F485325

General Info

Members Datasets Scaffolds Average Seq Length
905 268 1810 234

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_178560_c1|nmdc:mga09592_178560_c1_877_1716
Length 268
Sequence VRNTGVVRTYGQYCPIARGAEIFAERWTPLIIRNLHVGCGSFSEILEGAPGLSRTLLSERLKQLERLGVVKSAPKPDGRGHHYELTPAGHDLFTVCQSLGEWGARWLEIAPENLDPFVALWSMCNALRRDRLPDRRVVIRFDFLARRSASREGGTGRPPAFAARLSSPVQNEASGGGRRERYWLLIELGDTEICKTNPGLDEDLYITAEAEAFVKWHAGQLTWAQATRDGRIQLDGPPSLVRAFPTWNARSMFAHIRPVSRTATSSAG

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
168 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
169 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
170 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
171 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
172 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
173 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
174 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
175 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
176 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
177 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
178 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
179 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
180 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
181 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
182 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
183 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
184 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
185 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
186 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
187 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
190 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
191 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
260 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
261 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
262 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
263 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
264 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
265 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
266 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
267 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
268 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0.88
Rhizoplane 1.77
Rhizosphere 97.13
Stem 0
Stem Tuber 0
Unclassified 0.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_178560_c1 3300050508 Bacteria 1836
2 JGI24737J22298_10097054 3300001990 Bacteria 874
3 JGI24750J21931_1005016 3300002070 Bacteria 1619
4 JGI25406J46586_10002026 3300003203 Bacteria 9562
5 JGI25406J46586_10027296 3300003203 Bacteria 2191
6 Ga0065707_10084192 3300005295 Bacteria 7549
7 Ga0070676_10115795 3300005328 Bacteria 1675
8 Ga0070690_100023931 3300005330 Bacteria 3752
9 Ga0068869_100447073 3300005334 Bacteria 1071
10 Ga0068869_100669332 3300005334 Bacteria 883
11 Ga0070682_100193823 3300005337 Bacteria 1428
12 Ga0068868_100007858 3300005338 Bacteria 7613
13 Ga0068868_100433681 3300005338 Bacteria 1140
14 Ga0070660_100121697 3300005339 Bacteria 2083
15 Ga0070660_100244897 3300005339 Bacteria 1461
16 Ga0070689_100019982 3300005340 Bacteria 4963
17 Ga0070691_10029071 3300005341 Bacteria 2585
18 Ga0070691_10047084 3300005341 Bacteria 2050
19 Ga0070691_10204578 3300005341 Bacteria 1039
20 Ga0070687_100015244 3300005343 Bacteria 3470
21 Ga0070692_10072312 3300005345 Bacteria 1840
22 Ga0070668_100006249 3300005347 Bacteria 8822
23 Ga0070668_100064262 3300005347 Bacteria 2845
24 Ga0070669_100037398 3300005353 Bacteria 3521
25 Ga0070669_100566138 3300005353 Bacteria 949
26 Ga0070675_100051359 3300005354 Bacteria 3388
27 Ga0070671_100190307 3300005355 Bacteria 1739
28 Ga0070674_100167830 3300005356 Bacteria 1671
29 Ga0070688_100021505 3300005365 Bacteria 3769
30 Ga0070659_100024159 3300005366 Bacteria 4657
31 Ga0070659_100049819 3300005366 Bacteria 3294
32 Ga0070659_100086706 3300005366 Bacteria 2506
33 Ga0070667_100006205 3300005367 Bacteria 9944
34 Ga0070709_10012970 3300005434 Bacteria 4675
35 Ga0070709_10041095 3300005434 Bacteria 2847
36 Ga0070709_10140300 3300005434 Bacteria 1660
37 Ga0070713_100002425 3300005436 Bacteria 12154
38 Ga0070713_100081674 3300005436 Bacteria 2758
39 Ga0070713_100210507 3300005436 Bacteria 1760
40 Ga0070710_10024918 3300005437 Bacteria 3161
41 Ga0070701_10000802 3300005438 Bacteria 11224
42 Ga0070701_10125840 3300005438 Bacteria 1450
43 Ga0070711_100002361 3300005439 Bacteria 10733
44 Ga0070711_100276959 3300005439 Bacteria 1326
45 Ga0070705_100011444 3300005440 Bacteria 4475
46 Ga0070705_100279553 3300005440 Bacteria 1186
47 Ga0070700_100016733 3300005441 Bacteria 4181
48 Ga0070694_100059857 3300005444 Bacteria 2596
49 Ga0070694_100070228 3300005444 Bacteria 2411
50 Ga0070663_100019735 3300005455 Bacteria 4451
51 Ga0070678_100002715 3300005456 Bacteria 9767
52 Ga0070678_100113040 3300005456 Bacteria 2128
53 Ga0070662_100033292 3300005457 Bacteria 3627
54 Ga0070662_100722262 3300005457 Bacteria 844
55 Ga0068867_100003221 3300005459 Bacteria 11509
56 Ga0070679_100200486 3300005530 Bacteria 1962
57 Ga0068853_100790148 3300005539 Bacteria 908
58 Ga0068853_100870175 3300005539 Bacteria 865
59 Ga0070672_100094912 3300005543 Bacteria 2412
60 Ga0070672_100332798 3300005543 Bacteria 1292
61 Ga0070686_100104501 3300005544 Bacteria 1919
62 Ga0070696_100195102 3300005546 Bacteria 1509
63 Ga0070693_100036062 3300005547 Bacteria 2747
64 Ga0070693_100113604 3300005547 Bacteria 1670
65 Ga0068855_100321003 3300005563 Bacteria 1712
66 Ga0068855_100483515 3300005563 Bacteria 1347
67 Ga0068856_100118486 3300005614 Bacteria 2648
68 Ga0068856_100259835 3300005614 Bacteria 1752
69 Ga0070702_100056039 3300005615 Bacteria 2275
70 Ga0068852_100105980 3300005616 Bacteria 2548
71 Ga0068852_100191773 3300005616 Bacteria 1929
72 Ga0068864_100269235 3300005618 Bacteria 1587
73 Ga0068866_10061824 3300005718 Bacteria 1946
74 Ga0068866_10181646 3300005718 Bacteria 1243
75 Ga0068861_100000307 3300005719 Bacteria 27379
76 Ga0068861_100029504 3300005719 Bacteria 4013
77 Ga0068861_100065787 3300005719 Bacteria 2793
78 Ga0068863_101061245 3300005841 Bacteria 814
79 Ga0068858_100000440 3300005842 Bacteria 43437
80 Ga0081455_10001898 3300005937 Bacteria 25151
81 Ga0081455_10003263 3300005937 Bacteria 18769
82 Ga0081455_10003430 3300005937 Bacteria 18219
83 Ga0081455_10003469 3300005937 Bacteria 18116
84 Ga0081455_10003963 3300005937 Bacteria 16804
85 Ga0081455_10016556 3300005937 Bacteria 7112
86 Ga0081455_10018893 3300005937 Bacteria 6539
87 Ga0081455_10021078 3300005937 Bacteria 6120
88 Ga0081455_10023422 3300005937 Bacteria 5745
89 Ga0081455_10026643 3300005937 Bacteria 5310
90 Ga0081455_10027234 3300005937 Bacteria 5238
91 Ga0081455_10029096 3300005937 Bacteria 5040
92 Ga0081455_10033756 3300005937 Bacteria 4594
93 Ga0081455_10108346 3300005937 Bacteria 2213
94 Ga0081455_10110936 3300005937 Bacteria 2180
95 Ga0081455_10150191 3300005937 Bacteria 1797
96 Ga0081455_10320032 3300005937 Bacteria 1105
97 Ga0081538_10001179 3300005981 Bacteria 27583
98 Ga0081538_10001329 3300005981 Bacteria 25435
99 Ga0081538_10004786 3300005981 Bacteria 12369
100 Ga0081538_10009207 3300005981 Bacteria 8274
101 Ga0081538_10011658 3300005981 Bacteria 7107
102 Ga0081538_10013588 3300005981 Bacteria 6439
103 Ga0081538_10016503 3300005981 Bacteria 5658
104 Ga0081538_10032659 3300005981 Bacteria 3481
105 Ga0081538_10041203 3300005981 Bacteria 2934
106 Ga0081538_10055647 3300005981 Bacteria 2326
107 Ga0081538_10067617 3300005981 Bacteria 1993
108 Ga0081540_1000957 3300005983 Bacteria 26043
109 Ga0081540_1001401 3300005983 Bacteria 20894
110 Ga0081540_1031114 3300005983 Bacteria 2942
111 Ga0081539_10001875 3300005985 Bacteria 33004
112 Ga0081539_10008043 3300005985 Bacteria 9342
113 Ga0081539_10009090 3300005985 Bacteria 8416
114 Ga0081539_10020618 3300005985 Bacteria 4444
115 Ga0070717_10577697 3300006028 Bacteria 1019
116 Ga0075432_10012558 3300006058 Bacteria 2877
117 Ga0070715_10002571 3300006163 Bacteria 5601
118 Ga0070716_100013660 3300006173 Bacteria 4143
119 Ga0070716_100033660 3300006173 Bacteria 2804
120 Ga0070716_100062544 3300006173 Bacteria 2158
121 Ga0070712_100001270 3300006175 Bacteria 15233
122 Ga0075362_10123673 3300006177 Bacteria 1226
123 Ga0075427_10017835 3300006194 Bacteria 1110
124 Ga0097621_100382701 3300006237 Bacteria 1257
125 Ga0068871_100017978 3300006358 Bacteria 5363
126 Ga0075428_100005941 3300006844 Bacteria 13566
127 Ga0075428_100010310 3300006844 Bacteria 10369
128 Ga0075428_100024830 3300006844 Bacteria 6630
129 Ga0075428_100025691 3300006844 Bacteria 6521
130 Ga0075428_100036338 3300006844 Bacteria 5426
131 Ga0075428_100044011 3300006844 Bacteria 4907
132 Ga0075428_100049533 3300006844 Bacteria 4608
133 Ga0075428_100065120 3300006844 Bacteria 3991
134 Ga0075428_100104550 3300006844 Bacteria 3088
135 Ga0075428_100272104 3300006844 Bacteria 1822
136 Ga0075428_100364202 3300006844 Bacteria 1551
137 Ga0075428_100508706 3300006844 Bacteria 1288
138 Ga0075428_100670247 3300006844 Bacteria 1106
139 Ga0075428_100783787 3300006844 Bacteria 1014
140 Ga0075428_100820831 3300006844 Bacteria 988
141 Ga0075430_100002919 3300006846 Bacteria 14298
142 Ga0075430_100007671 3300006846 Bacteria 9115
143 Ga0075430_100008188 3300006846 Bacteria 8832
144 Ga0075430_100025651 3300006846 Bacteria 5016
145 Ga0075430_100068732 3300006846 Bacteria 2972
146 Ga0075430_100095300 3300006846 Bacteria 2487
147 Ga0075430_100252899 3300006846 Bacteria 1460
148 Ga0075430_100346097 3300006846 Bacteria 1228
149 Ga0075430_100368665 3300006846 Bacteria 1186
150 Ga0075431_100001207 3300006847 Bacteria 23348
151 Ga0075431_100021924 3300006847 Bacteria 6530
152 Ga0075431_100022559 3300006847 Bacteria 6436
153 Ga0075431_100037507 3300006847 Bacteria 4993
154 Ga0075431_100253295 3300006847 Bacteria 1788
155 Ga0075431_100272054 3300006847 Bacteria 1716
156 Ga0075431_100354163 3300006847 Bacteria 1475
157 Ga0075433_10007508 3300006852 Bacteria 8654
158 Ga0075433_10016912 3300006852 Bacteria 6027
159 Ga0075433_10032369 3300006852 Bacteria 4479
160 Ga0075433_10060055 3300006852 Bacteria 3328
161 Ga0075433_10429074 3300006852 Bacteria 1165
162 Ga0075434_100016486 3300006871 Bacteria 7103
163 Ga0075434_100025697 3300006871 Bacteria 5763
164 Ga0075434_100095443 3300006871 Bacteria 2979
165 Ga0075434_100403428 3300006871 Bacteria 1388
166 Ga0075429_100004586 3300006880 Bacteria 11876
167 Ga0075429_100007802 3300006880 Bacteria 9296
168 Ga0075429_100009847 3300006880 Bacteria 8287
169 Ga0075429_100031876 3300006880 Bacteria 4581
170 Ga0075429_100158120 3300006880 Bacteria 1985
171 Ga0075429_100161591 3300006880 Bacteria 1962
172 Ga0075429_100212553 3300006880 Bacteria 1694
173 Ga0075429_100242587 3300006880 Bacteria 1578
174 Ga0075429_100401911 3300006880 Bacteria 1200
175 Ga0068865_100008992 3300006881 Bacteria 6181
176 Ga0068865_100481322 3300006881 Bacteria 1032
177 Ga0075436_100020064 3300006914 Bacteria 4586
178 Ga0075435_100217337 3300007076 Bacteria 1622
179 Ga0105240_10565048 3300009093 Bacteria 1257
180 Ga0105240_10894276 3300009093 Bacteria 956
181 Ga0105240_10974884 3300009093 Bacteria 908
182 Ga0111539_10006541 3300009094 Bacteria 15017
183 Ga0111539_10034991 3300009094 Bacteria 6083
184 Ga0111539_10124835 3300009094 Bacteria 3017
185 Ga0111539_10353915 3300009094 Bacteria 1709
186 Ga0105245_10010633 3300009098 Bacteria 8007
187 Ga0105245_10197338 3300009098 Bacteria 1931
188 Ga0105245_10303167 3300009098 Bacteria 1568
189 Ga0105247_10000584 3300009101 Bacteria 29668
190 Ga0105247_10073863 3300009101 Bacteria 2138
191 Ga0114129_10006506 3300009147 Bacteria 16576
192 Ga0114129_10008121 3300009147 Bacteria 14959
193 Ga0114129_10012228 3300009147 Bacteria 12211
194 Ga0114129_10012505 3300009147 Bacteria 12085
195 Ga0114129_10024194 3300009147 Bacteria 8608
196 Ga0114129_10032371 3300009147 Bacteria 7389
197 Ga0114129_10073125 3300009147 Bacteria 4776
198 Ga0114129_10075432 3300009147 Bacteria 4695
199 Ga0114129_10082385 3300009147 Bacteria 4470
200 Ga0114129_10099531 3300009147 Bacteria 4024
201 Ga0114129_10185961 3300009147 Bacteria 2823
202 Ga0114129_10250032 3300009147 Bacteria 2380
203 Ga0114129_10495960 3300009147 Bacteria 1595
204 Ga0114129_10587244 3300009147 Bacteria 1445
205 Ga0114129_11532625 3300009147 Bacteria 818
206 Ga0114129_11577094 3300009147 Bacteria 804
207 Ga0105243_10009400 3300009148 Bacteria 7450
208 Ga0105243_10131010 3300009148 Bacteria 2127
209 Ga0105241_10071846 3300009174 Bacteria 2688
210 Ga0105241_10347697 3300009174 Bacteria 1286
211 Ga0105242_10003225 3300009176 Bacteria 12717
212 Ga0105242_10559797 3300009176 Bacteria 1098
213 Ga0105248_10014990 3300009177 Bacteria 8533
214 Ga0105237_10036314 3300009545 Bacteria 4985
215 Ga0105237_10293733 3300009545 Bacteria 1628
216 Ga0105237_10452365 3300009545 Bacteria 1290
217 Ga0105238_10239112 3300009551 Bacteria 1793
218 Ga0105249_10024146 3300009553 Bacteria 5462
219 Ga0105249_10367987 3300009553 Bacteria 1460
220 Ga0105249_10629437 3300009553 Bacteria 1129
221 Ga0105239_10005314 3300010375 Bacteria 15120
222 Ga0105239_10025955 3300010375 Bacteria 6451
223 Ga0105246_10138325 3300011119 Bacteria 1828
224 Ga0157320_1006836 3300012481 Bacteria 801
225 Ga0157371_10047627 3300013102 Bacteria 3048
226 Ga0157370_10417917 3300013104 Bacteria 1234
227 Ga0157369_10012394 3300013105 Bacteria 9679
228 Ga0157369_10344653 3300013105 Bacteria 1548
229 Ga0157374_10047824 3300013296 Bacteria 3967
230 Ga0157374_10609405 3300013296 Bacteria 1102
231 Ga0157378_10005026 3300013297 Bacteria 11608
232 Ga0157378_10030720 3300013297 Bacteria 4744
233 Ga0163162_10040972 3300013306 Bacteria 4633
234 Ga0163162_10188080 3300013306 Bacteria 2192
235 Ga0163162_10588259 3300013306 Bacteria 1240
236 Ga0157372_10000875 3300013307 Bacteria 32716
237 Ga0157372_10026333 3300013307 Bacteria 6327
238 Ga0157375_10010499 3300013308 Bacteria 8153
239 Ga0157375_10751096 3300013308 Bacteria 1127
240 Ga0163163_10952410 3300014325 Bacteria 922
241 Ga0157377_10102314 3300014745 Bacteria 1709
242 Ga0157377_10141180 3300014745 Bacteria 1480
243 Ga0157379_10001901 3300014968 Bacteria 17267
244 Ga0157376_10245875 3300014969 Bacteria 1669
245 Ga0157376_10604950 3300014969 Bacteria 1091
246 Ga0163161_10161548 3300017792 Bacteria 1708
247 Ga0163161_10196553 3300017792 Bacteria 1553
248 Ga0163161_10277535 3300017792 Bacteria 1313
249 Ga0207692_10122159 3300025898 Bacteria 1460
250 Ga0207642_10000230 3300025899 Bacteria 16535
251 Ga0207710_10003445 3300025900 Bacteria 7053
252 Ga0207688_10000910 3300025901 Bacteria 14940
253 Ga0207685_10002006 3300025905 Bacteria 4526
254 Ga0207699_10005329 3300025906 Bacteria 6162
255 Ga0207699_10028439 3300025906 Bacteria 3107
256 Ga0207645_10041310 3300025907 Bacteria 2952
257 Ga0207684_10387963 3300025910 Bacteria 1201
258 Ga0207684_10508137 3300025910 Bacteria 1033
259 Ga0207654_10221500 3300025911 Bacteria 1255
260 Ga0207671_10075057 3300025914 Bacteria 2528
261 Ga0207693_10000614 3300025915 Bacteria 31922
262 Ga0207693_10100963 3300025915 Bacteria 2262
263 Ga0207663_10002572 3300025916 Bacteria 8730
264 Ga0207660_10600787 3300025917 Bacteria 896
265 Ga0207657_10299817 3300025919 Bacteria 1273
266 Ga0207681_10221019 3300025923 Bacteria 1465
267 Ga0207681_10269615 3300025923 Bacteria 1336
268 Ga0207659_10163887 3300025926 Bacteria 1748
269 Ga0207687_10004910 3300025927 Bacteria 8883
270 Ga0207687_10025683 3300025927 Bacteria 3942
271 Ga0207700_10013974 3300025928 Bacteria 5247
272 Ga0207664_10074993 3300025929 Bacteria 2734
273 Ga0207664_10410589 3300025929 Bacteria 1205
274 Ga0207690_10053538 3300025932 Bacteria 2708
275 Ga0207690_10091581 3300025932 Bacteria 2149
276 Ga0207686_10004045 3300025934 Bacteria 7870
277 Ga0207686_10313549 3300025934 Bacteria 1169
278 Ga0207686_10339828 3300025934 Bacteria 1127
279 Ga0207709_10031625 3300025935 Bacteria 3093
280 Ga0207709_10158248 3300025935 Bacteria 1577
281 Ga0207669_10000085 3300025937 Bacteria 47505
282 Ga0207704_10018460 3300025938 Bacteria 3641
283 Ga0207665_10012387 3300025939 Bacteria 5602
284 Ga0207665_10042662 3300025939 Bacteria 3032
285 Ga0207665_10106916 3300025939 Bacteria 1961
286 Ga0207691_10458804 3300025940 Bacteria 1084
287 Ga0207711_10026873 3300025941 Bacteria 4831
288 Ga0207711_10542377 3300025941 Bacteria 1085
289 Ga0207689_10156380 3300025942 Bacteria 1879
290 Ga0207667_10163213 3300025949 Bacteria 2291
291 Ga0207712_10030695 3300025961 Bacteria 3615
292 Ga0207712_10177054 3300025961 Bacteria 1672
293 Ga0207712_10281369 3300025961 Bacteria 1358
294 Ga0207668_10006550 3300025972 Bacteria 6883
295 Ga0207668_10286327 3300025972 Bacteria 1354
296 Ga0207640_10012787 3300025981 Bacteria 4793
297 Ga0207677_10001633 3300026023 Bacteria 11908
298 Ga0207677_10506273 3300026023 Bacteria 1045
299 Ga0207703_10019451 3300026035 Bacteria 5307
300 Ga0207703_10051829 3300026035 Bacteria 3329
301 Ga0207678_10153461 3300026067 Bacteria 1967
302 Ga0207708_10000329 3300026075 Bacteria 37329
303 Ga0207702_10350583 3300026078 Bacteria 1412
304 Ga0207648_10000112 3300026089 Bacteria 78746
305 Ga0207675_100000117 3300026118 Bacteria 64829
306 Ga0207675_100035018 3300026118 Bacteria 4682
307 Ga0207675_100071213 3300026118 Bacteria 3250
308 Ga0207675_100101674 3300026118 Bacteria 2708
309 Ga0207683_10000451 3300026121 Bacteria 38077
310 Ga0207683_10080796 3300026121 Bacteria 2884
311 Ga0207698_10114301 3300026142 Bacteria 2270
312 Ga0207698_11104688 3300026142 Bacteria 806
313 Ga0209971_1021740 3300027682 Bacteria 1527
314 Ga0209998_10009386 3300027717 Bacteria 2031
315 Ga0209974_10003935 3300027876 Bacteria 5313
316 Ga0209974_10006008 3300027876 Bacteria 4249
317 Ga0207428_10014509 3300027907 Bacteria 6839
318 Ga0207428_10076101 3300027907 Bacteria 2629
319 Ga0207428_10134220 3300027907 Bacteria 1893
320 Ga0207428_10148745 3300027907 Bacteria 1784
321 Ga0207428_10365340 3300027907 Bacteria 1060
322 Ga0268266_10477631 3300028379 Bacteria 1188
323 Ga0268265_10108343 3300028380 Bacteria 2261
324 Ga0268264_10008289 3300028381 Bacteria 8635
325 Ga0307408_100019491 3300031548 Bacteria 4567
326 Ga0307408_100030919 3300031548 Bacteria 3723
327 Ga0307408_100249514 3300031548 Bacteria 1463
328 Ga0307405_10024214 3300031731 Bacteria 3464
329 Ga0307405_10055521 3300031731 Bacteria 2479
330 Ga0307410_10025610 3300031852 Bacteria 3704
331 Ga0307410_10172954 3300031852 Bacteria 1629
332 Ga0307406_10005733 3300031901 Bacteria 6800
333 Ga0307407_10067677 3300031903 Bacteria 2112
334 Ga0307412_10005612 3300031911 Bacteria 7046
335 Ga0307412_10254880 3300031911 Bacteria 1364
336 Ga0307409_100005781 3300031995 Bacteria 7174
337 Ga0307409_100006095 3300031995 Bacteria 7046
338 Ga0307409_100227774 3300031995 Bacteria 1687
339 Ga0307416_100003132 3300032002 Bacteria 9683
340 Ga0307416_100019244 3300032002 Bacteria 4836
341 Ga0307416_100051032 3300032002 Bacteria 3301
342 Ga0307416_100275460 3300032002 Bacteria 1655
343 Ga0307414_10563504 3300032004 Bacteria 1017
344 Ga0307411_10152228 3300032005 Bacteria 1720
345 Ga0307415_100000014 3300032126 Bacteria 81236
346 Ga0307415_100000105 3300032126 Bacteria 35509
347 Ga0307415_100020149 3300032126 Bacteria 4066
348 Ga0307415_100034111 3300032126 Bacteria 3309
349 Ga0307415_100088434 3300032126 Bacteria 2235
350 Ga0307415_100298429 3300032126 Bacteria 1333
351 Ga0307415_100899988 3300032126 Bacteria 816
352 Ga0373962_0038961 3300035242 Bacteria 1332
353 Ga0373931_0096184 3300035691 Bacteria 1658
354 Ga0395900_0015425 3300037418 Bacteria 7789
355 Ga0395900_0031379 3300037418 Bacteria 5459
356 Ga0395898_0059923 3300037466 Bacteria 3701
357 Ga0395905_0354541 3300037471 Bacteria 1359
358 Ga0395901_0005579 3300038443 Bacteria 12737
359 Ga0395901_0078446 3300038443 Bacteria 3448
360 Ga0395901_0152238 3300038443 Bacteria 2430
361 Ga0395901_0288267 3300038443 Bacteria 1704
362 Ga0439465_0027292 3300041413 Bacteria 1808
363 Ga0439431_0008546 3300041997 Bacteria 2305
364 Ga0439443_000405 3300042003 Bacteria 3723
365 Ga0439448_0000036 3300042005 Bacteria 21413
366 Ga0439448_0003538 3300042005 Bacteria 4335
367 Ga0439450_000009 3300042008 Bacteria 16635
368 Ga0439454_003938 3300042011 Bacteria 1685
369 Ga0439455_0006275 3300042012 Bacteria 2459
370 Ga0439456_032795 3300042013 Bacteria 1116
371 Ga0439463_002568 3300042016 Bacteria 4606
372 Ga0439463_003319 3300042016 Bacteria 4079
373 Ga0450919_015070 3300042121 Bacteria 873
374 Ga0450888_003257 3300042126 Bacteria 1637
375 Ga0450888_004660 3300042126 Bacteria 1439
376 Ga0450890_024645 3300042127 Bacteria 831
377 Ga0450896_018055 3300042133 Bacteria 1021
378 Ga0450900_003735 3300042136 Bacteria 1706
379 Ga0450902_004511 3300042137 Bacteria 2075
380 Ga0450904_002347 3300042139 Bacteria 2282
381 Ga0450905_004083 3300042142 Bacteria 1926
382 Ga0450907_020709 3300042146 Bacteria 1105
383 Ga0439446_0025559 3300042156 Bacteria 1688
384 Ga0439458_0015239 3300042157 Bacteria 1741
385 Ga0439435_0033635 3300042436 Bacteria 1405
386 Ga0439444_0002398 3300042437 Bacteria 2560
387 Ga0439444_0073169 3300042437 Bacteria 737
388 Ga0439464_0001734 3300042439 Bacteria 5231
389 Ga0439464_0003738 3300042439 Bacteria 3863
390 Ga0439464_0006657 3300042439 Bacteria 3016
391 Ga0439464_0025791 3300042439 Bacteria 1628
392 Ga0439460_0000877 3300042461 Bacteria 6875
393 Ga0439460_0005287 3300042461 Bacteria 3165
394 Ga0450916_006755 3300042530 Bacteria 1360
395 Ga0450893_0008832 3300042532 Bacteria 1644
396 Ga0451577_0639735 3300042876 Bacteria 965
397 Ga0439440_0006928 3300042993 Bacteria 2293
398 Ga0439440_0019914 3300042993 Bacteria 1501
399 Ga0439440_0072168 3300042993 Bacteria 900
400 Ga0495638_0001609 3300046460 Bacteria 20167
401 Ga0495631_0122364 3300046518 Bacteria 1119
402 Ga0495631_0156771 3300046518 Bacteria 977
403 Ga0495663_0018205 3300046525 Bacteria 1999
404 Ga0495642_0102025 3300046528 Bacteria 1222
405 Ga0495656_0042936 3300046615 Bacteria 1896
406 Ga0495668_0229058 3300046616 Bacteria 1018
407 Ga0496100_0436567 3300048903 Bacteria 1002
408 Ga0496101_0224821 3300048904 Bacteria 1457
409 Ga0496102_0010611 3300048905 Bacteria 7936
410 Ga0496103_0003795 3300048906 Bacteria 9195
411 Ga0496105_0198902 3300048908 Bacteria 1636
412 Ga0496106_0006699 3300048909 Bacteria 8531
413 Ga0496106_0065833 3300048909 Bacteria 2759
414 Ga0496107_0004395 3300048910 Bacteria 9548
415 Ga0496107_0192718 3300048910 Bacteria 1515
416 Ga0496108_0156223 3300048911 Bacteria 1970
417 Ga0496110_0131645 3300048913 Bacteria 2259
418 Ga0496113_0367713 3300048916 Bacteria 1154
419 Ga0496114_0002083 3300048917 Bacteria 15214
420 Ga0496114_0093921 3300048917 Bacteria 2551
421 Ga0496115_0001294 3300048918 Bacteria 17870
422 Ga0496115_0012901 3300048918 Bacteria 6301
423 Ga0501300_020608 3300049523 Bacteria 963
424 Ga0501031_0011749 3300049568 Bacteria 5712
425 Ga0501031_0099018 3300049568 Bacteria 1903
426 Ga0501031_0131637 3300049568 Bacteria 1634
427 Ga0501031_0157927 3300049568 Bacteria 1482
428 Ga0501031_0296277 3300049568 Bacteria 1048
429 Ga0501032_0008010 3300049569 Bacteria 7701
430 Ga0501032_0046699 3300049569 Bacteria 2926
431 Ga0501032_0103076 3300049569 Bacteria 1891
432 Ga0501032_0200917 3300049569 Bacteria 1301
433 Ga0501032_0363854 3300049569 Bacteria 931
434 Ga0501033_0015043 3300049570 Bacteria 5872
435 Ga0501033_0016204 3300049570 Bacteria 5644
436 Ga0501033_0144553 3300049570 Bacteria 1718
437 Ga0501033_0152375 3300049570 Bacteria 1667
438 Ga0501034_0326005 3300049571 Bacteria 1468
439 Ga0501036_0000582 3300049572 Bacteria 26379
440 Ga0501036_0004752 3300049572 Bacteria 10966
441 Ga0501036_0006709 3300049572 Bacteria 9355
442 Ga0501036_0017926 3300049572 Bacteria 5927
443 Ga0501036_0022375 3300049572 Bacteria 5316
444 Ga0501036_0036275 3300049572 Bacteria 4172
445 Ga0501036_0069740 3300049572 Bacteria 2973
446 Ga0501036_0099255 3300049572 Bacteria 2462
447 Ga0501036_0169091 3300049572 Bacteria 1842
448 Ga0501036_0231293 3300049572 Bacteria 1551
449 Ga0501036_0473366 3300049572 Bacteria 1043
450 Ga0501036_0750975 3300049572 Bacteria 805
451 Ga0501037_0013058 3300049573 Bacteria 6124
452 Ga0501037_0044775 3300049573 Bacteria 3249
453 Ga0501037_0062644 3300049573 Bacteria 2711
454 Ga0501037_0169616 3300049573 Bacteria 1552
455 Ga0501038_0010768 3300049574 Bacteria 8359
456 Ga0501038_0012411 3300049574 Bacteria 7788
457 Ga0501038_0017197 3300049574 Bacteria 6538
458 Ga0501038_0018975 3300049574 Bacteria 6206
459 Ga0501038_0032919 3300049574 Bacteria 4568
460 Ga0501038_0046241 3300049574 Bacteria 3774
461 Ga0501038_0057733 3300049574 Bacteria 3331
462 Ga0501038_0065595 3300049574 Bacteria 3093
463 Ga0501038_0082283 3300049574 Bacteria 2711
464 Ga0501038_0136757 3300049574 Bacteria 2007
465 Ga0501038_0178346 3300049574 Bacteria 1716
466 Ga0501038_0183442 3300049574 Bacteria 1687
467 Ga0501038_0208302 3300049574 Bacteria 1566
468 Ga0501038_0212010 3300049574 Bacteria 1549
469 Ga0501038_0310098 3300049574 Bacteria 1237
470 Ga0501038_0317580 3300049574 Bacteria 1219
471 Ga0501038_0345708 3300049574 Bacteria 1159
472 Ga0501039_0000391 3300049575 Bacteria 31522
473 Ga0501039_0002002 3300049575 Bacteria 15076
474 Ga0501039_0005154 3300049575 Bacteria 9904
475 Ga0501039_0012997 3300049575 Bacteria 6365
476 Ga0501039_0013902 3300049575 Bacteria 6158
477 Ga0501039_0044760 3300049575 Bacteria 3419
478 Ga0501039_0054680 3300049575 Bacteria 3090
479 Ga0501039_0070112 3300049575 Bacteria 2723
480 Ga0501039_0080715 3300049575 Bacteria 2531
481 Ga0501039_0097536 3300049575 Bacteria 2292
482 Ga0501039_0118285 3300049575 Bacteria 2075
483 Ga0501039_0135603 3300049575 Bacteria 1932
484 Ga0501039_0233416 3300049575 Bacteria 1446
485 Ga0501039_0285092 3300049575 Bacteria 1298
486 Ga0501040_0000825 3300049576 Bacteria 19375
487 Ga0501040_0001130 3300049576 Bacteria 16914
488 Ga0501040_0003074 3300049576 Bacteria 10825
489 Ga0501040_0004483 3300049576 Bacteria 9068
490 Ga0501040_0013401 3300049576 Bacteria 5388
491 Ga0501040_0017524 3300049576 Bacteria 4755
492 Ga0501040_0022946 3300049576 Bacteria 4181
493 Ga0501040_0023544 3300049576 Bacteria 4129
494 Ga0501040_0050004 3300049576 Bacteria 2858
495 Ga0501040_0069648 3300049576 Bacteria 2427
496 Ga0501040_0083582 3300049576 Bacteria 2214
497 Ga0501040_0085269 3300049576 Bacteria 2192
498 Ga0501040_0133631 3300049576 Bacteria 1745
499 Ga0501040_0143396 3300049576 Bacteria 1683
500 Ga0501040_0147720 3300049576 Bacteria 1657
501 Ga0501040_0166527 3300049576 Bacteria 1560
502 Ga0501040_0182919 3300049576 Bacteria 1486
503 Ga0501040_0291661 3300049576 Bacteria 1166
504 Ga0501040_0344841 3300049576 Bacteria 1066
505 Ga0501041_0000831 3300049577 Bacteria 16549
506 Ga0501041_0001721 3300049577 Bacteria 12270
507 Ga0501041_0012758 3300049577 Bacteria 4979
508 Ga0501041_0021318 3300049577 Bacteria 3883
509 Ga0501041_0022509 3300049577 Bacteria 3773
510 Ga0501041_0031317 3300049577 Bacteria 3214
511 Ga0501041_0031392 3300049577 Bacteria 3209
512 Ga0501041_0034376 3300049577 Bacteria 3068
513 Ga0501041_0044344 3300049577 Bacteria 2704
514 Ga0501041_0046444 3300049577 Bacteria 2641
515 Ga0501041_0046660 3300049577 Bacteria 2636
516 Ga0501041_0061821 3300049577 Bacteria 2292
517 Ga0501041_0076576 3300049577 Bacteria 2058
518 Ga0501041_0119718 3300049577 Bacteria 1636
519 Ga0501041_0128497 3300049577 Bacteria 1578
520 Ga0501041_0249110 3300049577 Bacteria 1117
521 Ga0501041_0251701 3300049577 Bacteria 1110
522 Ga0501042_0000539 3300049578 Bacteria 19836
523 Ga0501042_0002500 3300049578 Bacteria 11317
524 Ga0501042_0009695 3300049578 Bacteria 6431
525 Ga0501042_0011560 3300049578 Bacteria 5959
526 Ga0501042_0011595 3300049578 Bacteria 5952
527 Ga0501042_0016167 3300049578 Bacteria 5118
528 Ga0501042_0058134 3300049578 Bacteria 2759
529 Ga0501042_0067053 3300049578 Bacteria 2566
530 Ga0501042_0119854 3300049578 Bacteria 1894
531 Ga0501042_0122613 3300049578 Bacteria 1872
532 Ga0501042_0162213 3300049578 Bacteria 1613
533 Ga0501042_0291081 3300049578 Bacteria 1179
534 Ga0501043_0011169 3300049579 Bacteria 7034
535 Ga0501043_0026806 3300049579 Bacteria 4522
536 Ga0501043_0060681 3300049579 Bacteria 2969
537 Ga0501043_0081413 3300049579 Bacteria 2544
538 Ga0501043_0111298 3300049579 Bacteria 2150
539 Ga0501043_0223298 3300049579 Bacteria 1457
540 Ga0501043_0322395 3300049579 Bacteria 1178
541 Ga0501043_0577518 3300049579 Bacteria 832
542 Ga0501046_0000792 3300049580 Bacteria 30629
543 Ga0501046_0001108 3300049580 Bacteria 26300
544 Ga0501046_0001759 3300049580 Bacteria 20697
545 Ga0501046_0045232 3300049580 Bacteria 3498
546 Ga0501046_0053364 3300049580 Bacteria 3184
547 Ga0501046_0060852 3300049580 Bacteria 2954
548 Ga0501046_0067364 3300049580 Bacteria 2788
549 Ga0501046_0160978 3300049580 Bacteria 1688
550 Ga0501046_0208248 3300049580 Bacteria 1452
551 Ga0501046_0247677 3300049580 Bacteria 1312
552 Ga0501046_0324982 3300049580 Bacteria 1120
553 Ga0501046_0338933 3300049580 Bacteria 1093
554 Ga0501047_0069768 3300049581 Bacteria 3384
555 Ga0501048_0000165 3300049582 Bacteria 41378
556 Ga0501048_0000495 3300049582 Bacteria 27512
557 Ga0501048_0005879 3300049582 Bacteria 9338
558 Ga0501048_0017926 3300049582 Bacteria 5210
559 Ga0501048_0025841 3300049582 Bacteria 4278
560 Ga0501048_0034293 3300049582 Bacteria 3663
561 Ga0501048_0042536 3300049582 Bacteria 3252
562 Ga0501048_0054061 3300049582 Bacteria 2853
563 Ga0501048_0078332 3300049582 Bacteria 2332
564 Ga0501048_0085598 3300049582 Bacteria 2223
565 Ga0501048_0087522 3300049582 Bacteria 2197
566 Ga0501048_0093151 3300049582 Bacteria 2125
567 Ga0501048_0150676 3300049582 Bacteria 1645
568 Ga0501048_0177534 3300049582 Bacteria 1509
569 Ga0501048_0283765 3300049582 Bacteria 1177
570 Ga0501048_0290706 3300049582 Bacteria 1162
571 Ga0501048_0303099 3300049582 Bacteria 1137
572 Ga0501068_0010653 3300049584 Bacteria 5171
573 Ga0501068_0023891 3300049584 Bacteria 3585
574 Ga0501068_0027781 3300049584 Bacteria 3342
575 Ga0501068_0028650 3300049584 Bacteria 3295
576 Ga0501068_0063687 3300049584 Bacteria 2243
577 Ga0501068_0095640 3300049584 Bacteria 1837
578 Ga0501068_0155507 3300049584 Bacteria 1439
579 Ga0501069_0013510 3300049585 Bacteria 4354
580 Ga0501069_0014680 3300049585 Bacteria 4190
581 Ga0501069_0053250 3300049585 Bacteria 2254
582 Ga0501070_0046346 3300049586 Bacteria 3615
583 Ga0501070_0080691 3300049586 Bacteria 2692
584 Ga0501071_0000605 3300049587 Bacteria 18582
585 Ga0501071_0001820 3300049587 Bacteria 12630
586 Ga0501071_0003969 3300049587 Bacteria 9334
587 Ga0501071_0005295 3300049587 Bacteria 8274
588 Ga0501071_0009846 3300049587 Bacteria 6381
589 Ga0501071_0026283 3300049587 Bacteria 4085
590 Ga0501071_0026634 3300049587 Bacteria 4060
591 Ga0501071_0039555 3300049587 Bacteria 3374
592 Ga0501071_0073273 3300049587 Bacteria 2497
593 Ga0501071_0077439 3300049587 Bacteria 2429
594 Ga0501071_0091965 3300049587 Bacteria 2229
595 Ga0501071_0104030 3300049587 Bacteria 2095
596 Ga0501071_0121161 3300049587 Bacteria 1939
597 Ga0501071_0217681 3300049587 Bacteria 1437
598 Ga0501071_0264669 3300049587 Bacteria 1299
599 Ga0501071_0342354 3300049587 Bacteria 1137
600 Ga0501071_0474586 3300049587 Bacteria 958
601 Ga0501072_0004217 3300049588 Bacteria 10905
602 Ga0501072_0006087 3300049588 Bacteria 9207
603 Ga0501072_0007345 3300049588 Bacteria 8358
604 Ga0501072_0008040 3300049588 Bacteria 8004
605 Ga0501072_0011517 3300049588 Bacteria 6759
606 Ga0501072_0025964 3300049588 Bacteria 4564
607 Ga0501072_0027361 3300049588 Bacteria 4447
608 Ga0501072_0038181 3300049588 Bacteria 3768
609 Ga0501072_0068976 3300049588 Bacteria 2791
610 Ga0501072_0072045 3300049588 Bacteria 2730
611 Ga0501072_0076422 3300049588 Bacteria 2649
612 Ga0501072_0078448 3300049588 Bacteria 2615
613 Ga0501072_0090542 3300049588 Bacteria 2428
614 Ga0501072_0114625 3300049588 Bacteria 2145
615 Ga0501072_0126827 3300049588 Bacteria 2033
616 Ga0501072_0155570 3300049588 Bacteria 1823
617 Ga0501072_0179650 3300049588 Bacteria 1688
618 Ga0501072_0216359 3300049588 Bacteria 1527
619 Ga0501072_0219485 3300049588 Bacteria 1515
620 Ga0501072_0278560 3300049588 Bacteria 1330
621 Ga0501072_0289928 3300049588 Bacteria 1301
622 Ga0501072_0381332 3300049588 Bacteria 1119
623 Ga0501072_0400616 3300049588 Bacteria 1089
624 Ga0501072_0547233 3300049588 Bacteria 914
625 Ga0501073_0103623 3300049589 Bacteria 1975
626 Ga0501074_0000608 3300049590 Bacteria 22237
627 Ga0501074_0002779 3300049590 Bacteria 12247
628 Ga0501074_0015037 3300049590 Bacteria 5630
629 Ga0501074_0024897 3300049590 Bacteria 4348
630 Ga0501074_0031123 3300049590 Bacteria 3866
631 Ga0501074_0047814 3300049590 Bacteria 3091
632 Ga0501074_0054313 3300049590 Bacteria 2889
633 Ga0501074_0192822 3300049590 Bacteria 1452
634 Ga0501074_0270466 3300049590 Bacteria 1208
635 Ga0501074_0444063 3300049590 Bacteria 920
636 Ga0501075_0000672 3300049591 Bacteria 21090
637 Ga0501075_0001648 3300049591 Bacteria 14666
638 Ga0501075_0005875 3300049591 Bacteria 8391
639 Ga0501075_0006176 3300049591 Bacteria 8235
640 Ga0501075_0039876 3300049591 Bacteria 3515
641 Ga0501075_0063668 3300049591 Bacteria 2780
642 Ga0501075_0099546 3300049591 Bacteria 2207
643 Ga0501075_0148535 3300049591 Bacteria 1786
644 Ga0501075_0237479 3300049591 Bacteria 1389
645 Ga0501076_0000903 3300049592 Bacteria 19315
646 Ga0501076_0003857 3300049592 Bacteria 10558
647 Ga0501076_0007166 3300049592 Bacteria 8107
648 Ga0501076_0008440 3300049592 Bacteria 7551
649 Ga0501076_0010120 3300049592 Bacteria 6984
650 Ga0501076_0010833 3300049592 Bacteria 6778
651 Ga0501076_0010866 3300049592 Bacteria 6772
652 Ga0501076_0012231 3300049592 Bacteria 6416
653 Ga0501076_0033084 3300049592 Bacteria 4037
654 Ga0501076_0035385 3300049592 Bacteria 3907
655 Ga0501076_0044434 3300049592 Bacteria 3504
656 Ga0501076_0052330 3300049592 Bacteria 3234
657 Ga0501076_0065860 3300049592 Bacteria 2890
658 Ga0501076_0067031 3300049592 Bacteria 2866
659 Ga0501076_0094630 3300049592 Bacteria 2405
660 Ga0501076_0130069 3300049592 Bacteria 2041
661 Ga0501076_0176734 3300049592 Bacteria 1740
662 Ga0501076_0221752 3300049592 Bacteria 1545
663 Ga0501076_0249364 3300049592 Bacteria 1452
664 Ga0501076_0288772 3300049592 Bacteria 1344
665 Ga0501077_0002176 3300049593 Bacteria 11842
666 Ga0501077_0003394 3300049593 Bacteria 9575
667 Ga0501077_0009331 3300049593 Bacteria 6092
668 Ga0501077_0011097 3300049593 Bacteria 5621
669 Ga0501077_0034315 3300049593 Bacteria 3229
670 Ga0501077_0038379 3300049593 Bacteria 3049
671 Ga0501077_0077985 3300049593 Bacteria 2099
672 Ga0501077_0080496 3300049593 Bacteria 2063
673 Ga0501077_0209957 3300049593 Bacteria 1237
674 Ga0501077_0346139 3300049593 Bacteria 948
675 Ga0501077_0391908 3300049593 Bacteria 887
676 Ga0501079_0000214 3300049741 Bacteria 34037
677 Ga0501079_0000479 3300049741 Bacteria 26367
678 Ga0501079_0003269 3300049741 Bacteria 11882
679 Ga0501079_0004598 3300049741 Bacteria 10228
680 Ga0501079_0006141 3300049741 Bacteria 9007
681 Ga0501079_0021393 3300049741 Bacteria 4947
682 Ga0501079_0024754 3300049741 Bacteria 4606
683 Ga0501079_0033068 3300049741 Bacteria 3977
684 Ga0501079_0034361 3300049741 Bacteria 3901
685 Ga0501079_0035517 3300049741 Bacteria 3837
686 Ga0501079_0060780 3300049741 Bacteria 2914
687 Ga0501079_0079869 3300049741 Bacteria 2529
688 Ga0501079_0088118 3300049741 Bacteria 2403
689 Ga0501079_0106339 3300049741 Bacteria 2177
690 Ga0501079_0145909 3300049741 Bacteria 1844
691 Ga0501079_0184124 3300049741 Bacteria 1630
692 Ga0501079_0299971 3300049741 Bacteria 1257
693 Ga0501079_0356263 3300049741 Bacteria 1147
694 Ga0501080_0009515 3300049742 Bacteria 8867
695 Ga0501080_0025801 3300049742 Bacteria 5459
696 Ga0501080_0028990 3300049742 Bacteria 5153
697 Ga0501080_0055473 3300049742 Bacteria 3691
698 Ga0501080_0058624 3300049742 Bacteria 3584
699 Ga0501080_0077330 3300049742 Bacteria 3095
700 Ga0501080_0121239 3300049742 Bacteria 2423
701 Ga0501080_0179577 3300049742 Bacteria 1948
702 Ga0501080_0479473 3300049742 Bacteria 1113
703 Ga0501080_0551151 3300049742 Bacteria 1027
704 Ga0501080_0670606 3300049742 Bacteria 916
705 Ga0501080_0875097 3300049742 Bacteria 784
706 Ga0501081_0000596 3300049743 Bacteria 20599
707 Ga0501081_0003165 3300049743 Bacteria 10467
708 Ga0501081_0007510 3300049743 Bacteria 7070
709 Ga0501081_0010476 3300049743 Bacteria 6050
710 Ga0501081_0010803 3300049743 Bacteria 5963
711 Ga0501081_0026744 3300049743 Bacteria 3892
712 Ga0501081_0055424 3300049743 Bacteria 2739
713 Ga0501081_0085898 3300049743 Bacteria 2209
714 Ga0501081_0204701 3300049743 Bacteria 1432
715 Ga0501081_0252441 3300049743 Bacteria 1288
716 Ga0501081_0255195 3300049743 Bacteria 1280
717 Ga0501081_0308349 3300049743 Bacteria 1162
718 Ga0501081_0476017 3300049743 Bacteria 929
719 Ga0501081_0508376 3300049743 Bacteria 898
720 Ga0501083_0022753 3300049744 Bacteria 4349
721 Ga0501083_0033096 3300049744 Bacteria 3541
722 Ga0501083_0078061 3300049744 Bacteria 2197
723 Ga0501083_0105044 3300049744 Bacteria 1860
724 Ga0501083_0129088 3300049744 Bacteria 1657
725 Ga0501035_0004738 3300049822 Bacteria 12917
726 Ga0501035_0041657 3300049822 Bacteria 4146
727 Ga0501035_0116912 3300049822 Bacteria 2334
728 Ga0501035_0168457 3300049822 Bacteria 1893
729 Ga0501035_0207328 3300049822 Bacteria 1678
730 Ga0501035_0496067 3300049822 Bacteria 1005
731 Ga0501044_0108234 3300049823 Bacteria 2790
732 Ga0501044_0359297 3300049823 Bacteria 1375
733 Ga0501045_0000417 3300049824 Bacteria 25889
734 Ga0501045_0001327 3300049824 Bacteria 16429
735 Ga0501045_0001675 3300049824 Bacteria 14905
736 Ga0501045_0003424 3300049824 Bacteria 10851
737 Ga0501045_0030122 3300049824 Bacteria 3926
738 Ga0501045_0054495 3300049824 Bacteria 2923
739 Ga0501045_0067194 3300049824 Bacteria 2632
740 Ga0501045_0077637 3300049824 Bacteria 2447
741 Ga0501045_0079604 3300049824 Bacteria 2416
742 Ga0501045_0097284 3300049824 Bacteria 2177
743 Ga0501045_0103604 3300049824 Bacteria 2107
744 Ga0501045_0113941 3300049824 Bacteria 2005
745 Ga0501045_0138262 3300049824 Bacteria 1811
746 Ga0501045_0293275 3300049824 Bacteria 1210
747 Ga0501045_0325532 3300049824 Bacteria 1144
748 Ga0501045_0387766 3300049824 Bacteria 1040
749 Ga0501045_0394300 3300049824 Bacteria 1030
750 Ga0501045_0396091 3300049824 Bacteria 1028
751 nmdc:mga0k408_14839_c1 3300050493 Bacteria 4300
752 nmdc:mga05p37_117045_c1 3300050507 Bacteria 3275
753 nmdc:mga05p37_117381_c1 3300050507 Bacteria 3270
754 nmdc:mga05p37_1180_c1 3300050507 Bacteria 30161
755 nmdc:mga05p37_123030_c1 3300050507 Bacteria 3187
756 nmdc:mga05p37_13070_c1 3300050507 Bacteria 9935
757 nmdc:mga05p37_165557_c1 3300050507 Bacteria 2699
758 nmdc:mga05p37_18730_c1 3300050507 Bacteria 8366
759 nmdc:mga05p37_20970_c2 3300050507 Bacteria 5938
760 nmdc:mga05p37_21742_c1 3300050507 Bacteria 7772
761 nmdc:mga05p37_298579_c1 3300050507 Bacteria 1915
762 nmdc:mga05p37_3426_c1 3300050507 Bacteria 18494
763 nmdc:mga05p37_40698_c1 3300050507 Bacteria 5707
764 nmdc:mga05p37_53934_c1 3300050507 Bacteria 4946
765 nmdc:mga05p37_539_c1 3300050507 Bacteria 41728
766 nmdc:mga05p37_617415_c1 3300050507 Bacteria 1221
767 nmdc:mga05p37_718822_c1 3300050507 Bacteria 1106
768 nmdc:mga05p37_8783_c1 3300050507 Bacteria 11937
769 nmdc:mga05p37_9623_c1 3300050507 Bacteria 11449
770 nmdc:mga09592_146520_c1 3300050508 Bacteria 2036
771 nmdc:mga09592_246064_c1 3300050508 Bacteria 1550
772 nmdc:mga09592_249_c1 3300050508 Bacteria 39234
773 nmdc:mga09592_259578_c1 3300050508 Bacteria 1506
774 nmdc:mga09592_278528_c1 3300050508 Bacteria 1451
775 nmdc:mga09592_390171_c1 3300050508 Bacteria 1204
776 nmdc:mga09592_397318_c1 3300050508 Bacteria 1192
777 nmdc:mga09592_45392_c1 3300050508 Bacteria 3702
778 nmdc:mga09592_503132_c1 3300050508 Bacteria 1043
779 nmdc:mga09592_61569_c1 3300050508 Bacteria 3175
780 nmdc:mga0qj67_103143_c1 3300050509 Bacteria 2300
781 nmdc:mga0qj67_124963_c1 3300050509 Bacteria 2082
782 nmdc:mga0qj67_169003_c1 3300050509 Bacteria 1775
783 nmdc:mga0qj67_206231_c1 3300050509 Bacteria 1597
784 nmdc:mga0qj67_211383_c1 3300050509 Bacteria 1576
785 nmdc:mga0qj67_217550_c1 3300050509 Bacteria 1551
786 nmdc:mga0qj67_22811_c1 3300050509 Bacteria 4809
787 nmdc:mga0qj67_31297_c1 3300050509 Bacteria 4144
788 nmdc:mga0qj67_313980_c1 3300050509 Bacteria 1269
789 nmdc:mga0qj67_353387_c1 3300050509 Bacteria 1188
790 nmdc:mga0qj67_431618_c1 3300050509 Bacteria 1062
791 nmdc:mga0qj67_474347_c1 3300050509 Bacteria 1007
792 nmdc:mga0qj67_551402_c1 3300050509 Bacteria 924
793 nmdc:mga0qj67_77390_c1 3300050509 Bacteria 2661
794 nmdc:mga0qj67_79638_c1 3300050509 Bacteria 2624
795 nmdc:mga0qj67_8883_c1 3300050509 Bacteria 7455
796 nmdc:mga0qj67_99707_c1 3300050509 Bacteria 2341
797 nmdc:mga06r32_104518_c1 3300050510 Bacteria 2781
798 nmdc:mga06r32_137012_c1 3300050510 Bacteria 2423
799 nmdc:mga06r32_14479_c1 3300050510 Bacteria 7159
800 nmdc:mga06r32_148770_c1 3300050510 Bacteria 2320
801 nmdc:mga06r32_149498_c1 3300050510 Bacteria 2314
802 nmdc:mga06r32_266_c1 3300050510 Bacteria 43245
803 nmdc:mga06r32_269639_c1 3300050510 Bacteria 1690
804 nmdc:mga06r32_391174_c1 3300050510 Bacteria 1373
805 nmdc:mga06r32_426090_c1 3300050510 Bacteria 1308
806 nmdc:mga06r32_467208_c1 3300050510 Bacteria 1240
807 nmdc:mga06r32_4878_c1 3300050510 Bacteria 12083
808 nmdc:mga06r32_568468_c1 3300050510 Bacteria 1107
809 nmdc:mga06r32_570389_c1 3300050510 Bacteria 1104
810 nmdc:mga06r32_62274_c1 3300050510 Bacteria 3594
811 nmdc:mga06r32_91102_c1 3300050510 Bacteria 2979
812 nmdc:mga06r32_9560_c1 3300050510 Bacteria 8756
813 nmdc:mga08y16_108533_c1 3300050511 Bacteria 2890
814 nmdc:mga08y16_133119_c1 3300050511 Bacteria 2584
815 nmdc:mga08y16_24835_c1 3300050511 Bacteria 6323
816 nmdc:mga08y16_2703_c1 3300050511 Bacteria 18201
817 nmdc:mga08y16_381248_c1 3300050511 Bacteria 1445
818 nmdc:mga08y16_66780_c1 3300050511 Bacteria 3754
819 nmdc:mga0n895_197961_c1 3300050512 Bacteria 2041
820 nmdc:mga0n895_237451_c1 3300050512 Bacteria 1850
821 nmdc:mga0n895_25389_c1 3300050512 Bacteria 5597
822 nmdc:mga0n895_343976_c1 3300050512 Bacteria 1511
823 nmdc:mga0n895_358735_c1 3300050512 Bacteria 1476
824 nmdc:mga0n895_531916_c1 3300050512 Bacteria 1182
825 nmdc:mga0n895_599156_c1 3300050512 Bacteria 1104
826 nmdc:mga0n895_8577_c1 3300050512 Bacteria 8863
827 nmdc:mga0rr50_18537_c1 3300050513 Bacteria 4678
828 nmdc:mga0rr50_215804_c1 3300050513 Bacteria 1583
829 nmdc:mga0rr50_62450_c1 3300050513 Bacteria 2810
830 nmdc:mga08x19_154404_c1 3300050514 Bacteria 1556
831 nmdc:mga08x19_43577_c1 3300050514 Bacteria 2863
832 nmdc:mga0a205_105122_c1 3300050515 Bacteria 2722
833 nmdc:mga0a205_11328_c1 3300050515 Bacteria 8208
834 nmdc:mga0a205_19230_c1 3300050515 Bacteria 6437
835 nmdc:mga0a205_5765_c1 3300050515 Bacteria 11164
836 nmdc:mga0a205_6578_c1 3300050515 Bacteria 10516
837 Ga0501084_0002256 3300054114 Bacteria 15482
838 Ga0501084_0002853 3300054114 Bacteria 13968
839 Ga0501084_0003996 3300054114 Bacteria 12014
840 Ga0501084_0021794 3300054114 Bacteria 5343
841 Ga0501084_0021946 3300054114 Bacteria 5324
842 Ga0501084_0041828 3300054114 Bacteria 3833
843 Ga0501084_0101153 3300054114 Bacteria 2420
844 Ga0501084_0136458 3300054114 Bacteria 2065
845 Ga0501084_0182431 3300054114 Bacteria 1772
846 Ga0501084_0186404 3300054114 Bacteria 1751
847 Ga0501084_0187460 3300054114 Bacteria 1746
848 Ga0501084_0238656 3300054114 Bacteria 1534
849 Ga0501084_0260009 3300054114 Bacteria 1465
850 Ga0501084_0426724 3300054114 Bacteria 1121
851 Ga0501084_0570409 3300054114 Unclassified 956
852 Ga0590071_006370 3300059421 Bacteria 2809
853 Ga0590071_022019 3300059421 Bacteria 1504
854 Ga0590074_003441 3300059423 Bacteria 2613
855 Ga0590077_019201 3300059426 Bacteria 1446
856 Ga0590077_041419 3300059426 Bacteria 1024
857 Ga0501082_0000174 3300060353 Bacteria 55706
858 Ga0501082_0002382 3300060353 Bacteria 16473
859 Ga0501082_0010036 3300060353 Bacteria 8160
860 Ga0501082_0010328 3300060353 Bacteria 8037
861 Ga0501082_0021236 3300060353 Bacteria 5601
862 Ga0501082_0031218 3300060353 Bacteria 4593
863 Ga0501082_0037474 3300060353 Bacteria 4179
864 Ga0501082_0066283 3300060353 Bacteria 3109
865 Ga0501082_0071367 3300060353 Bacteria 2991
866 Ga0501082_0269393 3300060353 Bacteria 1482
867 Ga0501082_0293740 3300060353 Bacteria 1415
868 Ga0501082_0321545 3300060353 Bacteria 1348
869 Ga0501082_0327659 3300060353 Bacteria 1334
870 Ga0501082_0353379 3300060353 Bacteria 1281
871 Ga0501082_0371593 3300060353 Bacteria 1247
872 Ga0501082_0376643 3300060353 Bacteria 1238
873 Ga0501082_0403847 3300060353 Bacteria 1192
874 Ga0501082_0495721 3300060353 Bacteria 1068
875 Ga0501082_0571014 3300060353 Bacteria 989
876 Ga0530510_0000104 3300061734 Bacteria 46177
877 Ga0530510_0000476 3300061734 Bacteria 25703
878 Ga0530510_0005517 3300061734 Bacteria 8760
879 Ga0530510_0010505 3300061734 Bacteria 6490
880 Ga0530510_0012247 3300061734 Bacteria 6020
881 Ga0530510_0012337 3300061734 Bacteria 6002
882 Ga0530510_0019676 3300061734 Bacteria 4793
883 Ga0530510_0025595 3300061734 Bacteria 4221
884 Ga0530510_0026940 3300061734 Bacteria 4117
885 Ga0530510_0044422 3300061734 Bacteria 3211
886 Ga0530510_0072709 3300061734 Bacteria 2496
887 Ga0530510_0102259 3300061734 Bacteria 2095
888 Ga0530510_0130047 3300061734 Bacteria 1852
889 Ga0530510_0181826 3300061734 Bacteria 1559
890 Ga0530510_0185308 3300061734 Bacteria 1544
891 Ga0530510_0193575 3300061734 Bacteria 1509
892 Ga0530510_0217821 3300061734 Bacteria 1419
893 Ga0530510_0220432 3300061734 Bacteria 1410
894 Ga0530510_0265128 3300061734 Bacteria 1281
895 Ga0530510_0311918 3300061734 Bacteria 1178
896 Ga0530510_0726868 3300061734 Bacteria 757
897 2558864794 2558860100 Bacteria 8458965
898 2744957624 2744054611 Bacteria 5611514
899 2874170127 2874168670 Bacteria 8062617
900 2876393642 2876392853 Bacteria 6660880
901 2881163403 2881161766 Bacteria 7127907
902 2904660150 2904659560 Bacteria 6685615
903 2961115475 2961114664 Bacteria 6680456
904 2968111206 2968110612 Bacteria 6814636
905 2977866046 2977864932 Bacteria 7534097
906 nmdc:mga09592_178560_c1
907 JGI24737J22298_10097054
908 JGI24750J21931_1005016
909 JGI25406J46586_10002026
910 JGI25406J46586_10027296
911 Ga0065707_10084192
912 Ga0070676_10115795
913 Ga0070690_100023931
914 Ga0068869_100447073
915 Ga0068869_100669332
916 Ga0070682_100193823
917 Ga0068868_100007858
918 Ga0068868_100433681
919 Ga0070660_100121697
920 Ga0070660_100244897
921 Ga0070689_100019982
922 Ga0070691_10029071
923 Ga0070691_10047084
924 Ga0070691_10204578
925 Ga0070687_100015244
926 Ga0070692_10072312
927 Ga0070668_100006249
928 Ga0070668_100064262
929 Ga0070669_100037398
930 Ga0070669_100566138
931 Ga0070675_100051359
932 Ga0070671_100190307
933 Ga0070674_100167830
934 Ga0070688_100021505
935 Ga0070659_100024159
936 Ga0070659_100049819
937 Ga0070659_100086706
938 Ga0070667_100006205
939 Ga0070709_10012970
940 Ga0070709_10041095
941 Ga0070709_10140300
942 Ga0070713_100002425
943 Ga0070713_100081674
944 Ga0070713_100210507
945 Ga0070710_10024918
946 Ga0070701_10000802
947 Ga0070701_10125840
948 Ga0070711_100002361
949 Ga0070711_100276959
950 Ga0070705_100011444
951 Ga0070705_100279553
952 Ga0070700_100016733
953 Ga0070694_100059857
954 Ga0070694_100070228
955 Ga0070663_100019735
956 Ga0070678_100002715
957 Ga0070678_100113040
958 Ga0070662_100033292
959 Ga0070662_100722262
960 Ga0068867_100003221
961 Ga0070679_100200486
962 Ga0068853_100790148
963 Ga0068853_100870175
964 Ga0070672_100094912
965 Ga0070672_100332798
966 Ga0070686_100104501
967 Ga0070696_100195102
968 Ga0070693_100036062
969 Ga0070693_100113604
970 Ga0068855_100321003
971 Ga0068855_100483515
972 Ga0068856_100118486
973 Ga0068856_100259835
974 Ga0070702_100056039
975 Ga0068852_100105980
976 Ga0068852_100191773
977 Ga0068864_100269235
978 Ga0068866_10061824
979 Ga0068866_10181646
980 Ga0068861_100000307
981 Ga0068861_100029504
982 Ga0068861_100065787
983 Ga0068863_101061245
984 Ga0068858_100000440
985 Ga0081455_10001898
986 Ga0081455_10003263
987 Ga0081455_10003430
988 Ga0081455_10003469
989 Ga0081455_10003963
990 Ga0081455_10016556
991 Ga0081455_10018893
992 Ga0081455_10021078
993 Ga0081455_10023422
994 Ga0081455_10026643
995 Ga0081455_10027234
996 Ga0081455_10029096
997 Ga0081455_10033756
998 Ga0081455_10108346
999 Ga0081455_10110936
1000 Ga0081455_10150191
1001 Ga0081455_10320032
1002 Ga0081538_10001179
1003 Ga0081538_10001329
1004 Ga0081538_10004786
1005 Ga0081538_10009207
1006 Ga0081538_10011658
1007 Ga0081538_10013588
1008 Ga0081538_10016503
1009 Ga0081538_10032659
1010 Ga0081538_10041203
1011 Ga0081538_10055647
1012 Ga0081538_10067617
1013 Ga0081540_1000957
1014 Ga0081540_1001401
1015 Ga0081540_1031114
1016 Ga0081539_10001875
1017 Ga0081539_10008043
1018 Ga0081539_10009090
1019 Ga0081539_10020618
1020 Ga0070717_10577697
1021 Ga0075432_10012558
1022 Ga0070715_10002571
1023 Ga0070716_100013660
1024 Ga0070716_100033660
1025 Ga0070716_100062544
1026 Ga0070712_100001270
1027 Ga0075362_10123673
1028 Ga0075427_10017835
1029 Ga0097621_100382701
1030 Ga0068871_100017978
1031 Ga0075428_100005941
1032 Ga0075428_100010310
1033 Ga0075428_100024830
1034 Ga0075428_100025691
1035 Ga0075428_100036338
1036 Ga0075428_100044011
1037 Ga0075428_100049533
1038 Ga0075428_100065120
1039 Ga0075428_100104550
1040 Ga0075428_100272104
1041 Ga0075428_100364202
1042 Ga0075428_100508706
1043 Ga0075428_100670247
1044 Ga0075428_100783787
1045 Ga0075428_100820831
1046 Ga0075430_100002919
1047 Ga0075430_100007671
1048 Ga0075430_100008188
1049 Ga0075430_100025651
1050 Ga0075430_100068732
1051 Ga0075430_100095300
1052 Ga0075430_100252899
1053 Ga0075430_100346097
1054 Ga0075430_100368665
1055 Ga0075431_100001207
1056 Ga0075431_100021924
1057 Ga0075431_100022559
1058 Ga0075431_100037507
1059 Ga0075431_100253295
1060 Ga0075431_100272054
1061 Ga0075431_100354163
1062 Ga0075433_10007508
1063 Ga0075433_10016912
1064 Ga0075433_10032369
1065 Ga0075433_10060055
1066 Ga0075433_10429074
1067 Ga0075434_100016486
1068 Ga0075434_100025697
1069 Ga0075434_100095443
1070 Ga0075434_100403428
1071 Ga0075429_100004586
1072 Ga0075429_100007802
1073 Ga0075429_100009847
1074 Ga0075429_100031876
1075 Ga0075429_100158120
1076 Ga0075429_100161591
1077 Ga0075429_100212553
1078 Ga0075429_100242587
1079 Ga0075429_100401911
1080 Ga0068865_100008992
1081 Ga0068865_100481322
1082 Ga0075436_100020064
1083 Ga0075435_100217337
1084 Ga0105240_10565048
1085 Ga0105240_10894276
1086 Ga0105240_10974884
1087 Ga0111539_10006541
1088 Ga0111539_10034991
1089 Ga0111539_10124835
1090 Ga0111539_10353915
1091 Ga0105245_10010633
1092 Ga0105245_10197338
1093 Ga0105245_10303167
1094 Ga0105247_10000584
1095 Ga0105247_10073863
1096 Ga0114129_10006506
1097 Ga0114129_10008121
1098 Ga0114129_10012228
1099 Ga0114129_10012505
1100 Ga0114129_10024194
1101 Ga0114129_10032371
1102 Ga0114129_10073125
1103 Ga0114129_10075432
1104 Ga0114129_10082385
1105 Ga0114129_10099531
1106 Ga0114129_10185961
1107 Ga0114129_10250032
1108 Ga0114129_10495960
1109 Ga0114129_10587244
1110 Ga0114129_11532625
1111 Ga0114129_11577094
1112 Ga0105243_10009400
1113 Ga0105243_10131010
1114 Ga0105241_10071846
1115 Ga0105241_10347697
1116 Ga0105242_10003225
1117 Ga0105242_10559797
1118 Ga0105248_10014990
1119 Ga0105237_10036314
1120 Ga0105237_10293733
1121 Ga0105237_10452365
1122 Ga0105238_10239112
1123 Ga0105249_10024146
1124 Ga0105249_10367987
1125 Ga0105249_10629437
1126 Ga0105239_10005314
1127 Ga0105239_10025955
1128 Ga0105246_10138325
1129 Ga0157320_1006836
1130 Ga0157371_10047627
1131 Ga0157370_10417917
1132 Ga0157369_10012394
1133 Ga0157369_10344653
1134 Ga0157374_10047824
1135 Ga0157374_10609405
1136 Ga0157378_10005026
1137 Ga0157378_10030720
1138 Ga0163162_10040972
1139 Ga0163162_10188080
1140 Ga0163162_10588259
1141 Ga0157372_10000875
1142 Ga0157372_10026333
1143 Ga0157375_10010499
1144 Ga0157375_10751096
1145 Ga0163163_10952410
1146 Ga0157377_10102314
1147 Ga0157377_10141180
1148 Ga0157379_10001901
1149 Ga0157376_10245875
1150 Ga0157376_10604950
1151 Ga0163161_10161548
1152 Ga0163161_10196553
1153 Ga0163161_10277535
1154 Ga0207692_10122159
1155 Ga0207642_10000230
1156 Ga0207710_10003445
1157 Ga0207688_10000910
1158 Ga0207685_10002006
1159 Ga0207699_10005329
1160 Ga0207699_10028439
1161 Ga0207645_10041310
1162 Ga0207684_10387963
1163 Ga0207684_10508137
1164 Ga0207654_10221500
1165 Ga0207671_10075057
1166 Ga0207693_10000614
1167 Ga0207693_10100963
1168 Ga0207663_10002572
1169 Ga0207660_10600787
1170 Ga0207657_10299817
1171 Ga0207681_10221019
1172 Ga0207681_10269615
1173 Ga0207659_10163887
1174 Ga0207687_10004910
1175 Ga0207687_10025683
1176 Ga0207700_10013974
1177 Ga0207664_10074993
1178 Ga0207664_10410589
1179 Ga0207690_10053538
1180 Ga0207690_10091581
1181 Ga0207686_10004045
1182 Ga0207686_10313549
1183 Ga0207686_10339828
1184 Ga0207709_10031625
1185 Ga0207709_10158248
1186 Ga0207669_10000085
1187 Ga0207704_10018460
1188 Ga0207665_10012387
1189 Ga0207665_10042662
1190 Ga0207665_10106916
1191 Ga0207691_10458804
1192 Ga0207711_10026873
1193 Ga0207711_10542377
1194 Ga0207689_10156380
1195 Ga0207667_10163213
1196 Ga0207712_10030695
1197 Ga0207712_10177054
1198 Ga0207712_10281369
1199 Ga0207668_10006550
1200 Ga0207668_10286327
1201 Ga0207640_10012787
1202 Ga0207677_10001633
1203 Ga0207677_10506273
1204 Ga0207703_10019451
1205 Ga0207703_10051829
1206 Ga0207678_10153461
1207 Ga0207708_10000329
1208 Ga0207702_10350583
1209 Ga0207648_10000112
1210 Ga0207675_100000117
1211 Ga0207675_100035018
1212 Ga0207675_100071213
1213 Ga0207675_100101674
1214 Ga0207683_10000451
1215 Ga0207683_10080796
1216 Ga0207698_10114301
1217 Ga0207698_11104688
1218 Ga0209971_1021740
1219 Ga0209998_10009386
1220 Ga0209974_10003935
1221 Ga0209974_10006008
1222 Ga0207428_10014509
1223 Ga0207428_10076101
1224 Ga0207428_10134220
1225 Ga0207428_10148745
1226 Ga0207428_10365340
1227 Ga0268266_10477631
1228 Ga0268265_10108343
1229 Ga0268264_10008289
1230 Ga0307408_100019491
1231 Ga0307408_100030919
1232 Ga0307408_100249514
1233 Ga0307405_10024214
1234 Ga0307405_10055521
1235 Ga0307410_10025610
1236 Ga0307410_10172954
1237 Ga0307406_10005733
1238 Ga0307407_10067677
1239 Ga0307412_10005612
1240 Ga0307412_10254880
1241 Ga0307409_100005781
1242 Ga0307409_100006095
1243 Ga0307409_100227774
1244 Ga0307416_100003132
1245 Ga0307416_100019244
1246 Ga0307416_100051032
1247 Ga0307416_100275460
1248 Ga0307414_10563504
1249 Ga0307411_10152228
1250 Ga0307415_100000014
1251 Ga0307415_100000105
1252 Ga0307415_100020149
1253 Ga0307415_100034111
1254 Ga0307415_100088434
1255 Ga0307415_100298429
1256 Ga0307415_100899988
1257 Ga0373962_0038961
1258 Ga0373931_0096184
1259 Ga0395900_0015425
1260 Ga0395900_0031379
1261 Ga0395898_0059923
1262 Ga0395905_0354541
1263 Ga0395901_0005579
1264 Ga0395901_0078446
1265 Ga0395901_0152238
1266 Ga0395901_0288267
1267 Ga0439465_0027292
1268 Ga0439431_0008546
1269 Ga0439443_000405
1270 Ga0439448_0000036
1271 Ga0439448_0003538
1272 Ga0439450_000009
1273 Ga0439454_003938
1274 Ga0439455_0006275
1275 Ga0439456_032795
1276 Ga0439463_002568
1277 Ga0439463_003319
1278 Ga0450919_015070
1279 Ga0450888_003257
1280 Ga0450888_004660
1281 Ga0450890_024645
1282 Ga0450896_018055
1283 Ga0450900_003735
1284 Ga0450902_004511
1285 Ga0450904_002347
1286 Ga0450905_004083
1287 Ga0450907_020709
1288 Ga0439446_0025559
1289 Ga0439458_0015239
1290 Ga0439435_0033635
1291 Ga0439444_0002398
1292 Ga0439444_0073169
1293 Ga0439464_0001734
1294 Ga0439464_0003738
1295 Ga0439464_0006657
1296 Ga0439464_0025791
1297 Ga0439460_0000877
1298 Ga0439460_0005287
1299 Ga0450916_006755
1300 Ga0450893_0008832
1301 Ga0451577_0639735
1302 Ga0439440_0006928
1303 Ga0439440_0019914
1304 Ga0439440_0072168
1305 Ga0495638_0001609
1306 Ga0495631_0122364
1307 Ga0495631_0156771
1308 Ga0495663_0018205
1309 Ga0495642_0102025
1310 Ga0495656_0042936
1311 Ga0495668_0229058
1312 Ga0496100_0436567
1313 Ga0496101_0224821
1314 Ga0496102_0010611
1315 Ga0496103_0003795
1316 Ga0496105_0198902
1317 Ga0496106_0006699
1318 Ga0496106_0065833
1319 Ga0496107_0004395
1320 Ga0496107_0192718
1321 Ga0496108_0156223
1322 Ga0496110_0131645
1323 Ga0496113_0367713
1324 Ga0496114_0002083
1325 Ga0496114_0093921
1326 Ga0496115_0001294
1327 Ga0496115_0012901
1328 Ga0501300_020608
1329 Ga0501031_0011749
1330 Ga0501031_0099018
1331 Ga0501031_0131637
1332 Ga0501031_0157927
1333 Ga0501031_0296277
1334 Ga0501032_0008010
1335 Ga0501032_0046699
1336 Ga0501032_0103076
1337 Ga0501032_0200917
1338 Ga0501032_0363854
1339 Ga0501033_0015043
1340 Ga0501033_0016204
1341 Ga0501033_0144553
1342 Ga0501033_0152375
1343 Ga0501034_0326005
1344 Ga0501036_0000582
1345 Ga0501036_0004752
1346 Ga0501036_0006709
1347 Ga0501036_0017926
1348 Ga0501036_0022375
1349 Ga0501036_0036275
1350 Ga0501036_0069740
1351 Ga0501036_0099255
1352 Ga0501036_0169091
1353 Ga0501036_0231293
1354 Ga0501036_0473366
1355 Ga0501036_0750975
1356 Ga0501037_0013058
1357 Ga0501037_0044775
1358 Ga0501037_0062644
1359 Ga0501037_0169616
1360 Ga0501038_0010768
1361 Ga0501038_0012411
1362 Ga0501038_0017197
1363 Ga0501038_0018975
1364 Ga0501038_0032919
1365 Ga0501038_0046241
1366 Ga0501038_0057733
1367 Ga0501038_0065595
1368 Ga0501038_0082283
1369 Ga0501038_0136757
1370 Ga0501038_0178346
1371 Ga0501038_0183442
1372 Ga0501038_0208302
1373 Ga0501038_0212010
1374 Ga0501038_0310098
1375 Ga0501038_0317580
1376 Ga0501038_0345708
1377 Ga0501039_0000391
1378 Ga0501039_0002002
1379 Ga0501039_0005154
1380 Ga0501039_0012997
1381 Ga0501039_0013902
1382 Ga0501039_0044760
1383 Ga0501039_0054680
1384 Ga0501039_0070112
1385 Ga0501039_0080715
1386 Ga0501039_0097536
1387 Ga0501039_0118285
1388 Ga0501039_0135603
1389 Ga0501039_0233416
1390 Ga0501039_0285092
1391 Ga0501040_0000825
1392 Ga0501040_0001130
1393 Ga0501040_0003074
1394 Ga0501040_0004483
1395 Ga0501040_0013401
1396 Ga0501040_0017524
1397 Ga0501040_0022946
1398 Ga0501040_0023544
1399 Ga0501040_0050004
1400 Ga0501040_0069648
1401 Ga0501040_0083582
1402 Ga0501040_0085269
1403 Ga0501040_0133631
1404 Ga0501040_0143396
1405 Ga0501040_0147720
1406 Ga0501040_0166527
1407 Ga0501040_0182919
1408 Ga0501040_0291661
1409 Ga0501040_0344841
1410 Ga0501041_0000831
1411 Ga0501041_0001721
1412 Ga0501041_0012758
1413 Ga0501041_0021318
1414 Ga0501041_0022509
1415 Ga0501041_0031317
1416 Ga0501041_0031392
1417 Ga0501041_0034376
1418 Ga0501041_0044344
1419 Ga0501041_0046444
1420 Ga0501041_0046660
1421 Ga0501041_0061821
1422 Ga0501041_0076576
1423 Ga0501041_0119718
1424 Ga0501041_0128497
1425 Ga0501041_0249110
1426 Ga0501041_0251701
1427 Ga0501042_0000539
1428 Ga0501042_0002500
1429 Ga0501042_0009695
1430 Ga0501042_0011560
1431 Ga0501042_0011595
1432 Ga0501042_0016167
1433 Ga0501042_0058134
1434 Ga0501042_0067053
1435 Ga0501042_0119854
1436 Ga0501042_0122613
1437 Ga0501042_0162213
1438 Ga0501042_0291081
1439 Ga0501043_0011169
1440 Ga0501043_0026806
1441 Ga0501043_0060681
1442 Ga0501043_0081413
1443 Ga0501043_0111298
1444 Ga0501043_0223298
1445 Ga0501043_0322395
1446 Ga0501043_0577518
1447 Ga0501046_0000792
1448 Ga0501046_0001108
1449 Ga0501046_0001759
1450 Ga0501046_0045232
1451 Ga0501046_0053364
1452 Ga0501046_0060852
1453 Ga0501046_0067364
1454 Ga0501046_0160978
1455 Ga0501046_0208248
1456 Ga0501046_0247677
1457 Ga0501046_0324982
1458 Ga0501046_0338933
1459 Ga0501047_0069768
1460 Ga0501048_0000165
1461 Ga0501048_0000495
1462 Ga0501048_0005879
1463 Ga0501048_0017926
1464 Ga0501048_0025841
1465 Ga0501048_0034293
1466 Ga0501048_0042536
1467 Ga0501048_0054061
1468 Ga0501048_0078332
1469 Ga0501048_0085598
1470 Ga0501048_0087522
1471 Ga0501048_0093151
1472 Ga0501048_0150676
1473 Ga0501048_0177534
1474 Ga0501048_0283765
1475 Ga0501048_0290706
1476 Ga0501048_0303099
1477 Ga0501068_0010653
1478 Ga0501068_0023891
1479 Ga0501068_0027781
1480 Ga0501068_0028650
1481 Ga0501068_0063687
1482 Ga0501068_0095640
1483 Ga0501068_0155507
1484 Ga0501069_0013510
1485 Ga0501069_0014680
1486 Ga0501069_0053250
1487 Ga0501070_0046346
1488 Ga0501070_0080691
1489 Ga0501071_0000605
1490 Ga0501071_0001820
1491 Ga0501071_0003969
1492 Ga0501071_0005295
1493 Ga0501071_0009846
1494 Ga0501071_0026283
1495 Ga0501071_0026634
1496 Ga0501071_0039555
1497 Ga0501071_0073273
1498 Ga0501071_0077439
1499 Ga0501071_0091965
1500 Ga0501071_0104030
1501 Ga0501071_0121161
1502 Ga0501071_0217681
1503 Ga0501071_0264669
1504 Ga0501071_0342354
1505 Ga0501071_0474586
1506 Ga0501072_0004217
1507 Ga0501072_0006087
1508 Ga0501072_0007345
1509 Ga0501072_0008040
1510 Ga0501072_0011517
1511 Ga0501072_0025964
1512 Ga0501072_0027361
1513 Ga0501072_0038181
1514 Ga0501072_0068976
1515 Ga0501072_0072045
1516 Ga0501072_0076422
1517 Ga0501072_0078448
1518 Ga0501072_0090542
1519 Ga0501072_0114625
1520 Ga0501072_0126827
1521 Ga0501072_0155570
1522 Ga0501072_0179650
1523 Ga0501072_0216359
1524 Ga0501072_0219485
1525 Ga0501072_0278560
1526 Ga0501072_0289928
1527 Ga0501072_0381332
1528 Ga0501072_0400616
1529 Ga0501072_0547233
1530 Ga0501073_0103623
1531 Ga0501074_0000608
1532 Ga0501074_0002779
1533 Ga0501074_0015037
1534 Ga0501074_0024897
1535 Ga0501074_0031123
1536 Ga0501074_0047814
1537 Ga0501074_0054313
1538 Ga0501074_0192822
1539 Ga0501074_0270466
1540 Ga0501074_0444063
1541 Ga0501075_0000672
1542 Ga0501075_0001648
1543 Ga0501075_0005875
1544 Ga0501075_0006176
1545 Ga0501075_0039876
1546 Ga0501075_0063668
1547 Ga0501075_0099546
1548 Ga0501075_0148535
1549 Ga0501075_0237479
1550 Ga0501076_0000903
1551 Ga0501076_0003857
1552 Ga0501076_0007166
1553 Ga0501076_0008440
1554 Ga0501076_0010120
1555 Ga0501076_0010833
1556 Ga0501076_0010866
1557 Ga0501076_0012231
1558 Ga0501076_0033084
1559 Ga0501076_0035385
1560 Ga0501076_0044434
1561 Ga0501076_0052330
1562 Ga0501076_0065860
1563 Ga0501076_0067031
1564 Ga0501076_0094630
1565 Ga0501076_0130069
1566 Ga0501076_0176734
1567 Ga0501076_0221752
1568 Ga0501076_0249364
1569 Ga0501076_0288772
1570 Ga0501077_0002176
1571 Ga0501077_0003394
1572 Ga0501077_0009331
1573 Ga0501077_0011097
1574 Ga0501077_0034315
1575 Ga0501077_0038379
1576 Ga0501077_0077985
1577 Ga0501077_0080496
1578 Ga0501077_0209957
1579 Ga0501077_0346139
1580 Ga0501077_0391908
1581 Ga0501079_0000214
1582 Ga0501079_0000479
1583 Ga0501079_0003269
1584 Ga0501079_0004598
1585 Ga0501079_0006141
1586 Ga0501079_0021393
1587 Ga0501079_0024754
1588 Ga0501079_0033068
1589 Ga0501079_0034361
1590 Ga0501079_0035517
1591 Ga0501079_0060780
1592 Ga0501079_0079869
1593 Ga0501079_0088118
1594 Ga0501079_0106339
1595 Ga0501079_0145909
1596 Ga0501079_0184124
1597 Ga0501079_0299971
1598 Ga0501079_0356263
1599 Ga0501080_0009515
1600 Ga0501080_0025801
1601 Ga0501080_0028990
1602 Ga0501080_0055473
1603 Ga0501080_0058624
1604 Ga0501080_0077330
1605 Ga0501080_0121239
1606 Ga0501080_0179577
1607 Ga0501080_0479473
1608 Ga0501080_0551151
1609 Ga0501080_0670606
1610 Ga0501080_0875097
1611 Ga0501081_0000596
1612 Ga0501081_0003165
1613 Ga0501081_0007510
1614 Ga0501081_0010476
1615 Ga0501081_0010803
1616 Ga0501081_0026744
1617 Ga0501081_0055424
1618 Ga0501081_0085898
1619 Ga0501081_0204701
1620 Ga0501081_0252441
1621 Ga0501081_0255195
1622 Ga0501081_0308349
1623 Ga0501081_0476017
1624 Ga0501081_0508376
1625 Ga0501083_0022753
1626 Ga0501083_0033096
1627 Ga0501083_0078061
1628 Ga0501083_0105044
1629 Ga0501083_0129088
1630 Ga0501035_0004738
1631 Ga0501035_0041657
1632 Ga0501035_0116912
1633 Ga0501035_0168457
1634 Ga0501035_0207328
1635 Ga0501035_0496067
1636 Ga0501044_0108234
1637 Ga0501044_0359297
1638 Ga0501045_0000417
1639 Ga0501045_0001327
1640 Ga0501045_0001675
1641 Ga0501045_0003424
1642 Ga0501045_0030122
1643 Ga0501045_0054495
1644 Ga0501045_0067194
1645 Ga0501045_0077637
1646 Ga0501045_0079604
1647 Ga0501045_0097284
1648 Ga0501045_0103604
1649 Ga0501045_0113941
1650 Ga0501045_0138262
1651 Ga0501045_0293275
1652 Ga0501045_0325532
1653 Ga0501045_0387766
1654 Ga0501045_0394300
1655 Ga0501045_0396091
1656 nmdc:mga0k408_14839_c1
1657 nmdc:mga05p37_117045_c1
1658 nmdc:mga05p37_117381_c1
1659 nmdc:mga05p37_1180_c1
1660 nmdc:mga05p37_123030_c1
1661 nmdc:mga05p37_13070_c1
1662 nmdc:mga05p37_165557_c1
1663 nmdc:mga05p37_18730_c1
1664 nmdc:mga05p37_20970_c2
1665 nmdc:mga05p37_21742_c1
1666 nmdc:mga05p37_298579_c1
1667 nmdc:mga05p37_3426_c1
1668 nmdc:mga05p37_40698_c1
1669 nmdc:mga05p37_53934_c1
1670 nmdc:mga05p37_539_c1
1671 nmdc:mga05p37_617415_c1
1672 nmdc:mga05p37_718822_c1
1673 nmdc:mga05p37_8783_c1
1674 nmdc:mga05p37_9623_c1
1675 nmdc:mga09592_146520_c1
1676 nmdc:mga09592_246064_c1
1677 nmdc:mga09592_249_c1
1678 nmdc:mga09592_259578_c1
1679 nmdc:mga09592_278528_c1
1680 nmdc:mga09592_390171_c1
1681 nmdc:mga09592_397318_c1
1682 nmdc:mga09592_45392_c1
1683 nmdc:mga09592_503132_c1
1684 nmdc:mga09592_61569_c1
1685 nmdc:mga0qj67_103143_c1
1686 nmdc:mga0qj67_124963_c1
1687 nmdc:mga0qj67_169003_c1
1688 nmdc:mga0qj67_206231_c1
1689 nmdc:mga0qj67_211383_c1
1690 nmdc:mga0qj67_217550_c1
1691 nmdc:mga0qj67_22811_c1
1692 nmdc:mga0qj67_31297_c1
1693 nmdc:mga0qj67_313980_c1
1694 nmdc:mga0qj67_353387_c1
1695 nmdc:mga0qj67_431618_c1
1696 nmdc:mga0qj67_474347_c1
1697 nmdc:mga0qj67_551402_c1
1698 nmdc:mga0qj67_77390_c1
1699 nmdc:mga0qj67_79638_c1
1700 nmdc:mga0qj67_8883_c1
1701 nmdc:mga0qj67_99707_c1
1702 nmdc:mga06r32_104518_c1
1703 nmdc:mga06r32_137012_c1
1704 nmdc:mga06r32_14479_c1
1705 nmdc:mga06r32_148770_c1
1706 nmdc:mga06r32_149498_c1
1707 nmdc:mga06r32_266_c1
1708 nmdc:mga06r32_269639_c1
1709 nmdc:mga06r32_391174_c1
1710 nmdc:mga06r32_426090_c1
1711 nmdc:mga06r32_467208_c1
1712 nmdc:mga06r32_4878_c1
1713 nmdc:mga06r32_568468_c1
1714 nmdc:mga06r32_570389_c1
1715 nmdc:mga06r32_62274_c1
1716 nmdc:mga06r32_91102_c1
1717 nmdc:mga06r32_9560_c1
1718 nmdc:mga08y16_108533_c1
1719 nmdc:mga08y16_133119_c1
1720 nmdc:mga08y16_24835_c1
1721 nmdc:mga08y16_2703_c1
1722 nmdc:mga08y16_381248_c1
1723 nmdc:mga08y16_66780_c1
1724 nmdc:mga0n895_197961_c1
1725 nmdc:mga0n895_237451_c1
1726 nmdc:mga0n895_25389_c1
1727 nmdc:mga0n895_343976_c1
1728 nmdc:mga0n895_358735_c1
1729 nmdc:mga0n895_531916_c1
1730 nmdc:mga0n895_599156_c1
1731 nmdc:mga0n895_8577_c1
1732 nmdc:mga0rr50_18537_c1
1733 nmdc:mga0rr50_215804_c1
1734 nmdc:mga0rr50_62450_c1
1735 nmdc:mga08x19_154404_c1
1736 nmdc:mga08x19_43577_c1
1737 nmdc:mga0a205_105122_c1
1738 nmdc:mga0a205_11328_c1
1739 nmdc:mga0a205_19230_c1
1740 nmdc:mga0a205_5765_c1
1741 nmdc:mga0a205_6578_c1
1742 Ga0501084_0002256
1743 Ga0501084_0002853
1744 Ga0501084_0003996
1745 Ga0501084_0021794
1746 Ga0501084_0021946
1747 Ga0501084_0041828
1748 Ga0501084_0101153
1749 Ga0501084_0136458
1750 Ga0501084_0182431
1751 Ga0501084_0186404
1752 Ga0501084_0187460
1753 Ga0501084_0238656
1754 Ga0501084_0260009
1755 Ga0501084_0426724
1756 Ga0501084_0570409
1757 Ga0590071_006370
1758 Ga0590071_022019
1759 Ga0590074_003441
1760 Ga0590077_019201
1761 Ga0590077_041419
1762 Ga0501082_0000174
1763 Ga0501082_0002382
1764 Ga0501082_0010036
1765 Ga0501082_0010328
1766 Ga0501082_0021236
1767 Ga0501082_0031218
1768 Ga0501082_0037474
1769 Ga0501082_0066283
1770 Ga0501082_0071367
1771 Ga0501082_0269393
1772 Ga0501082_0293740
1773 Ga0501082_0321545
1774 Ga0501082_0327659
1775 Ga0501082_0353379
1776 Ga0501082_0371593
1777 Ga0501082_0376643
1778 Ga0501082_0403847
1779 Ga0501082_0495721
1780 Ga0501082_0571014
1781 Ga0530510_0000104
1782 Ga0530510_0000476
1783 Ga0530510_0005517
1784 Ga0530510_0010505
1785 Ga0530510_0012247
1786 Ga0530510_0012337
1787 Ga0530510_0019676
1788 Ga0530510_0025595
1789 Ga0530510_0026940
1790 Ga0530510_0044422
1791 Ga0530510_0072709
1792 Ga0530510_0102259
1793 Ga0530510_0130047
1794 Ga0530510_0181826
1795 Ga0530510_0185308
1796 Ga0530510_0193575
1797 Ga0530510_0217821
1798 Ga0530510_0220432
1799 Ga0530510_0265128
1800 Ga0530510_0311918
1801 Ga0530510_0726868
1802 2558864794
1803 2744957624
1804 2874170127
1805 2876393642
1806 2881163403
1807 2904660150
1808 2961115475
1809 2968111206
1810 2977866046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

22

111

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wq2-assembly1.cif.gz_B neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.9332 35 79
7kua-assembly1.cif.gz_A-2 crystal structure of the marr family transcriptional regulator from pseudomonas putida bound to indole 3 acetic acid 0.9067 21 95
7bzd-assembly1.cif.gz_A-2 structure of bacillus subtilis hxlr, wild type 0.8858 20 105
5m52-assembly2.cif.gz_B crystal structure of yeast brr2 full-lenght in complex with prp8 jab1 domain 0.8803 48 87
4rs8-assembly1.cif.gz_B apo structure of novel pnob8 plasmid centromere binding protein 0.87 20 89
ID Description Score Start End Superfamily
af_P91529_82_146_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8801 21 79 1.10.10.10
af_Q58948_3_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.879 21 93 1.10.10.10
af_Q4DKK4_76_138_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8766 24 79 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8615 25 79 1.10.10.10
af_Q57693_7_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8611 23 88 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7J9WC18-F1-model_v4 Uncharacterized protein 0.9287 113 212
AF-A0A654ZZ52-F1-model_v4 Transcriptional regulator 0.9254 117 218
AF-A0A2X3KBI1-F1-model_v4 deleted 0.9201 115 218
AF-A0A535KGX2-F1-model_v4 Uncharacterized protein 0.9109 115 200
AF-A0A7V9BMN0-F1-model_v4 SCP2 domain-containing protein 0.9025 133 221

Map