_0010095 3300049581 Bacteria 8924
764 Ga0501047_0051014 3300049581 Bacteria 3996
765 Ga0501047_0069679 3300049581 Bacteria 3387
766 Ga0501048_0010696 3300049582 Bacteria 6843
767 Ga0501067_0027648 3300049583 Bacteria 3143
768 Ga0501067_0153613 3300049583 Bacteria 1282
769 Ga0501068_0006180 3300049584 Bacteria 6589
770 Ga0501069_0042308 3300049585 Bacteria 2520
771 Ga0501069_0057166 3300049585 Bacteria 2174
772 Ga0501070_0001101 3300049586 Bacteria 24235
773 Ga0501070_0010680 3300049586 Bacteria 7763
774 Ga0501070_0102039 3300049586 Bacteria 2372
775 Ga0501070_0315246 3300049586 Bacteria 1273
776 Ga0501071_0014456 3300049587 Bacteria 5399
777 Ga0501072_0003234 3300049588 Bacteria 12227
778 Ga0501072_0059654 3300049588 Bacteria 3008
779 Ga0501072_0392186 3300049588 Bacteria 1101
780 Ga0501073_0000366 3300049589 Bacteria 30456
781 Ga0501073_0023110 3300049589 Bacteria 4469
782 Ga0501073_0270357 3300049589 Bacteria 1173
783 Ga0501074_0023586 3300049590 Bacteria 4472
784 Ga0501074_0128478 3300049590 Bacteria 1813
785 Ga0501074_0152717 3300049590 Bacteria 1650
786 Ga0501076_0088515 3300049592 Bacteria 2488
787 Ga0501077_0042044 3300049593 Bacteria 2908
788 Ga0501077_0138510 3300049593 Bacteria 1543
789 Ga0501079_0014405 3300049741 Bacteria 6029
790 Ga0501079_0021966 3300049741 Bacteria 4888
791 Ga0501079_0486936 3300049741 Bacteria 969
792 Ga0501080_0068751 3300049742 Bacteria 3295
793 Ga0501080_0129752 3300049742 Bacteria 2333
794 Ga0501080_0476731 3300049742 Bacteria 1117
795 Ga0501080_0739949 3300049742 Bacteria 865
796 Ga0501083_0000047 3300049744 Bacteria 88014
797 Ga0501035_0012980 3300049822 Bacteria 7687
798 Ga0501044_0003649 3300049823 Bacteria 17329
799 Ga0501044_0318532 3300049823 Bacteria 1480
800 Ga0501045_0014518 3300049824 Bacteria 5583
801 nmdc:mga03n38_45561_c1 3300050490 Bacteria 1932
802 nmdc:mga00v17_121235_c1 3300050491 Bacteria 1665
803 nmdc:mga00v17_234983_c1 3300050491 Bacteria 1188
804 nmdc:mga00v17_442_c1 3300050491 Bacteria 23249
805 nmdc:mga0yw44_1010_c1 3300050492 Bacteria 10760
806 nmdc:mga0yw44_1818_c1 3300050492 Bacteria 8736
807 nmdc:mga0yw44_776_c1 3300050492 Bacteria 11836
808 nmdc:mga07m45_532728_c1 3300050496 Bacteria 679
809 nmdc:mga05p37_13198_c1 3300050507 Bacteria 9889
810 nmdc:mga05p37_156681_c1 3300050507 Bacteria 2783
811 nmdc:mga05p37_206463_c1 3300050507 Bacteria 2376
812 nmdc:mga05p37_42240_c1 3300050507 Bacteria 5602
813 nmdc:mga05p37_73400_c1 3300050507 Bacteria 4211
814 nmdc:mga05p37_94528_c1 3300050507 Bacteria 3683
815 nmdc:mga09592_13361_c1 3300050508 Bacteria 6705
816 nmdc:mga09592_142748_c1 3300050508 Bacteria 2064
817 nmdc:mga09592_200618_c1 3300050508 Bacteria 1727
818 nmdc:mga09592_420440_c1 3300050508 Bacteria 1154
819 nmdc:mga09592_94655_c1 3300050508 Bacteria 2555
820 nmdc:mga0qj67_125092_c1 3300050509 Bacteria 2081
821 nmdc:mga0qj67_15780_c1 3300050509 Bacteria 5721
822 nmdc:mga0qj67_42057_c1 3300050509 Bacteria 3597
823 nmdc:mga0qj67_48_c1 3300050509 Bacteria 85487
824 nmdc:mga0qj67_5437_c1 3300050509 Bacteria 9304
825 nmdc:mga06r32_28049_c1 3300050510 Bacteria 5266
826 nmdc:mga06r32_80315_c1 3300050510 Bacteria 3174
827 nmdc:mga06r32_97248_c1 3300050510 Bacteria 2885
828 nmdc:mga08y16_83954_c1 3300050511 Bacteria 3320
829 nmdc:mga0n895_19256_c1 3300050512 Bacteria 6340
830 nmdc:mga0n895_222547_c1 3300050512 Bacteria 1916
831 nmdc:mga0rr50_53114_c1 3300050513 Bacteria 3014
832 nmdc:mga08x19_267599_c1 3300050514 Bacteria 1182
833 nmdc:mga0a205_7200_c1 3300050515 Bacteria 10059
834 nmdc:mga0sz30_100178_c1 3300050516 Bacteria 1265
835 nmdc:mga0sz30_11757_c1 3300050516 Bacteria 1756
836 Ga0495601_0069562 3300053077 Bacteria 2245
837 Ga0495601_0235849 3300053077 Bacteria 1194
838 Ga0495612_0000458 3300053078 Bacteria 16364
839 Ga0500635_0000016 3300053080 Bacteria 124879
840 Ga0495655_0013272 3300053083 Bacteria 1701
841 Ga0495595_0132960 3300053084 Bacteria 1217
842 Ga0495619_0033270 3300053085 Bacteria 3348
843 Ga0495619_0101961 3300053085 Bacteria 1954
844 Ga0495619_0195095 3300053085 Bacteria 1402
845 Ga0500644_0002440 3300053088 Bacteria 4648
846 Ga0500651_0056049 3300053093 Bacteria 2468
847 Ga0500566_0000140 3300053094 Bacteria 37236
848 Ga0500650_0025374 3300053098 Bacteria 2650
849 Ga0500660_056583 3300053100 Bacteria 1911
850 Ga0500556_0000204 3300053104 Bacteria 48558
851 Ga0500556_0000768 3300053104 Bacteria 19015
852 Ga0500562_000448 3300053108 Bacteria 10042
853 Ga0500593_004594 3300053117 Bacteria 5369
854 Ga0500652_041423 3300053131 Bacteria 1854
855 Ga0500559_0000317 3300053136 Bacteria 36554
856 Ga0500568_0000327 3300053139 Bacteria 37336
857 Ga0500568_0025483 3300053139 Bacteria 2495
858 Ga0500577_0027678 3300053142 Bacteria 1944
859 Ga0500616_0000071 3300053153 Bacteria 232527
860 Ga0500633_0037035 3300053160 Bacteria 1617
861 Ga0501084_0004047 3300054114 Bacteria 11943
862 Ga0501084_0115406 3300054114 Bacteria 2257
863 Ga0501082_0073572 3300060353 Bacteria 2943
864 Ga0501082_0402229 3300060353 Bacteria 1195
865 Ga0530510_0103150 3300061734 Bacteria 2086

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0152817 Ga0495650_0152817_12_626 179
2 3300044706 Ga0466964_0368414 Ga0466964_0368414_67_720 182
3 3300005471 Ga0070698_100037624 Ga0070698_1000376245 188
4 3300050496 nmdc:mga07m45_532728_c1 nmdc:mga07m45_532728_c1_13_666 192
5 3300046517 Ga0495630_0318102 Ga0495630_0318102_518_1180 195
6 3300049741 Ga0501079_0486936 Ga0501079_0486936_278_943 195
7 3300037418 Ga0395900_0985284 Ga0395900_0985284_88_753 196
8 3300037466 Ga0395898_1081321 Ga0395898_1081321_11_676 196
9 3300046558 Ga0495633_0278735 Ga0495633_0278735_24_695 196
10 3300049742 Ga0501080_0068751 Ga0501080_0068751_552_1217 196
11 3300053077 Ga0495601_0069562 Ga0495601_0069562_51_812 201
12 3300047317 Ga0495604_0196340 Ga0495604_0196340_667_1350 202
13 3300005539 Ga0068853_100248732 Ga0068853_1002487322 203
14 3300005548 Ga0070665_100000001 Ga0070665_100000001301 205
15 3300028379 Ga0268266_10000102 Ga0268266_1000010265 205
16 3300044842 Ga0466957_0604073 Ga0466957_0604073_55_747 205
17 3300046533 Ga0495640_0054437 Ga0495640_0054437_34_726 205
18 3300046675 Ga0495657_0037941 Ga0495657_0037941_45_737 205
19 3300047319 Ga0495674_0539667 Ga0495674_0539667_56_748 205
20 3300047443 Ga0495687_145820 Ga0495687_145820_68_760 205
21 3300049581 Ga0501047_0051014 Ga0501047_0051014_1768_2460 205
22 3300009011 Ga0105251_10132951 Ga0105251_101329511 206
23 3300048922 Ga0496119_0003001 Ga0496119_0003001_10873_11646 206
24 3300048923 Ga0496120_0019728 Ga0496120_0019728_2182_2955 206
25 3300048920 Ga0496117_0055240 Ga0496117_0055240_847_1617 207
26 3300009545 Ga0105237_10637934 Ga0105237_106379342 208
27 3300013306 Ga0163162_10830894 Ga0163162_108308941 208
28 3300013308 Ga0157375_10042755 Ga0157375_100427551 208
29 3300017792 Ga0163161_10122253 Ga0163161_101222533 208
30 3300031731 Ga0307405_10036526 Ga0307405_100365263 208
31 3300047320 Ga0495672_0008252 Ga0495672_0008252_2094_2855 208
32 3300048904 Ga0496101_0242304 Ga0496101_0242304_445_1206 208
33 3300048909 Ga0496106_0006289 Ga0496106_0006289_6766_7527 208
34 3300048909 Ga0496106_0274644 Ga0496106_0274644_295_1056 208
35 3300048910 Ga0496107_0018120 Ga0496107_0018120_2424_3185 208
36 3300048911 Ga0496108_0310503 Ga0496108_0310503_596_1357 208
37 3300048912 Ga0496109_0983479 Ga0496109_0983479_16_717 208
38 3300048915 Ga0496112_0588106 Ga0496112_0588106_218_979 208
39 3300048916 Ga0496113_0255798 Ga0496113_0255798_209_970 208
40 3300048918 Ga0496115_0036198 Ga0496115_0036198_2964_3725 208
41 3300049534 Ga0501318_022048 Ga0501318_022048_90_791 208
42 3300049590 Ga0501074_0023586 Ga0501074_0023586_3725_4426 208
43 3300050490 nmdc:mga03n38_45561_c1 nmdc:mga03n38_45561_c1_1204_1905 208
44 3300048905 Ga0496102_0366851 Ga0496102_0366851_583_1308 209
45 3300009545 Ga0105237_10431060 Ga0105237_104310602 210
46 3300032126 Ga0307415_100058923 Ga0307415_1000589234 210
47 3300048912 Ga0496109_0001256 Ga0496109_0001256_9223_9984 210
48 3300048924 Ga0496121_0037879 Ga0496121_0037879_2540_3313 210
49 3300009551 Ga0105238_10113875 Ga0105238_101138752 211
50 3300031616 Ga0307508_10181359 Ga0307508_101813593 211
51 3300033179 Ga0307507_10265178 Ga0307507_102651781 211
52 3300044658 Ga0466972_0022532 Ga0466972_0022532_2222_2980 211
53 3300044765 Ga0466970_0097927 Ga0466970_0097927_63_821 211
54 3300049741 Ga0501079_0021966 Ga0501079_0021966_1986_2699 211
55 3300001989 JGI24739J22299_10085499 JGI24739J22299_100854992 212
56 3300002067 JGI24735J21928_10032757 JGI24735J21928_100327572 212
57 3300003320 rootH2_10175217 rootH2_101752174 212
58 3300003322 rootL2_10077234 rootL2_100772346 212
59 3300003322 rootL2_10271871 rootL2_102718712 212
60 3300003323 rootH1_10192662 rootH1_101926622 212
61 3300003578 Ga0006562J51391_1095727 Ga0006562J51391_10957274 212
62 3300003578 Ga0006562J51391_1095728 Ga0006562J51391_10957282 212
63 3300005435 Ga0070714_100290659 Ga0070714_1002906592 212
64 3300009545 Ga0105237_10367179 Ga0105237_103671792 212
65 3300009553 Ga0105249_10873759 Ga0105249_108737592 212
66 3300025904 Ga0207647_10072786 Ga0207647_100727863 212
67 3300025929 Ga0207664_10382299 Ga0207664_103822992 212
68 3300037418 Ga0395900_0003464 Ga0395900_0003464_10688_11464 212
69 3300037466 Ga0395898_0000015 Ga0395898_0000015_315262_316038 212
70 3300046463 Ga0495653_0018240 Ga0495653_0018240_4584_5345 212
71 3300046689 Ga0495613_0159448 Ga0495613_0159448_488_1249 212
72 3300060353 Ga0501082_0402229 Ga0501082_0402229_54_815 212
73 3300003203 JGI25406J46586_10008542 JGI25406J46586_100085423 213
74 3300005985 Ga0081539_10054051 Ga0081539_100540512 213
75 3300041512 Ga0451853_0632895 Ga0451853_0632895_373_1134 213
76 3300044658 Ga0466972_0092777 Ga0466972_0092777_362_1144 213
77 3300044901 Ga0466960_0003842 Ga0466960_0003842_2442_3224 213
78 3300045976 Ga0466967_0282974 Ga0466967_0282974_327_1088 213
79 3300049578 Ga0501042_0193766 Ga0501042_0193766_174_935 213
80 3300003578 Ga0006562J51391_1096029 Ga0006562J51391_10960293 214
81 3300003578 Ga0006562J51391_1096030 Ga0006562J51391_10960303 214
82 3300002739 JGI25158J39367_1012116 JGI25158J39367_10121161 215
83 3300009093 Ga0105240_10484420 Ga0105240_104844201 215
84 3300009147 Ga0114129_10088561 Ga0114129_100885615 215
85 3300013105 Ga0157369_10593704 Ga0157369_105937042 215
86 3300014497 Ga0182008_10000001 Ga0182008_1000000156 215
87 3300025208 Ga0209436_100233 Ga0209436_10023314 215
88 3300025284 Ga0209130_1002047 Ga0209130_10020473 215
89 3300025302 Ga0207426_1000539 Ga0207426_100053910 215
90 3300025900 Ga0207710_10158591 Ga0207710_101585912 215
91 3300032126 Ga0307415_100230987 Ga0307415_1002309872 215
92 3300039437 Ga0436365_1565935 Ga0436365_1565935_461_1219 215
93 3300042876 Ga0451577_0100538 Ga0451577_0100538_1406_2176 215
94 3300044673 Ga0453683_0046533 Ga0453683_0046533_1418_2188 215
95 3300045051 Ga0451576_0000188 Ga0451576_0000188_59546_60316 215
96 3300050507 nmdc:mga05p37_73400_c1 nmdc:mga05p37_73400_c1_2706_3476 215
97 3300005985 Ga0081539_10004561 Ga0081539_1000456110 216
98 3300049581 Ga0501047_0069679 Ga0501047_0069679_2476_3237 216
99 3300003760 Ga0055527_1000001 Ga0055527_1000001748 217
100 3300003763 Ga0055529_1000019 Ga0055529_1000019254 217
101 3300005535 Ga0070684_100361616 Ga0070684_1003616162 217
102 3300005937 Ga0081455_10025093 Ga0081455_100250933 217
103 3300006844 Ga0075428_100220034 Ga0075428_1002200342 217
104 3300006847 Ga0075431_100021347 Ga0075431_1000213472 217
105 3300025228 Ga0209672_100006 Ga0209672_100006227 217
106 3300025229 Ga0209147_100677 Ga0209147_10067720 217
107 3300025254 Ga0209148_1000015 Ga0209148_100001571 217
108 3300025272 Ga0209455_1000013 Ga0209455_100001371 217
109 3300049586 Ga0501070_0001101 Ga0501070_0001101_4600_5376 217
110 3300050509 nmdc:mga0qj67_125092_c1 nmdc:mga0qj67_125092_c1_675_1436 217
111 3300005616 Ga0068852_100636402 Ga0068852_1006364022 218
112 3300025904 Ga0207647_10163243 Ga0207647_101632432 218
113 3300025910 Ga0207684_10319441 Ga0207684_103194411 218
114 3300048904 Ga0496101_0041856 Ga0496101_0041856_2105_2881 218
115 3300048905 Ga0496102_0323270 Ga0496102_0323270_277_1053 218
116 3300048906 Ga0496103_0014831 Ga0496103_0014831_3624_4400 218
117 3300048907 Ga0496104_0095059 Ga0496104_0095059_2041_2817 218
118 3300048908 Ga0496105_0058765 Ga0496105_0058765_2344_3120 218
119 3300048918 Ga0496115_0090496 Ga0496115_0090496_523_1299 218
120 3300048921 Ga0496118_0199450 Ga0496118_0199450_273_1049 218
121 3300048922 Ga0496119_0055837 Ga0496119_0055837_1383_2159 218
122 3300048924 Ga0496121_0354367 Ga0496121_0354367_33_809 218
123 3300048929 Ga0496126_0162176 Ga0496126_0162176_928_1704 218
124 3300053083 Ga0495655_0013272 Ga0495655_0013272_871_1632 218
125 3300006846 Ga0075430_100067055 Ga0075430_1000670553 219
126 3300006847 Ga0075431_100070873 Ga0075431_1000708734 219
127 3300006871 Ga0075434_100013750 Ga0075434_1000137506 219
128 3300006880 Ga0075429_100105764 Ga0075429_1001057643 219
129 3300027907 Ga0207428_10007572 Ga0207428_100075723 219
130 3300050507 nmdc:mga05p37_42240_c1 nmdc:mga05p37_42240_c1_2503_3270 219
131 3300050508 nmdc:mga09592_94655_c1 nmdc:mga09592_94655_c1_981_1748 219
132 3300050509 nmdc:mga0qj67_15780_c1 nmdc:mga0qj67_15780_c1_3056_3823 219
133 3300050510 nmdc:mga06r32_80315_c1 nmdc:mga06r32_80315_c1_1001_1768 219
134 3300050512 nmdc:mga0n895_222547_c1 nmdc:mga0n895_222547_c1_120_881 219
135 3300053104 Ga0500556_0000204 Ga0500556_0000204_47746_48519 219
136 3300053117 Ga0500593_004594 Ga0500593_004594_63_836 219
137 3300017792 Ga0163161_10252190 Ga0163161_102521903 220
138 3300048917 Ga0496114_0057430 Ga0496114_0057430_1105_1869 220
139 3300009098 Ga0105245_10042613 Ga0105245_100426135 221
140 3300009148 Ga0105243_10886801 Ga0105243_108868011 221
141 3300021388 Ga0213875_10000220 Ga0213875_1000022048 221
142 3300037853 Ga0436364_0501302 Ga0436364_0501302_79841_80608 221
143 3300048905 Ga0496102_0229644 Ga0496102_0229644_69_830 221
144 3300048910 Ga0496107_0116186 Ga0496107_0116186_927_1688 221
145 3300048910 Ga0496107_0151231 Ga0496107_0151231_241_1002 221
146 3300048913 Ga0496110_0159773 Ga0496110_0159773_882_1643 221
147 3300048915 Ga0496112_0027451 Ga0496112_0027451_340_1101 221
148 3300048917 Ga0496114_0020109 Ga0496114_0020109_767_1528 221
149 3300049588 Ga0501072_0003234 Ga0501072_0003234_5644_6315 221
150 3300030521 Ga0307511_10080776 Ga0307511_100807764 222
151 3300049571 Ga0501034_0832773 Ga0501034_0832773_35_799 222
152 3300053085 Ga0495619_0195095 Ga0495619_0195095_363_1124 222
153 3300053142 Ga0500577_0027678 Ga0500577_0027678_82_843 222
154 3300053160 Ga0500633_0037035 Ga0500633_0037035_735_1529 222
155 iso_pu_bacteria 2906799679 2906801114 222
156 3300013307 Ga0157372_10437843 Ga0157372_104378433 223
157 3300013308 Ga0157375_11166980 Ga0157375_111669801 223
158 3300031911 Ga0307412_10673254 Ga0307412_106732542 223
159 3300048903 Ga0496100_0010412 Ga0496100_0010412_4305_5066 223
160 3300048905 Ga0496102_0008838 Ga0496102_0008838_4063_4824 223
161 3300048906 Ga0496103_0128878 Ga0496103_0128878_506_1267 223
162 3300048909 Ga0496106_0013055 Ga0496106_0013055_2274_3035 223
163 3300048917 Ga0496114_0035459 Ga0496114_0035459_2976_3737 223
164 3300048918 Ga0496115_0014868 Ga0496115_0014868_2429_3190 223
165 iso_pu_bacteria 2818991460 2819678606 223
166 iso_pu_bacteria 2837268691 2837273542 223
167 3300006038 Ga0075365_10039746 Ga0075365_100397464 224
168 3300050491 nmdc:mga00v17_121235_c1 nmdc:mga00v17_121235_c1_757_1530 224
169 3300050492 nmdc:mga0yw44_1818_c1 nmdc:mga0yw44_1818_c1_2393_3166 224
170 3300053136 Ga0500559_0000317 Ga0500559_0000317_17167_17940 224
171 iso_pu_bacteria 2616644814 2616702826 224
172 iso_pu_bacteria 2643221617 2644101197 224
173 iso_pu_bacteria 2643221620 2644119397 224
174 iso_pu_bacteria 2773857762 2774397026 224
175 iso_pu_bacteria 2808606439 2809198674 224
176 iso_pu_bacteria 2811994878 2812352753 224
177 iso_pu_bacteria 2852632344 2852635320 224
178 iso_pu_bacteria 2870721527 2870727061 224
179 iso_pu_bacteria 2891968417 2891969706 224
180 iso_pu_bacteria 2929219909 2929224359 224
181 iso_pu_bacteria 2946003308 2946006216 224
182 iso_pu_bacteria 8048406513 8048413723 224
183 iso_pu_bacteria 8056579771 8056581920 224
184 3300005563 Ga0068855_100581140 Ga0068855_1005811402 225
185 3300005577 Ga0068857_100236890 Ga0068857_1002368902 225
186 3300005843 Ga0068860_100021498 Ga0068860_1000214986 225
187 3300013307 Ga0157372_10561414 Ga0157372_105614142 225
188 3300025940 Ga0207691_10144008 Ga0207691_101440082 225
189 3300026116 Ga0207674_10370711 Ga0207674_103707112 225
190 3300028381 Ga0268264_10015344 Ga0268264_100153443 225
191 3300031852 Ga0307410_10231779 Ga0307410_102317792 225
192 3300033179 Ga0307507_10104699 Ga0307507_101046993 225
193 3300037853 Ga0436364_0361998 Ga0436364_0361998_407_1168 225
194 3300038443 Ga0395901_0352598 Ga0395901_0352598_242_1000 225
195 3300042876 Ga0451577_0068052 Ga0451577_0068052_320_1084 225
196 3300044712 Ga0453684_0000007 Ga0453684_0000007_257768_258532 225
197 3300048921 Ga0496118_0007218 Ga0496118_0007218_10302_11081 225
198 3300049459 Ga0495678_074963 Ga0495678_074963_133_900 225
199 iso_pu_bacteria 2501939600 2501943152 225
200 iso_pu_bacteria 2643221619 2644111505 225
201 iso_pu_bacteria 2643221632 2644183771 225
202 iso_pu_bacteria 2721755702 2723643464 225
203 iso_pu_bacteria 2738541305 2738868875 225
204 iso_pu_bacteria 2738543034 2739363590 225
205 iso_pu_bacteria 2739367654 2739605536 225
206 iso_pu_bacteria 2773857763 2774399657 225
207 iso_pu_bacteria 2808606372 2808899981 225
208 iso_pu_bacteria 2808606394 2809028774 225
209 iso_pu_bacteria 2839986021 2839987289 225
210 iso_pu_bacteria 2844841374 2844843111 225
211 iso_pu_bacteria 2852646457 2852648493 225
212 iso_pu_bacteria 2856858025 2856859704 225
213 iso_pu_bacteria 2919055335 2919058623 225
214 iso_pu_bacteria 2919059106 2919060976 225
215 iso_pu_bacteria 2919443155 2919444716 225
216 iso_pu_bacteria 2928153084 2928153273 225
217 iso_pu_bacteria 2935409751 2935411748 225
218 iso_pu_bacteria 2939657138 2939657979 225
219 iso_pu_bacteria 2945941187 2945943428 225
220 iso_pu_bacteria 2953998280 2953998834 225
221 iso_pu_bacteria 649633069 649810194 225
222 iso_pu_bacteria 8045830549 8045831460 225
223 iso_pu_bacteria 8055037949 8055038443 225
224 3300005347 Ga0070668_100302545 Ga0070668_1003025452 226
225 3300005614 Ga0068856_100071837 Ga0068856_1000718373 226
226 3300009148 Ga0105243_10123441 Ga0105243_101234411 226
227 3300009177 Ga0105248_10516539 Ga0105248_105165392 226
228 3300010375 Ga0105239_10042641 Ga0105239_100426412 226
229 3300013296 Ga0157374_10000003 Ga0157374_10000003319 226
230 3300013297 Ga0157378_10207220 Ga0157378_102072202 226
231 3300013306 Ga0163162_10001277 Ga0163162_100012772 226
232 3300013308 Ga0157375_10594215 Ga0157375_105942152 226
233 3300014745 Ga0157377_10206578 Ga0157377_102065782 226
234 3300017792 Ga0163161_10098660 Ga0163161_100986602 226
235 3300025904 Ga0207647_10216658 Ga0207647_102166581 226
236 3300025941 Ga0207711_10253779 Ga0207711_102537791 226
237 3300025972 Ga0207668_10692455 Ga0207668_106924551 226
238 3300026078 Ga0207702_10052785 Ga0207702_100527853 226
239 3300028666 Ga0265336_10002352 Ga0265336_100023525 226
240 3300028800 Ga0265338_10002819 Ga0265338_100028199 226
241 3300033180 Ga0307510_10001560 Ga0307510_1000156012 226
242 3300039453 Ga0436362_1141557 Ga0436362_1141557_176_937 226
243 3300046463 Ga0495653_0118280 Ga0495653_0118280_115_876 226
244 3300048904 Ga0496101_0087556 Ga0496101_0087556_610_1371 226
245 3300048912 Ga0496109_0015218 Ga0496109_0015218_3220_3981 226
246 3300048915 Ga0496112_0571818 Ga0496112_0571818_71_835 226
247 3300005354 Ga0070675_100171344 Ga0070675_1001713442 227
248 3300005356 Ga0070674_100023271 Ga0070674_1000232716 227
249 3300005366 Ga0070659_100305275 Ga0070659_1003052752 227
250 3300005434 Ga0070709_10153556 Ga0070709_101535561 227
251 3300005434 Ga0070709_10614000 Ga0070709_106140001 227
252 3300005435 Ga0070714_100087980 Ga0070714_1000879804 227
253 3300005435 Ga0070714_100125574 Ga0070714_1001255742 227
254 3300005436 Ga0070713_100909786 Ga0070713_1009097861 227
255 3300005437 Ga0070710_10229399 Ga0070710_102293991 227
256 3300005439 Ga0070711_100440035 Ga0070711_1004400352 227
257 3300005981 Ga0081538_10004076 Ga0081538_100040765 227
258 3300006178 Ga0075367_10019889 Ga0075367_100198896 227
259 3300006195 Ga0075366_10112694 Ga0075366_101126942 227
260 3300006844 Ga0075428_100160108 Ga0075428_1001601082 227
261 3300006846 Ga0075430_100052817 Ga0075430_1000528174 227
262 3300006847 Ga0075431_100057283 Ga0075431_1000572833 227
263 3300006880 Ga0075429_100255353 Ga0075429_1002553532 227
264 3300009147 Ga0114129_10014539 Ga0114129_100145394 227
265 3300009545 Ga0105237_11075278 Ga0105237_110752781 227
266 3300010375 Ga0105239_10246387 Ga0105239_102463873 227
267 3300013308 Ga0157375_10807836 Ga0157375_108078361 227
268 3300025253 Ga0209677_101239 Ga0209677_1012399 227
269 3300025906 Ga0207699_10156208 Ga0207699_101562081 227
270 3300025916 Ga0207663_10423650 Ga0207663_104236501 227
271 3300025926 Ga0207659_10447535 Ga0207659_104475352 227
272 3300025929 Ga0207664_10022882 Ga0207664_100228822 227
273 3300025929 Ga0207664_10168738 Ga0207664_101687382 227
274 3300025932 Ga0207690_10286122 Ga0207690_102861222 227
275 3300025937 Ga0207669_10043606 Ga0207669_100436061 227
276 3300035083 Ga0373926_0016809 Ga0373926_0016809_986_1744 227
277 3300035086 Ga0373934_0130488 Ga0373934_0130488_124_882 227
278 3300035089 Ga0373944_0008359 Ga0373944_0008359_1222_1980 227
279 3300035113 Ga0373936_0008251 Ga0373936_0008251_2252_3010 227
280 3300035116 Ga0373945_0001638 Ga0373945_0001638_5670_6428 227
281 3300035117 Ga0373953_0105577 Ga0373953_0105577_115_873 227
282 3300035170 Ga0373943_0000237 Ga0373943_0000237_946_1704 227
283 3300035171 Ga0373946_0000406 Ga0373946_0000406_10339_11097 227
284 3300035410 Ga0373924_0002210 Ga0373924_0002210_3619_4377 227
285 3300035692 Ga0373935_0016330 Ga0373935_0016330_685_1443 227
286 3300035692 Ga0373935_0070001 Ga0373935_0070001_1378_2136 227
287 3300035695 Ga0373927_0027168 Ga0373927_0027168_2004_2762 227
288 3300035725 Ga0373947_0080988 Ga0373947_0080988_685_1443 227
289 3300037068 Ga0373925_0001410 Ga0373925_0001410_3307_4068 227
290 3300037068 Ga0373925_0117552 Ga0373925_0117552_864_1622 227
291 3300042005 Ga0439448_0078105 Ga0439448_0078105_318_1085 227
292 3300042008 Ga0439450_014163 Ga0439450_014163_384_1151 227
293 3300042011 Ga0439454_008528 Ga0439454_008528_205_972 227
294 3300042993 Ga0439440_0031880 Ga0439440_0031880_273_1040 227
295 3300044683 Ga0466965_0012050 Ga0466965_0012050_1317_2078 227
296 3300045976 Ga0466967_0024099 Ga0466967_0024099_3126_3890 227
297 3300046454 Ga0495592_0152527 Ga0495592_0152527_238_996 227
298 3300046461 Ga0495641_0019160 Ga0495641_0019160_2120_2878 227
299 3300046462 Ga0495651_0009846 Ga0495651_0009846_5024_5782 227
300 3300046463 Ga0495653_0001000 Ga0495653_0001000_19136_19894 227
301 3300046463 Ga0495653_0160610 Ga0495653_0160610_161_919 227
302 3300046476 Ga0495662_0012812 Ga0495662_0012812_1522_2280 227
303 3300046477 Ga0495664_0004919 Ga0495664_0004919_5050_5808 227
304 3300046511 Ga0495608_0032396 Ga0495608_0032396_973_1731 227
305 3300046511 Ga0495608_0328156 Ga0495608_0328156_134_892 227
306 3300046514 Ga0495618_0092254 Ga0495618_0092254_949_1707 227
307 3300046516 Ga0495628_0082004 Ga0495628_0082004_340_1098 227
308 3300046517 Ga0495630_0011793 Ga0495630_0011793_946_1704 227
309 3300046529 Ga0495652_0039712 Ga0495652_0039712_2170_2928 227
310 3300046531 Ga0495665_0035159 Ga0495665_0035159_1413_2171 227
311 3300046533 Ga0495640_0138290 Ga0495640_0138290_410_1168 227
312 3300046536 Ga0495587_0191634 Ga0495587_0191634_263_1021 227
313 3300046543 Ga0495645_0120763 Ga0495645_0120763_690_1448 227
314 3300046559 Ga0495667_0026141 Ga0495667_0026141_2215_2973 227
315 3300046559 Ga0495667_0066861 Ga0495667_0066861_886_1644 227
316 3300046616 Ga0495668_0009864 Ga0495668_0009864_3518_4291 227
317 3300046663 Ga0495635_0003863 Ga0495635_0003863_5018_5776 227
318 3300046663 Ga0495635_0241939 Ga0495635_0241939_96_854 227
319 3300046678 Ga0495599_0003120 Ga0495599_0003120_8844_9602 227
320 3300046690 Ga0495624_0004760 Ga0495624_0004760_4126_4884 227
321 3300046809 Ga0495600_0020658 Ga0495600_0020658_141_899 227
322 3300047315 Ga0495581_0025613 Ga0495581_0025613_1501_2259 227
323 3300047319 Ga0495674_0004890 Ga0495674_0004890_5041_5799 227
324 3300047321 Ga0495676_0002009 Ga0495676_0002009_3292_4050 227
325 3300047322 Ga0495680_0003102 Ga0495680_0003102_15156_15914 227
326 3300047322 Ga0495680_0063314 Ga0495680_0063314_411_1169 227
327 3300047322 Ga0495680_0408078 Ga0495680_0408078_160_918 227
328 3300047471 Ga0495684_0018851 Ga0495684_0018851_2862_3620 227
329 3300047471 Ga0495684_0189276 Ga0495684_0189276_235_993 227
330 3300047673 Ga0495593_0042986 Ga0495593_0042986_773_1531 227
331 3300048905 Ga0496102_0001614 Ga0496102_0001614_5788_6549 227
332 3300048906 Ga0496103_0007504 Ga0496103_0007504_1764_2525 227
333 3300048911 Ga0496108_0356140 Ga0496108_0356140_183_941 227
334 3300048912 Ga0496109_0165103 Ga0496109_0165103_1254_2012 227
335 3300049571 Ga0501034_0111028 Ga0501034_0111028_46_807 227
336 3300049583 Ga0501067_0027648 Ga0501067_0027648_1978_2739 227
337 3300049584 Ga0501068_0006180 Ga0501068_0006180_1027_1788 227
338 3300049585 Ga0501069_0042308 Ga0501069_0042308_897_1658 227
339 3300049586 Ga0501070_0102039 Ga0501070_0102039_1207_1968 227
340 3300049588 Ga0501072_0392186 Ga0501072_0392186_157_918 227
341 3300049589 Ga0501073_0023110 Ga0501073_0023110_1299_2060 227
342 3300049590 Ga0501074_0128478 Ga0501074_0128478_841_1602 227
343 3300049593 Ga0501077_0042044 Ga0501077_0042044_998_1759 227
344 3300049742 Ga0501080_0129752 Ga0501080_0129752_646_1407 227
345 3300049744 Ga0501083_0000047 Ga0501083_0000047_63328_64089 227
346 3300049823 Ga0501044_0318532 Ga0501044_0318532_458_1219 227
347 3300050508 nmdc:mga09592_142748_c1 nmdc:mga09592_142748_c1_886_1647 227
348 3300050510 nmdc:mga06r32_28049_c1 nmdc:mga06r32_28049_c1_1469_2230 227
349 3300054114 Ga0501084_0004047 Ga0501084_0004047_7179_7940 227
350 3300060353 Ga0501082_0073572 Ga0501082_0073572_1324_2085 227
351 3300003659 JGI25404J52841_10004405 JGI25404J52841_100044053 228
352 3300005327 Ga0070658_10100252 Ga0070658_101002524 228
353 3300005327 Ga0070658_10161304 Ga0070658_101613043 228
354 3300005334 Ga0068869_100071921 Ga0068869_1000719212 228
355 3300005334 Ga0068869_100396194 Ga0068869_1003961942 228
356 3300005335 Ga0070666_10147942 Ga0070666_101479421 228
357 3300005338 Ga0068868_100538527 Ga0068868_1005385271 228
358 3300005347 Ga0070668_100018010 Ga0070668_1000180105 228
359 3300005347 Ga0070668_100407740 Ga0070668_1004077402 228
360 3300005354 Ga0070675_100252163 Ga0070675_1002521632 228
361 3300005434 Ga0070709_10011385 Ga0070709_100113853 228
362 3300005434 Ga0070709_10057356 Ga0070709_100573563 228
363 3300005434 Ga0070709_10152671 Ga0070709_101526711 228
364 3300005435 Ga0070714_100136889 Ga0070714_1001368893 228
365 3300005436 Ga0070713_100032487 Ga0070713_1000324873 228
366 3300005436 Ga0070713_100742706 Ga0070713_1007427062 228
367 3300005437 Ga0070710_10002785 Ga0070710_100027857 228
368 3300005437 Ga0070710_10046663 Ga0070710_100466632 228
369 3300005437 Ga0070710_10091923 Ga0070710_100919232 228
370 3300005439 Ga0070711_100386124 Ga0070711_1003861242 228
371 3300005456 Ga0070678_100032235 Ga0070678_1000322353 228
372 3300005458 Ga0070681_10689803 Ga0070681_106898031 228
373 3300005458 Ga0070681_10708326 Ga0070681_107083261 228
374 3300005467 Ga0070706_100029829 Ga0070706_1000298294 228
375 3300005467 Ga0070706_100192730 Ga0070706_1001927302 228
376 3300005539 Ga0068853_100192656 Ga0068853_1001926562 228
377 3300005545 Ga0070695_100233505 Ga0070695_1002335051 228
378 3300005563 Ga0068855_100026576 Ga0068855_1000265762 228
379 3300005564 Ga0070664_100430223 Ga0070664_1004302231 228
380 3300005614 Ga0068856_100063130 Ga0068856_1000631303 228
381 3300005615 Ga0070702_100235904 Ga0070702_1002359042 228
382 3300005618 Ga0068864_100891835 Ga0068864_1008918352 228
383 3300005719 Ga0068861_100264343 Ga0068861_1002643432 228
384 3300005842 Ga0068858_100036408 Ga0068858_1000364083 228
385 3300005842 Ga0068858_100244311 Ga0068858_1002443112 228
386 3300005844 Ga0068862_100009224 Ga0068862_1000092241 228
387 3300005937 Ga0081455_10005778 Ga0081455_100057788 228
388 3300005937 Ga0081455_10016895 Ga0081455_100168958 228
389 3300005937 Ga0081455_10108782 Ga0081455_101087822 228
390 3300005937 Ga0081455_10158262 Ga0081455_101582622 228
391 3300005981 Ga0081538_10006653 Ga0081538_100066537 228
392 3300005981 Ga0081538_10043181 Ga0081538_100431812 228
393 3300005983 Ga0081540_1000051 Ga0081540_1000051127 228
394 3300005983 Ga0081540_1143877 Ga0081540_11438772 228
395 3300006028 Ga0070717_10310350 Ga0070717_103103502 228
396 3300006038 Ga0075365_10376742 Ga0075365_103767422 228
397 3300006042 Ga0075368_10022375 Ga0075368_100223753 228
398 3300006051 Ga0075364_10001762 Ga0075364_100017625 228
399 3300006163 Ga0070715_10056596 Ga0070715_100565962 228
400 3300006173 Ga0070716_100015172 Ga0070716_1000151722 228
401 3300006173 Ga0070716_100031205 Ga0070716_1000312053 228
402 3300006173 Ga0070716_100334139 Ga0070716_1003341392 228
403 3300006175 Ga0070712_100092712 Ga0070712_1000927122 228
404 3300006177 Ga0075362_10177068 Ga0075362_101770681 228
405 3300006186 Ga0075369_10135007 Ga0075369_101350072 228
406 3300006194 Ga0075427_10008791 Ga0075427_100087912 228
407 3300006844 Ga0075428_100042705 Ga0075428_1000427056 228
408 3300006844 Ga0075428_100045332 Ga0075428_1000453322 228
409 3300006844 Ga0075428_100075810 Ga0075428_1000758103 228
410 3300006846 Ga0075430_100004837 Ga0075430_10000483710 228
411 3300006846 Ga0075430_100076663 Ga0075430_1000766632 228
412 3300006846 Ga0075430_100373830 Ga0075430_1003738301 228
413 3300006847 Ga0075431_100004579 Ga0075431_1000045793 228
414 3300006847 Ga0075431_100410472 Ga0075431_1004104722 228
415 3300006852 Ga0075433_10007152 Ga0075433_100071525 228
416 3300006871 Ga0075434_100004021 Ga0075434_10000402112 228
417 3300006880 Ga0075429_100024498 Ga0075429_1000244984 228
418 3300006880 Ga0075429_100364433 Ga0075429_1003644332 228
419 3300006881 Ga0068865_100208611 Ga0068865_1002086112 228
420 3300006881 Ga0068865_100592533 Ga0068865_1005925331 228
421 3300006914 Ga0075436_100205839 Ga0075436_1002058392 228
422 3300009093 Ga0105240_10170212 Ga0105240_101702124 228
423 3300009093 Ga0105240_10357485 Ga0105240_103574852 228
424 3300009098 Ga0105245_10040193 Ga0105245_100401935 228
425 3300009098 Ga0105245_10438494 Ga0105245_104384942 228
426 3300009101 Ga0105247_10129913 Ga0105247_101299132 228
427 3300009147 Ga0114129_10003310 Ga0114129_1000331024 228
428 3300009147 Ga0114129_10006580 Ga0114129_1000658016 228
429 3300009147 Ga0114129_10008508 Ga0114129_100085081 228
430 3300009147 Ga0114129_10711916 Ga0114129_107119162 228
431 3300009148 Ga0105243_10084550 Ga0105243_100845502 228
432 3300009174 Ga0105241_10702090 Ga0105241_107020902 228
433 3300009177 Ga0105248_10054648 Ga0105248_100546485 228
434 3300009177 Ga0105248_10383794 Ga0105248_103837942 228
435 3300009545 Ga0105237_10298877 Ga0105237_102988772 228
436 3300009551 Ga0105238_10043572 Ga0105238_100435723 228
437 3300009553 Ga0105249_10093856 Ga0105249_100938562 228
438 3300010375 Ga0105239_10081330 Ga0105239_100813303 228
439 3300013102 Ga0157371_10028551 Ga0157371_100285513 228
440 3300013104 Ga0157370_10184200 Ga0157370_101842002 228
441 3300013105 Ga0157369_10026473 Ga0157369_100264732 228
442 3300013105 Ga0157369_10103973 Ga0157369_101039732 228
443 3300013105 Ga0157369_10150911 Ga0157369_101509113 228
444 3300013296 Ga0157374_10594417 Ga0157374_105944172 228
445 3300013297 Ga0157378_10575323 Ga0157378_105753232 228
446 3300013306 Ga0163162_10378299 Ga0163162_103782993 228
447 3300013306 Ga0163162_10469334 Ga0163162_104693342 228
448 3300013306 Ga0163162_10499997 Ga0163162_104999972 228
449 3300013307 Ga0157372_10136632 Ga0157372_101366324 228
450 3300013307 Ga0157372_10452185 Ga0157372_104521852 228
451 3300014325 Ga0163163_10650195 Ga0163163_106501952 228
452 3300014497 Ga0182008_10012803 Ga0182008_100128034 228
453 3300014968 Ga0157379_10046656 Ga0157379_100466563 228
454 3300014969 Ga0157376_10612214 Ga0157376_106122142 228
455 3300014969 Ga0157376_10769538 Ga0157376_107695382 228
456 3300015262 Ga0182007_10002103 Ga0182007_100021038 228
457 3300021388 Ga0213875_10000386 Ga0213875_1000038623 228
458 3300021388 Ga0213875_10055967 Ga0213875_100559672 228
459 3300025901 Ga0207688_10224365 Ga0207688_102243652 228
460 3300025903 Ga0207680_10036903 Ga0207680_100369031 228
461 3300025905 Ga0207685_10020248 Ga0207685_100202482 228
462 3300025906 Ga0207699_10009759 Ga0207699_100097595 228
463 3300025906 Ga0207699_10015597 Ga0207699_100155975 228
464 3300025908 Ga0207643_10045380 Ga0207643_100453803 228
465 3300025909 Ga0207705_10218060 Ga0207705_102180602 228
466 3300025910 Ga0207684_10256236 Ga0207684_102562363 228
467 3300025913 Ga0207695_10139908 Ga0207695_101399081 228
468 3300025915 Ga0207693_10001639 Ga0207693_1000163915 228
469 3300025915 Ga0207693_10026140 Ga0207693_100261404 228
470 3300025915 Ga0207693_10130757 Ga0207693_101307572 228
471 3300025916 Ga0207663_10042421 Ga0207663_100424214 228
472 3300025927 Ga0207687_10452655 Ga0207687_104526551 228
473 3300025928 Ga0207700_10018357 Ga0207700_100183573 228
474 3300025928 Ga0207700_10173141 Ga0207700_101731413 228
475 3300025928 Ga0207700_10235697 Ga0207700_102356972 228
476 3300025939 Ga0207665_10006024 Ga0207665_100060243 228
477 3300025939 Ga0207665_10012540 Ga0207665_100125406 228
478 3300025939 Ga0207665_10277934 Ga0207665_102779341 228
479 3300025941 Ga0207711_10173752 Ga0207711_101737522 228
480 3300025942 Ga0207689_10057501 Ga0207689_100575012 228
481 3300025945 Ga0207679_10181498 Ga0207679_101814982 228
482 3300025949 Ga0207667_10035862 Ga0207667_100358624 228
483 3300025949 Ga0207667_10283221 Ga0207667_102832213 228
484 3300025961 Ga0207712_10006450 Ga0207712_100064505 228
485 3300025972 Ga0207668_10012416 Ga0207668_100124165 228
486 3300025986 Ga0207658_10253458 Ga0207658_102534582 228
487 3300026023 Ga0207677_10489478 Ga0207677_104894781 228
488 3300026078 Ga0207702_10144748 Ga0207702_101447483 228
489 3300026089 Ga0207648_10019076 Ga0207648_100190768 228
490 3300026089 Ga0207648_10334325 Ga0207648_103343252 228
491 3300026095 Ga0207676_10257891 Ga0207676_102578912 228
492 3300026118 Ga0207675_100050341 Ga0207675_1000503414 228
493 3300026121 Ga0207683_10027099 Ga0207683_100270995 228
494 3300027907 Ga0207428_10001525 Ga0207428_100015254 228
495 3300028379 Ga0268266_10009660 Ga0268266_1000966012 228
496 3300028380 Ga0268265_10089239 Ga0268265_100892392 228
497 3300028786 Ga0307517_10269917 Ga0307517_102699171 228
498 3300028794 Ga0307515_10000941 Ga0307515_1000094153 228
499 3300028794 Ga0307515_10030339 Ga0307515_100303392 228
500 3300028794 Ga0307515_10054239 Ga0307515_100542393 228
501 3300031456 Ga0307513_10025506 Ga0307513_100255064 228
502 3300031507 Ga0307509_10114990 Ga0307509_101149903 228
503 3300031548 Ga0307408_100590798 Ga0307408_1005907982 228
504 3300031616 Ga0307508_10020499 Ga0307508_100204995 228
505 3300031649 Ga0307514_10254043 Ga0307514_102540431 228
506 3300031730 Ga0307516_10003156 Ga0307516_1000315615 228
507 3300031730 Ga0307516_10032377 Ga0307516_100323775 228
508 3300031731 Ga0307405_10001416 Ga0307405_100014164 228
509 3300031824 Ga0307413_10109358 Ga0307413_101093583 228
510 3300031824 Ga0307413_10179415 Ga0307413_101794152 228
511 3300031852 Ga0307410_10005220 Ga0307410_100052206 228
512 3300031852 Ga0307410_10109263 Ga0307410_101092632 228
513 3300031852 Ga0307410_10125250 Ga0307410_101252503 228
514 3300031852 Ga0307410_10182517 Ga0307410_101825171 228
515 3300031901 Ga0307406_10050198 Ga0307406_100501983 228
516 3300031901 Ga0307406_10150122 Ga0307406_101501222 228
517 3300031901 Ga0307406_10155325 Ga0307406_101553251 228
518 3300031903 Ga0307407_10007799 Ga0307407_100077994 228
519 3300031903 Ga0307407_10077907 Ga0307407_100779072 228
520 3300031903 Ga0307407_10150609 Ga0307407_101506091 228
521 3300031911 Ga0307412_10343150 Ga0307412_103431502 228
522 3300031995 Ga0307409_100003467 Ga0307409_1000034673 228
523 3300031995 Ga0307409_100026415 Ga0307409_1000264154 228
524 3300031995 Ga0307409_100076499 Ga0307409_1000764992 228
525 3300031995 Ga0307409_100111656 Ga0307409_1001116562 228
526 3300031995 Ga0307409_100115348 Ga0307409_1001153482 228
527 3300031995 Ga0307409_100278559 Ga0307409_1002785592 228
528 3300031995 Ga0307409_100438363 Ga0307409_1004383632 228
529 3300032002 Ga0307416_100000369 Ga0307416_10000036912 228
530 3300032002 Ga0307416_100139529 Ga0307416_1001395292 228
531 3300032002 Ga0307416_100254248 Ga0307416_1002542482 228
532 3300032005 Ga0307411_10118240 Ga0307411_101182402 228
533 3300032126 Ga0307415_100000025 Ga0307415_10000002527 228
534 3300032126 Ga0307415_100060115 Ga0307415_1000601153 228
535 3300032126 Ga0307415_100125101 Ga0307415_1001251012 228
536 3300032126 Ga0307415_100165857 Ga0307415_1001658572 228
537 3300032126 Ga0307415_100313681 Ga0307415_1003136812 228
538 3300034957 Ga0373938_0019466 Ga0373938_0019466_354_1115 228
539 3300035091 Ga0373951_0000079 Ga0373951_0000079_34346_35107 228
540 3300035111 Ga0373923_0041771 Ga0373923_0041771_115_876 228
541 3300035113 Ga0373936_0047025 Ga0373936_0047025_244_1005 228
542 3300035117 Ga0373953_0086052 Ga0373953_0086052_492_1253 228
543 3300035170 Ga0373943_0043065 Ga0373943_0043065_1215_1976 228
544 3300035691 Ga0373931_0288488 Ga0373931_0288488_158_919 228
545 3300035692 Ga0373935_0015284 Ga0373935_0015284_3274_4035 228
546 3300035695 Ga0373927_0144623 Ga0373927_0144623_111_872 228
547 3300035724 Ga0373933_0006388 Ga0373933_0006388_3756_4523 228
548 3300035724 Ga0373933_0112783 Ga0373933_0112783_151_912 228
549 3300035724 Ga0373933_0128406 Ga0373933_0128406_201_962 228
550 3300035725 Ga0373947_0000027 Ga0373947_0000027_41376_42137 228
551 3300036401 Ga0373937_0013181 Ga0373937_0013181_2340_3107 228
552 3300036401 Ga0373937_0183625 Ga0373937_0183625_1099_1860 228
553 3300037068 Ga0373925_0238280 Ga0373925_0238280_464_1225 228
554 3300037068 Ga0373925_0492685 Ga0373925_0492685_208_969 228
555 3300037312 Ga0395899_0070354 Ga0395899_0070354_1214_1975 228
556 3300037418 Ga0395900_0072675 Ga0395900_0072675_2131_2898 228
557 3300037418 Ga0395900_0177757 Ga0395900_0177757_364_1125 228
558 3300037466 Ga0395898_0043300 Ga0395898_0043300_1971_2738 228
559 3300037466 Ga0395898_0123869 Ga0395898_0123869_257_1021 228
560 3300037466 Ga0395898_0236047 Ga0395898_0236047_84_851 228
561 3300037471 Ga0395905_0069401 Ga0395905_0069401_208_975 228
562 3300037471 Ga0395905_0167107 Ga0395905_0167107_83_844 228
563 3300037853 Ga0436364_0764179 Ga0436364_0764179_49535_50296 228
564 3300038443 Ga0395901_0007766 Ga0395901_0007766_9261_10022 228
565 3300038443 Ga0395901_0034104 Ga0395901_0034104_2332_3099 228
566 3300038443 Ga0395901_0706430 Ga0395901_0706430_177_938 228
567 3300041503 Ga0451847_0075466 Ga0451847_0075466_92_856 228
568 3300042007 Ga0439449_0001862 Ga0439449_0001862_1362_2123 228
569 3300042126 Ga0450888_009637 Ga0450888_009637_328_1089 228
570 3300042146 Ga0450907_014856 Ga0450907_014856_451_1215 228
571 3300044683 Ga0466965_0026789 Ga0466965_0026789_225_1010 228
572 3300044693 Ga0466961_0016693 Ga0466961_0016693_2825_3595 228
573 3300044706 Ga0466964_0095329 Ga0466964_0095329_36_806 228
574 3300044765 Ga0466970_0011864 Ga0466970_0011864_747_1517 228
575 3300044842 Ga0466957_0144631 Ga0466957_0144631_528_1298 228
576 3300044901 Ga0466960_0115006 Ga0466960_0115006_271_1089 228
577 3300044901 Ga0466960_0161546 Ga0466960_0161546_262_1023 228
578 3300046452 Ga0495617_008068 Ga0495617_008068_1742_2503 228
579 3300046454 Ga0495592_0011443 Ga0495592_0011443_5333_6100 228
580 3300046455 Ga0495603_0279305 Ga0495603_0279305_35_796 228
581 3300046458 Ga0495591_041037 Ga0495591_041037_530_1291 228
582 3300046459 Ga0495629_0174925 Ga0495629_0174925_436_1197 228
583 3300046459 Ga0495629_0251877 Ga0495629_0251877_395_1156 228
584 3300046461 Ga0495641_0017919 Ga0495641_0017919_1593_2354 228
585 3300046462 Ga0495651_0002619 Ga0495651_0002619_4205_4972 228
586 3300046462 Ga0495651_0047874 Ga0495651_0047874_256_1017 228
587 3300046462 Ga0495651_0110998 Ga0495651_0110998_1252_2013 228
588 3300046462 Ga0495651_0151410 Ga0495651_0151410_358_1119 228
589 3300046463 Ga0495653_0001148 Ga0495653_0001148_2171_2938 228
590 3300046463 Ga0495653_0071166 Ga0495653_0071166_612_1373 228
591 3300046463 Ga0495653_0077631 Ga0495653_0077631_921_1682 228
592 3300046463 Ga0495653_0078142 Ga0495653_0078142_583_1344 228
593 3300046472 Ga0495580_0023045 Ga0495580_0023045_59_820 228
594 3300046474 Ga0495605_0019533 Ga0495605_0019533_1494_2255 228
595 3300046476 Ga0495662_0001362 Ga0495662_0001362_10430_11191 228
596 3300046477 Ga0495664_0017558 Ga0495664_0017558_1096_1857 228
597 3300046492 Ga0495585_0031085 Ga0495585_0031085_1762_2523 228
598 3300046501 Ga0495607_0082143 Ga0495607_0082143_371_1132 228
599 3300046501 Ga0495607_0158492 Ga0495607_0158492_276_1037 228
600 3300046506 Ga0495583_0034906 Ga0495583_0034906_1151_1912 228
601 3300046511 Ga0495608_0003361 Ga0495608_0003361_5113_5880 228
602 3300046511 Ga0495608_0022571 Ga0495608_0022571_3160_3921 228
603 3300046511 Ga0495608_0056119 Ga0495608_0056119_859_1620 228
604 3300046511 Ga0495608_0116091 Ga0495608_0116091_265_1026 228
605 3300046511 Ga0495608_0193636 Ga0495608_0193636_315_1076 228
606 3300046511 Ga0495608_0253609 Ga0495608_0253609_313_1074 228
607 3300046514 Ga0495618_0083963 Ga0495618_0083963_632_1393 228
608 3300046514 Ga0495618_0113924 Ga0495618_0113924_612_1379 228
609 3300046514 Ga0495618_0153803 Ga0495618_0153803_377_1138 228
610 3300046516 Ga0495628_0057651 Ga0495628_0057651_1521_2282 228
611 3300046516 Ga0495628_0113053 Ga0495628_0113053_378_1145 228
612 3300046516 Ga0495628_0113987 Ga0495628_0113987_113_874 228
613 3300046517 Ga0495630_0052690 Ga0495630_0052690_961_1722 228
614 3300046517 Ga0495630_0185011 Ga0495630_0185011_519_1280 228
615 3300046517 Ga0495630_0318685 Ga0495630_0318685_193_954 228
616 3300046518 Ga0495631_0195944 Ga0495631_0195944_75_836 228
617 3300046522 Ga0495643_0003638 Ga0495643_0003638_2320_3081 228
618 3300046524 Ga0495648_0056461 Ga0495648_0056461_323_1084 228
619 3300046526 Ga0495666_0002838 Ga0495666_0002838_6663_7424 228
620 3300046529 Ga0495652_0003969 Ga0495652_0003969_12812_13579 228
621 3300046531 Ga0495665_0053310 Ga0495665_0053310_1007_1768 228
622 3300046533 Ga0495640_0051892 Ga0495640_0051892_1896_2657 228
623 3300046533 Ga0495640_0094336 Ga0495640_0094336_879_1640 228
624 3300046533 Ga0495640_0175865 Ga0495640_0175865_190_951 228
625 3300046533 Ga0495640_0215301 Ga0495640_0215301_418_1179 228
626 3300046536 Ga0495587_0001643 Ga0495587_0001643_3931_4698 228
627 3300046536 Ga0495587_0024641 Ga0495587_0024641_761_1522 228
628 3300046536 Ga0495587_0073208 Ga0495587_0073208_390_1151 228
629 3300046542 Ga0495597_0036105 Ga0495597_0036105_741_1502 228
630 3300046543 Ga0495645_0008208 Ga0495645_0008208_1370_2137 228
631 3300046543 Ga0495645_0453638 Ga0495645_0453638_12_773 228
632 3300046559 Ga0495667_0000419 Ga0495667_0000419_13206_13973 228
633 3300046559 Ga0495667_0049358 Ga0495667_0049358_1161_1922 228
634 3300046559 Ga0495667_0062008 Ga0495667_0062008_90_851 228
635 3300046559 Ga0495667_0075069 Ga0495667_0075069_807_1568 228
636 3300046559 Ga0495667_0080360 Ga0495667_0080360_553_1314 228
637 3300046642 Ga0495634_0179020 Ga0495634_0179020_192_953 228
638 3300046660 Ga0495625_0146718 Ga0495625_0146718_219_980 228
639 3300046660 Ga0495625_0234695 Ga0495625_0234695_95_856 228
640 3300046663 Ga0495635_0006159 Ga0495635_0006159_5415_6182 228
641 3300046663 Ga0495635_0009878 Ga0495635_0009878_2071_2832 228
642 3300046663 Ga0495635_0060624 Ga0495635_0060624_926_1687 228
643 3300046663 Ga0495635_0084732 Ga0495635_0084732_840_1601 228
644 3300046665 Ga0495661_0081491 Ga0495661_0081491_295_1056 228
645 3300046675 Ga0495657_0001846 Ga0495657_0001846_3792_4559 228
646 3300046675 Ga0495657_0005301 Ga0495657_0005301_4239_5000 228
647 3300046675 Ga0495657_0005508 Ga0495657_0005508_187_948 228
648 3300046675 Ga0495657_0071075 Ga0495657_0071075_1098_1859 228
649 3300046675 Ga0495657_0290023 Ga0495657_0290023_169_930 228
650 3300046678 Ga0495599_0001193 Ga0495599_0001193_10217_10984 228
651 3300046678 Ga0495599_0138386 Ga0495599_0138386_109_870 228
652 3300046679 Ga0495623_0040914 Ga0495623_0040914_843_1604 228
653 3300046679 Ga0495623_0176784 Ga0495623_0176784_435_1202 228
654 3300046680 Ga0495646_0115885 Ga0495646_0115885_737_1498 228
655 3300046689 Ga0495613_0003928 Ga0495613_0003928_8018_8779 228
656 3300046689 Ga0495613_0061004 Ga0495613_0061004_1633_2394 228
657 3300046689 Ga0495613_0226026 Ga0495613_0226026_164_925 228
658 3300046694 Ga0495649_0159021 Ga0495649_0159021_367_1128 228
659 3300046794 Ga0495589_0013643 Ga0495589_0013643_1431_2192 228
660 3300046809 Ga0495600_0014992 Ga0495600_0014992_3917_4684 228
661 3300046809 Ga0495600_0019627 Ga0495600_0019627_1242_2003 228
662 3300046809 Ga0495600_0047982 Ga0495600_0047982_1129_1890 228
663 3300046809 Ga0495600_0111266 Ga0495600_0111266_232_993 228
664 3300046810 Ga0495660_0030479 Ga0495660_0030479_545_1306 228
665 3300046810 Ga0495660_0067730 Ga0495660_0067730_445_1206 228
666 3300047315 Ga0495581_0038407 Ga0495581_0038407_992_1753 228
667 3300047317 Ga0495604_0005472 Ga0495604_0005472_4235_5002 228
668 3300047317 Ga0495604_0100801 Ga0495604_0100801_767_1528 228
669 3300047317 Ga0495604_0118431 Ga0495604_0118431_943_1704 228
670 3300047319 Ga0495674_0022999 Ga0495674_0022999_2691_3452 228
671 3300047319 Ga0495674_0024860 Ga0495674_0024860_4524_5285 228
672 3300047319 Ga0495674_0045064 Ga0495674_0045064_2164_2931 228
673 3300047319 Ga0495674_0080640 Ga0495674_0080640_1247_2008 228
674 3300047319 Ga0495674_0113360 Ga0495674_0113360_1513_2274 228
675 3300047319 Ga0495674_0324441 Ga0495674_0324441_464_1225 228
676 3300047322 Ga0495680_0000782 Ga0495680_0000782_25637_26404 228
677 3300047322 Ga0495680_0024753 Ga0495680_0024753_3349_4110 228
678 3300047322 Ga0495680_0099106 Ga0495680_0099106_1228_1989 228
679 3300047323 Ga0495683_0015124 Ga0495683_0015124_1470_2231 228
680 3300047444 Ga0495675_0188424 Ga0495675_0188424_93_860 228
681 3300047447 Ga0495685_002535 Ga0495685_002535_1725_2486 228
682 3300047471 Ga0495684_0015428 Ga0495684_0015428_2841_3608 228
683 3300047471 Ga0495684_0018012 Ga0495684_0018012_1726_2487 228
684 3300047471 Ga0495684_0072454 Ga0495684_0072454_1072_1833 228
685 3300047673 Ga0495593_0004861 Ga0495593_0004861_5680_6441 228
686 3300047673 Ga0495593_0196450 Ga0495593_0196450_173_934 228
687 3300048088 Ga0495602_0003177 Ga0495602_0003177_3829_4596 228
688 3300048088 Ga0495602_0013811 Ga0495602_0013811_83_844 228
689 3300048088 Ga0495602_0331312 Ga0495602_0331312_291_1052 228
690 3300048903 Ga0496100_0078590 Ga0496100_0078590_1025_1789 228
691 3300048903 Ga0496100_0129972 Ga0496100_0129972_580_1341 228
692 3300048904 Ga0496101_0008779 Ga0496101_0008779_2983_3750 228
693 3300048905 Ga0496102_0056757 Ga0496102_0056757_1528_2295 228
694 3300048907 Ga0496104_0010849 Ga0496104_0010849_280_1044 228
695 3300048907 Ga0496104_0649258 Ga0496104_0649258_62_823 228
696 3300048908 Ga0496105_0079966 Ga0496105_0079966_547_1311 228
697 3300048911 Ga0496108_0009832 Ga0496108_0009832_3913_4680 228
698 3300048912 Ga0496109_0007380 Ga0496109_0007380_2219_2983 228
699 3300048912 Ga0496109_0015301 Ga0496109_0015301_2559_3320 228
700 3300048912 Ga0496109_0075678 Ga0496109_0075678_634_1395 228
701 3300048913 Ga0496110_0092001 Ga0496110_0092001_970_1734 228
702 3300048913 Ga0496110_0407213 Ga0496110_0407213_92_853 228
703 3300048914 Ga0496111_0137197 Ga0496111_0137197_754_1521 228
704 3300048914 Ga0496111_0385211 Ga0496111_0385211_145_906 228
705 3300048915 Ga0496112_0083481 Ga0496112_0083481_801_1562 228
706 3300048916 Ga0496113_0205045 Ga0496113_0205045_639_1436 228
707 3300048916 Ga0496113_0242420 Ga0496113_0242420_301_1062 228
708 3300048916 Ga0496113_0290436 Ga0496113_0290436_405_1166 228
709 3300048916 Ga0496113_0339790 Ga0496113_0339790_263_1024 228
710 3300048917 Ga0496114_0088886 Ga0496114_0088886_1164_1964 228
711 3300048917 Ga0496114_0095005 Ga0496114_0095005_1011_1799 228
712 3300048918 Ga0496115_0095578 Ga0496115_0095578_854_1624 228
713 3300048922 Ga0496119_0142836 Ga0496119_0142836_19_780 228
714 3300048924 Ga0496121_0071186 Ga0496121_0071186_1625_2386 228
715 3300048929 Ga0496126_0049478 Ga0496126_0049478_647_1408 228
716 3300049568 Ga0501031_0029186 Ga0501031_0029186_801_1565 228
717 3300049568 Ga0501031_0118600 Ga0501031_0118600_615_1382 228
718 3300049572 Ga0501036_0147254 Ga0501036_0147254_643_1407 228
719 3300049573 Ga0501037_0134802 Ga0501037_0134802_904_1668 228
720 3300049574 Ga0501038_0001094 Ga0501038_0001094_14785_15546 228
721 3300049574 Ga0501038_0034588 Ga0501038_0034588_1927_2691 228
722 3300049575 Ga0501039_0125264 Ga0501039_0125264_431_1195 228
723 3300049575 Ga0501039_0162544 Ga0501039_0162544_198_965 228
724 3300049576 Ga0501040_0050261 Ga0501040_0050261_990_1754 228
725 3300049577 Ga0501041_0259085 Ga0501041_0259085_79_843 228
726 3300049578 Ga0501042_0086941 Ga0501042_0086941_698_1462 228
727 3300049582 Ga0501048_0010696 Ga0501048_0010696_765_1529 228
728 3300049585 Ga0501069_0057166 Ga0501069_0057166_850_1614 228
729 3300049587 Ga0501071_0014456 Ga0501071_0014456_676_1440 228
730 3300049588 Ga0501072_0059654 Ga0501072_0059654_306_1070 228
731 3300049589 Ga0501073_0270357 Ga0501073_0270357_72_836 228
732 3300049590 Ga0501074_0152717 Ga0501074_0152717_828_1592 228
733 3300049592 Ga0501076_0088515 Ga0501076_0088515_752_1516 228
734 3300049593 Ga0501077_0138510 Ga0501077_0138510_121_888 228
735 3300049741 Ga0501079_0014405 Ga0501079_0014405_1154_1918 228
736 3300049742 Ga0501080_0476731 Ga0501080_0476731_307_1068 228
737 3300049742 Ga0501080_0739949 Ga0501080_0739949_78_842 228
738 3300049824 Ga0501045_0014518 Ga0501045_0014518_3961_4725 228
739 3300050491 nmdc:mga00v17_234983_c1 nmdc:mga00v17_234983_c1_135_896 228
740 3300050491 nmdc:mga00v17_442_c1 nmdc:mga00v17_442_c1_300_1061 228
741 3300050492 nmdc:mga0yw44_776_c1 nmdc:mga0yw44_776_c1_8063_8824 228
742 3300050507 nmdc:mga05p37_13198_c1 nmdc:mga05p37_13198_c1_7117_7878 228
743 3300050507 nmdc:mga05p37_156681_c1 nmdc:mga05p37_156681_c1_201_1013 228
744 3300050507 nmdc:mga05p37_206463_c1 nmdc:mga05p37_206463_c1_199_960 228
745 3300050507 nmdc:mga05p37_94528_c1 nmdc:mga05p37_94528_c1_1834_2607 228
746 3300050508 nmdc:mga09592_13361_c1 nmdc:mga09592_13361_c1_3473_4246 228
747 3300050508 nmdc:mga09592_200618_c1 nmdc:mga09592_200618_c1_37_798 228
748 3300050508 nmdc:mga09592_420440_c1 nmdc:mga09592_420440_c1_43_804 228
749 3300050509 nmdc:mga0qj67_42057_c1 nmdc:mga0qj67_42057_c1_2135_2908 228
750 3300050509 nmdc:mga0qj67_48_c1 nmdc:mga0qj67_48_c1_27030_27791 228
751 3300050509 nmdc:mga0qj67_5437_c1 nmdc:mga0qj67_5437_c1_2334_3095 228
752 3300050510 nmdc:mga06r32_97248_c1 nmdc:mga06r32_97248_c1_300_1073 228
753 3300050511 nmdc:mga08y16_83954_c1 nmdc:mga08y16_83954_c1_1446_2258 228
754 3300050512 nmdc:mga0n895_19256_c1 nmdc:mga0n895_19256_c1_4139_4951 228
755 3300050513 nmdc:mga0rr50_53114_c1 nmdc:mga0rr50_53114_c1_2095_2907 228
756 3300050514 nmdc:mga08x19_267599_c1 nmdc:mga08x19_267599_c1_241_1002 228
757 3300050515 nmdc:mga0a205_7200_c1 nmdc:mga0a205_7200_c1_7809_8621 228
758 3300050516 nmdc:mga0sz30_100178_c1 nmdc:mga0sz30_100178_c1_456_1217 228
759 3300053077 Ga0495601_0235849 Ga0495601_0235849_227_997 228
760 3300053078 Ga0495612_0000458 Ga0495612_0000458_4210_4971 228
761 3300053084 Ga0495595_0132960 Ga0495595_0132960_33_794 228
762 3300053085 Ga0495619_0033270 Ga0495619_0033270_293_1054 228
763 3300053085 Ga0495619_0101961 Ga0495619_0101961_182_949 228
764 3300053088 Ga0500644_0002440 Ga0500644_0002440_1527_2288 228
765 3300053093 Ga0500651_0056049 Ga0500651_0056049_1463_2224 228
766 3300053094 Ga0500566_0000140 Ga0500566_0000140_29772_30533 228
767 3300053098 Ga0500650_0025374 Ga0500650_0025374_96_857 228
768 3300053100 Ga0500660_056583 Ga0500660_056583_173_934 228
769 3300053104 Ga0500556_0000768 Ga0500556_0000768_8383_9144 228
770 3300053131 Ga0500652_041423 Ga0500652_041423_36_797 228
771 3300054114 Ga0501084_0115406 Ga0501084_0115406_405_1169 228
772 3300061734 Ga0530510_0103150 Ga0530510_0103150_1013_1777 228
773 3300001979 JGI24740J21852_10001702 JGI24740J21852_1000170212 229
774 3300003752 Ga0055539_1000008 Ga0055539_1000008315 229
775 3300003756 Ga0055533_1000001 Ga0055533_1000001756 229
776 3300003759 Ga0055525_1000497 Ga0055525_100049720 229
777 3300003759 Ga0055525_1001592 Ga0055525_10015922 229
778 3300005327 Ga0070658_10012817 Ga0070658_100128178 229
779 3300006186 Ga0075369_10033394 Ga0075369_100333942 229
780 3300009148 Ga0105243_10078580 Ga0105243_100785802 229
781 3300011119 Ga0105246_10002245 Ga0105246_1000224513 229
782 3300011119 Ga0105246_10003457 Ga0105246_1000345712 229
783 3300013250 Ga0171462_1003 Ga0171462_1003521 229
784 3300013307 Ga0157372_10077075 Ga0157372_100770756 229
785 3300013307 Ga0157372_10954889 Ga0157372_109548891 229
786 3300013308 Ga0157375_10239218 Ga0157375_102392182 229
787 3300014325 Ga0163163_10618679 Ga0163163_106186792 229
788 3300014969 Ga0157376_10366729 Ga0157376_103667292 229
789 3300020081 Ga0206354_11335766 Ga0206354_113357662 229
790 3300020082 Ga0206353_11910771 Ga0206353_119107713 229
791 3300025225 Ga0209566_100050 Ga0209566_100050232 229
792 3300025226 Ga0209674_100001 Ga0209674_100001756 229
793 3300025230 Ga0209563_100001 Ga0209563_100001756 229
794 3300025230 Ga0209563_100276 Ga0209563_1002769 229
795 3300025253 Ga0209677_100001 Ga0209677_100001756 229
796 3300025272 Ga0209455_1001463 Ga0209455_10014637 229
797 3300025909 Ga0207705_10081202 Ga0207705_100812023 229
798 3300025935 Ga0207709_10018497 Ga0207709_100184974 229
799 3300025937 Ga0207669_10316313 Ga0207669_103163131 229
800 3300026121 Ga0207683_10177752 Ga0207683_101777521 229
801 3300026142 Ga0207698_10124834 Ga0207698_101248342 229
802 3300031548 Ga0307408_100007323 Ga0307408_1000073237 229
803 3300031548 Ga0307408_100015791 Ga0307408_1000157912 229
804 3300031548 Ga0307408_100069259 Ga0307408_1000692593 229
805 3300031731 Ga0307405_10224046 Ga0307405_102240462 229
806 3300031824 Ga0307413_10209587 Ga0307413_102095871 229
807 3300031824 Ga0307413_10270273 Ga0307413_102702732 229
808 3300031852 Ga0307410_10008763 Ga0307410_100087633 229
809 3300031901 Ga0307406_10357034 Ga0307406_103570341 229
810 3300031903 Ga0307407_10041438 Ga0307407_100414382 229
811 3300031911 Ga0307412_10002338 Ga0307412_100023383 229
812 3300031911 Ga0307412_10015415 Ga0307412_100154156 229
813 3300031911 Ga0307412_10034617 Ga0307412_100346174 229
814 3300031911 Ga0307412_10094398 Ga0307412_100943982 229
815 3300031911 Ga0307412_10095669 Ga0307412_100956692 229
816 3300037312 Ga0395899_0018679 Ga0395899_0018679_2712_3482 229
817 3300037312 Ga0395899_0179366 Ga0395899_0179366_128_892 229
818 3300037418 Ga0395900_0172883 Ga0395900_0172883_18_782 229
819 3300037418 Ga0395900_0220293 Ga0395900_0220293_880_1644 229
820 3300037466 Ga0395898_0047481 Ga0395898_0047481_1793_2557 229
821 3300037466 Ga0395898_0558151 Ga0395898_0558151_285_1049 229
822 3300037466 Ga0395898_0728205 Ga0395898_0728205_34_798 229
823 3300038443 Ga0395901_0449780 Ga0395901_0449780_401_1165 229
824 3300041451 Ga0451791_0529767 Ga0451791_0529767_23_787 229
825 3300042002 Ga0439442_000270 Ga0439442_000270_10067_10831 229
826 3300042016 Ga0439463_002010 Ga0439463_002010_1557_2321 229
827 3300042146 Ga0450907_002416 Ga0450907_002416_643_1407 229
828 3300042435 Ga0439434_0000397 Ga0439434_0000397_9716_10480 229
829 3300042435 Ga0439434_0053989 Ga0439434_0053989_427_1191 229
830 3300042531 Ga0450918_000574 Ga0450918_000574_1816_2580 229
831 3300044658 Ga0466972_0008570 Ga0466972_0008570_2389_3153 229
832 3300044658 Ga0466972_0012105 Ga0466972_0012105_146_910 229
833 3300044684 Ga0466966_0035728 Ga0466966_0035728_2173_2937 229
834 3300044684 Ga0466966_0123848 Ga0466966_0123848_314_1078 229
835 3300044693 Ga0466961_0019240 Ga0466961_0019240_475_1239 229
836 3300044693 Ga0466961_0022427 Ga0466961_0022427_839_1603 229
837 3300044693 Ga0466961_0048034 Ga0466961_0048034_178_942 229
838 3300044706 Ga0466964_0176863 Ga0466964_0176863_70_834 229
839 3300044719 Ga0466971_0016902 Ga0466971_0016902_1812_2576 229
840 3300044735 Ga0466968_0056699 Ga0466968_0056699_664_1428 229
841 3300044735 Ga0466968_0101214 Ga0466968_0101214_56_823 229
842 3300044765 Ga0466970_0000096 Ga0466970_0000096_7391_8155 229
843 3300044765 Ga0466970_0008859 Ga0466970_0008859_1944_2708 229
844 3300044765 Ga0466970_0014509 Ga0466970_0014509_199_963 229
845 3300044765 Ga0466970_0070401 Ga0466970_0070401_596_1360 229
846 3300044842 Ga0466957_0013971 Ga0466957_0013971_240_1004 229
847 3300044901 Ga0466960_0015060 Ga0466960_0015060_422_1186 229
848 3300045049 Ga0466959_0028311 Ga0466959_0028311_1460_2224 229
849 3300045836 Ga0466958_0088508 Ga0466958_0088508_489_1253 229
850 3300046463 Ga0495653_0022798 Ga0495653_0022798_2757_3521 229
851 3300046471 Ga0495650_0000591 Ga0495650_0000591_40045_40809 229
852 3300046476 Ga0495662_0030409 Ga0495662_0030409_471_1235 229
853 3300046477 Ga0495664_0001467 Ga0495664_0001467_9778_10542 229
854 3300046517 Ga0495630_0253858 Ga0495630_0253858_532_1296 229
855 3300046531 Ga0495665_0024932 Ga0495665_0024932_472_1236 229
856 3300046535 Ga0495586_0023658 Ga0495586_0023658_855_1619 229
857 3300046536 Ga0495587_0034941 Ga0495587_0034941_67_831 229
858 3300046543 Ga0495645_0000314 Ga0495645_0000314_2113_2877 229
859 3300046559 Ga0495667_0000209 Ga0495667_0000209_6577_7341 229
860 3300046663 Ga0495635_0413101 Ga0495635_0413101_120_884 229
861 3300046683 Ga0495658_0120290 Ga0495658_0120290_338_1102 229
862 3300046809 Ga0495600_0004319 Ga0495600_0004319_2380_3144 229
863 3300047315 Ga0495581_0003074 Ga0495581_0003074_5589_6353 229
864 3300047315 Ga0495581_0055046 Ga0495581_0055046_365_1129 229
865 3300047319 Ga0495674_0269931 Ga0495674_0269931_353_1117 229
866 3300047322 Ga0495680_0039758 Ga0495680_0039758_1512_2276 229
867 3300047444 Ga0495675_0040133 Ga0495675_0040133_1110_1874 229
868 3300047471 Ga0495684_0138444 Ga0495684_0138444_64_828 229
869 3300048903 Ga0496100_0333718 Ga0496100_0333718_188_952 229
870 3300048905 Ga0496102_0402479 Ga0496102_0402479_180_944 229
871 3300048907 Ga0496104_0068414 Ga0496104_0068414_2309_3073 229
872 3300048907 Ga0496104_0542616 Ga0496104_0542616_297_1061 229
873 3300048908 Ga0496105_0011381 Ga0496105_0011381_262_1026 229
874 3300048908 Ga0496105_0037487 Ga0496105_0037487_1856_2620 229
875 3300048910 Ga0496107_0122546 Ga0496107_0122546_284_1048 229
876 3300048910 Ga0496107_0389988 Ga0496107_0389988_11_775 229
877 3300048911 Ga0496108_0002013 Ga0496108_0002013_14363_15127 229
878 3300048911 Ga0496108_0271617 Ga0496108_0271617_309_1073 229
879 3300048912 Ga0496109_0318972 Ga0496109_0318972_386_1150 229
880 3300048913 Ga0496110_0002211 Ga0496110_0002211_13440_14204 229
881 3300048914 Ga0496111_0112449 Ga0496111_0112449_115_879 229
882 3300048917 Ga0496114_0163424 Ga0496114_0163424_255_1019 229
883 3300048918 Ga0496115_0021354 Ga0496115_0021354_2052_2816 229
884 3300048918 Ga0496115_0115861 Ga0496115_0115861_227_991 229
885 3300048924 Ga0496121_0003923 Ga0496121_0003923_7686_8450 229
886 3300048925 Ga0496122_0009222 Ga0496122_0009222_7249_8013 229
887 3300048926 Ga0496123_0010117 Ga0496123_0010117_2907_3671 229
888 3300048929 Ga0496126_0013859 Ga0496126_0013859_4090_4854 229
889 3300049573 Ga0501037_0030311 Ga0501037_0030311_2217_2990 229
890 3300049574 Ga0501038_0136226 Ga0501038_0136226_291_1058 229
891 3300049574 Ga0501038_0403667 Ga0501038_0403667_228_1001 229
892 3300049579 Ga0501043_0236438 Ga0501043_0236438_141_914 229
893 3300049581 Ga0501047_0010095 Ga0501047_0010095_365_1138 229
894 3300049583 Ga0501067_0153613 Ga0501067_0153613_316_1089 229
895 3300049586 Ga0501070_0010680 Ga0501070_0010680_2144_2947 229
896 3300049586 Ga0501070_0315246 Ga0501070_0315246_88_855 229
897 3300049589 Ga0501073_0000366 Ga0501073_0000366_14402_15175 229
898 3300049822 Ga0501035_0012980 Ga0501035_0012980_1698_2471 229
899 3300049823 Ga0501044_0003649 Ga0501044_0003649_1838_2611 229
900 3300050492 nmdc:mga0yw44_1010_c1 nmdc:mga0yw44_1010_c1_9853_10629 229
901 3300050516 nmdc:mga0sz30_11757_c1 nmdc:mga0sz30_11757_c1_603_1391 229
902 3300053080 Ga0500635_0000016 Ga0500635_0000016_102108_102872 229
903 3300053108 Ga0500562_000448 Ga0500562_000448_176_949 229
904 3300053139 Ga0500568_0000327 Ga0500568_0000327_3728_4495 229
905 3300053139 Ga0500568_0025483 Ga0500568_0025483_1682_2446 229
906 3300053153 Ga0500616_0000071 Ga0500616_0000071_87377_88144 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

22

234

0.91

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

63

263

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bi0-assembly1.cif.gz_A abcg2 turnover-2 state with tariquidar bound 0.7522 114 224
8bht-assembly1.cif.gz_A abcg2 turnover-1 state with tariquidar bound 0.7402 114 223
7jr7-assembly1.cif.gz_A cryo-em structure of abcg5/g8 in complex with fab 2e10 and 11f4 0.7387 113 225
8p8a-assembly1.cif.gz_A structure of 5d3-fab and nanobody(nb17)-bound abcg2 0.7379 114 220
8p8a-assembly1.cif.gz_B structure of 5d3-fab and nanobody(nb17)-bound abcg2 0.7379 114 220
ID Description Score Start End Superfamily
af_E0AHB5_1_108_1.20.120.340 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Flagellar protein FliS 0.4832 111 219 1.20.120.340
1gnlA02 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.468 120 227 1.20.1270.20
af_K7LSM9_1_176_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.4321 121 222 1.20.1080.10
1gnlA02 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.4295 120 227 1.20.1270.20
3gm6A03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.4148 98 225 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A0Q9MLE9-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9374 114 227 GO:0016020
GO:0140359
AF-A0A2N3FQK2-F1-model_v4 ABC transporter permease 0.9202 129 228 GO:0016020
AF-A0A6B3FYG4-F1-model_v4 ABC transporter permease 0.9161 114 229 GO:0016020
GO:0140359
AF-A0A0Q9MLE9-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9142 114 227 GO:0016020
GO:0140359
AF-D6M663-F1-model_v4 ABC transporter, permease 0.9108 114 229 GO:0016020
GO:0140359

Feature Viewer

pLDDT pTM Quality
79.52 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map