F485338
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 906 | 429 | 865 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300044901|Ga0466960_0115006|Ga0466960_0115006_271_1089 |
| Length | 272 |
| Sequence | MTIQTTHTSQTAATTGTRFLGEAVVLTKRSLRHILRSPDTIITTAITPVAMLLLFVYVFGGAIDISGAPNDKYVDYLLPGILLITVASGVAYTSYRLFLDLQGGIFQRFESMPIARSAALWAHVLTSLVANLLSLALVVIVALVMGFRSGAGPLAWLGVLGILVLFTLALTWLAVIAGLTAKSTDGAGGFAYPLLFLPFLSSAFVPTDGMPPPVRWFAEHQPVTPLVDALRSLYAEQPLGNDVWTALAWCSALLAVAYALAMRAYHRRMKAC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 3 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 4 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 5 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 6 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 7 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 8 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 9 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 10 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 11 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 12 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 13 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 14 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 15 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 16 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 17 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 18 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 19 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 20 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 21 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 22 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 23 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 24 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 25 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 26 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 27 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 28 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 29 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 30 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 31 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 32 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 33 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 34 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 35 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 36 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 37 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 38 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 39 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 40 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 41 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 43 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 44 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 45 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 46 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 47 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 49 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 51 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 54 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 101 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 104 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 105 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 132 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 140 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 193 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 194 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 200 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 201 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 212 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 213 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 214 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 215 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 216 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 241 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 243 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 244 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 245 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 246 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 247 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 248 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 249 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 250 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 251 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 252 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 253 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 254 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 255 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 256 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 257 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 258 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 259 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 260 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 261 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 262 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 263 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 264 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 265 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 266 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 267 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 268 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 269 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 270 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 271 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 272 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 339 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 340 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 341 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 345 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 346 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 347 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 348 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 349 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 350 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 351 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 352 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 353 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 354 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 355 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 356 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 357 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 358 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 389 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 390 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 392 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 402 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 405 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 410 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 411 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 412 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 413 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 414 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 415 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 416 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 417 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 418 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 419 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 420 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 422 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 425 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 426 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 427 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 428 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 429 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.7 |
| Metatranscriptomes | 0.77 |
| Isolates | 4.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.29 |
| Nodule | 0 |
| Rhizoplane | 8.5 |
| Rhizosphere | 77.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001702 | 3300001979 | Bacteria | 10095 |
| 2 | JGI24739J22299_10085499 | 3300001989 | Bacteria | 964 |
| 3 | JGI24735J21928_10032757 | 3300002067 | Bacteria | 1537 |
| 4 | JGI25158J39367_1012116 | 3300002739 | Bacteria | 1141 |
| 5 | JGI25406J46586_10008542 | 3300003203 | Bacteria | 4631 |
| 6 | rootH2_10175217 | 3300003320 | Bacteria | 2876 |
| 7 | rootL2_10077234 | 3300003322 | Bacteria | 10064 |
| 8 | rootL2_10271871 | 3300003322 | Bacteria | 2842 |
| 9 | rootH1_10192662 | 3300003323 | Bacteria | 1952 |
| 10 | Ga0006562J51391_1095727 | 3300003578 | Bacteria | 2947 |
| 11 | Ga0006562J51391_1095728 | 3300003578 | Bacteria | 2480 |
| 12 | Ga0006562J51391_1096029 | 3300003578 | Bacteria | 10820 |
| 13 | Ga0006562J51391_1096030 | 3300003578 | Bacteria | 8210 |
| 14 | JGI25404J52841_10004405 | 3300003659 | Bacteria | 2851 |
| 15 | Ga0055539_1000008 | 3300003752 | Bacteria | 537665 |
| 16 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 17 | Ga0055525_1000497 | 3300003759 | Bacteria | 19910 |
| 18 | Ga0055525_1001592 | 3300003759 | Bacteria | 3657 |
| 19 | Ga0055527_1000001 | 3300003760 | Bacteria | 850044 |
| 20 | Ga0055529_1000019 | 3300003763 | Bacteria | 332786 |
| 21 | Ga0070658_10012817 | 3300005327 | Bacteria | 6727 |
| 22 | Ga0070658_10100252 | 3300005327 | Bacteria | 2394 |
| 23 | Ga0070658_10161304 | 3300005327 | Bacteria | 1881 |
| 24 | Ga0068869_100071921 | 3300005334 | Bacteria | 2562 |
| 25 | Ga0068869_100396194 | 3300005334 | Bacteria | 1135 |
| 26 | Ga0070666_10147942 | 3300005335 | Bacteria | 1638 |
| 27 | Ga0068868_100538527 | 3300005338 | Bacteria | 1027 |
| 28 | Ga0070668_100018010 | 3300005347 | Bacteria | 5299 |
| 29 | Ga0070668_100302545 | 3300005347 | Bacteria | 1342 |
| 30 | Ga0070668_100407740 | 3300005347 | Bacteria | 1162 |
| 31 | Ga0070675_100171344 | 3300005354 | Bacteria | 1872 |
| 32 | Ga0070675_100252163 | 3300005354 | Bacteria | 1545 |
| 33 | Ga0070674_100023271 | 3300005356 | Bacteria | 4007 |
| 34 | Ga0070659_100305275 | 3300005366 | Bacteria | 1328 |
| 35 | Ga0070709_10011385 | 3300005434 | Bacteria | 4957 |
| 36 | Ga0070709_10057356 | 3300005434 | Bacteria | 2466 |
| 37 | Ga0070709_10152671 | 3300005434 | Bacteria | 1597 |
| 38 | Ga0070709_10153556 | 3300005434 | Bacteria | 1593 |
| 39 | Ga0070709_10614000 | 3300005434 | Bacteria | 838 |
| 40 | Ga0070714_100087980 | 3300005435 | Bacteria | 2717 |
| 41 | Ga0070714_100125574 | 3300005435 | Bacteria | 2287 |
| 42 | Ga0070714_100136889 | 3300005435 | Bacteria | 2194 |
| 43 | Ga0070714_100290659 | 3300005435 | Bacteria | 1521 |
| 44 | Ga0070713_100032487 | 3300005436 | Bacteria | 4169 |
| 45 | Ga0070713_100742706 | 3300005436 | Bacteria | 938 |
| 46 | Ga0070713_100909786 | 3300005436 | Bacteria | 846 |
| 47 | Ga0070710_10002785 | 3300005437 | Bacteria | 8330 |
| 48 | Ga0070710_10046663 | 3300005437 | Bacteria | 2413 |
| 49 | Ga0070710_10091923 | 3300005437 | Bacteria | 1791 |
| 50 | Ga0070710_10229399 | 3300005437 | Bacteria | 1185 |
| 51 | Ga0070711_100386124 | 3300005439 | Bacteria | 1133 |
| 52 | Ga0070711_100440035 | 3300005439 | Bacteria | 1065 |
| 53 | Ga0070678_100032235 | 3300005456 | Bacteria | 3625 |
| 54 | Ga0070681_10689803 | 3300005458 | Bacteria | 937 |
| 55 | Ga0070681_10708326 | 3300005458 | Bacteria | 923 |
| 56 | Ga0070706_100029829 | 3300005467 | Bacteria | 5024 |
| 57 | Ga0070706_100192730 | 3300005467 | Bacteria | 1904 |
| 58 | Ga0070698_100037624 | 3300005471 | Bacteria | 4988 |
| 59 | Ga0070684_100361616 | 3300005535 | Bacteria | 1336 |
| 60 | Ga0068853_100192656 | 3300005539 | Bacteria | 1853 |
| 61 | Ga0068853_100248732 | 3300005539 | Bacteria | 1631 |
| 62 | Ga0070695_100233505 | 3300005545 | Bacteria | 1331 |
| 63 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 64 | Ga0068855_100026576 | 3300005563 | Bacteria | 6925 |
| 65 | Ga0068855_100581140 | 3300005563 | Bacteria | 1210 |
| 66 | Ga0070664_100430223 | 3300005564 | Bacteria | 1210 |
| 67 | Ga0068857_100236890 | 3300005577 | Bacteria | 1670 |
| 68 | Ga0068856_100063130 | 3300005614 | Bacteria | 3659 |
| 69 | Ga0068856_100071837 | 3300005614 | Bacteria | 3426 |
| 70 | Ga0070702_100235904 | 3300005615 | Bacteria | 1232 |
| 71 | Ga0068852_100636402 | 3300005616 | Bacteria | 1073 |
| 72 | Ga0068864_100891835 | 3300005618 | Bacteria | 878 |
| 73 | Ga0068861_100264343 | 3300005719 | Bacteria | 1474 |
| 74 | Ga0068858_100036408 | 3300005842 | Bacteria | 4563 |
| 75 | Ga0068858_100244311 | 3300005842 | Bacteria | 1704 |
| 76 | Ga0068860_100021498 | 3300005843 | Bacteria | 6247 |
| 77 | Ga0068862_100009224 | 3300005844 | Bacteria | 8172 |
| 78 | Ga0081455_10005778 | 3300005937 | Bacteria | 13485 |
| 79 | Ga0081455_10016895 | 3300005937 | Bacteria | 7017 |
| 80 | Ga0081455_10025093 | 3300005937 | Bacteria | 5508 |
| 81 | Ga0081455_10108782 | 3300005937 | Bacteria | 2207 |
| 82 | Ga0081455_10158262 | 3300005937 | Bacteria | 1739 |
| 83 | Ga0081538_10004076 | 3300005981 | Bacteria | 13588 |
| 84 | Ga0081538_10006653 | 3300005981 | Bacteria | 10129 |
| 85 | Ga0081538_10043181 | 3300005981 | Bacteria | 2835 |
| 86 | Ga0081540_1000051 | 3300005983 | Bacteria | 126311 |
| 87 | Ga0081540_1143877 | 3300005983 | Bacteria | 952 |
| 88 | Ga0081539_10004561 | 3300005985 | Bacteria | 15152 |
| 89 | Ga0081539_10054051 | 3300005985 | Bacteria | 2245 |
| 90 | Ga0070717_10310350 | 3300006028 | Bacteria | 1403 |
| 91 | Ga0075365_10039746 | 3300006038 | Bacteria | 3065 |
| 92 | Ga0075365_10376742 | 3300006038 | Bacteria | 1001 |
| 93 | Ga0075368_10022375 | 3300006042 | Bacteria | 2407 |
| 94 | Ga0075364_10001762 | 3300006051 | Bacteria | 11960 |
| 95 | Ga0070715_10056596 | 3300006163 | Bacteria | 1706 |
| 96 | Ga0070716_100015172 | 3300006173 | Bacteria | 3953 |
| 97 | Ga0070716_100031205 | 3300006173 | Bacteria | 2896 |
| 98 | Ga0070716_100334139 | 3300006173 | Bacteria | 1066 |
| 99 | Ga0070712_100092712 | 3300006175 | Bacteria | 2215 |
| 100 | Ga0075362_10177068 | 3300006177 | Bacteria | 1032 |
| 101 | Ga0075367_10019889 | 3300006178 | Bacteria | 3730 |
| 102 | Ga0075369_10033394 | 3300006186 | Bacteria | 2180 |
| 103 | Ga0075369_10135007 | 3300006186 | Bacteria | 1123 |
| 104 | Ga0075427_10008791 | 3300006194 | Bacteria | 1501 |
| 105 | Ga0075366_10112694 | 3300006195 | Bacteria | 1637 |
| 106 | Ga0075428_100042705 | 3300006844 | Bacteria | 4985 |
| 107 | Ga0075428_100045332 | 3300006844 | Bacteria | 4831 |
| 108 | Ga0075428_100075810 | 3300006844 | Bacteria | 3672 |
| 109 | Ga0075428_100160108 | 3300006844 | Bacteria | 2443 |
| 110 | Ga0075428_100220034 | 3300006844 | Bacteria | 2050 |
| 111 | Ga0075430_100004837 | 3300006846 | Bacteria | 11338 |
| 112 | Ga0075430_100052817 | 3300006846 | Bacteria | 3422 |
| 113 | Ga0075430_100067055 | 3300006846 | Bacteria | 3013 |
| 114 | Ga0075430_100076663 | 3300006846 | Bacteria | 2802 |
| 115 | Ga0075430_100373830 | 3300006846 | Bacteria | 1176 |
| 116 | Ga0075431_100004579 | 3300006847 | Bacteria | 13572 |
| 117 | Ga0075431_100021347 | 3300006847 | Bacteria | 6620 |
| 118 | Ga0075431_100057283 | 3300006847 | Bacteria | 4019 |
| 119 | Ga0075431_100070873 | 3300006847 | Bacteria | 3596 |
| 120 | Ga0075431_100410472 | 3300006847 | Bacteria | 1354 |
| 121 | Ga0075433_10007152 | 3300006852 | Bacteria | 8838 |
| 122 | Ga0075434_100004021 | 3300006871 | Bacteria | 13177 |
| 123 | Ga0075434_100013750 | 3300006871 | Bacteria | 7717 |
| 124 | Ga0075429_100024498 | 3300006880 | Bacteria | 5235 |
| 125 | Ga0075429_100105764 | 3300006880 | Bacteria | 2458 |
| 126 | Ga0075429_100255353 | 3300006880 | Bacteria | 1535 |
| 127 | Ga0075429_100364433 | 3300006880 | Bacteria | 1265 |
| 128 | Ga0068865_100208611 | 3300006881 | Bacteria | 1521 |
| 129 | Ga0068865_100592533 | 3300006881 | Bacteria | 936 |
| 130 | Ga0075436_100205839 | 3300006914 | Bacteria | 1394 |
| 131 | Ga0105251_10132951 | 3300009011 | Bacteria | 1127 |
| 132 | Ga0105240_10170212 | 3300009093 | Bacteria | 2581 |
| 133 | Ga0105240_10357485 | 3300009093 | Bacteria | 1655 |
| 134 | Ga0105240_10484420 | 3300009093 | Bacteria | 1378 |
| 135 | Ga0105245_10040193 | 3300009098 | Bacteria | 4166 |
| 136 | Ga0105245_10042613 | 3300009098 | Bacteria | 4050 |
| 137 | Ga0105245_10438494 | 3300009098 | Bacteria | 1312 |
| 138 | Ga0105247_10129913 | 3300009101 | Bacteria | 1641 |
| 139 | Ga0114129_10003310 | 3300009147 | Bacteria | 22631 |
| 140 | Ga0114129_10006580 | 3300009147 | Bacteria | 16496 |
| 141 | Ga0114129_10008508 | 3300009147 | Bacteria | 14627 |
| 142 | Ga0114129_10014539 | 3300009147 | Bacteria | 11216 |
| 143 | Ga0114129_10088561 | 3300009147 | Bacteria | 4291 |
| 144 | Ga0114129_10711916 | 3300009147 | Bacteria | 1289 |
| 145 | Ga0105243_10078580 | 3300009148 | Bacteria | 2687 |
| 146 | Ga0105243_10084550 | 3300009148 | Bacteria | 2599 |
| 147 | Ga0105243_10123441 | 3300009148 | Bacteria | 2187 |
| 148 | Ga0105243_10886801 | 3300009148 | Bacteria | 886 |
| 149 | Ga0105241_10702090 | 3300009174 | Bacteria | 923 |
| 150 | Ga0105248_10054648 | 3300009177 | Bacteria | 4478 |
| 151 | Ga0105248_10383794 | 3300009177 | Bacteria | 1582 |
| 152 | Ga0105248_10516539 | 3300009177 | Bacteria | 1347 |
| 153 | Ga0105237_10298877 | 3300009545 | Bacteria | 1613 |
| 154 | Ga0105237_10367179 | 3300009545 | Bacteria | 1444 |
| 155 | Ga0105237_10431060 | 3300009545 | Bacteria | 1324 |
| 156 | Ga0105237_10637934 | 3300009545 | Bacteria | 1072 |
| 157 | Ga0105237_11075278 | 3300009545 | Bacteria | 811 |
| 158 | Ga0105238_10043572 | 3300009551 | Bacteria | 4540 |
| 159 | Ga0105238_10113875 | 3300009551 | Bacteria | 2684 |
| 160 | Ga0105249_10093856 | 3300009553 | Bacteria | 2812 |
| 161 | Ga0105249_10873759 | 3300009553 | Bacteria | 965 |
| 162 | Ga0105239_10042641 | 3300010375 | Bacteria | 4972 |
| 163 | Ga0105239_10081330 | 3300010375 | Bacteria | 3565 |
| 164 | Ga0105239_10246387 | 3300010375 | Bacteria | 2006 |
| 165 | Ga0105246_10002245 | 3300011119 | Bacteria | 11650 |
| 166 | Ga0105246_10003457 | 3300011119 | Bacteria | 9574 |
| 167 | Ga0157371_10028551 | 3300013102 | Bacteria | 4039 |
| 168 | Ga0157370_10184200 | 3300013104 | Bacteria | 1939 |
| 169 | Ga0157369_10026473 | 3300013105 | Bacteria | 6432 |
| 170 | Ga0157369_10103973 | 3300013105 | Bacteria | 3025 |
| 171 | Ga0157369_10150911 | 3300013105 | Bacteria | 2456 |
| 172 | Ga0157369_10593704 | 3300013105 | Bacteria | 1143 |
| 173 | Ga0171462_1003 | 3300013250 | Bacteria | 853796 |
| 174 | Ga0157374_10000003 | 3300013296 | Bacteria | 854471 |
| 175 | Ga0157374_10594417 | 3300013296 | Bacteria | 1116 |
| 176 | Ga0157378_10207220 | 3300013297 | Bacteria | 1857 |
| 177 | Ga0157378_10575323 | 3300013297 | Bacteria | 1135 |
| 178 | Ga0163162_10001277 | 3300013306 | Bacteria | 23565 |
| 179 | Ga0163162_10378299 | 3300013306 | Bacteria | 1549 |
| 180 | Ga0163162_10469334 | 3300013306 | Bacteria | 1390 |
| 181 | Ga0163162_10499997 | 3300013306 | Bacteria | 1346 |
| 182 | Ga0163162_10830894 | 3300013306 | Bacteria | 1040 |
| 183 | Ga0157372_10077075 | 3300013307 | Bacteria | 3764 |
| 184 | Ga0157372_10136632 | 3300013307 | Bacteria | 2823 |
| 185 | Ga0157372_10437843 | 3300013307 | Bacteria | 1524 |
| 186 | Ga0157372_10452185 | 3300013307 | Bacteria | 1497 |
| 187 | Ga0157372_10561414 | 3300013307 | Bacteria | 1331 |
| 188 | Ga0157372_10954889 | 3300013307 | Bacteria | 994 |
| 189 | Ga0157375_10042755 | 3300013308 | Bacteria | 4388 |
| 190 | Ga0157375_10239218 | 3300013308 | Bacteria | 1975 |
| 191 | Ga0157375_10594215 | 3300013308 | Bacteria | 1266 |
| 192 | Ga0157375_10807836 | 3300013308 | Bacteria | 1086 |
| 193 | Ga0157375_11166980 | 3300013308 | Bacteria | 903 |
| 194 | Ga0163163_10618679 | 3300014325 | Bacteria | 1146 |
| 195 | Ga0163163_10650195 | 3300014325 | Bacteria | 1118 |
| 196 | Ga0182008_10000001 | 3300014497 | Bacteria | 540790 |
| 197 | Ga0182008_10012803 | 3300014497 | Bacteria | 4422 |
| 198 | Ga0157377_10206578 | 3300014745 | Bacteria | 1250 |
| 199 | Ga0157379_10046656 | 3300014968 | Bacteria | 3865 |
| 200 | Ga0157376_10366729 | 3300014969 | Bacteria | 1383 |
| 201 | Ga0157376_10612214 | 3300014969 | Bacteria | 1085 |
| 202 | Ga0157376_10769538 | 3300014969 | Bacteria | 973 |
| 203 | Ga0182007_10002103 | 3300015262 | Bacteria | 10193 |
| 204 | Ga0163161_10098660 | 3300017792 | Bacteria | 2172 |
| 205 | Ga0163161_10122253 | 3300017792 | Bacteria | 1957 |
| 206 | Ga0163161_10252190 | 3300017792 | Bacteria | 1376 |
| 207 | Ga0206354_11335766 | 3300020081 | Bacteria | 2021 |
| 208 | Ga0206353_11910771 | 3300020082 | Bacteria | 4430 |
| 209 | Ga0213875_10000220 | 3300021388 | Bacteria | 57921 |
| 210 | Ga0213875_10000386 | 3300021388 | Bacteria | 39534 |
| 211 | Ga0213875_10055967 | 3300021388 | Bacteria | 1847 |
| 212 | Ga0209436_100233 | 3300025208 | Bacteria | 25515 |
| 213 | Ga0209566_100050 | 3300025225 | Bacteria | 234653 |
| 214 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 215 | Ga0209672_100006 | 3300025228 | Bacteria | 1004497 |
| 216 | Ga0209147_100677 | 3300025229 | Bacteria | 17561 |
| 217 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 218 | Ga0209563_100276 | 3300025230 | Bacteria | 21685 |
| 219 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 220 | Ga0209677_101239 | 3300025253 | Bacteria | 11548 |
| 221 | Ga0209148_1000015 | 3300025254 | Bacteria | 850103 |
| 222 | Ga0209455_1000013 | 3300025272 | Bacteria | 850103 |
| 223 | Ga0209455_1001463 | 3300025272 | Bacteria | 10632 |
| 224 | Ga0209130_1002047 | 3300025284 | Bacteria | 10968 |
| 225 | Ga0207426_1000539 | 3300025302 | Bacteria | 54198 |
| 226 | Ga0207710_10158591 | 3300025900 | Bacteria | 1101 |
| 227 | Ga0207688_10224365 | 3300025901 | Bacteria | 1133 |
| 228 | Ga0207680_10036903 | 3300025903 | Bacteria | 2817 |
| 229 | Ga0207647_10072786 | 3300025904 | Bacteria | 2072 |
| 230 | Ga0207647_10163243 | 3300025904 | Bacteria | 1299 |
| 231 | Ga0207647_10216658 | 3300025904 | Bacteria | 1104 |
| 232 | Ga0207685_10020248 | 3300025905 | Bacteria | 2207 |
| 233 | Ga0207699_10009759 | 3300025906 | Bacteria | 4792 |
| 234 | Ga0207699_10015597 | 3300025906 | Bacteria | 3951 |
| 235 | Ga0207699_10156208 | 3300025906 | Bacteria | 1514 |
| 236 | Ga0207643_10045380 | 3300025908 | Bacteria | 2482 |
| 237 | Ga0207705_10081202 | 3300025909 | Bacteria | 2363 |
| 238 | Ga0207705_10218060 | 3300025909 | Bacteria | 1448 |
| 239 | Ga0207684_10256236 | 3300025910 | Bacteria | 1510 |
| 240 | Ga0207684_10319441 | 3300025910 | Bacteria | 1338 |
| 241 | Ga0207695_10139908 | 3300025913 | Bacteria | 2370 |
| 242 | Ga0207693_10001639 | 3300025915 | Bacteria | 19763 |
| 243 | Ga0207693_10026140 | 3300025915 | Bacteria | 4622 |
| 244 | Ga0207693_10130757 | 3300025915 | Bacteria | 1973 |
| 245 | Ga0207663_10042421 | 3300025916 | Bacteria | 2779 |
| 246 | Ga0207663_10423650 | 3300025916 | Bacteria | 1022 |
| 247 | Ga0207659_10447535 | 3300025926 | Bacteria | 1087 |
| 248 | Ga0207687_10452655 | 3300025927 | Bacteria | 1065 |
| 249 | Ga0207700_10018357 | 3300025928 | Bacteria | 4697 |
| 250 | Ga0207700_10173141 | 3300025928 | Bacteria | 1802 |
| 251 | Ga0207700_10235697 | 3300025928 | Bacteria | 1558 |
| 252 | Ga0207664_10022882 | 3300025929 | Bacteria | 4674 |
| 253 | Ga0207664_10168738 | 3300025929 | Bacteria | 1871 |
| 254 | Ga0207664_10382299 | 3300025929 | Bacteria | 1250 |
| 255 | Ga0207690_10286122 | 3300025932 | Bacteria | 1285 |
| 256 | Ga0207709_10018497 | 3300025935 | Bacteria | 3903 |
| 257 | Ga0207669_10043606 | 3300025937 | Bacteria | 2628 |
| 258 | Ga0207669_10316313 | 3300025937 | Bacteria | 1193 |
| 259 | Ga0207665_10006024 | 3300025939 | Bacteria | 8052 |
| 260 | Ga0207665_10012540 | 3300025939 | Bacteria | 5569 |
| 261 | Ga0207665_10277934 | 3300025939 | Bacteria | 1245 |
| 262 | Ga0207691_10144008 | 3300025940 | Bacteria | 2099 |
| 263 | Ga0207711_10173752 | 3300025941 | Bacteria | 1956 |
| 264 | Ga0207711_10253779 | 3300025941 | Bacteria | 1615 |
| 265 | Ga0207689_10057501 | 3300025942 | Bacteria | 3199 |
| 266 | Ga0207679_10181498 | 3300025945 | Bacteria | 1742 |
| 267 | Ga0207667_10035862 | 3300025949 | Bacteria | 5320 |
| 268 | Ga0207667_10283221 | 3300025949 | Bacteria | 1694 |
| 269 | Ga0207712_10006450 | 3300025961 | Bacteria | 7397 |
| 270 | Ga0207668_10012416 | 3300025972 | Bacteria | 5216 |
| 271 | Ga0207668_10692455 | 3300025972 | Bacteria | 895 |
| 272 | Ga0207658_10253458 | 3300025986 | Bacteria | 1496 |
| 273 | Ga0207677_10489478 | 3300026023 | Bacteria | 1061 |
| 274 | Ga0207702_10052785 | 3300026078 | Bacteria | 3441 |
| 275 | Ga0207702_10144748 | 3300026078 | Bacteria | 2155 |
| 276 | Ga0207648_10019076 | 3300026089 | Bacteria | 6193 |
| 277 | Ga0207648_10334325 | 3300026089 | Bacteria | 1363 |
| 278 | Ga0207676_10257891 | 3300026095 | Bacteria | 1573 |
| 279 | Ga0207674_10370711 | 3300026116 | Bacteria | 1384 |
| 280 | Ga0207675_100050341 | 3300026118 | Bacteria | 3887 |
| 281 | Ga0207683_10027099 | 3300026121 | Bacteria | 4953 |
| 282 | Ga0207683_10177752 | 3300026121 | Bacteria | 1929 |
| 283 | Ga0207698_10124834 | 3300026142 | Bacteria | 2187 |
| 284 | Ga0207428_10001525 | 3300027907 | Bacteria | 24188 |
| 285 | Ga0207428_10007572 | 3300027907 | Bacteria | 9897 |
| 286 | Ga0268266_10000102 | 3300028379 | Bacteria | 179754 |
| 287 | Ga0268266_10009660 | 3300028379 | Bacteria | 8481 |
| 288 | Ga0268265_10089239 | 3300028380 | Bacteria | 2458 |
| 289 | Ga0268264_10015344 | 3300028381 | Bacteria | 6283 |
| 290 | Ga0265336_10002352 | 3300028666 | Bacteria | 7861 |
| 291 | Ga0307517_10269917 | 3300028786 | Bacteria | 979 |
| 292 | Ga0307515_10000941 | 3300028794 | Bacteria | 66641 |
| 293 | Ga0307515_10030339 | 3300028794 | Bacteria | 9085 |
| 294 | Ga0307515_10054239 | 3300028794 | Bacteria | 5890 |
| 295 | Ga0265338_10002819 | 3300028800 | Bacteria | 25378 |
| 296 | Ga0307511_10080776 | 3300030521 | Bacteria | 2288 |
| 297 | Ga0307513_10025506 | 3300031456 | Bacteria | 6844 |
| 298 | Ga0307509_10114990 | 3300031507 | Bacteria | 2684 |
| 299 | Ga0307408_100007323 | 3300031548 | Bacteria | 7300 |
| 300 | Ga0307408_100015791 | 3300031548 | Bacteria | 5031 |
| 301 | Ga0307408_100069259 | 3300031548 | Bacteria | 2601 |
| 302 | Ga0307408_100590798 | 3300031548 | Bacteria | 985 |
| 303 | Ga0307508_10020499 | 3300031616 | Bacteria | 6003 |
| 304 | Ga0307508_10181359 | 3300031616 | Bacteria | 1708 |
| 305 | Ga0307514_10254043 | 3300031649 | Bacteria | 1037 |
| 306 | Ga0307516_10003156 | 3300031730 | Bacteria | 21453 |
| 307 | Ga0307516_10032377 | 3300031730 | Bacteria | 5266 |
| 308 | Ga0307405_10001416 | 3300031731 | Bacteria | 10090 |
| 309 | Ga0307405_10036526 | 3300031731 | Bacteria | 2945 |
| 310 | Ga0307405_10224046 | 3300031731 | Bacteria | 1382 |
| 311 | Ga0307413_10109358 | 3300031824 | Bacteria | 1847 |
| 312 | Ga0307413_10179415 | 3300031824 | Bacteria | 1508 |
| 313 | Ga0307413_10209587 | 3300031824 | Bacteria | 1414 |
| 314 | Ga0307413_10270273 | 3300031824 | Bacteria | 1272 |
| 315 | Ga0307410_10005220 | 3300031852 | Bacteria | 6841 |
| 316 | Ga0307410_10008763 | 3300031852 | Bacteria | 5632 |
| 317 | Ga0307410_10109263 | 3300031852 | Bacteria | 1998 |
| 318 | Ga0307410_10125250 | 3300031852 | Bacteria | 1880 |
| 319 | Ga0307410_10182517 | 3300031852 | Bacteria | 1590 |
| 320 | Ga0307410_10231779 | 3300031852 | Bacteria | 1426 |
| 321 | Ga0307406_10050198 | 3300031901 | Bacteria | 2643 |
| 322 | Ga0307406_10150122 | 3300031901 | Bacteria | 1661 |
| 323 | Ga0307406_10155325 | 3300031901 | Bacteria | 1638 |
| 324 | Ga0307406_10357034 | 3300031901 | Bacteria | 1144 |
| 325 | Ga0307407_10007799 | 3300031903 | Bacteria | 4871 |
| 326 | Ga0307407_10041438 | 3300031903 | Bacteria | 2575 |
| 327 | Ga0307407_10077907 | 3300031903 | Bacteria | 1995 |
| 328 | Ga0307407_10150609 | 3300031903 | Bacteria | 1511 |
| 329 | Ga0307412_10002338 | 3300031911 | Bacteria | 10503 |
| 330 | Ga0307412_10015415 | 3300031911 | Bacteria | 4533 |
| 331 | Ga0307412_10034617 | 3300031911 | Bacteria | 3220 |
| 332 | Ga0307412_10094398 | 3300031911 | Bacteria | 2100 |
| 333 | Ga0307412_10095669 | 3300031911 | Bacteria | 2088 |
| 334 | Ga0307412_10343150 | 3300031911 | Bacteria | 1196 |
| 335 | Ga0307412_10673254 | 3300031911 | Bacteria | 885 |
| 336 | Ga0307409_100003467 | 3300031995 | Bacteria | 8569 |
| 337 | Ga0307409_100026415 | 3300031995 | Bacteria | 4094 |
| 338 | Ga0307409_100076499 | 3300031995 | Bacteria | 2684 |
| 339 | Ga0307409_100111656 | 3300031995 | Bacteria | 2293 |
| 340 | Ga0307409_100115348 | 3300031995 | Bacteria | 2261 |
| 341 | Ga0307409_100278559 | 3300031995 | Bacteria | 1544 |
| 342 | Ga0307409_100438363 | 3300031995 | Bacteria | 1258 |
| 343 | Ga0307416_100000369 | 3300032002 | Bacteria | 23398 |
| 344 | Ga0307416_100139529 | 3300032002 | Bacteria | 2200 |
| 345 | Ga0307416_100254248 | 3300032002 | Bacteria | 1712 |
| 346 | Ga0307411_10118240 | 3300032005 | Bacteria | 1912 |
| 347 | Ga0307415_100000025 | 3300032126 | Bacteria | 62892 |
| 348 | Ga0307415_100058923 | 3300032126 | Bacteria | 2646 |
| 349 | Ga0307415_100060115 | 3300032126 | Bacteria | 2624 |
| 350 | Ga0307415_100125101 | 3300032126 | Bacteria | 1936 |
| 351 | Ga0307415_100165857 | 3300032126 | Bacteria | 1717 |
| 352 | Ga0307415_100230987 | 3300032126 | Bacteria | 1490 |
| 353 | Ga0307415_100313681 | 3300032126 | Bacteria | 1304 |
| 354 | Ga0307507_10104699 | 3300033179 | Bacteria | 2347 |
| 355 | Ga0307507_10265178 | 3300033179 | Bacteria | 1092 |
| 356 | Ga0307510_10001560 | 3300033180 | Bacteria | 25328 |
| 357 | Ga0373938_0019466 | 3300034957 | Bacteria | 1358 |
| 358 | Ga0373926_0016809 | 3300035083 | Bacteria | 2507 |
| 359 | Ga0373934_0130488 | 3300035086 | Bacteria | 1025 |
| 360 | Ga0373944_0008359 | 3300035089 | Bacteria | 2796 |
| 361 | Ga0373951_0000079 | 3300035091 | Bacteria | 38464 |
| 362 | Ga0373923_0041771 | 3300035111 | Bacteria | 1892 |
| 363 | Ga0373936_0008251 | 3300035113 | Bacteria | 3916 |
| 364 | Ga0373936_0047025 | 3300035113 | Bacteria | 1740 |
| 365 | Ga0373945_0001638 | 3300035116 | Bacteria | 6866 |
| 366 | Ga0373953_0086052 | 3300035117 | Bacteria | 1312 |
| 367 | Ga0373953_0105577 | 3300035117 | Bacteria | 1188 |
| 368 | Ga0373943_0000237 | 3300035170 | Bacteria | 22674 |
| 369 | Ga0373943_0043065 | 3300035170 | Bacteria | 2191 |
| 370 | Ga0373946_0000406 | 3300035171 | Bacteria | 14067 |
| 371 | Ga0373924_0002210 | 3300035410 | Bacteria | 6520 |
| 372 | Ga0373931_0288488 | 3300035691 | Bacteria | 1010 |
| 373 | Ga0373935_0015284 | 3300035692 | Bacteria | 4637 |
| 374 | Ga0373935_0016330 | 3300035692 | Bacteria | 4492 |
| 375 | Ga0373935_0070001 | 3300035692 | Bacteria | 2261 |
| 376 | Ga0373927_0027168 | 3300035695 | Bacteria | 3738 |
| 377 | Ga0373927_0144623 | 3300035695 | Bacteria | 1556 |
| 378 | Ga0373933_0006388 | 3300035724 | Bacteria | 6416 |
| 379 | Ga0373933_0112783 | 3300035724 | Bacteria | 1697 |
| 380 | Ga0373933_0128406 | 3300035724 | Bacteria | 1592 |
| 381 | Ga0373947_0000027 | 3300035725 | Bacteria | 81186 |
| 382 | Ga0373947_0080988 | 3300035725 | Bacteria | 2009 |
| 383 | Ga0373937_0013181 | 3300036401 | Bacteria | 7279 |
| 384 | Ga0373937_0183625 | 3300036401 | Bacteria | 1964 |
| 385 | Ga0373925_0001410 | 3300037068 | Bacteria | 20874 |
| 386 | Ga0373925_0117552 | 3300037068 | Bacteria | 2060 |
| 387 | Ga0373925_0238280 | 3300037068 | Bacteria | 1456 |
| 388 | Ga0373925_0492685 | 3300037068 | Bacteria | 1006 |
| 389 | Ga0395899_0018679 | 3300037312 | Bacteria | 5268 |
| 390 | Ga0395899_0070354 | 3300037312 | Bacteria | 2561 |
| 391 | Ga0395899_0179366 | 3300037312 | Bacteria | 1488 |
| 392 | Ga0395900_0003464 | 3300037418 | Bacteria | 17036 |
| 393 | Ga0395900_0072675 | 3300037418 | Bacteria | 3536 |
| 394 | Ga0395900_0172883 | 3300037418 | Bacteria | 2198 |
| 395 | Ga0395900_0177757 | 3300037418 | Bacteria | 2164 |
| 396 | Ga0395900_0220293 | 3300037418 | Bacteria | 1913 |
| 397 | Ga0395900_0985284 | 3300037418 | Bacteria | 763 |
| 398 | Ga0395898_0000015 | 3300037466 | Bacteria | 439819 |
| 399 | Ga0395898_0043300 | 3300037466 | Bacteria | 4436 |
| 400 | Ga0395898_0047481 | 3300037466 | Bacteria | 4214 |
| 401 | Ga0395898_0123869 | 3300037466 | Bacteria | 2477 |
| 402 | Ga0395898_0236047 | 3300037466 | Bacteria | 1744 |
| 403 | Ga0395898_0558151 | 3300037466 | Bacteria | 1087 |
| 404 | Ga0395898_0728205 | 3300037466 | Bacteria | 933 |
| 405 | Ga0395898_1081321 | 3300037466 | Bacteria | 736 |
| 406 | Ga0395905_0069401 | 3300037471 | Bacteria | 3301 |
| 407 | Ga0395905_0167107 | 3300037471 | Bacteria | 2067 |
| 408 | Ga0436364_0361998 | 3300037853 | Bacteria | 1499 |
| 409 | Ga0436364_0501302 | 3300037853 | Bacteria | 94330 |
| 410 | Ga0436364_0764179 | 3300037853 | Bacteria | 57419 |
| 411 | Ga0395901_0007766 | 3300038443 | Bacteria | 10824 |
| 412 | Ga0395901_0034104 | 3300038443 | Bacteria | 5256 |
| 413 | Ga0395901_0352598 | 3300038443 | Bacteria | 1518 |
| 414 | Ga0395901_0449780 | 3300038443 | Bacteria | 1317 |
| 415 | Ga0395901_0706430 | 3300038443 | Bacteria | 1005 |
| 416 | Ga0436365_1565935 | 3300039437 | Bacteria | 1697 |
| 417 | Ga0436362_1141557 | 3300039453 | Bacteria | 1053 |
| 418 | Ga0451791_0529767 | 3300041451 | Bacteria | 1933 |
| 419 | Ga0451847_0075466 | 3300041503 | Bacteria | 868 |
| 420 | Ga0451853_0632895 | 3300041512 | Bacteria | 1210 |
| 421 | Ga0439442_000270 | 3300042002 | Bacteria | 12664 |
| 422 | Ga0439448_0078105 | 3300042005 | Bacteria | 1109 |
| 423 | Ga0439449_0001862 | 3300042007 | Bacteria | 8307 |
| 424 | Ga0439450_014163 | 3300042008 | Bacteria | 1613 |
| 425 | Ga0439454_008528 | 3300042011 | Bacteria | 1311 |
| 426 | Ga0439463_002010 | 3300042016 | Bacteria | 5284 |
| 427 | Ga0450888_009637 | 3300042126 | Bacteria | 1107 |
| 428 | Ga0450907_002416 | 3300042146 | Bacteria | 3566 |
| 429 | Ga0450907_014856 | 3300042146 | Bacteria | 1299 |
| 430 | Ga0439434_0000397 | 3300042435 | Bacteria | 12414 |
| 431 | Ga0439434_0053989 | 3300042435 | Bacteria | 1249 |
| 432 | Ga0450918_000574 | 3300042531 | Bacteria | 7815 |
| 433 | Ga0451577_0068052 | 3300042876 | Bacteria | 3176 |
| 434 | Ga0451577_0100538 | 3300042876 | Bacteria | 2583 |
| 435 | Ga0439440_0031880 | 3300042993 | Bacteria | 1248 |
| 436 | Ga0466972_0008570 | 3300044658 | Bacteria | 5131 |
| 437 | Ga0466972_0012105 | 3300044658 | Bacteria | 4334 |
| 438 | Ga0466972_0022532 | 3300044658 | Bacteria | 3136 |
| 439 | Ga0466972_0092777 | 3300044658 | Bacteria | 1431 |
| 440 | Ga0453683_0046533 | 3300044673 | Bacteria | 2720 |
| 441 | Ga0466965_0012050 | 3300044683 | Bacteria | 4060 |
| 442 | Ga0466965_0026789 | 3300044683 | Bacteria | 2795 |
| 443 | Ga0466966_0035728 | 3300044684 | Bacteria | 3209 |
| 444 | Ga0466966_0123848 | 3300044684 | Bacteria | 1586 |
| 445 | Ga0466961_0016693 | 3300044693 | Bacteria | 4721 |
| 446 | Ga0466961_0019240 | 3300044693 | Bacteria | 4395 |
| 447 | Ga0466961_0022427 | 3300044693 | Bacteria | 4061 |
| 448 | Ga0466961_0048034 | 3300044693 | Bacteria | 2728 |
| 449 | Ga0466964_0095329 | 3300044706 | Bacteria | 1302 |
| 450 | Ga0466964_0176863 | 3300044706 | Bacteria | 1009 |
| 451 | Ga0466964_0368414 | 3300044706 | Bacteria | 743 |
| 452 | Ga0453684_0000007 | 3300044712 | Bacteria | 1301482 |
| 453 | Ga0466971_0016902 | 3300044719 | Bacteria | 3224 |
| 454 | Ga0466968_0056699 | 3300044735 | Bacteria | 1683 |
| 455 | Ga0466968_0101214 | 3300044735 | Bacteria | 1286 |
| 456 | Ga0466970_0000096 | 3300044765 | Bacteria | 37750 |
| 457 | Ga0466970_0008859 | 3300044765 | Bacteria | 5072 |
| 458 | Ga0466970_0011864 | 3300044765 | Bacteria | 4444 |
| 459 | Ga0466970_0014509 | 3300044765 | Bacteria | 4046 |
| 460 | Ga0466970_0070401 | 3300044765 | Bacteria | 1880 |
| 461 | Ga0466970_0097927 | 3300044765 | Bacteria | 1596 |
| 462 | Ga0466957_0013971 | 3300044842 | Bacteria | 4669 |
| 463 | Ga0466957_0144631 | 3300044842 | Bacteria | 1534 |
| 464 | Ga0466957_0604073 | 3300044842 | Bacteria | 768 |
| 465 | Ga0466960_0003842 | 3300044901 | Bacteria | 5823 |
| 466 | Ga0466960_0015060 | 3300044901 | Bacteria | 3328 |
| 467 | Ga0466960_0115006 | 3300044901 | Bacteria | 1402 |
| 468 | Ga0466960_0161546 | 3300044901 | Bacteria | 1203 |
| 469 | Ga0466959_0028311 | 3300045049 | Bacteria | 4155 |
| 470 | Ga0451576_0000188 | 3300045051 | Bacteria | 155095 |
| 471 | Ga0466958_0088508 | 3300045836 | Bacteria | 1913 |
| 472 | Ga0466967_0024099 | 3300045976 | Bacteria | 4998 |
| 473 | Ga0466967_0282974 | 3300045976 | Bacteria | 1591 |
| 474 | Ga0495617_008068 | 3300046452 | Bacteria | 3638 |
| 475 | Ga0495592_0011443 | 3300046454 | Bacteria | 6713 |
| 476 | Ga0495592_0152527 | 3300046454 | Bacteria | 1597 |
| 477 | Ga0495603_0279305 | 3300046455 | Bacteria | 960 |
| 478 | Ga0495591_041037 | 3300046458 | Bacteria | 1316 |
| 479 | Ga0495629_0174925 | 3300046459 | Bacteria | 1489 |
| 480 | Ga0495629_0251877 | 3300046459 | Bacteria | 1215 |
| 481 | Ga0495641_0017919 | 3300046461 | Bacteria | 3670 |
| 482 | Ga0495641_0019160 | 3300046461 | Bacteria | 3510 |
| 483 | Ga0495651_0002619 | 3300046462 | Bacteria | 13925 |
| 484 | Ga0495651_0009846 | 3300046462 | Bacteria | 7349 |
| 485 | Ga0495651_0047874 | 3300046462 | Bacteria | 3303 |
| 486 | Ga0495651_0110998 | 3300046462 | Bacteria | 2027 |
| 487 | Ga0495651_0151410 | 3300046462 | Bacteria | 1671 |
| 488 | Ga0495653_0001000 | 3300046463 | Bacteria | 21793 |
| 489 | Ga0495653_0001148 | 3300046463 | Bacteria | 20379 |
| 490 | Ga0495653_0018240 | 3300046463 | Bacteria | 5702 |
| 491 | Ga0495653_0022798 | 3300046463 | Bacteria | 5064 |
| 492 | Ga0495653_0071166 | 3300046463 | Bacteria | 2601 |
| 493 | Ga0495653_0077631 | 3300046463 | Bacteria | 2465 |
| 494 | Ga0495653_0078142 | 3300046463 | Bacteria | 2455 |
| 495 | Ga0495653_0118280 | 3300046463 | Bacteria | 1893 |
| 496 | Ga0495653_0160610 | 3300046463 | Bacteria | 1560 |
| 497 | Ga0495650_0000591 | 3300046471 | Bacteria | 50174 |
| 498 | Ga0495650_0152817 | 3300046471 | Bacteria | 828 |
| 499 | Ga0495580_0023045 | 3300046472 | Bacteria | 4577 |
| 500 | Ga0495605_0019533 | 3300046474 | Bacteria | 3617 |
| 501 | Ga0495662_0001362 | 3300046476 | Bacteria | 12078 |
| 502 | Ga0495662_0012812 | 3300046476 | Bacteria | 4087 |
| 503 | Ga0495662_0030409 | 3300046476 | Bacteria | 2607 |
| 504 | Ga0495664_0001467 | 3300046477 | Bacteria | 12499 |
| 505 | Ga0495664_0004919 | 3300046477 | Bacteria | 7310 |
| 506 | Ga0495664_0017558 | 3300046477 | Bacteria | 4092 |
| 507 | Ga0495585_0031085 | 3300046492 | Bacteria | 3034 |
| 508 | Ga0495607_0082143 | 3300046501 | Bacteria | 1769 |
| 509 | Ga0495607_0158492 | 3300046501 | Bacteria | 1152 |
| 510 | Ga0495583_0034906 | 3300046506 | Bacteria | 2405 |
| 511 | Ga0495608_0003361 | 3300046511 | Bacteria | 11438 |
| 512 | Ga0495608_0022571 | 3300046511 | Bacteria | 4315 |
| 513 | Ga0495608_0032396 | 3300046511 | Bacteria | 3533 |
| 514 | Ga0495608_0056119 | 3300046511 | Bacteria | 2602 |
| 515 | Ga0495608_0116091 | 3300046511 | Bacteria | 1718 |
| 516 | Ga0495608_0193636 | 3300046511 | Bacteria | 1283 |
| 517 | Ga0495608_0253609 | 3300046511 | Bacteria | 1096 |
| 518 | Ga0495608_0328156 | 3300046511 | Bacteria | 944 |
| 519 | Ga0495618_0083963 | 3300046514 | Bacteria | 2035 |
| 520 | Ga0495618_0092254 | 3300046514 | Bacteria | 1936 |
| 521 | Ga0495618_0113924 | 3300046514 | Bacteria | 1731 |
| 522 | Ga0495618_0153803 | 3300046514 | Bacteria | 1469 |
| 523 | Ga0495628_0057651 | 3300046516 | Bacteria | 3055 |
| 524 | Ga0495628_0082004 | 3300046516 | Bacteria | 2505 |
| 525 | Ga0495628_0113053 | 3300046516 | Bacteria | 2087 |
| 526 | Ga0495628_0113987 | 3300046516 | Bacteria | 2077 |
| 527 | Ga0495630_0011793 | 3300046517 | Bacteria | 6335 |
| 528 | Ga0495630_0052690 | 3300046517 | Bacteria | 3047 |
| 529 | Ga0495630_0185011 | 3300046517 | Bacteria | 1589 |
| 530 | Ga0495630_0253858 | 3300046517 | Bacteria | 1343 |
| 531 | Ga0495630_0318102 | 3300046517 | Bacteria | 1190 |
| 532 | Ga0495630_0318685 | 3300046517 | Bacteria | 1188 |
| 533 | Ga0495631_0195944 | 3300046518 | Bacteria | 864 |
| 534 | Ga0495643_0003638 | 3300046522 | Bacteria | 11196 |
| 535 | Ga0495648_0056461 | 3300046524 | Bacteria | 2362 |
| 536 | Ga0495666_0002838 | 3300046526 | Bacteria | 8670 |
| 537 | Ga0495652_0003969 | 3300046529 | Bacteria | 14333 |
| 538 | Ga0495652_0039712 | 3300046529 | Bacteria | 4069 |
| 539 | Ga0495665_0024932 | 3300046531 | Bacteria | 3213 |
| 540 | Ga0495665_0035159 | 3300046531 | Bacteria | 2677 |
| 541 | Ga0495665_0053310 | 3300046531 | Bacteria | 2139 |
| 542 | Ga0495640_0051892 | 3300046533 | Bacteria | 2817 |
| 543 | Ga0495640_0054437 | 3300046533 | Bacteria | 2740 |
| 544 | Ga0495640_0094336 | 3300046533 | Bacteria | 1971 |
| 545 | Ga0495640_0138290 | 3300046533 | Bacteria | 1571 |
| 546 | Ga0495640_0175865 | 3300046533 | Bacteria | 1366 |
| 547 | Ga0495640_0215301 | 3300046533 | Bacteria | 1213 |
| 548 | Ga0495586_0023658 | 3300046535 | Bacteria | 3281 |
| 549 | Ga0495587_0001643 | 3300046536 | Bacteria | 14911 |
| 550 | Ga0495587_0024641 | 3300046536 | Bacteria | 3684 |
| 551 | Ga0495587_0034941 | 3300046536 | Bacteria | 3029 |
| 552 | Ga0495587_0073208 | 3300046536 | Bacteria | 1991 |
| 553 | Ga0495587_0191634 | 3300046536 | Bacteria | 1157 |
| 554 | Ga0495597_0036105 | 3300046542 | Bacteria | 2227 |
| 555 | Ga0495645_0000314 | 3300046543 | Bacteria | 34802 |
| 556 | Ga0495645_0008208 | 3300046543 | Bacteria | 7282 |
| 557 | Ga0495645_0120763 | 3300046543 | Bacteria | 1845 |
| 558 | Ga0495645_0453638 | 3300046543 | Bacteria | 808 |
| 559 | Ga0495633_0278735 | 3300046558 | Bacteria | 761 |
| 560 | Ga0495667_0000209 | 3300046559 | Bacteria | 39226 |
| 561 | Ga0495667_0000419 | 3300046559 | Bacteria | 27279 |
| 562 | Ga0495667_0026141 | 3300046559 | Bacteria | 3932 |
| 563 | Ga0495667_0049358 | 3300046559 | Bacteria | 2778 |
| 564 | Ga0495667_0062008 | 3300046559 | Bacteria | 2450 |
| 565 | Ga0495667_0066861 | 3300046559 | Bacteria | 2349 |
| 566 | Ga0495667_0075069 | 3300046559 | Bacteria | 2201 |
| 567 | Ga0495667_0080360 | 3300046559 | Bacteria | 2119 |
| 568 | Ga0495668_0009864 | 3300046616 | Bacteria | 5825 |
| 569 | Ga0495634_0179020 | 3300046642 | Bacteria | 1328 |
| 570 | Ga0495625_0146718 | 3300046660 | Bacteria | 1588 |
| 571 | Ga0495625_0234695 | 3300046660 | Bacteria | 1196 |
| 572 | Ga0495635_0003863 | 3300046663 | Bacteria | 10411 |
| 573 | Ga0495635_0006159 | 3300046663 | Bacteria | 8362 |
| 574 | Ga0495635_0009878 | 3300046663 | Bacteria | 6670 |
| 575 | Ga0495635_0060624 | 3300046663 | Bacteria | 2599 |
| 576 | Ga0495635_0084732 | 3300046663 | Bacteria | 2168 |
| 577 | Ga0495635_0241939 | 3300046663 | Bacteria | 1217 |
| 578 | Ga0495635_0413101 | 3300046663 | Bacteria | 895 |
| 579 | Ga0495661_0081491 | 3300046665 | Bacteria | 1865 |
| 580 | Ga0495657_0001846 | 3300046675 | Bacteria | 18067 |
| 581 | Ga0495657_0005301 | 3300046675 | Bacteria | 10199 |
| 582 | Ga0495657_0005508 | 3300046675 | Bacteria | 10006 |
| 583 | Ga0495657_0037941 | 3300046675 | Bacteria | 3317 |
| 584 | Ga0495657_0071075 | 3300046675 | Bacteria | 2273 |
| 585 | Ga0495657_0290023 | 3300046675 | Bacteria | 977 |
| 586 | Ga0495599_0001193 | 3300046678 | Bacteria | 14754 |
| 587 | Ga0495599_0003120 | 3300046678 | Bacteria | 9656 |
| 588 | Ga0495599_0138386 | 3300046678 | Bacteria | 1511 |
| 589 | Ga0495623_0040914 | 3300046679 | Bacteria | 2958 |
| 590 | Ga0495623_0176784 | 3300046679 | Bacteria | 1243 |
| 591 | Ga0495646_0115885 | 3300046680 | Bacteria | 1521 |
| 592 | Ga0495658_0120290 | 3300046683 | Bacteria | 1588 |
| 593 | Ga0495613_0003928 | 3300046689 | Bacteria | 11132 |
| 594 | Ga0495613_0061004 | 3300046689 | Bacteria | 2762 |
| 595 | Ga0495613_0159448 | 3300046689 | Bacteria | 1605 |
| 596 | Ga0495613_0226026 | 3300046689 | Bacteria | 1312 |
| 597 | Ga0495624_0004760 | 3300046690 | Bacteria | 9875 |
| 598 | Ga0495649_0159021 | 3300046694 | Bacteria | 1185 |
| 599 | Ga0495589_0013643 | 3300046794 | Bacteria | 4189 |
| 600 | Ga0495600_0004319 | 3300046809 | Bacteria | 8498 |
| 601 | Ga0495600_0014992 | 3300046809 | Bacteria | 4894 |
| 602 | Ga0495600_0019627 | 3300046809 | Bacteria | 4319 |
| 603 | Ga0495600_0020658 | 3300046809 | Bacteria | 4211 |
| 604 | Ga0495600_0047982 | 3300046809 | Bacteria | 2786 |
| 605 | Ga0495600_0111266 | 3300046809 | Bacteria | 1783 |
| 606 | Ga0495660_0030479 | 3300046810 | Bacteria | 3038 |
| 607 | Ga0495660_0067730 | 3300046810 | Bacteria | 1901 |
| 608 | Ga0495581_0003074 | 3300047315 | Bacteria | 9544 |
| 609 | Ga0495581_0025613 | 3300047315 | Bacteria | 3420 |
| 610 | Ga0495581_0038407 | 3300047315 | Bacteria | 2771 |
| 611 | Ga0495581_0055046 | 3300047315 | Bacteria | 2296 |
| 612 | Ga0495604_0005472 | 3300047317 | Bacteria | 10074 |
| 613 | Ga0495604_0100801 | 3300047317 | Bacteria | 2122 |
| 614 | Ga0495604_0118431 | 3300047317 | Bacteria | 1920 |
| 615 | Ga0495604_0196340 | 3300047317 | Bacteria | 1403 |
| 616 | Ga0495674_0004890 | 3300047319 | Bacteria | 12878 |
| 617 | Ga0495674_0022999 | 3300047319 | Bacteria | 5742 |
| 618 | Ga0495674_0024860 | 3300047319 | Bacteria | 5499 |
| 619 | Ga0495674_0045064 | 3300047319 | Bacteria | 3918 |
| 620 | Ga0495674_0080640 | 3300047319 | Bacteria | 2792 |
| 621 | Ga0495674_0113360 | 3300047319 | Bacteria | 2296 |
| 622 | Ga0495674_0269931 | 3300047319 | Bacteria | 1396 |
| 623 | Ga0495674_0324441 | 3300047319 | Bacteria | 1254 |
| 624 | Ga0495674_0539667 | 3300047319 | Bacteria | 929 |
| 625 | Ga0495672_0008252 | 3300047320 | Bacteria | 7714 |
| 626 | Ga0495676_0002009 | 3300047321 | Bacteria | 17914 |
| 627 | Ga0495680_0000782 | 3300047322 | Bacteria | 35634 |
| 628 | Ga0495680_0003102 | 3300047322 | Bacteria | 16553 |
| 629 | Ga0495680_0024753 | 3300047322 | Bacteria | 4974 |
| 630 | Ga0495680_0039758 | 3300047322 | Bacteria | 3750 |
| 631 | Ga0495680_0063314 | 3300047322 | Bacteria | 2840 |
| 632 | Ga0495680_0099106 | 3300047322 | Bacteria | 2173 |
| 633 | Ga0495680_0408078 | 3300047322 | Bacteria | 937 |
| 634 | Ga0495683_0015124 | 3300047323 | Bacteria | 4019 |
| 635 | Ga0495687_145820 | 3300047443 | Bacteria | 816 |
| 636 | Ga0495675_0040133 | 3300047444 | Bacteria | 2981 |
| 637 | Ga0495675_0188424 | 3300047444 | Bacteria | 1260 |
| 638 | Ga0495685_002535 | 3300047447 | Bacteria | 5739 |
| 639 | Ga0495684_0015428 | 3300047471 | Bacteria | 5880 |
| 640 | Ga0495684_0018012 | 3300047471 | Bacteria | 5442 |
| 641 | Ga0495684_0018851 | 3300047471 | Bacteria | 5315 |
| 642 | Ga0495684_0072454 | 3300047471 | Bacteria | 2617 |
| 643 | Ga0495684_0138444 | 3300047471 | Bacteria | 1826 |
| 644 | Ga0495684_0189276 | 3300047471 | Bacteria | 1522 |
| 645 | Ga0495593_0004861 | 3300047673 | Bacteria | 7977 |
| 646 | Ga0495593_0042986 | 3300047673 | Bacteria | 2424 |
| 647 | Ga0495593_0196450 | 3300047673 | Bacteria | 1014 |
| 648 | Ga0495602_0003177 | 3300048088 | Bacteria | 16945 |
| 649 | Ga0495602_0013811 | 3300048088 | Bacteria | 8233 |
| 650 | Ga0495602_0331312 | 3300048088 | Bacteria | 1104 |
| 651 | Ga0496100_0010412 | 3300048903 | Bacteria | 5262 |
| 652 | Ga0496100_0078590 | 3300048903 | Bacteria | 2221 |
| 653 | Ga0496100_0129972 | 3300048903 | Bacteria | 1773 |
| 654 | Ga0496100_0333718 | 3300048903 | Bacteria | 1142 |
| 655 | Ga0496101_0008779 | 3300048904 | Bacteria | 6614 |
| 656 | Ga0496101_0041856 | 3300048904 | Bacteria | 3268 |
| 657 | Ga0496101_0087556 | 3300048904 | Bacteria | 2312 |
| 658 | Ga0496101_0242304 | 3300048904 | Bacteria | 1403 |
| 659 | Ga0496102_0001614 | 3300048905 | Bacteria | 19876 |
| 660 | Ga0496102_0008838 | 3300048905 | Bacteria | 8642 |
| 661 | Ga0496102_0056757 | 3300048905 | Bacteria | 3573 |
| 662 | Ga0496102_0229644 | 3300048905 | Bacteria | 1750 |
| 663 | Ga0496102_0323270 | 3300048905 | Bacteria | 1453 |
| 664 | Ga0496102_0366851 | 3300048905 | Bacteria | 1355 |
| 665 | Ga0496102_0402479 | 3300048905 | Bacteria | 1287 |
| 666 | Ga0496103_0007504 | 3300048906 | Bacteria | 6498 |
| 667 | Ga0496103_0014831 | 3300048906 | Bacteria | 4633 |
| 668 | Ga0496103_0128878 | 3300048906 | Bacteria | 1615 |
| 669 | Ga0496104_0010849 | 3300048907 | Bacteria | 8147 |
| 670 | Ga0496104_0068414 | 3300048907 | Bacteria | 3375 |
| 671 | Ga0496104_0095059 | 3300048907 | Bacteria | 2851 |
| 672 | Ga0496104_0542616 | 3300048907 | Bacteria | 1074 |
| 673 | Ga0496104_0649258 | 3300048907 | Bacteria | 964 |
| 674 | Ga0496105_0011381 | 3300048908 | Bacteria | 7027 |
| 675 | Ga0496105_0037487 | 3300048908 | Bacteria | 3992 |
| 676 | Ga0496105_0058765 | 3300048908 | Bacteria | 3174 |
| 677 | Ga0496105_0079966 | 3300048908 | Bacteria | 2699 |
| 678 | Ga0496106_0006289 | 3300048909 | Bacteria | 8792 |
| 679 | Ga0496106_0013055 | 3300048909 | Bacteria | 6130 |
| 680 | Ga0496106_0274644 | 3300048909 | Bacteria | 1350 |
| 681 | Ga0496107_0018120 | 3300048910 | Bacteria | 4954 |
| 682 | Ga0496107_0116186 | 3300048910 | Bacteria | 1969 |
| 683 | Ga0496107_0122546 | 3300048910 | Bacteria | 1916 |
| 684 | Ga0496107_0151231 | 3300048910 | Bacteria | 1717 |
| 685 | Ga0496107_0389988 | 3300048910 | Bacteria | 1036 |
| 686 | Ga0496108_0002013 | 3300048911 | Bacteria | 16278 |
| 687 | Ga0496108_0009832 | 3300048911 | Bacteria | 7751 |
| 688 | Ga0496108_0271617 | 3300048911 | Bacteria | 1476 |
| 689 | Ga0496108_0310503 | 3300048911 | Bacteria | 1374 |
| 690 | Ga0496108_0356140 | 3300048911 | Bacteria | 1277 |
| 691 | Ga0496109_0001256 | 3300048912 | Bacteria | 21057 |
| 692 | Ga0496109_0007380 | 3300048912 | Bacteria | 9304 |
| 693 | Ga0496109_0015218 | 3300048912 | Bacteria | 6697 |
| 694 | Ga0496109_0015301 | 3300048912 | Bacteria | 6682 |
| 695 | Ga0496109_0075678 | 3300048912 | Bacteria | 3095 |
| 696 | Ga0496109_0165103 | 3300048912 | Bacteria | 2075 |
| 697 | Ga0496109_0318972 | 3300048912 | Bacteria | 1466 |
| 698 | Ga0496109_0983479 | 3300048912 | Bacteria | 781 |
| 699 | Ga0496110_0002211 | 3300048913 | Bacteria | 14540 |
| 700 | Ga0496110_0092001 | 3300048913 | Bacteria | 2714 |
| 701 | Ga0496110_0159773 | 3300048913 | Bacteria | 2042 |
| 702 | Ga0496110_0407213 | 3300048913 | Bacteria | 1240 |
| 703 | Ga0496111_0112449 | 3300048914 | Bacteria | 2006 |
| 704 | Ga0496111_0137197 | 3300048914 | Bacteria | 1812 |
| 705 | Ga0496111_0385211 | 3300048914 | Bacteria | 1037 |
| 706 | Ga0496112_0027451 | 3300048915 | Bacteria | 5488 |
| 707 | Ga0496112_0083481 | 3300048915 | Bacteria | 3160 |
| 708 | Ga0496112_0571818 | 3300048915 | Bacteria | 1063 |
| 709 | Ga0496112_0588106 | 3300048915 | Bacteria | 1045 |
| 710 | Ga0496113_0205045 | 3300048916 | Bacteria | 1568 |
| 711 | Ga0496113_0242420 | 3300048916 | Bacteria | 1438 |
| 712 | Ga0496113_0255798 | 3300048916 | Bacteria | 1399 |
| 713 | Ga0496113_0290436 | 3300048916 | Bacteria | 1308 |
| 714 | Ga0496113_0339790 | 3300048916 | Bacteria | 1204 |
| 715 | Ga0496114_0020109 | 3300048917 | Bacteria | 5416 |
| 716 | Ga0496114_0035459 | 3300048917 | Bacteria | 4119 |
| 717 | Ga0496114_0057430 | 3300048917 | Bacteria | 3249 |
| 718 | Ga0496114_0088886 | 3300048917 | Bacteria | 2621 |
| 719 | Ga0496114_0095005 | 3300048917 | Bacteria | 2536 |
| 720 | Ga0496114_0163424 | 3300048917 | Bacteria | 1937 |
| 721 | Ga0496115_0014868 | 3300048918 | Bacteria | 5902 |
| 722 | Ga0496115_0021354 | 3300048918 | Bacteria | 5001 |
| 723 | Ga0496115_0036198 | 3300048918 | Bacteria | 3907 |
| 724 | Ga0496115_0090496 | 3300048918 | Bacteria | 2499 |
| 725 | Ga0496115_0095578 | 3300048918 | Bacteria | 2432 |
| 726 | Ga0496115_0115861 | 3300048918 | Bacteria | 2203 |
| 727 | Ga0496117_0055240 | 3300048920 | Bacteria | 2776 |
| 728 | Ga0496118_0007218 | 3300048921 | Bacteria | 11866 |
| 729 | Ga0496118_0199450 | 3300048921 | Bacteria | 1187 |
| 730 | Ga0496119_0003001 | 3300048922 | Bacteria | 17894 |
| 731 | Ga0496119_0055837 | 3300048922 | Bacteria | 2396 |
| 732 | Ga0496119_0142836 | 3300048922 | Bacteria | 1291 |
| 733 | Ga0496120_0019728 | 3300048923 | Bacteria | 4305 |
| 734 | Ga0496121_0003923 | 3300048924 | Bacteria | 20623 |
| 735 | Ga0496121_0037879 | 3300048924 | Bacteria | 4278 |
| 736 | Ga0496121_0071186 | 3300048924 | Bacteria | 2798 |
| 737 | Ga0496121_0354367 | 3300048924 | Bacteria | 976 |
| 738 | Ga0496122_0009222 | 3300048925 | Bacteria | 10443 |
| 739 | Ga0496123_0010117 | 3300048926 | Bacteria | 8386 |
| 740 | Ga0496126_0013859 | 3300048929 | Bacteria | 8178 |
| 741 | Ga0496126_0049478 | 3300048929 | Bacteria | 3837 |
| 742 | Ga0496126_0162176 | 3300048929 | Bacteria | 1909 |
| 743 | Ga0495678_074963 | 3300049459 | Bacteria | 1230 |
| 744 | Ga0501318_022048 | 3300049534 | Bacteria | 814 |
| 745 | Ga0501031_0029186 | 3300049568 | Bacteria | 3598 |
| 746 | Ga0501031_0118600 | 3300049568 | Bacteria | 1729 |
| 747 | Ga0501034_0111028 | 3300049571 | Bacteria | 2732 |
| 748 | Ga0501034_0832773 | 3300049571 | Bacteria | 814 |
| 749 | Ga0501036_0147254 | 3300049572 | Bacteria | 1986 |
| 750 | Ga0501037_0030311 | 3300049573 | Bacteria | 3998 |
| 751 | Ga0501037_0134802 | 3300049573 | Bacteria | 1769 |
| 752 | Ga0501038_0001094 | 3300049574 | Bacteria | 24528 |
| 753 | Ga0501038_0034588 | 3300049574 | Bacteria | 4442 |
| 754 | Ga0501038_0136226 | 3300049574 | Bacteria | 2012 |
| 755 | Ga0501038_0403667 | 3300049574 | Bacteria | 1057 |
| 756 | Ga0501039_0125264 | 3300049575 | Bacteria | 2015 |
| 757 | Ga0501039_0162544 | 3300049575 | Bacteria | 1755 |
| 758 | Ga0501040_0050261 | 3300049576 | Bacteria | 2851 |
| 759 | Ga0501041_0259085 | 3300049577 | Bacteria | 1093 |
| 760 | Ga0501042_0086941 | 3300049578 | Bacteria | 2242 |
| 761 | Ga0501042_0193766 | 3300049578 | Bacteria | 1466 |
| 762 | Ga0501043_0236438 | 3300049579 | Bacteria | 1410 |
| 763 | Ga0501047_0010095 | 3300049581 | Bacteria | 8924 |
| 764 | Ga0501047_0051014 | 3300049581 | Bacteria | 3996 |
| 765 | Ga0501047_0069679 | 3300049581 | Bacteria | 3387 |
| 766 | Ga0501048_0010696 | 3300049582 | Bacteria | 6843 |
| 767 | Ga0501067_0027648 | 3300049583 | Bacteria | 3143 |
| 768 | Ga0501067_0153613 | 3300049583 | Bacteria | 1282 |
| 769 | Ga0501068_0006180 | 3300049584 | Bacteria | 6589 |
| 770 | Ga0501069_0042308 | 3300049585 | Bacteria | 2520 |
| 771 | Ga0501069_0057166 | 3300049585 | Bacteria | 2174 |
| 772 | Ga0501070_0001101 | 3300049586 | Bacteria | 24235 |
| 773 | Ga0501070_0010680 | 3300049586 | Bacteria | 7763 |
| 774 | Ga0501070_0102039 | 3300049586 | Bacteria | 2372 |
| 775 | Ga0501070_0315246 | 3300049586 | Bacteria | 1273 |
| 776 | Ga0501071_0014456 | 3300049587 | Bacteria | 5399 |
| 777 | Ga0501072_0003234 | 3300049588 | Bacteria | 12227 |
| 778 | Ga0501072_0059654 | 3300049588 | Bacteria | 3008 |
| 779 | Ga0501072_0392186 | 3300049588 | Bacteria | 1101 |
| 780 | Ga0501073_0000366 | 3300049589 | Bacteria | 30456 |
| 781 | Ga0501073_0023110 | 3300049589 | Bacteria | 4469 |
| 782 | Ga0501073_0270357 | 3300049589 | Bacteria | 1173 |
| 783 | Ga0501074_0023586 | 3300049590 | Bacteria | 4472 |
| 784 | Ga0501074_0128478 | 3300049590 | Bacteria | 1813 |
| 785 | Ga0501074_0152717 | 3300049590 | Bacteria | 1650 |
| 786 | Ga0501076_0088515 | 3300049592 | Bacteria | 2488 |
| 787 | Ga0501077_0042044 | 3300049593 | Bacteria | 2908 |
| 788 | Ga0501077_0138510 | 3300049593 | Bacteria | 1543 |
| 789 | Ga0501079_0014405 | 3300049741 | Bacteria | 6029 |
| 790 | Ga0501079_0021966 | 3300049741 | Bacteria | 4888 |
| 791 | Ga0501079_0486936 | 3300049741 | Bacteria | 969 |
| 792 | Ga0501080_0068751 | 3300049742 | Bacteria | 3295 |
| 793 | Ga0501080_0129752 | 3300049742 | Bacteria | 2333 |
| 794 | Ga0501080_0476731 | 3300049742 | Bacteria | 1117 |
| 795 | Ga0501080_0739949 | 3300049742 | Bacteria | 865 |
| 796 | Ga0501083_0000047 | 3300049744 | Bacteria | 88014 |
| 797 | Ga0501035_0012980 | 3300049822 | Bacteria | 7687 |
| 798 | Ga0501044_0003649 | 3300049823 | Bacteria | 17329 |
| 799 | Ga0501044_0318532 | 3300049823 | Bacteria | 1480 |
| 800 | Ga0501045_0014518 | 3300049824 | Bacteria | 5583 |
| 801 | nmdc:mga03n38_45561_c1 | 3300050490 | Bacteria | 1932 |
| 802 | nmdc:mga00v17_121235_c1 | 3300050491 | Bacteria | 1665 |
| 803 | nmdc:mga00v17_234983_c1 | 3300050491 | Bacteria | 1188 |
| 804 | nmdc:mga00v17_442_c1 | 3300050491 | Bacteria | 23249 |
| 805 | nmdc:mga0yw44_1010_c1 | 3300050492 | Bacteria | 10760 |
| 806 | nmdc:mga0yw44_1818_c1 | 3300050492 | Bacteria | 8736 |
| 807 | nmdc:mga0yw44_776_c1 | 3300050492 | Bacteria | 11836 |
| 808 | nmdc:mga07m45_532728_c1 | 3300050496 | Bacteria | 679 |
| 809 | nmdc:mga05p37_13198_c1 | 3300050507 | Bacteria | 9889 |
| 810 | nmdc:mga05p37_156681_c1 | 3300050507 | Bacteria | 2783 |
| 811 | nmdc:mga05p37_206463_c1 | 3300050507 | Bacteria | 2376 |
| 812 | nmdc:mga05p37_42240_c1 | 3300050507 | Bacteria | 5602 |
| 813 | nmdc:mga05p37_73400_c1 | 3300050507 | Bacteria | 4211 |
| 814 | nmdc:mga05p37_94528_c1 | 3300050507 | Bacteria | 3683 |
| 815 | nmdc:mga09592_13361_c1 | 3300050508 | Bacteria | 6705 |
| 816 | nmdc:mga09592_142748_c1 | 3300050508 | Bacteria | 2064 |
| 817 | nmdc:mga09592_200618_c1 | 3300050508 | Bacteria | 1727 |
| 818 | nmdc:mga09592_420440_c1 | 3300050508 | Bacteria | 1154 |
| 819 | nmdc:mga09592_94655_c1 | 3300050508 | Bacteria | 2555 |
| 820 | nmdc:mga0qj67_125092_c1 | 3300050509 | Bacteria | 2081 |
| 821 | nmdc:mga0qj67_15780_c1 | 3300050509 | Bacteria | 5721 |
| 822 | nmdc:mga0qj67_42057_c1 | 3300050509 | Bacteria | 3597 |
| 823 | nmdc:mga0qj67_48_c1 | 3300050509 | Bacteria | 85487 |
| 824 | nmdc:mga0qj67_5437_c1 | 3300050509 | Bacteria | 9304 |
| 825 | nmdc:mga06r32_28049_c1 | 3300050510 | Bacteria | 5266 |
| 826 | nmdc:mga06r32_80315_c1 | 3300050510 | Bacteria | 3174 |
| 827 | nmdc:mga06r32_97248_c1 | 3300050510 | Bacteria | 2885 |
| 828 | nmdc:mga08y16_83954_c1 | 3300050511 | Bacteria | 3320 |
| 829 | nmdc:mga0n895_19256_c1 | 3300050512 | Bacteria | 6340 |
| 830 | nmdc:mga0n895_222547_c1 | 3300050512 | Bacteria | 1916 |
| 831 | nmdc:mga0rr50_53114_c1 | 3300050513 | Bacteria | 3014 |
| 832 | nmdc:mga08x19_267599_c1 | 3300050514 | Bacteria | 1182 |
| 833 | nmdc:mga0a205_7200_c1 | 3300050515 | Bacteria | 10059 |
| 834 | nmdc:mga0sz30_100178_c1 | 3300050516 | Bacteria | 1265 |
| 835 | nmdc:mga0sz30_11757_c1 | 3300050516 | Bacteria | 1756 |
| 836 | Ga0495601_0069562 | 3300053077 | Bacteria | 2245 |
| 837 | Ga0495601_0235849 | 3300053077 | Bacteria | 1194 |
| 838 | Ga0495612_0000458 | 3300053078 | Bacteria | 16364 |
| 839 | Ga0500635_0000016 | 3300053080 | Bacteria | 124879 |
| 840 | Ga0495655_0013272 | 3300053083 | Bacteria | 1701 |
| 841 | Ga0495595_0132960 | 3300053084 | Bacteria | 1217 |
| 842 | Ga0495619_0033270 | 3300053085 | Bacteria | 3348 |
| 843 | Ga0495619_0101961 | 3300053085 | Bacteria | 1954 |
| 844 | Ga0495619_0195095 | 3300053085 | Bacteria | 1402 |
| 845 | Ga0500644_0002440 | 3300053088 | Bacteria | 4648 |
| 846 | Ga0500651_0056049 | 3300053093 | Bacteria | 2468 |
| 847 | Ga0500566_0000140 | 3300053094 | Bacteria | 37236 |
| 848 | Ga0500650_0025374 | 3300053098 | Bacteria | 2650 |
| 849 | Ga0500660_056583 | 3300053100 | Bacteria | 1911 |
| 850 | Ga0500556_0000204 | 3300053104 | Bacteria | 48558 |
| 851 | Ga0500556_0000768 | 3300053104 | Bacteria | 19015 |
| 852 | Ga0500562_000448 | 3300053108 | Bacteria | 10042 |
| 853 | Ga0500593_004594 | 3300053117 | Bacteria | 5369 |
| 854 | Ga0500652_041423 | 3300053131 | Bacteria | 1854 |
| 855 | Ga0500559_0000317 | 3300053136 | Bacteria | 36554 |
| 856 | Ga0500568_0000327 | 3300053139 | Bacteria | 37336 |
| 857 | Ga0500568_0025483 | 3300053139 | Bacteria | 2495 |
| 858 | Ga0500577_0027678 | 3300053142 | Bacteria | 1944 |
| 859 | Ga0500616_0000071 | 3300053153 | Bacteria | 232527 |
| 860 | Ga0500633_0037035 | 3300053160 | Bacteria | 1617 |
| 861 | Ga0501084_0004047 | 3300054114 | Bacteria | 11943 |
| 862 | Ga0501084_0115406 | 3300054114 | Bacteria | 2257 |
| 863 | Ga0501082_0073572 | 3300060353 | Bacteria | 2943 |
| 864 | Ga0501082_0402229 | 3300060353 | Bacteria | 1195 |
| 865 | Ga0530510_0103150 | 3300061734 | Bacteria | 2086 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046471 | Ga0495650_0152817 | Ga0495650_0152817_12_626 | 179 |
| 2 | 3300044706 | Ga0466964_0368414 | Ga0466964_0368414_67_720 | 182 |
| 3 | 3300005471 | Ga0070698_100037624 | Ga0070698_1000376245 | 188 |
| 4 | 3300050496 | nmdc:mga07m45_532728_c1 | nmdc:mga07m45_532728_c1_13_666 | 192 |
| 5 | 3300046517 | Ga0495630_0318102 | Ga0495630_0318102_518_1180 | 195 |
| 6 | 3300049741 | Ga0501079_0486936 | Ga0501079_0486936_278_943 | 195 |
| 7 | 3300037418 | Ga0395900_0985284 | Ga0395900_0985284_88_753 | 196 |
| 8 | 3300037466 | Ga0395898_1081321 | Ga0395898_1081321_11_676 | 196 |
| 9 | 3300046558 | Ga0495633_0278735 | Ga0495633_0278735_24_695 | 196 |
| 10 | 3300049742 | Ga0501080_0068751 | Ga0501080_0068751_552_1217 | 196 |
| 11 | 3300053077 | Ga0495601_0069562 | Ga0495601_0069562_51_812 | 201 |
| 12 | 3300047317 | Ga0495604_0196340 | Ga0495604_0196340_667_1350 | 202 |
| 13 | 3300005539 | Ga0068853_100248732 | Ga0068853_1002487322 | 203 |
| 14 | 3300005548 | Ga0070665_100000001 | Ga0070665_100000001301 | 205 |
| 15 | 3300028379 | Ga0268266_10000102 | Ga0268266_1000010265 | 205 |
| 16 | 3300044842 | Ga0466957_0604073 | Ga0466957_0604073_55_747 | 205 |
| 17 | 3300046533 | Ga0495640_0054437 | Ga0495640_0054437_34_726 | 205 |
| 18 | 3300046675 | Ga0495657_0037941 | Ga0495657_0037941_45_737 | 205 |
| 19 | 3300047319 | Ga0495674_0539667 | Ga0495674_0539667_56_748 | 205 |
| 20 | 3300047443 | Ga0495687_145820 | Ga0495687_145820_68_760 | 205 |
| 21 | 3300049581 | Ga0501047_0051014 | Ga0501047_0051014_1768_2460 | 205 |
| 22 | 3300009011 | Ga0105251_10132951 | Ga0105251_101329511 | 206 |
| 23 | 3300048922 | Ga0496119_0003001 | Ga0496119_0003001_10873_11646 | 206 |
| 24 | 3300048923 | Ga0496120_0019728 | Ga0496120_0019728_2182_2955 | 206 |
| 25 | 3300048920 | Ga0496117_0055240 | Ga0496117_0055240_847_1617 | 207 |
| 26 | 3300009545 | Ga0105237_10637934 | Ga0105237_106379342 | 208 |
| 27 | 3300013306 | Ga0163162_10830894 | Ga0163162_108308941 | 208 |
| 28 | 3300013308 | Ga0157375_10042755 | Ga0157375_100427551 | 208 |
| 29 | 3300017792 | Ga0163161_10122253 | Ga0163161_101222533 | 208 |
| 30 | 3300031731 | Ga0307405_10036526 | Ga0307405_100365263 | 208 |
| 31 | 3300047320 | Ga0495672_0008252 | Ga0495672_0008252_2094_2855 | 208 |
| 32 | 3300048904 | Ga0496101_0242304 | Ga0496101_0242304_445_1206 | 208 |
| 33 | 3300048909 | Ga0496106_0006289 | Ga0496106_0006289_6766_7527 | 208 |
| 34 | 3300048909 | Ga0496106_0274644 | Ga0496106_0274644_295_1056 | 208 |
| 35 | 3300048910 | Ga0496107_0018120 | Ga0496107_0018120_2424_3185 | 208 |
| 36 | 3300048911 | Ga0496108_0310503 | Ga0496108_0310503_596_1357 | 208 |
| 37 | 3300048912 | Ga0496109_0983479 | Ga0496109_0983479_16_717 | 208 |
| 38 | 3300048915 | Ga0496112_0588106 | Ga0496112_0588106_218_979 | 208 |
| 39 | 3300048916 | Ga0496113_0255798 | Ga0496113_0255798_209_970 | 208 |
| 40 | 3300048918 | Ga0496115_0036198 | Ga0496115_0036198_2964_3725 | 208 |
| 41 | 3300049534 | Ga0501318_022048 | Ga0501318_022048_90_791 | 208 |
| 42 | 3300049590 | Ga0501074_0023586 | Ga0501074_0023586_3725_4426 | 208 |
| 43 | 3300050490 | nmdc:mga03n38_45561_c1 | nmdc:mga03n38_45561_c1_1204_1905 | 208 |
| 44 | 3300048905 | Ga0496102_0366851 | Ga0496102_0366851_583_1308 | 209 |
| 45 | 3300009545 | Ga0105237_10431060 | Ga0105237_104310602 | 210 |
| 46 | 3300032126 | Ga0307415_100058923 | Ga0307415_1000589234 | 210 |
| 47 | 3300048912 | Ga0496109_0001256 | Ga0496109_0001256_9223_9984 | 210 |
| 48 | 3300048924 | Ga0496121_0037879 | Ga0496121_0037879_2540_3313 | 210 |
| 49 | 3300009551 | Ga0105238_10113875 | Ga0105238_101138752 | 211 |
| 50 | 3300031616 | Ga0307508_10181359 | Ga0307508_101813593 | 211 |
| 51 | 3300033179 | Ga0307507_10265178 | Ga0307507_102651781 | 211 |
| 52 | 3300044658 | Ga0466972_0022532 | Ga0466972_0022532_2222_2980 | 211 |
| 53 | 3300044765 | Ga0466970_0097927 | Ga0466970_0097927_63_821 | 211 |
| 54 | 3300049741 | Ga0501079_0021966 | Ga0501079_0021966_1986_2699 | 211 |
| 55 | 3300001989 | JGI24739J22299_10085499 | JGI24739J22299_100854992 | 212 |
| 56 | 3300002067 | JGI24735J21928_10032757 | JGI24735J21928_100327572 | 212 |
| 57 | 3300003320 | rootH2_10175217 | rootH2_101752174 | 212 |
| 58 | 3300003322 | rootL2_10077234 | rootL2_100772346 | 212 |
| 59 | 3300003322 | rootL2_10271871 | rootL2_102718712 | 212 |
| 60 | 3300003323 | rootH1_10192662 | rootH1_101926622 | 212 |
| 61 | 3300003578 | Ga0006562J51391_1095727 | Ga0006562J51391_10957274 | 212 |
| 62 | 3300003578 | Ga0006562J51391_1095728 | Ga0006562J51391_10957282 | 212 |
| 63 | 3300005435 | Ga0070714_100290659 | Ga0070714_1002906592 | 212 |
| 64 | 3300009545 | Ga0105237_10367179 | Ga0105237_103671792 | 212 |
| 65 | 3300009553 | Ga0105249_10873759 | Ga0105249_108737592 | 212 |
| 66 | 3300025904 | Ga0207647_10072786 | Ga0207647_100727863 | 212 |
| 67 | 3300025929 | Ga0207664_10382299 | Ga0207664_103822992 | 212 |
| 68 | 3300037418 | Ga0395900_0003464 | Ga0395900_0003464_10688_11464 | 212 |
| 69 | 3300037466 | Ga0395898_0000015 | Ga0395898_0000015_315262_316038 | 212 |
| 70 | 3300046463 | Ga0495653_0018240 | Ga0495653_0018240_4584_5345 | 212 |
| 71 | 3300046689 | Ga0495613_0159448 | Ga0495613_0159448_488_1249 | 212 |
| 72 | 3300060353 | Ga0501082_0402229 | Ga0501082_0402229_54_815 | 212 |
| 73 | 3300003203 | JGI25406J46586_10008542 | JGI25406J46586_100085423 | 213 |
| 74 | 3300005985 | Ga0081539_10054051 | Ga0081539_100540512 | 213 |
| 75 | 3300041512 | Ga0451853_0632895 | Ga0451853_0632895_373_1134 | 213 |
| 76 | 3300044658 | Ga0466972_0092777 | Ga0466972_0092777_362_1144 | 213 |
| 77 | 3300044901 | Ga0466960_0003842 | Ga0466960_0003842_2442_3224 | 213 |
| 78 | 3300045976 | Ga0466967_0282974 | Ga0466967_0282974_327_1088 | 213 |
| 79 | 3300049578 | Ga0501042_0193766 | Ga0501042_0193766_174_935 | 213 |
| 80 | 3300003578 | Ga0006562J51391_1096029 | Ga0006562J51391_10960293 | 214 |
| 81 | 3300003578 | Ga0006562J51391_1096030 | Ga0006562J51391_10960303 | 214 |
| 82 | 3300002739 | JGI25158J39367_1012116 | JGI25158J39367_10121161 | 215 |
| 83 | 3300009093 | Ga0105240_10484420 | Ga0105240_104844201 | 215 |
| 84 | 3300009147 | Ga0114129_10088561 | Ga0114129_100885615 | 215 |
| 85 | 3300013105 | Ga0157369_10593704 | Ga0157369_105937042 | 215 |
| 86 | 3300014497 | Ga0182008_10000001 | Ga0182008_1000000156 | 215 |
| 87 | 3300025208 | Ga0209436_100233 | Ga0209436_10023314 | 215 |
| 88 | 3300025284 | Ga0209130_1002047 | Ga0209130_10020473 | 215 |
| 89 | 3300025302 | Ga0207426_1000539 | Ga0207426_100053910 | 215 |
| 90 | 3300025900 | Ga0207710_10158591 | Ga0207710_101585912 | 215 |
| 91 | 3300032126 | Ga0307415_100230987 | Ga0307415_1002309872 | 215 |
| 92 | 3300039437 | Ga0436365_1565935 | Ga0436365_1565935_461_1219 | 215 |
| 93 | 3300042876 | Ga0451577_0100538 | Ga0451577_0100538_1406_2176 | 215 |
| 94 | 3300044673 | Ga0453683_0046533 | Ga0453683_0046533_1418_2188 | 215 |
| 95 | 3300045051 | Ga0451576_0000188 | Ga0451576_0000188_59546_60316 | 215 |
| 96 | 3300050507 | nmdc:mga05p37_73400_c1 | nmdc:mga05p37_73400_c1_2706_3476 | 215 |
| 97 | 3300005985 | Ga0081539_10004561 | Ga0081539_1000456110 | 216 |
| 98 | 3300049581 | Ga0501047_0069679 | Ga0501047_0069679_2476_3237 | 216 |
| 99 | 3300003760 | Ga0055527_1000001 | Ga0055527_1000001748 | 217 |
| 100 | 3300003763 | Ga0055529_1000019 | Ga0055529_1000019254 | 217 |
| 101 | 3300005535 | Ga0070684_100361616 | Ga0070684_1003616162 | 217 |
| 102 | 3300005937 | Ga0081455_10025093 | Ga0081455_100250933 | 217 |
| 103 | 3300006844 | Ga0075428_100220034 | Ga0075428_1002200342 | 217 |
| 104 | 3300006847 | Ga0075431_100021347 | Ga0075431_1000213472 | 217 |
| 105 | 3300025228 | Ga0209672_100006 | Ga0209672_100006227 | 217 |
| 106 | 3300025229 | Ga0209147_100677 | Ga0209147_10067720 | 217 |
| 107 | 3300025254 | Ga0209148_1000015 | Ga0209148_100001571 | 217 |
| 108 | 3300025272 | Ga0209455_1000013 | Ga0209455_100001371 | 217 |
| 109 | 3300049586 | Ga0501070_0001101 | Ga0501070_0001101_4600_5376 | 217 |
| 110 | 3300050509 | nmdc:mga0qj67_125092_c1 | nmdc:mga0qj67_125092_c1_675_1436 | 217 |
| 111 | 3300005616 | Ga0068852_100636402 | Ga0068852_1006364022 | 218 |
| 112 | 3300025904 | Ga0207647_10163243 | Ga0207647_101632432 | 218 |
| 113 | 3300025910 | Ga0207684_10319441 | Ga0207684_103194411 | 218 |
| 114 | 3300048904 | Ga0496101_0041856 | Ga0496101_0041856_2105_2881 | 218 |
| 115 | 3300048905 | Ga0496102_0323270 | Ga0496102_0323270_277_1053 | 218 |
| 116 | 3300048906 | Ga0496103_0014831 | Ga0496103_0014831_3624_4400 | 218 |
| 117 | 3300048907 | Ga0496104_0095059 | Ga0496104_0095059_2041_2817 | 218 |
| 118 | 3300048908 | Ga0496105_0058765 | Ga0496105_0058765_2344_3120 | 218 |
| 119 | 3300048918 | Ga0496115_0090496 | Ga0496115_0090496_523_1299 | 218 |
| 120 | 3300048921 | Ga0496118_0199450 | Ga0496118_0199450_273_1049 | 218 |
| 121 | 3300048922 | Ga0496119_0055837 | Ga0496119_0055837_1383_2159 | 218 |
| 122 | 3300048924 | Ga0496121_0354367 | Ga0496121_0354367_33_809 | 218 |
| 123 | 3300048929 | Ga0496126_0162176 | Ga0496126_0162176_928_1704 | 218 |
| 124 | 3300053083 | Ga0495655_0013272 | Ga0495655_0013272_871_1632 | 218 |
| 125 | 3300006846 | Ga0075430_100067055 | Ga0075430_1000670553 | 219 |
| 126 | 3300006847 | Ga0075431_100070873 | Ga0075431_1000708734 | 219 |
| 127 | 3300006871 | Ga0075434_100013750 | Ga0075434_1000137506 | 219 |
| 128 | 3300006880 | Ga0075429_100105764 | Ga0075429_1001057643 | 219 |
| 129 | 3300027907 | Ga0207428_10007572 | Ga0207428_100075723 | 219 |
| 130 | 3300050507 | nmdc:mga05p37_42240_c1 | nmdc:mga05p37_42240_c1_2503_3270 | 219 |
| 131 | 3300050508 | nmdc:mga09592_94655_c1 | nmdc:mga09592_94655_c1_981_1748 | 219 |
| 132 | 3300050509 | nmdc:mga0qj67_15780_c1 | nmdc:mga0qj67_15780_c1_3056_3823 | 219 |
| 133 | 3300050510 | nmdc:mga06r32_80315_c1 | nmdc:mga06r32_80315_c1_1001_1768 | 219 |
| 134 | 3300050512 | nmdc:mga0n895_222547_c1 | nmdc:mga0n895_222547_c1_120_881 | 219 |
| 135 | 3300053104 | Ga0500556_0000204 | Ga0500556_0000204_47746_48519 | 219 |
| 136 | 3300053117 | Ga0500593_004594 | Ga0500593_004594_63_836 | 219 |
| 137 | 3300017792 | Ga0163161_10252190 | Ga0163161_102521903 | 220 |
| 138 | 3300048917 | Ga0496114_0057430 | Ga0496114_0057430_1105_1869 | 220 |
| 139 | 3300009098 | Ga0105245_10042613 | Ga0105245_100426135 | 221 |
| 140 | 3300009148 | Ga0105243_10886801 | Ga0105243_108868011 | 221 |
| 141 | 3300021388 | Ga0213875_10000220 | Ga0213875_1000022048 | 221 |
| 142 | 3300037853 | Ga0436364_0501302 | Ga0436364_0501302_79841_80608 | 221 |
| 143 | 3300048905 | Ga0496102_0229644 | Ga0496102_0229644_69_830 | 221 |
| 144 | 3300048910 | Ga0496107_0116186 | Ga0496107_0116186_927_1688 | 221 |
| 145 | 3300048910 | Ga0496107_0151231 | Ga0496107_0151231_241_1002 | 221 |
| 146 | 3300048913 | Ga0496110_0159773 | Ga0496110_0159773_882_1643 | 221 |
| 147 | 3300048915 | Ga0496112_0027451 | Ga0496112_0027451_340_1101 | 221 |
| 148 | 3300048917 | Ga0496114_0020109 | Ga0496114_0020109_767_1528 | 221 |
| 149 | 3300049588 | Ga0501072_0003234 | Ga0501072_0003234_5644_6315 | 221 |
| 150 | 3300030521 | Ga0307511_10080776 | Ga0307511_100807764 | 222 |
| 151 | 3300049571 | Ga0501034_0832773 | Ga0501034_0832773_35_799 | 222 |
| 152 | 3300053085 | Ga0495619_0195095 | Ga0495619_0195095_363_1124 | 222 |
| 153 | 3300053142 | Ga0500577_0027678 | Ga0500577_0027678_82_843 | 222 |
| 154 | 3300053160 | Ga0500633_0037035 | Ga0500633_0037035_735_1529 | 222 |
| 155 | iso_pu_bacteria | 2906799679 | 2906801114 | 222 |
| 156 | 3300013307 | Ga0157372_10437843 | Ga0157372_104378433 | 223 |
| 157 | 3300013308 | Ga0157375_11166980 | Ga0157375_111669801 | 223 |
| 158 | 3300031911 | Ga0307412_10673254 | Ga0307412_106732542 | 223 |
| 159 | 3300048903 | Ga0496100_0010412 | Ga0496100_0010412_4305_5066 | 223 |
| 160 | 3300048905 | Ga0496102_0008838 | Ga0496102_0008838_4063_4824 | 223 |
| 161 | 3300048906 | Ga0496103_0128878 | Ga0496103_0128878_506_1267 | 223 |
| 162 | 3300048909 | Ga0496106_0013055 | Ga0496106_0013055_2274_3035 | 223 |
| 163 | 3300048917 | Ga0496114_0035459 | Ga0496114_0035459_2976_3737 | 223 |
| 164 | 3300048918 | Ga0496115_0014868 | Ga0496115_0014868_2429_3190 | 223 |
| 165 | iso_pu_bacteria | 2818991460 | 2819678606 | 223 |
| 166 | iso_pu_bacteria | 2837268691 | 2837273542 | 223 |
| 167 | 3300006038 | Ga0075365_10039746 | Ga0075365_100397464 | 224 |
| 168 | 3300050491 | nmdc:mga00v17_121235_c1 | nmdc:mga00v17_121235_c1_757_1530 | 224 |
| 169 | 3300050492 | nmdc:mga0yw44_1818_c1 | nmdc:mga0yw44_1818_c1_2393_3166 | 224 |
| 170 | 3300053136 | Ga0500559_0000317 | Ga0500559_0000317_17167_17940 | 224 |
| 171 | iso_pu_bacteria | 2616644814 | 2616702826 | 224 |
| 172 | iso_pu_bacteria | 2643221617 | 2644101197 | 224 |
| 173 | iso_pu_bacteria | 2643221620 | 2644119397 | 224 |
| 174 | iso_pu_bacteria | 2773857762 | 2774397026 | 224 |
| 175 | iso_pu_bacteria | 2808606439 | 2809198674 | 224 |
| 176 | iso_pu_bacteria | 2811994878 | 2812352753 | 224 |
| 177 | iso_pu_bacteria | 2852632344 | 2852635320 | 224 |
| 178 | iso_pu_bacteria | 2870721527 | 2870727061 | 224 |
| 179 | iso_pu_bacteria | 2891968417 | 2891969706 | 224 |
| 180 | iso_pu_bacteria | 2929219909 | 2929224359 | 224 |
| 181 | iso_pu_bacteria | 2946003308 | 2946006216 | 224 |
| 182 | iso_pu_bacteria | 8048406513 | 8048413723 | 224 |
| 183 | iso_pu_bacteria | 8056579771 | 8056581920 | 224 |
| 184 | 3300005563 | Ga0068855_100581140 | Ga0068855_1005811402 | 225 |
| 185 | 3300005577 | Ga0068857_100236890 | Ga0068857_1002368902 | 225 |
| 186 | 3300005843 | Ga0068860_100021498 | Ga0068860_1000214986 | 225 |
| 187 | 3300013307 | Ga0157372_10561414 | Ga0157372_105614142 | 225 |
| 188 | 3300025940 | Ga0207691_10144008 | Ga0207691_101440082 | 225 |
| 189 | 3300026116 | Ga0207674_10370711 | Ga0207674_103707112 | 225 |
| 190 | 3300028381 | Ga0268264_10015344 | Ga0268264_100153443 | 225 |
| 191 | 3300031852 | Ga0307410_10231779 | Ga0307410_102317792 | 225 |
| 192 | 3300033179 | Ga0307507_10104699 | Ga0307507_101046993 | 225 |
| 193 | 3300037853 | Ga0436364_0361998 | Ga0436364_0361998_407_1168 | 225 |
| 194 | 3300038443 | Ga0395901_0352598 | Ga0395901_0352598_242_1000 | 225 |
| 195 | 3300042876 | Ga0451577_0068052 | Ga0451577_0068052_320_1084 | 225 |
| 196 | 3300044712 | Ga0453684_0000007 | Ga0453684_0000007_257768_258532 | 225 |
| 197 | 3300048921 | Ga0496118_0007218 | Ga0496118_0007218_10302_11081 | 225 |
| 198 | 3300049459 | Ga0495678_074963 | Ga0495678_074963_133_900 | 225 |
| 199 | iso_pu_bacteria | 2501939600 | 2501943152 | 225 |
| 200 | iso_pu_bacteria | 2643221619 | 2644111505 | 225 |
| 201 | iso_pu_bacteria | 2643221632 | 2644183771 | 225 |
| 202 | iso_pu_bacteria | 2721755702 | 2723643464 | 225 |
| 203 | iso_pu_bacteria | 2738541305 | 2738868875 | 225 |
| 204 | iso_pu_bacteria | 2738543034 | 2739363590 | 225 |
| 205 | iso_pu_bacteria | 2739367654 | 2739605536 | 225 |
| 206 | iso_pu_bacteria | 2773857763 | 2774399657 | 225 |
| 207 | iso_pu_bacteria | 2808606372 | 2808899981 | 225 |
| 208 | iso_pu_bacteria | 2808606394 | 2809028774 | 225 |
| 209 | iso_pu_bacteria | 2839986021 | 2839987289 | 225 |
| 210 | iso_pu_bacteria | 2844841374 | 2844843111 | 225 |
| 211 | iso_pu_bacteria | 2852646457 | 2852648493 | 225 |
| 212 | iso_pu_bacteria | 2856858025 | 2856859704 | 225 |
| 213 | iso_pu_bacteria | 2919055335 | 2919058623 | 225 |
| 214 | iso_pu_bacteria | 2919059106 | 2919060976 | 225 |
| 215 | iso_pu_bacteria | 2919443155 | 2919444716 | 225 |
| 216 | iso_pu_bacteria | 2928153084 | 2928153273 | 225 |
| 217 | iso_pu_bacteria | 2935409751 | 2935411748 | 225 |
| 218 | iso_pu_bacteria | 2939657138 | 2939657979 | 225 |
| 219 | iso_pu_bacteria | 2945941187 | 2945943428 | 225 |
| 220 | iso_pu_bacteria | 2953998280 | 2953998834 | 225 |
| 221 | iso_pu_bacteria | 649633069 | 649810194 | 225 |
| 222 | iso_pu_bacteria | 8045830549 | 8045831460 | 225 |
| 223 | iso_pu_bacteria | 8055037949 | 8055038443 | 225 |
| 224 | 3300005347 | Ga0070668_100302545 | Ga0070668_1003025452 | 226 |
| 225 | 3300005614 | Ga0068856_100071837 | Ga0068856_1000718373 | 226 |
| 226 | 3300009148 | Ga0105243_10123441 | Ga0105243_101234411 | 226 |
| 227 | 3300009177 | Ga0105248_10516539 | Ga0105248_105165392 | 226 |
| 228 | 3300010375 | Ga0105239_10042641 | Ga0105239_100426412 | 226 |
| 229 | 3300013296 | Ga0157374_10000003 | Ga0157374_10000003319 | 226 |
| 230 | 3300013297 | Ga0157378_10207220 | Ga0157378_102072202 | 226 |
| 231 | 3300013306 | Ga0163162_10001277 | Ga0163162_100012772 | 226 |
| 232 | 3300013308 | Ga0157375_10594215 | Ga0157375_105942152 | 226 |
| 233 | 3300014745 | Ga0157377_10206578 | Ga0157377_102065782 | 226 |
| 234 | 3300017792 | Ga0163161_10098660 | Ga0163161_100986602 | 226 |
| 235 | 3300025904 | Ga0207647_10216658 | Ga0207647_102166581 | 226 |
| 236 | 3300025941 | Ga0207711_10253779 | Ga0207711_102537791 | 226 |
| 237 | 3300025972 | Ga0207668_10692455 | Ga0207668_106924551 | 226 |
| 238 | 3300026078 | Ga0207702_10052785 | Ga0207702_100527853 | 226 |
| 239 | 3300028666 | Ga0265336_10002352 | Ga0265336_100023525 | 226 |
| 240 | 3300028800 | Ga0265338_10002819 | Ga0265338_100028199 | 226 |
| 241 | 3300033180 | Ga0307510_10001560 | Ga0307510_1000156012 | 226 |
| 242 | 3300039453 | Ga0436362_1141557 | Ga0436362_1141557_176_937 | 226 |
| 243 | 3300046463 | Ga0495653_0118280 | Ga0495653_0118280_115_876 | 226 |
| 244 | 3300048904 | Ga0496101_0087556 | Ga0496101_0087556_610_1371 | 226 |
| 245 | 3300048912 | Ga0496109_0015218 | Ga0496109_0015218_3220_3981 | 226 |
| 246 | 3300048915 | Ga0496112_0571818 | Ga0496112_0571818_71_835 | 226 |
| 247 | 3300005354 | Ga0070675_100171344 | Ga0070675_1001713442 | 227 |
| 248 | 3300005356 | Ga0070674_100023271 | Ga0070674_1000232716 | 227 |
| 249 | 3300005366 | Ga0070659_100305275 | Ga0070659_1003052752 | 227 |
| 250 | 3300005434 | Ga0070709_10153556 | Ga0070709_101535561 | 227 |
| 251 | 3300005434 | Ga0070709_10614000 | Ga0070709_106140001 | 227 |
| 252 | 3300005435 | Ga0070714_100087980 | Ga0070714_1000879804 | 227 |
| 253 | 3300005435 | Ga0070714_100125574 | Ga0070714_1001255742 | 227 |
| 254 | 3300005436 | Ga0070713_100909786 | Ga0070713_1009097861 | 227 |
| 255 | 3300005437 | Ga0070710_10229399 | Ga0070710_102293991 | 227 |
| 256 | 3300005439 | Ga0070711_100440035 | Ga0070711_1004400352 | 227 |
| 257 | 3300005981 | Ga0081538_10004076 | Ga0081538_100040765 | 227 |
| 258 | 3300006178 | Ga0075367_10019889 | Ga0075367_100198896 | 227 |
| 259 | 3300006195 | Ga0075366_10112694 | Ga0075366_101126942 | 227 |
| 260 | 3300006844 | Ga0075428_100160108 | Ga0075428_1001601082 | 227 |
| 261 | 3300006846 | Ga0075430_100052817 | Ga0075430_1000528174 | 227 |
| 262 | 3300006847 | Ga0075431_100057283 | Ga0075431_1000572833 | 227 |
| 263 | 3300006880 | Ga0075429_100255353 | Ga0075429_1002553532 | 227 |
| 264 | 3300009147 | Ga0114129_10014539 | Ga0114129_100145394 | 227 |
| 265 | 3300009545 | Ga0105237_11075278 | Ga0105237_110752781 | 227 |
| 266 | 3300010375 | Ga0105239_10246387 | Ga0105239_102463873 | 227 |
| 267 | 3300013308 | Ga0157375_10807836 | Ga0157375_108078361 | 227 |
| 268 | 3300025253 | Ga0209677_101239 | Ga0209677_1012399 | 227 |
| 269 | 3300025906 | Ga0207699_10156208 | Ga0207699_101562081 | 227 |
| 270 | 3300025916 | Ga0207663_10423650 | Ga0207663_104236501 | 227 |
| 271 | 3300025926 | Ga0207659_10447535 | Ga0207659_104475352 | 227 |
| 272 | 3300025929 | Ga0207664_10022882 | Ga0207664_100228822 | 227 |
| 273 | 3300025929 | Ga0207664_10168738 | Ga0207664_101687382 | 227 |
| 274 | 3300025932 | Ga0207690_10286122 | Ga0207690_102861222 | 227 |
| 275 | 3300025937 | Ga0207669_10043606 | Ga0207669_100436061 | 227 |
| 276 | 3300035083 | Ga0373926_0016809 | Ga0373926_0016809_986_1744 | 227 |
| 277 | 3300035086 | Ga0373934_0130488 | Ga0373934_0130488_124_882 | 227 |
| 278 | 3300035089 | Ga0373944_0008359 | Ga0373944_0008359_1222_1980 | 227 |
| 279 | 3300035113 | Ga0373936_0008251 | Ga0373936_0008251_2252_3010 | 227 |
| 280 | 3300035116 | Ga0373945_0001638 | Ga0373945_0001638_5670_6428 | 227 |
| 281 | 3300035117 | Ga0373953_0105577 | Ga0373953_0105577_115_873 | 227 |
| 282 | 3300035170 | Ga0373943_0000237 | Ga0373943_0000237_946_1704 | 227 |
| 283 | 3300035171 | Ga0373946_0000406 | Ga0373946_0000406_10339_11097 | 227 |
| 284 | 3300035410 | Ga0373924_0002210 | Ga0373924_0002210_3619_4377 | 227 |
| 285 | 3300035692 | Ga0373935_0016330 | Ga0373935_0016330_685_1443 | 227 |
| 286 | 3300035692 | Ga0373935_0070001 | Ga0373935_0070001_1378_2136 | 227 |
| 287 | 3300035695 | Ga0373927_0027168 | Ga0373927_0027168_2004_2762 | 227 |
| 288 | 3300035725 | Ga0373947_0080988 | Ga0373947_0080988_685_1443 | 227 |
| 289 | 3300037068 | Ga0373925_0001410 | Ga0373925_0001410_3307_4068 | 227 |
| 290 | 3300037068 | Ga0373925_0117552 | Ga0373925_0117552_864_1622 | 227 |
| 291 | 3300042005 | Ga0439448_0078105 | Ga0439448_0078105_318_1085 | 227 |
| 292 | 3300042008 | Ga0439450_014163 | Ga0439450_014163_384_1151 | 227 |
| 293 | 3300042011 | Ga0439454_008528 | Ga0439454_008528_205_972 | 227 |
| 294 | 3300042993 | Ga0439440_0031880 | Ga0439440_0031880_273_1040 | 227 |
| 295 | 3300044683 | Ga0466965_0012050 | Ga0466965_0012050_1317_2078 | 227 |
| 296 | 3300045976 | Ga0466967_0024099 | Ga0466967_0024099_3126_3890 | 227 |
| 297 | 3300046454 | Ga0495592_0152527 | Ga0495592_0152527_238_996 | 227 |
| 298 | 3300046461 | Ga0495641_0019160 | Ga0495641_0019160_2120_2878 | 227 |
| 299 | 3300046462 | Ga0495651_0009846 | Ga0495651_0009846_5024_5782 | 227 |
| 300 | 3300046463 | Ga0495653_0001000 | Ga0495653_0001000_19136_19894 | 227 |
| 301 | 3300046463 | Ga0495653_0160610 | Ga0495653_0160610_161_919 | 227 |
| 302 | 3300046476 | Ga0495662_0012812 | Ga0495662_0012812_1522_2280 | 227 |
| 303 | 3300046477 | Ga0495664_0004919 | Ga0495664_0004919_5050_5808 | 227 |
| 304 | 3300046511 | Ga0495608_0032396 | Ga0495608_0032396_973_1731 | 227 |
| 305 | 3300046511 | Ga0495608_0328156 | Ga0495608_0328156_134_892 | 227 |
| 306 | 3300046514 | Ga0495618_0092254 | Ga0495618_0092254_949_1707 | 227 |
| 307 | 3300046516 | Ga0495628_0082004 | Ga0495628_0082004_340_1098 | 227 |
| 308 | 3300046517 | Ga0495630_0011793 | Ga0495630_0011793_946_1704 | 227 |
| 309 | 3300046529 | Ga0495652_0039712 | Ga0495652_0039712_2170_2928 | 227 |
| 310 | 3300046531 | Ga0495665_0035159 | Ga0495665_0035159_1413_2171 | 227 |
| 311 | 3300046533 | Ga0495640_0138290 | Ga0495640_0138290_410_1168 | 227 |
| 312 | 3300046536 | Ga0495587_0191634 | Ga0495587_0191634_263_1021 | 227 |
| 313 | 3300046543 | Ga0495645_0120763 | Ga0495645_0120763_690_1448 | 227 |
| 314 | 3300046559 | Ga0495667_0026141 | Ga0495667_0026141_2215_2973 | 227 |
| 315 | 3300046559 | Ga0495667_0066861 | Ga0495667_0066861_886_1644 | 227 |
| 316 | 3300046616 | Ga0495668_0009864 | Ga0495668_0009864_3518_4291 | 227 |
| 317 | 3300046663 | Ga0495635_0003863 | Ga0495635_0003863_5018_5776 | 227 |
| 318 | 3300046663 | Ga0495635_0241939 | Ga0495635_0241939_96_854 | 227 |
| 319 | 3300046678 | Ga0495599_0003120 | Ga0495599_0003120_8844_9602 | 227 |
| 320 | 3300046690 | Ga0495624_0004760 | Ga0495624_0004760_4126_4884 | 227 |
| 321 | 3300046809 | Ga0495600_0020658 | Ga0495600_0020658_141_899 | 227 |
| 322 | 3300047315 | Ga0495581_0025613 | Ga0495581_0025613_1501_2259 | 227 |
| 323 | 3300047319 | Ga0495674_0004890 | Ga0495674_0004890_5041_5799 | 227 |
| 324 | 3300047321 | Ga0495676_0002009 | Ga0495676_0002009_3292_4050 | 227 |
| 325 | 3300047322 | Ga0495680_0003102 | Ga0495680_0003102_15156_15914 | 227 |
| 326 | 3300047322 | Ga0495680_0063314 | Ga0495680_0063314_411_1169 | 227 |
| 327 | 3300047322 | Ga0495680_0408078 | Ga0495680_0408078_160_918 | 227 |
| 328 | 3300047471 | Ga0495684_0018851 | Ga0495684_0018851_2862_3620 | 227 |
| 329 | 3300047471 | Ga0495684_0189276 | Ga0495684_0189276_235_993 | 227 |
| 330 | 3300047673 | Ga0495593_0042986 | Ga0495593_0042986_773_1531 | 227 |
| 331 | 3300048905 | Ga0496102_0001614 | Ga0496102_0001614_5788_6549 | 227 |
| 332 | 3300048906 | Ga0496103_0007504 | Ga0496103_0007504_1764_2525 | 227 |
| 333 | 3300048911 | Ga0496108_0356140 | Ga0496108_0356140_183_941 | 227 |
| 334 | 3300048912 | Ga0496109_0165103 | Ga0496109_0165103_1254_2012 | 227 |
| 335 | 3300049571 | Ga0501034_0111028 | Ga0501034_0111028_46_807 | 227 |
| 336 | 3300049583 | Ga0501067_0027648 | Ga0501067_0027648_1978_2739 | 227 |
| 337 | 3300049584 | Ga0501068_0006180 | Ga0501068_0006180_1027_1788 | 227 |
| 338 | 3300049585 | Ga0501069_0042308 | Ga0501069_0042308_897_1658 | 227 |
| 339 | 3300049586 | Ga0501070_0102039 | Ga0501070_0102039_1207_1968 | 227 |
| 340 | 3300049588 | Ga0501072_0392186 | Ga0501072_0392186_157_918 | 227 |
| 341 | 3300049589 | Ga0501073_0023110 | Ga0501073_0023110_1299_2060 | 227 |
| 342 | 3300049590 | Ga0501074_0128478 | Ga0501074_0128478_841_1602 | 227 |
| 343 | 3300049593 | Ga0501077_0042044 | Ga0501077_0042044_998_1759 | 227 |
| 344 | 3300049742 | Ga0501080_0129752 | Ga0501080_0129752_646_1407 | 227 |
| 345 | 3300049744 | Ga0501083_0000047 | Ga0501083_0000047_63328_64089 | 227 |
| 346 | 3300049823 | Ga0501044_0318532 | Ga0501044_0318532_458_1219 | 227 |
| 347 | 3300050508 | nmdc:mga09592_142748_c1 | nmdc:mga09592_142748_c1_886_1647 | 227 |
| 348 | 3300050510 | nmdc:mga06r32_28049_c1 | nmdc:mga06r32_28049_c1_1469_2230 | 227 |
| 349 | 3300054114 | Ga0501084_0004047 | Ga0501084_0004047_7179_7940 | 227 |
| 350 | 3300060353 | Ga0501082_0073572 | Ga0501082_0073572_1324_2085 | 227 |
| 351 | 3300003659 | JGI25404J52841_10004405 | JGI25404J52841_100044053 | 228 |
| 352 | 3300005327 | Ga0070658_10100252 | Ga0070658_101002524 | 228 |
| 353 | 3300005327 | Ga0070658_10161304 | Ga0070658_101613043 | 228 |
| 354 | 3300005334 | Ga0068869_100071921 | Ga0068869_1000719212 | 228 |
| 355 | 3300005334 | Ga0068869_100396194 | Ga0068869_1003961942 | 228 |
| 356 | 3300005335 | Ga0070666_10147942 | Ga0070666_101479421 | 228 |
| 357 | 3300005338 | Ga0068868_100538527 | Ga0068868_1005385271 | 228 |
| 358 | 3300005347 | Ga0070668_100018010 | Ga0070668_1000180105 | 228 |
| 359 | 3300005347 | Ga0070668_100407740 | Ga0070668_1004077402 | 228 |
| 360 | 3300005354 | Ga0070675_100252163 | Ga0070675_1002521632 | 228 |
| 361 | 3300005434 | Ga0070709_10011385 | Ga0070709_100113853 | 228 |
| 362 | 3300005434 | Ga0070709_10057356 | Ga0070709_100573563 | 228 |
| 363 | 3300005434 | Ga0070709_10152671 | Ga0070709_101526711 | 228 |
| 364 | 3300005435 | Ga0070714_100136889 | Ga0070714_1001368893 | 228 |
| 365 | 3300005436 | Ga0070713_100032487 | Ga0070713_1000324873 | 228 |
| 366 | 3300005436 | Ga0070713_100742706 | Ga0070713_1007427062 | 228 |
| 367 | 3300005437 | Ga0070710_10002785 | Ga0070710_100027857 | 228 |
| 368 | 3300005437 | Ga0070710_10046663 | Ga0070710_100466632 | 228 |
| 369 | 3300005437 | Ga0070710_10091923 | Ga0070710_100919232 | 228 |
| 370 | 3300005439 | Ga0070711_100386124 | Ga0070711_1003861242 | 228 |
| 371 | 3300005456 | Ga0070678_100032235 | Ga0070678_1000322353 | 228 |
| 372 | 3300005458 | Ga0070681_10689803 | Ga0070681_106898031 | 228 |
| 373 | 3300005458 | Ga0070681_10708326 | Ga0070681_107083261 | 228 |
| 374 | 3300005467 | Ga0070706_100029829 | Ga0070706_1000298294 | 228 |
| 375 | 3300005467 | Ga0070706_100192730 | Ga0070706_1001927302 | 228 |
| 376 | 3300005539 | Ga0068853_100192656 | Ga0068853_1001926562 | 228 |
| 377 | 3300005545 | Ga0070695_100233505 | Ga0070695_1002335051 | 228 |
| 378 | 3300005563 | Ga0068855_100026576 | Ga0068855_1000265762 | 228 |
| 379 | 3300005564 | Ga0070664_100430223 | Ga0070664_1004302231 | 228 |
| 380 | 3300005614 | Ga0068856_100063130 | Ga0068856_1000631303 | 228 |
| 381 | 3300005615 | Ga0070702_100235904 | Ga0070702_1002359042 | 228 |
| 382 | 3300005618 | Ga0068864_100891835 | Ga0068864_1008918352 | 228 |
| 383 | 3300005719 | Ga0068861_100264343 | Ga0068861_1002643432 | 228 |
| 384 | 3300005842 | Ga0068858_100036408 | Ga0068858_1000364083 | 228 |
| 385 | 3300005842 | Ga0068858_100244311 | Ga0068858_1002443112 | 228 |
| 386 | 3300005844 | Ga0068862_100009224 | Ga0068862_1000092241 | 228 |
| 387 | 3300005937 | Ga0081455_10005778 | Ga0081455_100057788 | 228 |
| 388 | 3300005937 | Ga0081455_10016895 | Ga0081455_100168958 | 228 |
| 389 | 3300005937 | Ga0081455_10108782 | Ga0081455_101087822 | 228 |
| 390 | 3300005937 | Ga0081455_10158262 | Ga0081455_101582622 | 228 |
| 391 | 3300005981 | Ga0081538_10006653 | Ga0081538_100066537 | 228 |
| 392 | 3300005981 | Ga0081538_10043181 | Ga0081538_100431812 | 228 |
| 393 | 3300005983 | Ga0081540_1000051 | Ga0081540_1000051127 | 228 |
| 394 | 3300005983 | Ga0081540_1143877 | Ga0081540_11438772 | 228 |
| 395 | 3300006028 | Ga0070717_10310350 | Ga0070717_103103502 | 228 |
| 396 | 3300006038 | Ga0075365_10376742 | Ga0075365_103767422 | 228 |
| 397 | 3300006042 | Ga0075368_10022375 | Ga0075368_100223753 | 228 |
| 398 | 3300006051 | Ga0075364_10001762 | Ga0075364_100017625 | 228 |
| 399 | 3300006163 | Ga0070715_10056596 | Ga0070715_100565962 | 228 |
| 400 | 3300006173 | Ga0070716_100015172 | Ga0070716_1000151722 | 228 |
| 401 | 3300006173 | Ga0070716_100031205 | Ga0070716_1000312053 | 228 |
| 402 | 3300006173 | Ga0070716_100334139 | Ga0070716_1003341392 | 228 |
| 403 | 3300006175 | Ga0070712_100092712 | Ga0070712_1000927122 | 228 |
| 404 | 3300006177 | Ga0075362_10177068 | Ga0075362_101770681 | 228 |
| 405 | 3300006186 | Ga0075369_10135007 | Ga0075369_101350072 | 228 |
| 406 | 3300006194 | Ga0075427_10008791 | Ga0075427_100087912 | 228 |
| 407 | 3300006844 | Ga0075428_100042705 | Ga0075428_1000427056 | 228 |
| 408 | 3300006844 | Ga0075428_100045332 | Ga0075428_1000453322 | 228 |
| 409 | 3300006844 | Ga0075428_100075810 | Ga0075428_1000758103 | 228 |
| 410 | 3300006846 | Ga0075430_100004837 | Ga0075430_10000483710 | 228 |
| 411 | 3300006846 | Ga0075430_100076663 | Ga0075430_1000766632 | 228 |
| 412 | 3300006846 | Ga0075430_100373830 | Ga0075430_1003738301 | 228 |
| 413 | 3300006847 | Ga0075431_100004579 | Ga0075431_1000045793 | 228 |
| 414 | 3300006847 | Ga0075431_100410472 | Ga0075431_1004104722 | 228 |
| 415 | 3300006852 | Ga0075433_10007152 | Ga0075433_100071525 | 228 |
| 416 | 3300006871 | Ga0075434_100004021 | Ga0075434_10000402112 | 228 |
| 417 | 3300006880 | Ga0075429_100024498 | Ga0075429_1000244984 | 228 |
| 418 | 3300006880 | Ga0075429_100364433 | Ga0075429_1003644332 | 228 |
| 419 | 3300006881 | Ga0068865_100208611 | Ga0068865_1002086112 | 228 |
| 420 | 3300006881 | Ga0068865_100592533 | Ga0068865_1005925331 | 228 |
| 421 | 3300006914 | Ga0075436_100205839 | Ga0075436_1002058392 | 228 |
| 422 | 3300009093 | Ga0105240_10170212 | Ga0105240_101702124 | 228 |
| 423 | 3300009093 | Ga0105240_10357485 | Ga0105240_103574852 | 228 |
| 424 | 3300009098 | Ga0105245_10040193 | Ga0105245_100401935 | 228 |
| 425 | 3300009098 | Ga0105245_10438494 | Ga0105245_104384942 | 228 |
| 426 | 3300009101 | Ga0105247_10129913 | Ga0105247_101299132 | 228 |
| 427 | 3300009147 | Ga0114129_10003310 | Ga0114129_1000331024 | 228 |
| 428 | 3300009147 | Ga0114129_10006580 | Ga0114129_1000658016 | 228 |
| 429 | 3300009147 | Ga0114129_10008508 | Ga0114129_100085081 | 228 |
| 430 | 3300009147 | Ga0114129_10711916 | Ga0114129_107119162 | 228 |
| 431 | 3300009148 | Ga0105243_10084550 | Ga0105243_100845502 | 228 |
| 432 | 3300009174 | Ga0105241_10702090 | Ga0105241_107020902 | 228 |
| 433 | 3300009177 | Ga0105248_10054648 | Ga0105248_100546485 | 228 |
| 434 | 3300009177 | Ga0105248_10383794 | Ga0105248_103837942 | 228 |
| 435 | 3300009545 | Ga0105237_10298877 | Ga0105237_102988772 | 228 |
| 436 | 3300009551 | Ga0105238_10043572 | Ga0105238_100435723 | 228 |
| 437 | 3300009553 | Ga0105249_10093856 | Ga0105249_100938562 | 228 |
| 438 | 3300010375 | Ga0105239_10081330 | Ga0105239_100813303 | 228 |
| 439 | 3300013102 | Ga0157371_10028551 | Ga0157371_100285513 | 228 |
| 440 | 3300013104 | Ga0157370_10184200 | Ga0157370_101842002 | 228 |
| 441 | 3300013105 | Ga0157369_10026473 | Ga0157369_100264732 | 228 |
| 442 | 3300013105 | Ga0157369_10103973 | Ga0157369_101039732 | 228 |
| 443 | 3300013105 | Ga0157369_10150911 | Ga0157369_101509113 | 228 |
| 444 | 3300013296 | Ga0157374_10594417 | Ga0157374_105944172 | 228 |
| 445 | 3300013297 | Ga0157378_10575323 | Ga0157378_105753232 | 228 |
| 446 | 3300013306 | Ga0163162_10378299 | Ga0163162_103782993 | 228 |
| 447 | 3300013306 | Ga0163162_10469334 | Ga0163162_104693342 | 228 |
| 448 | 3300013306 | Ga0163162_10499997 | Ga0163162_104999972 | 228 |
| 449 | 3300013307 | Ga0157372_10136632 | Ga0157372_101366324 | 228 |
| 450 | 3300013307 | Ga0157372_10452185 | Ga0157372_104521852 | 228 |
| 451 | 3300014325 | Ga0163163_10650195 | Ga0163163_106501952 | 228 |
| 452 | 3300014497 | Ga0182008_10012803 | Ga0182008_100128034 | 228 |
| 453 | 3300014968 | Ga0157379_10046656 | Ga0157379_100466563 | 228 |
| 454 | 3300014969 | Ga0157376_10612214 | Ga0157376_106122142 | 228 |
| 455 | 3300014969 | Ga0157376_10769538 | Ga0157376_107695382 | 228 |
| 456 | 3300015262 | Ga0182007_10002103 | Ga0182007_100021038 | 228 |
| 457 | 3300021388 | Ga0213875_10000386 | Ga0213875_1000038623 | 228 |
| 458 | 3300021388 | Ga0213875_10055967 | Ga0213875_100559672 | 228 |
| 459 | 3300025901 | Ga0207688_10224365 | Ga0207688_102243652 | 228 |
| 460 | 3300025903 | Ga0207680_10036903 | Ga0207680_100369031 | 228 |
| 461 | 3300025905 | Ga0207685_10020248 | Ga0207685_100202482 | 228 |
| 462 | 3300025906 | Ga0207699_10009759 | Ga0207699_100097595 | 228 |
| 463 | 3300025906 | Ga0207699_10015597 | Ga0207699_100155975 | 228 |
| 464 | 3300025908 | Ga0207643_10045380 | Ga0207643_100453803 | 228 |
| 465 | 3300025909 | Ga0207705_10218060 | Ga0207705_102180602 | 228 |
| 466 | 3300025910 | Ga0207684_10256236 | Ga0207684_102562363 | 228 |
| 467 | 3300025913 | Ga0207695_10139908 | Ga0207695_101399081 | 228 |
| 468 | 3300025915 | Ga0207693_10001639 | Ga0207693_1000163915 | 228 |
| 469 | 3300025915 | Ga0207693_10026140 | Ga0207693_100261404 | 228 |
| 470 | 3300025915 | Ga0207693_10130757 | Ga0207693_101307572 | 228 |
| 471 | 3300025916 | Ga0207663_10042421 | Ga0207663_100424214 | 228 |
| 472 | 3300025927 | Ga0207687_10452655 | Ga0207687_104526551 | 228 |
| 473 | 3300025928 | Ga0207700_10018357 | Ga0207700_100183573 | 228 |
| 474 | 3300025928 | Ga0207700_10173141 | Ga0207700_101731413 | 228 |
| 475 | 3300025928 | Ga0207700_10235697 | Ga0207700_102356972 | 228 |
| 476 | 3300025939 | Ga0207665_10006024 | Ga0207665_100060243 | 228 |
| 477 | 3300025939 | Ga0207665_10012540 | Ga0207665_100125406 | 228 |
| 478 | 3300025939 | Ga0207665_10277934 | Ga0207665_102779341 | 228 |
| 479 | 3300025941 | Ga0207711_10173752 | Ga0207711_101737522 | 228 |
| 480 | 3300025942 | Ga0207689_10057501 | Ga0207689_100575012 | 228 |
| 481 | 3300025945 | Ga0207679_10181498 | Ga0207679_101814982 | 228 |
| 482 | 3300025949 | Ga0207667_10035862 | Ga0207667_100358624 | 228 |
| 483 | 3300025949 | Ga0207667_10283221 | Ga0207667_102832213 | 228 |
| 484 | 3300025961 | Ga0207712_10006450 | Ga0207712_100064505 | 228 |
| 485 | 3300025972 | Ga0207668_10012416 | Ga0207668_100124165 | 228 |
| 486 | 3300025986 | Ga0207658_10253458 | Ga0207658_102534582 | 228 |
| 487 | 3300026023 | Ga0207677_10489478 | Ga0207677_104894781 | 228 |
| 488 | 3300026078 | Ga0207702_10144748 | Ga0207702_101447483 | 228 |
| 489 | 3300026089 | Ga0207648_10019076 | Ga0207648_100190768 | 228 |
| 490 | 3300026089 | Ga0207648_10334325 | Ga0207648_103343252 | 228 |
| 491 | 3300026095 | Ga0207676_10257891 | Ga0207676_102578912 | 228 |
| 492 | 3300026118 | Ga0207675_100050341 | Ga0207675_1000503414 | 228 |
| 493 | 3300026121 | Ga0207683_10027099 | Ga0207683_100270995 | 228 |
| 494 | 3300027907 | Ga0207428_10001525 | Ga0207428_100015254 | 228 |
| 495 | 3300028379 | Ga0268266_10009660 | Ga0268266_1000966012 | 228 |
| 496 | 3300028380 | Ga0268265_10089239 | Ga0268265_100892392 | 228 |
| 497 | 3300028786 | Ga0307517_10269917 | Ga0307517_102699171 | 228 |
| 498 | 3300028794 | Ga0307515_10000941 | Ga0307515_1000094153 | 228 |
| 499 | 3300028794 | Ga0307515_10030339 | Ga0307515_100303392 | 228 |
| 500 | 3300028794 | Ga0307515_10054239 | Ga0307515_100542393 | 228 |
| 501 | 3300031456 | Ga0307513_10025506 | Ga0307513_100255064 | 228 |
| 502 | 3300031507 | Ga0307509_10114990 | Ga0307509_101149903 | 228 |
| 503 | 3300031548 | Ga0307408_100590798 | Ga0307408_1005907982 | 228 |
| 504 | 3300031616 | Ga0307508_10020499 | Ga0307508_100204995 | 228 |
| 505 | 3300031649 | Ga0307514_10254043 | Ga0307514_102540431 | 228 |
| 506 | 3300031730 | Ga0307516_10003156 | Ga0307516_1000315615 | 228 |
| 507 | 3300031730 | Ga0307516_10032377 | Ga0307516_100323775 | 228 |
| 508 | 3300031731 | Ga0307405_10001416 | Ga0307405_100014164 | 228 |
| 509 | 3300031824 | Ga0307413_10109358 | Ga0307413_101093583 | 228 |
| 510 | 3300031824 | Ga0307413_10179415 | Ga0307413_101794152 | 228 |
| 511 | 3300031852 | Ga0307410_10005220 | Ga0307410_100052206 | 228 |
| 512 | 3300031852 | Ga0307410_10109263 | Ga0307410_101092632 | 228 |
| 513 | 3300031852 | Ga0307410_10125250 | Ga0307410_101252503 | 228 |
| 514 | 3300031852 | Ga0307410_10182517 | Ga0307410_101825171 | 228 |
| 515 | 3300031901 | Ga0307406_10050198 | Ga0307406_100501983 | 228 |
| 516 | 3300031901 | Ga0307406_10150122 | Ga0307406_101501222 | 228 |
| 517 | 3300031901 | Ga0307406_10155325 | Ga0307406_101553251 | 228 |
| 518 | 3300031903 | Ga0307407_10007799 | Ga0307407_100077994 | 228 |
| 519 | 3300031903 | Ga0307407_10077907 | Ga0307407_100779072 | 228 |
| 520 | 3300031903 | Ga0307407_10150609 | Ga0307407_101506091 | 228 |
| 521 | 3300031911 | Ga0307412_10343150 | Ga0307412_103431502 | 228 |
| 522 | 3300031995 | Ga0307409_100003467 | Ga0307409_1000034673 | 228 |
| 523 | 3300031995 | Ga0307409_100026415 | Ga0307409_1000264154 | 228 |
| 524 | 3300031995 | Ga0307409_100076499 | Ga0307409_1000764992 | 228 |
| 525 | 3300031995 | Ga0307409_100111656 | Ga0307409_1001116562 | 228 |
| 526 | 3300031995 | Ga0307409_100115348 | Ga0307409_1001153482 | 228 |
| 527 | 3300031995 | Ga0307409_100278559 | Ga0307409_1002785592 | 228 |
| 528 | 3300031995 | Ga0307409_100438363 | Ga0307409_1004383632 | 228 |
| 529 | 3300032002 | Ga0307416_100000369 | Ga0307416_10000036912 | 228 |
| 530 | 3300032002 | Ga0307416_100139529 | Ga0307416_1001395292 | 228 |
| 531 | 3300032002 | Ga0307416_100254248 | Ga0307416_1002542482 | 228 |
| 532 | 3300032005 | Ga0307411_10118240 | Ga0307411_101182402 | 228 |
| 533 | 3300032126 | Ga0307415_100000025 | Ga0307415_10000002527 | 228 |
| 534 | 3300032126 | Ga0307415_100060115 | Ga0307415_1000601153 | 228 |
| 535 | 3300032126 | Ga0307415_100125101 | Ga0307415_1001251012 | 228 |
| 536 | 3300032126 | Ga0307415_100165857 | Ga0307415_1001658572 | 228 |
| 537 | 3300032126 | Ga0307415_100313681 | Ga0307415_1003136812 | 228 |
| 538 | 3300034957 | Ga0373938_0019466 | Ga0373938_0019466_354_1115 | 228 |
| 539 | 3300035091 | Ga0373951_0000079 | Ga0373951_0000079_34346_35107 | 228 |
| 540 | 3300035111 | Ga0373923_0041771 | Ga0373923_0041771_115_876 | 228 |
| 541 | 3300035113 | Ga0373936_0047025 | Ga0373936_0047025_244_1005 | 228 |
| 542 | 3300035117 | Ga0373953_0086052 | Ga0373953_0086052_492_1253 | 228 |
| 543 | 3300035170 | Ga0373943_0043065 | Ga0373943_0043065_1215_1976 | 228 |
| 544 | 3300035691 | Ga0373931_0288488 | Ga0373931_0288488_158_919 | 228 |
| 545 | 3300035692 | Ga0373935_0015284 | Ga0373935_0015284_3274_4035 | 228 |
| 546 | 3300035695 | Ga0373927_0144623 | Ga0373927_0144623_111_872 | 228 |
| 547 | 3300035724 | Ga0373933_0006388 | Ga0373933_0006388_3756_4523 | 228 |
| 548 | 3300035724 | Ga0373933_0112783 | Ga0373933_0112783_151_912 | 228 |
| 549 | 3300035724 | Ga0373933_0128406 | Ga0373933_0128406_201_962 | 228 |
| 550 | 3300035725 | Ga0373947_0000027 | Ga0373947_0000027_41376_42137 | 228 |
| 551 | 3300036401 | Ga0373937_0013181 | Ga0373937_0013181_2340_3107 | 228 |
| 552 | 3300036401 | Ga0373937_0183625 | Ga0373937_0183625_1099_1860 | 228 |
| 553 | 3300037068 | Ga0373925_0238280 | Ga0373925_0238280_464_1225 | 228 |
| 554 | 3300037068 | Ga0373925_0492685 | Ga0373925_0492685_208_969 | 228 |
| 555 | 3300037312 | Ga0395899_0070354 | Ga0395899_0070354_1214_1975 | 228 |
| 556 | 3300037418 | Ga0395900_0072675 | Ga0395900_0072675_2131_2898 | 228 |
| 557 | 3300037418 | Ga0395900_0177757 | Ga0395900_0177757_364_1125 | 228 |
| 558 | 3300037466 | Ga0395898_0043300 | Ga0395898_0043300_1971_2738 | 228 |
| 559 | 3300037466 | Ga0395898_0123869 | Ga0395898_0123869_257_1021 | 228 |
| 560 | 3300037466 | Ga0395898_0236047 | Ga0395898_0236047_84_851 | 228 |
| 561 | 3300037471 | Ga0395905_0069401 | Ga0395905_0069401_208_975 | 228 |
| 562 | 3300037471 | Ga0395905_0167107 | Ga0395905_0167107_83_844 | 228 |
| 563 | 3300037853 | Ga0436364_0764179 | Ga0436364_0764179_49535_50296 | 228 |
| 564 | 3300038443 | Ga0395901_0007766 | Ga0395901_0007766_9261_10022 | 228 |
| 565 | 3300038443 | Ga0395901_0034104 | Ga0395901_0034104_2332_3099 | 228 |
| 566 | 3300038443 | Ga0395901_0706430 | Ga0395901_0706430_177_938 | 228 |
| 567 | 3300041503 | Ga0451847_0075466 | Ga0451847_0075466_92_856 | 228 |
| 568 | 3300042007 | Ga0439449_0001862 | Ga0439449_0001862_1362_2123 | 228 |
| 569 | 3300042126 | Ga0450888_009637 | Ga0450888_009637_328_1089 | 228 |
| 570 | 3300042146 | Ga0450907_014856 | Ga0450907_014856_451_1215 | 228 |
| 571 | 3300044683 | Ga0466965_0026789 | Ga0466965_0026789_225_1010 | 228 |
| 572 | 3300044693 | Ga0466961_0016693 | Ga0466961_0016693_2825_3595 | 228 |
| 573 | 3300044706 | Ga0466964_0095329 | Ga0466964_0095329_36_806 | 228 |
| 574 | 3300044765 | Ga0466970_0011864 | Ga0466970_0011864_747_1517 | 228 |
| 575 | 3300044842 | Ga0466957_0144631 | Ga0466957_0144631_528_1298 | 228 |
| 576 | 3300044901 | Ga0466960_0115006 | Ga0466960_0115006_271_1089 | 228 |
| 577 | 3300044901 | Ga0466960_0161546 | Ga0466960_0161546_262_1023 | 228 |
| 578 | 3300046452 | Ga0495617_008068 | Ga0495617_008068_1742_2503 | 228 |
| 579 | 3300046454 | Ga0495592_0011443 | Ga0495592_0011443_5333_6100 | 228 |
| 580 | 3300046455 | Ga0495603_0279305 | Ga0495603_0279305_35_796 | 228 |
| 581 | 3300046458 | Ga0495591_041037 | Ga0495591_041037_530_1291 | 228 |
| 582 | 3300046459 | Ga0495629_0174925 | Ga0495629_0174925_436_1197 | 228 |
| 583 | 3300046459 | Ga0495629_0251877 | Ga0495629_0251877_395_1156 | 228 |
| 584 | 3300046461 | Ga0495641_0017919 | Ga0495641_0017919_1593_2354 | 228 |
| 585 | 3300046462 | Ga0495651_0002619 | Ga0495651_0002619_4205_4972 | 228 |
| 586 | 3300046462 | Ga0495651_0047874 | Ga0495651_0047874_256_1017 | 228 |
| 587 | 3300046462 | Ga0495651_0110998 | Ga0495651_0110998_1252_2013 | 228 |
| 588 | 3300046462 | Ga0495651_0151410 | Ga0495651_0151410_358_1119 | 228 |
| 589 | 3300046463 | Ga0495653_0001148 | Ga0495653_0001148_2171_2938 | 228 |
| 590 | 3300046463 | Ga0495653_0071166 | Ga0495653_0071166_612_1373 | 228 |
| 591 | 3300046463 | Ga0495653_0077631 | Ga0495653_0077631_921_1682 | 228 |
| 592 | 3300046463 | Ga0495653_0078142 | Ga0495653_0078142_583_1344 | 228 |
| 593 | 3300046472 | Ga0495580_0023045 | Ga0495580_0023045_59_820 | 228 |
| 594 | 3300046474 | Ga0495605_0019533 | Ga0495605_0019533_1494_2255 | 228 |
| 595 | 3300046476 | Ga0495662_0001362 | Ga0495662_0001362_10430_11191 | 228 |
| 596 | 3300046477 | Ga0495664_0017558 | Ga0495664_0017558_1096_1857 | 228 |
| 597 | 3300046492 | Ga0495585_0031085 | Ga0495585_0031085_1762_2523 | 228 |
| 598 | 3300046501 | Ga0495607_0082143 | Ga0495607_0082143_371_1132 | 228 |
| 599 | 3300046501 | Ga0495607_0158492 | Ga0495607_0158492_276_1037 | 228 |
| 600 | 3300046506 | Ga0495583_0034906 | Ga0495583_0034906_1151_1912 | 228 |
| 601 | 3300046511 | Ga0495608_0003361 | Ga0495608_0003361_5113_5880 | 228 |
| 602 | 3300046511 | Ga0495608_0022571 | Ga0495608_0022571_3160_3921 | 228 |
| 603 | 3300046511 | Ga0495608_0056119 | Ga0495608_0056119_859_1620 | 228 |
| 604 | 3300046511 | Ga0495608_0116091 | Ga0495608_0116091_265_1026 | 228 |
| 605 | 3300046511 | Ga0495608_0193636 | Ga0495608_0193636_315_1076 | 228 |
| 606 | 3300046511 | Ga0495608_0253609 | Ga0495608_0253609_313_1074 | 228 |
| 607 | 3300046514 | Ga0495618_0083963 | Ga0495618_0083963_632_1393 | 228 |
| 608 | 3300046514 | Ga0495618_0113924 | Ga0495618_0113924_612_1379 | 228 |
| 609 | 3300046514 | Ga0495618_0153803 | Ga0495618_0153803_377_1138 | 228 |
| 610 | 3300046516 | Ga0495628_0057651 | Ga0495628_0057651_1521_2282 | 228 |
| 611 | 3300046516 | Ga0495628_0113053 | Ga0495628_0113053_378_1145 | 228 |
| 612 | 3300046516 | Ga0495628_0113987 | Ga0495628_0113987_113_874 | 228 |
| 613 | 3300046517 | Ga0495630_0052690 | Ga0495630_0052690_961_1722 | 228 |
| 614 | 3300046517 | Ga0495630_0185011 | Ga0495630_0185011_519_1280 | 228 |
| 615 | 3300046517 | Ga0495630_0318685 | Ga0495630_0318685_193_954 | 228 |
| 616 | 3300046518 | Ga0495631_0195944 | Ga0495631_0195944_75_836 | 228 |
| 617 | 3300046522 | Ga0495643_0003638 | Ga0495643_0003638_2320_3081 | 228 |
| 618 | 3300046524 | Ga0495648_0056461 | Ga0495648_0056461_323_1084 | 228 |
| 619 | 3300046526 | Ga0495666_0002838 | Ga0495666_0002838_6663_7424 | 228 |
| 620 | 3300046529 | Ga0495652_0003969 | Ga0495652_0003969_12812_13579 | 228 |
| 621 | 3300046531 | Ga0495665_0053310 | Ga0495665_0053310_1007_1768 | 228 |
| 622 | 3300046533 | Ga0495640_0051892 | Ga0495640_0051892_1896_2657 | 228 |
| 623 | 3300046533 | Ga0495640_0094336 | Ga0495640_0094336_879_1640 | 228 |
| 624 | 3300046533 | Ga0495640_0175865 | Ga0495640_0175865_190_951 | 228 |
| 625 | 3300046533 | Ga0495640_0215301 | Ga0495640_0215301_418_1179 | 228 |
| 626 | 3300046536 | Ga0495587_0001643 | Ga0495587_0001643_3931_4698 | 228 |
| 627 | 3300046536 | Ga0495587_0024641 | Ga0495587_0024641_761_1522 | 228 |
| 628 | 3300046536 | Ga0495587_0073208 | Ga0495587_0073208_390_1151 | 228 |
| 629 | 3300046542 | Ga0495597_0036105 | Ga0495597_0036105_741_1502 | 228 |
| 630 | 3300046543 | Ga0495645_0008208 | Ga0495645_0008208_1370_2137 | 228 |
| 631 | 3300046543 | Ga0495645_0453638 | Ga0495645_0453638_12_773 | 228 |
| 632 | 3300046559 | Ga0495667_0000419 | Ga0495667_0000419_13206_13973 | 228 |
| 633 | 3300046559 | Ga0495667_0049358 | Ga0495667_0049358_1161_1922 | 228 |
| 634 | 3300046559 | Ga0495667_0062008 | Ga0495667_0062008_90_851 | 228 |
| 635 | 3300046559 | Ga0495667_0075069 | Ga0495667_0075069_807_1568 | 228 |
| 636 | 3300046559 | Ga0495667_0080360 | Ga0495667_0080360_553_1314 | 228 |
| 637 | 3300046642 | Ga0495634_0179020 | Ga0495634_0179020_192_953 | 228 |
| 638 | 3300046660 | Ga0495625_0146718 | Ga0495625_0146718_219_980 | 228 |
| 639 | 3300046660 | Ga0495625_0234695 | Ga0495625_0234695_95_856 | 228 |
| 640 | 3300046663 | Ga0495635_0006159 | Ga0495635_0006159_5415_6182 | 228 |
| 641 | 3300046663 | Ga0495635_0009878 | Ga0495635_0009878_2071_2832 | 228 |
| 642 | 3300046663 | Ga0495635_0060624 | Ga0495635_0060624_926_1687 | 228 |
| 643 | 3300046663 | Ga0495635_0084732 | Ga0495635_0084732_840_1601 | 228 |
| 644 | 3300046665 | Ga0495661_0081491 | Ga0495661_0081491_295_1056 | 228 |
| 645 | 3300046675 | Ga0495657_0001846 | Ga0495657_0001846_3792_4559 | 228 |
| 646 | 3300046675 | Ga0495657_0005301 | Ga0495657_0005301_4239_5000 | 228 |
| 647 | 3300046675 | Ga0495657_0005508 | Ga0495657_0005508_187_948 | 228 |
| 648 | 3300046675 | Ga0495657_0071075 | Ga0495657_0071075_1098_1859 | 228 |
| 649 | 3300046675 | Ga0495657_0290023 | Ga0495657_0290023_169_930 | 228 |
| 650 | 3300046678 | Ga0495599_0001193 | Ga0495599_0001193_10217_10984 | 228 |
| 651 | 3300046678 | Ga0495599_0138386 | Ga0495599_0138386_109_870 | 228 |
| 652 | 3300046679 | Ga0495623_0040914 | Ga0495623_0040914_843_1604 | 228 |
| 653 | 3300046679 | Ga0495623_0176784 | Ga0495623_0176784_435_1202 | 228 |
| 654 | 3300046680 | Ga0495646_0115885 | Ga0495646_0115885_737_1498 | 228 |
| 655 | 3300046689 | Ga0495613_0003928 | Ga0495613_0003928_8018_8779 | 228 |
| 656 | 3300046689 | Ga0495613_0061004 | Ga0495613_0061004_1633_2394 | 228 |
| 657 | 3300046689 | Ga0495613_0226026 | Ga0495613_0226026_164_925 | 228 |
| 658 | 3300046694 | Ga0495649_0159021 | Ga0495649_0159021_367_1128 | 228 |
| 659 | 3300046794 | Ga0495589_0013643 | Ga0495589_0013643_1431_2192 | 228 |
| 660 | 3300046809 | Ga0495600_0014992 | Ga0495600_0014992_3917_4684 | 228 |
| 661 | 3300046809 | Ga0495600_0019627 | Ga0495600_0019627_1242_2003 | 228 |
| 662 | 3300046809 | Ga0495600_0047982 | Ga0495600_0047982_1129_1890 | 228 |
| 663 | 3300046809 | Ga0495600_0111266 | Ga0495600_0111266_232_993 | 228 |
| 664 | 3300046810 | Ga0495660_0030479 | Ga0495660_0030479_545_1306 | 228 |
| 665 | 3300046810 | Ga0495660_0067730 | Ga0495660_0067730_445_1206 | 228 |
| 666 | 3300047315 | Ga0495581_0038407 | Ga0495581_0038407_992_1753 | 228 |
| 667 | 3300047317 | Ga0495604_0005472 | Ga0495604_0005472_4235_5002 | 228 |
| 668 | 3300047317 | Ga0495604_0100801 | Ga0495604_0100801_767_1528 | 228 |
| 669 | 3300047317 | Ga0495604_0118431 | Ga0495604_0118431_943_1704 | 228 |
| 670 | 3300047319 | Ga0495674_0022999 | Ga0495674_0022999_2691_3452 | 228 |
| 671 | 3300047319 | Ga0495674_0024860 | Ga0495674_0024860_4524_5285 | 228 |
| 672 | 3300047319 | Ga0495674_0045064 | Ga0495674_0045064_2164_2931 | 228 |
| 673 | 3300047319 | Ga0495674_0080640 | Ga0495674_0080640_1247_2008 | 228 |
| 674 | 3300047319 | Ga0495674_0113360 | Ga0495674_0113360_1513_2274 | 228 |
| 675 | 3300047319 | Ga0495674_0324441 | Ga0495674_0324441_464_1225 | 228 |
| 676 | 3300047322 | Ga0495680_0000782 | Ga0495680_0000782_25637_26404 | 228 |
| 677 | 3300047322 | Ga0495680_0024753 | Ga0495680_0024753_3349_4110 | 228 |
| 678 | 3300047322 | Ga0495680_0099106 | Ga0495680_0099106_1228_1989 | 228 |
| 679 | 3300047323 | Ga0495683_0015124 | Ga0495683_0015124_1470_2231 | 228 |
| 680 | 3300047444 | Ga0495675_0188424 | Ga0495675_0188424_93_860 | 228 |
| 681 | 3300047447 | Ga0495685_002535 | Ga0495685_002535_1725_2486 | 228 |
| 682 | 3300047471 | Ga0495684_0015428 | Ga0495684_0015428_2841_3608 | 228 |
| 683 | 3300047471 | Ga0495684_0018012 | Ga0495684_0018012_1726_2487 | 228 |
| 684 | 3300047471 | Ga0495684_0072454 | Ga0495684_0072454_1072_1833 | 228 |
| 685 | 3300047673 | Ga0495593_0004861 | Ga0495593_0004861_5680_6441 | 228 |
| 686 | 3300047673 | Ga0495593_0196450 | Ga0495593_0196450_173_934 | 228 |
| 687 | 3300048088 | Ga0495602_0003177 | Ga0495602_0003177_3829_4596 | 228 |
| 688 | 3300048088 | Ga0495602_0013811 | Ga0495602_0013811_83_844 | 228 |
| 689 | 3300048088 | Ga0495602_0331312 | Ga0495602_0331312_291_1052 | 228 |
| 690 | 3300048903 | Ga0496100_0078590 | Ga0496100_0078590_1025_1789 | 228 |
| 691 | 3300048903 | Ga0496100_0129972 | Ga0496100_0129972_580_1341 | 228 |
| 692 | 3300048904 | Ga0496101_0008779 | Ga0496101_0008779_2983_3750 | 228 |
| 693 | 3300048905 | Ga0496102_0056757 | Ga0496102_0056757_1528_2295 | 228 |
| 694 | 3300048907 | Ga0496104_0010849 | Ga0496104_0010849_280_1044 | 228 |
| 695 | 3300048907 | Ga0496104_0649258 | Ga0496104_0649258_62_823 | 228 |
| 696 | 3300048908 | Ga0496105_0079966 | Ga0496105_0079966_547_1311 | 228 |
| 697 | 3300048911 | Ga0496108_0009832 | Ga0496108_0009832_3913_4680 | 228 |
| 698 | 3300048912 | Ga0496109_0007380 | Ga0496109_0007380_2219_2983 | 228 |
| 699 | 3300048912 | Ga0496109_0015301 | Ga0496109_0015301_2559_3320 | 228 |
| 700 | 3300048912 | Ga0496109_0075678 | Ga0496109_0075678_634_1395 | 228 |
| 701 | 3300048913 | Ga0496110_0092001 | Ga0496110_0092001_970_1734 | 228 |
| 702 | 3300048913 | Ga0496110_0407213 | Ga0496110_0407213_92_853 | 228 |
| 703 | 3300048914 | Ga0496111_0137197 | Ga0496111_0137197_754_1521 | 228 |
| 704 | 3300048914 | Ga0496111_0385211 | Ga0496111_0385211_145_906 | 228 |
| 705 | 3300048915 | Ga0496112_0083481 | Ga0496112_0083481_801_1562 | 228 |
| 706 | 3300048916 | Ga0496113_0205045 | Ga0496113_0205045_639_1436 | 228 |
| 707 | 3300048916 | Ga0496113_0242420 | Ga0496113_0242420_301_1062 | 228 |
| 708 | 3300048916 | Ga0496113_0290436 | Ga0496113_0290436_405_1166 | 228 |
| 709 | 3300048916 | Ga0496113_0339790 | Ga0496113_0339790_263_1024 | 228 |
| 710 | 3300048917 | Ga0496114_0088886 | Ga0496114_0088886_1164_1964 | 228 |
| 711 | 3300048917 | Ga0496114_0095005 | Ga0496114_0095005_1011_1799 | 228 |
| 712 | 3300048918 | Ga0496115_0095578 | Ga0496115_0095578_854_1624 | 228 |
| 713 | 3300048922 | Ga0496119_0142836 | Ga0496119_0142836_19_780 | 228 |
| 714 | 3300048924 | Ga0496121_0071186 | Ga0496121_0071186_1625_2386 | 228 |
| 715 | 3300048929 | Ga0496126_0049478 | Ga0496126_0049478_647_1408 | 228 |
| 716 | 3300049568 | Ga0501031_0029186 | Ga0501031_0029186_801_1565 | 228 |
| 717 | 3300049568 | Ga0501031_0118600 | Ga0501031_0118600_615_1382 | 228 |
| 718 | 3300049572 | Ga0501036_0147254 | Ga0501036_0147254_643_1407 | 228 |
| 719 | 3300049573 | Ga0501037_0134802 | Ga0501037_0134802_904_1668 | 228 |
| 720 | 3300049574 | Ga0501038_0001094 | Ga0501038_0001094_14785_15546 | 228 |
| 721 | 3300049574 | Ga0501038_0034588 | Ga0501038_0034588_1927_2691 | 228 |
| 722 | 3300049575 | Ga0501039_0125264 | Ga0501039_0125264_431_1195 | 228 |
| 723 | 3300049575 | Ga0501039_0162544 | Ga0501039_0162544_198_965 | 228 |
| 724 | 3300049576 | Ga0501040_0050261 | Ga0501040_0050261_990_1754 | 228 |
| 725 | 3300049577 | Ga0501041_0259085 | Ga0501041_0259085_79_843 | 228 |
| 726 | 3300049578 | Ga0501042_0086941 | Ga0501042_0086941_698_1462 | 228 |
| 727 | 3300049582 | Ga0501048_0010696 | Ga0501048_0010696_765_1529 | 228 |
| 728 | 3300049585 | Ga0501069_0057166 | Ga0501069_0057166_850_1614 | 228 |
| 729 | 3300049587 | Ga0501071_0014456 | Ga0501071_0014456_676_1440 | 228 |
| 730 | 3300049588 | Ga0501072_0059654 | Ga0501072_0059654_306_1070 | 228 |
| 731 | 3300049589 | Ga0501073_0270357 | Ga0501073_0270357_72_836 | 228 |
| 732 | 3300049590 | Ga0501074_0152717 | Ga0501074_0152717_828_1592 | 228 |
| 733 | 3300049592 | Ga0501076_0088515 | Ga0501076_0088515_752_1516 | 228 |
| 734 | 3300049593 | Ga0501077_0138510 | Ga0501077_0138510_121_888 | 228 |
| 735 | 3300049741 | Ga0501079_0014405 | Ga0501079_0014405_1154_1918 | 228 |
| 736 | 3300049742 | Ga0501080_0476731 | Ga0501080_0476731_307_1068 | 228 |
| 737 | 3300049742 | Ga0501080_0739949 | Ga0501080_0739949_78_842 | 228 |
| 738 | 3300049824 | Ga0501045_0014518 | Ga0501045_0014518_3961_4725 | 228 |
| 739 | 3300050491 | nmdc:mga00v17_234983_c1 | nmdc:mga00v17_234983_c1_135_896 | 228 |
| 740 | 3300050491 | nmdc:mga00v17_442_c1 | nmdc:mga00v17_442_c1_300_1061 | 228 |
| 741 | 3300050492 | nmdc:mga0yw44_776_c1 | nmdc:mga0yw44_776_c1_8063_8824 | 228 |
| 742 | 3300050507 | nmdc:mga05p37_13198_c1 | nmdc:mga05p37_13198_c1_7117_7878 | 228 |
| 743 | 3300050507 | nmdc:mga05p37_156681_c1 | nmdc:mga05p37_156681_c1_201_1013 | 228 |
| 744 | 3300050507 | nmdc:mga05p37_206463_c1 | nmdc:mga05p37_206463_c1_199_960 | 228 |
| 745 | 3300050507 | nmdc:mga05p37_94528_c1 | nmdc:mga05p37_94528_c1_1834_2607 | 228 |
| 746 | 3300050508 | nmdc:mga09592_13361_c1 | nmdc:mga09592_13361_c1_3473_4246 | 228 |
| 747 | 3300050508 | nmdc:mga09592_200618_c1 | nmdc:mga09592_200618_c1_37_798 | 228 |
| 748 | 3300050508 | nmdc:mga09592_420440_c1 | nmdc:mga09592_420440_c1_43_804 | 228 |
| 749 | 3300050509 | nmdc:mga0qj67_42057_c1 | nmdc:mga0qj67_42057_c1_2135_2908 | 228 |
| 750 | 3300050509 | nmdc:mga0qj67_48_c1 | nmdc:mga0qj67_48_c1_27030_27791 | 228 |
| 751 | 3300050509 | nmdc:mga0qj67_5437_c1 | nmdc:mga0qj67_5437_c1_2334_3095 | 228 |
| 752 | 3300050510 | nmdc:mga06r32_97248_c1 | nmdc:mga06r32_97248_c1_300_1073 | 228 |
| 753 | 3300050511 | nmdc:mga08y16_83954_c1 | nmdc:mga08y16_83954_c1_1446_2258 | 228 |
| 754 | 3300050512 | nmdc:mga0n895_19256_c1 | nmdc:mga0n895_19256_c1_4139_4951 | 228 |
| 755 | 3300050513 | nmdc:mga0rr50_53114_c1 | nmdc:mga0rr50_53114_c1_2095_2907 | 228 |
| 756 | 3300050514 | nmdc:mga08x19_267599_c1 | nmdc:mga08x19_267599_c1_241_1002 | 228 |
| 757 | 3300050515 | nmdc:mga0a205_7200_c1 | nmdc:mga0a205_7200_c1_7809_8621 | 228 |
| 758 | 3300050516 | nmdc:mga0sz30_100178_c1 | nmdc:mga0sz30_100178_c1_456_1217 | 228 |
| 759 | 3300053077 | Ga0495601_0235849 | Ga0495601_0235849_227_997 | 228 |
| 760 | 3300053078 | Ga0495612_0000458 | Ga0495612_0000458_4210_4971 | 228 |
| 761 | 3300053084 | Ga0495595_0132960 | Ga0495595_0132960_33_794 | 228 |
| 762 | 3300053085 | Ga0495619_0033270 | Ga0495619_0033270_293_1054 | 228 |
| 763 | 3300053085 | Ga0495619_0101961 | Ga0495619_0101961_182_949 | 228 |
| 764 | 3300053088 | Ga0500644_0002440 | Ga0500644_0002440_1527_2288 | 228 |
| 765 | 3300053093 | Ga0500651_0056049 | Ga0500651_0056049_1463_2224 | 228 |
| 766 | 3300053094 | Ga0500566_0000140 | Ga0500566_0000140_29772_30533 | 228 |
| 767 | 3300053098 | Ga0500650_0025374 | Ga0500650_0025374_96_857 | 228 |
| 768 | 3300053100 | Ga0500660_056583 | Ga0500660_056583_173_934 | 228 |
| 769 | 3300053104 | Ga0500556_0000768 | Ga0500556_0000768_8383_9144 | 228 |
| 770 | 3300053131 | Ga0500652_041423 | Ga0500652_041423_36_797 | 228 |
| 771 | 3300054114 | Ga0501084_0115406 | Ga0501084_0115406_405_1169 | 228 |
| 772 | 3300061734 | Ga0530510_0103150 | Ga0530510_0103150_1013_1777 | 228 |
| 773 | 3300001979 | JGI24740J21852_10001702 | JGI24740J21852_1000170212 | 229 |
| 774 | 3300003752 | Ga0055539_1000008 | Ga0055539_1000008315 | 229 |
| 775 | 3300003756 | Ga0055533_1000001 | Ga0055533_1000001756 | 229 |
| 776 | 3300003759 | Ga0055525_1000497 | Ga0055525_100049720 | 229 |
| 777 | 3300003759 | Ga0055525_1001592 | Ga0055525_10015922 | 229 |
| 778 | 3300005327 | Ga0070658_10012817 | Ga0070658_100128178 | 229 |
| 779 | 3300006186 | Ga0075369_10033394 | Ga0075369_100333942 | 229 |
| 780 | 3300009148 | Ga0105243_10078580 | Ga0105243_100785802 | 229 |
| 781 | 3300011119 | Ga0105246_10002245 | Ga0105246_1000224513 | 229 |
| 782 | 3300011119 | Ga0105246_10003457 | Ga0105246_1000345712 | 229 |
| 783 | 3300013250 | Ga0171462_1003 | Ga0171462_1003521 | 229 |
| 784 | 3300013307 | Ga0157372_10077075 | Ga0157372_100770756 | 229 |
| 785 | 3300013307 | Ga0157372_10954889 | Ga0157372_109548891 | 229 |
| 786 | 3300013308 | Ga0157375_10239218 | Ga0157375_102392182 | 229 |
| 787 | 3300014325 | Ga0163163_10618679 | Ga0163163_106186792 | 229 |
| 788 | 3300014969 | Ga0157376_10366729 | Ga0157376_103667292 | 229 |
| 789 | 3300020081 | Ga0206354_11335766 | Ga0206354_113357662 | 229 |
| 790 | 3300020082 | Ga0206353_11910771 | Ga0206353_119107713 | 229 |
| 791 | 3300025225 | Ga0209566_100050 | Ga0209566_100050232 | 229 |
| 792 | 3300025226 | Ga0209674_100001 | Ga0209674_100001756 | 229 |
| 793 | 3300025230 | Ga0209563_100001 | Ga0209563_100001756 | 229 |
| 794 | 3300025230 | Ga0209563_100276 | Ga0209563_1002769 | 229 |
| 795 | 3300025253 | Ga0209677_100001 | Ga0209677_100001756 | 229 |
| 796 | 3300025272 | Ga0209455_1001463 | Ga0209455_10014637 | 229 |
| 797 | 3300025909 | Ga0207705_10081202 | Ga0207705_100812023 | 229 |
| 798 | 3300025935 | Ga0207709_10018497 | Ga0207709_100184974 | 229 |
| 799 | 3300025937 | Ga0207669_10316313 | Ga0207669_103163131 | 229 |
| 800 | 3300026121 | Ga0207683_10177752 | Ga0207683_101777521 | 229 |
| 801 | 3300026142 | Ga0207698_10124834 | Ga0207698_101248342 | 229 |
| 802 | 3300031548 | Ga0307408_100007323 | Ga0307408_1000073237 | 229 |
| 803 | 3300031548 | Ga0307408_100015791 | Ga0307408_1000157912 | 229 |
| 804 | 3300031548 | Ga0307408_100069259 | Ga0307408_1000692593 | 229 |
| 805 | 3300031731 | Ga0307405_10224046 | Ga0307405_102240462 | 229 |
| 806 | 3300031824 | Ga0307413_10209587 | Ga0307413_102095871 | 229 |
| 807 | 3300031824 | Ga0307413_10270273 | Ga0307413_102702732 | 229 |
| 808 | 3300031852 | Ga0307410_10008763 | Ga0307410_100087633 | 229 |
| 809 | 3300031901 | Ga0307406_10357034 | Ga0307406_103570341 | 229 |
| 810 | 3300031903 | Ga0307407_10041438 | Ga0307407_100414382 | 229 |
| 811 | 3300031911 | Ga0307412_10002338 | Ga0307412_100023383 | 229 |
| 812 | 3300031911 | Ga0307412_10015415 | Ga0307412_100154156 | 229 |
| 813 | 3300031911 | Ga0307412_10034617 | Ga0307412_100346174 | 229 |
| 814 | 3300031911 | Ga0307412_10094398 | Ga0307412_100943982 | 229 |
| 815 | 3300031911 | Ga0307412_10095669 | Ga0307412_100956692 | 229 |
| 816 | 3300037312 | Ga0395899_0018679 | Ga0395899_0018679_2712_3482 | 229 |
| 817 | 3300037312 | Ga0395899_0179366 | Ga0395899_0179366_128_892 | 229 |
| 818 | 3300037418 | Ga0395900_0172883 | Ga0395900_0172883_18_782 | 229 |
| 819 | 3300037418 | Ga0395900_0220293 | Ga0395900_0220293_880_1644 | 229 |
| 820 | 3300037466 | Ga0395898_0047481 | Ga0395898_0047481_1793_2557 | 229 |
| 821 | 3300037466 | Ga0395898_0558151 | Ga0395898_0558151_285_1049 | 229 |
| 822 | 3300037466 | Ga0395898_0728205 | Ga0395898_0728205_34_798 | 229 |
| 823 | 3300038443 | Ga0395901_0449780 | Ga0395901_0449780_401_1165 | 229 |
| 824 | 3300041451 | Ga0451791_0529767 | Ga0451791_0529767_23_787 | 229 |
| 825 | 3300042002 | Ga0439442_000270 | Ga0439442_000270_10067_10831 | 229 |
| 826 | 3300042016 | Ga0439463_002010 | Ga0439463_002010_1557_2321 | 229 |
| 827 | 3300042146 | Ga0450907_002416 | Ga0450907_002416_643_1407 | 229 |
| 828 | 3300042435 | Ga0439434_0000397 | Ga0439434_0000397_9716_10480 | 229 |
| 829 | 3300042435 | Ga0439434_0053989 | Ga0439434_0053989_427_1191 | 229 |
| 830 | 3300042531 | Ga0450918_000574 | Ga0450918_000574_1816_2580 | 229 |
| 831 | 3300044658 | Ga0466972_0008570 | Ga0466972_0008570_2389_3153 | 229 |
| 832 | 3300044658 | Ga0466972_0012105 | Ga0466972_0012105_146_910 | 229 |
| 833 | 3300044684 | Ga0466966_0035728 | Ga0466966_0035728_2173_2937 | 229 |
| 834 | 3300044684 | Ga0466966_0123848 | Ga0466966_0123848_314_1078 | 229 |
| 835 | 3300044693 | Ga0466961_0019240 | Ga0466961_0019240_475_1239 | 229 |
| 836 | 3300044693 | Ga0466961_0022427 | Ga0466961_0022427_839_1603 | 229 |
| 837 | 3300044693 | Ga0466961_0048034 | Ga0466961_0048034_178_942 | 229 |
| 838 | 3300044706 | Ga0466964_0176863 | Ga0466964_0176863_70_834 | 229 |
| 839 | 3300044719 | Ga0466971_0016902 | Ga0466971_0016902_1812_2576 | 229 |
| 840 | 3300044735 | Ga0466968_0056699 | Ga0466968_0056699_664_1428 | 229 |
| 841 | 3300044735 | Ga0466968_0101214 | Ga0466968_0101214_56_823 | 229 |
| 842 | 3300044765 | Ga0466970_0000096 | Ga0466970_0000096_7391_8155 | 229 |
| 843 | 3300044765 | Ga0466970_0008859 | Ga0466970_0008859_1944_2708 | 229 |
| 844 | 3300044765 | Ga0466970_0014509 | Ga0466970_0014509_199_963 | 229 |
| 845 | 3300044765 | Ga0466970_0070401 | Ga0466970_0070401_596_1360 | 229 |
| 846 | 3300044842 | Ga0466957_0013971 | Ga0466957_0013971_240_1004 | 229 |
| 847 | 3300044901 | Ga0466960_0015060 | Ga0466960_0015060_422_1186 | 229 |
| 848 | 3300045049 | Ga0466959_0028311 | Ga0466959_0028311_1460_2224 | 229 |
| 849 | 3300045836 | Ga0466958_0088508 | Ga0466958_0088508_489_1253 | 229 |
| 850 | 3300046463 | Ga0495653_0022798 | Ga0495653_0022798_2757_3521 | 229 |
| 851 | 3300046471 | Ga0495650_0000591 | Ga0495650_0000591_40045_40809 | 229 |
| 852 | 3300046476 | Ga0495662_0030409 | Ga0495662_0030409_471_1235 | 229 |
| 853 | 3300046477 | Ga0495664_0001467 | Ga0495664_0001467_9778_10542 | 229 |
| 854 | 3300046517 | Ga0495630_0253858 | Ga0495630_0253858_532_1296 | 229 |
| 855 | 3300046531 | Ga0495665_0024932 | Ga0495665_0024932_472_1236 | 229 |
| 856 | 3300046535 | Ga0495586_0023658 | Ga0495586_0023658_855_1619 | 229 |
| 857 | 3300046536 | Ga0495587_0034941 | Ga0495587_0034941_67_831 | 229 |
| 858 | 3300046543 | Ga0495645_0000314 | Ga0495645_0000314_2113_2877 | 229 |
| 859 | 3300046559 | Ga0495667_0000209 | Ga0495667_0000209_6577_7341 | 229 |
| 860 | 3300046663 | Ga0495635_0413101 | Ga0495635_0413101_120_884 | 229 |
| 861 | 3300046683 | Ga0495658_0120290 | Ga0495658_0120290_338_1102 | 229 |
| 862 | 3300046809 | Ga0495600_0004319 | Ga0495600_0004319_2380_3144 | 229 |
| 863 | 3300047315 | Ga0495581_0003074 | Ga0495581_0003074_5589_6353 | 229 |
| 864 | 3300047315 | Ga0495581_0055046 | Ga0495581_0055046_365_1129 | 229 |
| 865 | 3300047319 | Ga0495674_0269931 | Ga0495674_0269931_353_1117 | 229 |
| 866 | 3300047322 | Ga0495680_0039758 | Ga0495680_0039758_1512_2276 | 229 |
| 867 | 3300047444 | Ga0495675_0040133 | Ga0495675_0040133_1110_1874 | 229 |
| 868 | 3300047471 | Ga0495684_0138444 | Ga0495684_0138444_64_828 | 229 |
| 869 | 3300048903 | Ga0496100_0333718 | Ga0496100_0333718_188_952 | 229 |
| 870 | 3300048905 | Ga0496102_0402479 | Ga0496102_0402479_180_944 | 229 |
| 871 | 3300048907 | Ga0496104_0068414 | Ga0496104_0068414_2309_3073 | 229 |
| 872 | 3300048907 | Ga0496104_0542616 | Ga0496104_0542616_297_1061 | 229 |
| 873 | 3300048908 | Ga0496105_0011381 | Ga0496105_0011381_262_1026 | 229 |
| 874 | 3300048908 | Ga0496105_0037487 | Ga0496105_0037487_1856_2620 | 229 |
| 875 | 3300048910 | Ga0496107_0122546 | Ga0496107_0122546_284_1048 | 229 |
| 876 | 3300048910 | Ga0496107_0389988 | Ga0496107_0389988_11_775 | 229 |
| 877 | 3300048911 | Ga0496108_0002013 | Ga0496108_0002013_14363_15127 | 229 |
| 878 | 3300048911 | Ga0496108_0271617 | Ga0496108_0271617_309_1073 | 229 |
| 879 | 3300048912 | Ga0496109_0318972 | Ga0496109_0318972_386_1150 | 229 |
| 880 | 3300048913 | Ga0496110_0002211 | Ga0496110_0002211_13440_14204 | 229 |
| 881 | 3300048914 | Ga0496111_0112449 | Ga0496111_0112449_115_879 | 229 |
| 882 | 3300048917 | Ga0496114_0163424 | Ga0496114_0163424_255_1019 | 229 |
| 883 | 3300048918 | Ga0496115_0021354 | Ga0496115_0021354_2052_2816 | 229 |
| 884 | 3300048918 | Ga0496115_0115861 | Ga0496115_0115861_227_991 | 229 |
| 885 | 3300048924 | Ga0496121_0003923 | Ga0496121_0003923_7686_8450 | 229 |
| 886 | 3300048925 | Ga0496122_0009222 | Ga0496122_0009222_7249_8013 | 229 |
| 887 | 3300048926 | Ga0496123_0010117 | Ga0496123_0010117_2907_3671 | 229 |
| 888 | 3300048929 | Ga0496126_0013859 | Ga0496126_0013859_4090_4854 | 229 |
| 889 | 3300049573 | Ga0501037_0030311 | Ga0501037_0030311_2217_2990 | 229 |
| 890 | 3300049574 | Ga0501038_0136226 | Ga0501038_0136226_291_1058 | 229 |
| 891 | 3300049574 | Ga0501038_0403667 | Ga0501038_0403667_228_1001 | 229 |
| 892 | 3300049579 | Ga0501043_0236438 | Ga0501043_0236438_141_914 | 229 |
| 893 | 3300049581 | Ga0501047_0010095 | Ga0501047_0010095_365_1138 | 229 |
| 894 | 3300049583 | Ga0501067_0153613 | Ga0501067_0153613_316_1089 | 229 |
| 895 | 3300049586 | Ga0501070_0010680 | Ga0501070_0010680_2144_2947 | 229 |
| 896 | 3300049586 | Ga0501070_0315246 | Ga0501070_0315246_88_855 | 229 |
| 897 | 3300049589 | Ga0501073_0000366 | Ga0501073_0000366_14402_15175 | 229 |
| 898 | 3300049822 | Ga0501035_0012980 | Ga0501035_0012980_1698_2471 | 229 |
| 899 | 3300049823 | Ga0501044_0003649 | Ga0501044_0003649_1838_2611 | 229 |
| 900 | 3300050492 | nmdc:mga0yw44_1010_c1 | nmdc:mga0yw44_1010_c1_9853_10629 | 229 |
| 901 | 3300050516 | nmdc:mga0sz30_11757_c1 | nmdc:mga0sz30_11757_c1_603_1391 | 229 |
| 902 | 3300053080 | Ga0500635_0000016 | Ga0500635_0000016_102108_102872 | 229 |
| 903 | 3300053108 | Ga0500562_000448 | Ga0500562_000448_176_949 | 229 |
| 904 | 3300053139 | Ga0500568_0000327 | Ga0500568_0000327_3728_4495 | 229 |
| 905 | 3300053139 | Ga0500568_0025483 | Ga0500568_0025483_1682_2446 | 229 |
| 906 | 3300053153 | Ga0500616_0000071 | Ga0500616_0000071_87377_88144 | 229 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8bi0-assembly1.cif.gz_A | abcg2 turnover-2 state with tariquidar bound | 0.7522 | 114 | 224 |
| 8bht-assembly1.cif.gz_A | abcg2 turnover-1 state with tariquidar bound | 0.7402 | 114 | 223 |
| 7jr7-assembly1.cif.gz_A | cryo-em structure of abcg5/g8 in complex with fab 2e10 and 11f4 | 0.7387 | 113 | 225 |
| 8p8a-assembly1.cif.gz_A | structure of 5d3-fab and nanobody(nb17)-bound abcg2 | 0.7379 | 114 | 220 |
| 8p8a-assembly1.cif.gz_B | structure of 5d3-fab and nanobody(nb17)-bound abcg2 | 0.7379 | 114 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E0AHB5_1_108_1.20.120.340 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Flagellar protein FliS | 0.4832 | 111 | 219 | 1.20.120.340 |
| 1gnlA02 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.468 | 120 | 227 | 1.20.1270.20 |
| af_K7LSM9_1_176_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.4321 | 121 | 222 | 1.20.1080.10 |
| 1gnlA02 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.4295 | 120 | 227 | 1.20.1270.20 |
| 3gm6A03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.4148 | 98 | 225 | 1.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q9MLE9-F1-model_v4 | ABC-2 type transporter transmembrane domain-containing protein | 0.9374 | 114 | 227 |
GO:0016020
GO:0140359 |
| AF-A0A2N3FQK2-F1-model_v4 | ABC transporter permease | 0.9202 | 129 | 228 |
GO:0016020
|
| AF-A0A6B3FYG4-F1-model_v4 | ABC transporter permease | 0.9161 | 114 | 229 |
GO:0016020
GO:0140359 |
| AF-A0A0Q9MLE9-F1-model_v4 | ABC-2 type transporter transmembrane domain-containing protein | 0.9142 | 114 | 227 |
GO:0016020
GO:0140359 |
| AF-D6M663-F1-model_v4 | ABC transporter, permease | 0.9108 | 114 | 229 |
GO:0016020
GO:0140359 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar