F485288
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 904 | 361 | 1808 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0059549|Ga0466969_0059549_928_1290 |
| Length | 106 |
| Sequence | MDDRPIYMISVAADLVGMHPQTLRMYEAKGLIRPQRTPGGTRLYSEADIERLRIVQRLTTELGLNLAGVELVLRLEDELRKAHAQVERLQRRDLVVYREERHPERA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 107 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 171 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 180 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 182 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 196 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 198 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 215 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 219 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 220 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 221 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 222 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 223 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 224 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 225 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 226 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 227 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 228 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 229 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 230 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 231 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 232 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 233 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 234 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 235 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 236 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 237 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 238 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 239 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 240 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 241 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 242 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 243 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 246 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 314 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 315 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 316 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 317 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 318 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 358 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 361 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99 |
| Metatranscriptomes | 1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 8.19 |
| Rhizosphere | 90.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466969_0059549 | 3300044656 | Bacteria | 1857 |
| 2 | JGI24742J22300_10002407 | 3300002244 | Bacteria | 2997 |
| 3 | Ga0070658_10016087 | 3300005327 | Bacteria | 5983 |
| 4 | Ga0070658_10062834 | 3300005327 | Bacteria | 3026 |
| 5 | Ga0070658_11169599 | 3300005327 | Bacteria | 669 |
| 6 | Ga0070683_100796345 | 3300005329 | Bacteria | 906 |
| 7 | Ga0070683_100957300 | 3300005329 | Bacteria | 821 |
| 8 | Ga0068869_100659207 | 3300005334 | Bacteria | 889 |
| 9 | Ga0070666_10264481 | 3300005335 | Bacteria | 1220 |
| 10 | Ga0070680_100065367 | 3300005336 | Bacteria | 2981 |
| 11 | Ga0070680_100206596 | 3300005336 | Bacteria | 1656 |
| 12 | Ga0070680_100236457 | 3300005336 | Bacteria | 1543 |
| 13 | Ga0070680_100311063 | 3300005336 | Bacteria | 1337 |
| 14 | Ga0070680_100361888 | 3300005336 | Bacteria | 1234 |
| 15 | Ga0070680_100518305 | 3300005336 | Bacteria | 1020 |
| 16 | Ga0070682_100106780 | 3300005337 | Bacteria | 1858 |
| 17 | Ga0070682_100164915 | 3300005337 | Bacteria | 1534 |
| 18 | Ga0070682_100200074 | 3300005337 | Bacteria | 1408 |
| 19 | Ga0068868_100117788 | 3300005338 | Bacteria | 2164 |
| 20 | Ga0070660_100024469 | 3300005339 | Bacteria | 4478 |
| 21 | Ga0070660_100045564 | 3300005339 | Bacteria | 3358 |
| 22 | Ga0070660_100054273 | 3300005339 | Bacteria | 3094 |
| 23 | Ga0070660_101121955 | 3300005339 | Bacteria | 666 |
| 24 | Ga0070660_101250510 | 3300005339 | Bacteria | 630 |
| 25 | Ga0070689_100137086 | 3300005340 | Bacteria | 1966 |
| 26 | Ga0070692_10034327 | 3300005345 | Bacteria | 2562 |
| 27 | Ga0070668_100228289 | 3300005347 | Bacteria | 1538 |
| 28 | Ga0070669_100135350 | 3300005353 | Bacteria | 1895 |
| 29 | Ga0070675_100109097 | 3300005354 | Bacteria | 2339 |
| 30 | Ga0070675_100121365 | 3300005354 | Bacteria | 2221 |
| 31 | Ga0070675_100856491 | 3300005354 | Bacteria | 832 |
| 32 | Ga0070671_100109774 | 3300005355 | Bacteria | 2317 |
| 33 | Ga0070671_100176914 | 3300005355 | Bacteria | 1806 |
| 34 | Ga0070674_100114732 | 3300005356 | Bacteria | 1984 |
| 35 | Ga0070673_100069209 | 3300005364 | Bacteria | 2828 |
| 36 | Ga0070673_100563624 | 3300005364 | Bacteria | 1036 |
| 37 | Ga0070688_100008913 | 3300005365 | Bacteria | 5463 |
| 38 | Ga0070659_100018012 | 3300005366 | Bacteria | 5325 |
| 39 | Ga0070659_100120401 | 3300005366 | Bacteria | 2125 |
| 40 | Ga0070659_100464052 | 3300005366 | Bacteria | 1076 |
| 41 | Ga0070667_102228794 | 3300005367 | Unclassified | 516 |
| 42 | Ga0070703_10011287 | 3300005406 | Bacteria | 2522 |
| 43 | Ga0070709_10006375 | 3300005434 | Bacteria | 6426 |
| 44 | Ga0070709_10422785 | 3300005434 | Bacteria | 999 |
| 45 | Ga0070709_10578359 | 3300005434 | Bacteria | 862 |
| 46 | Ga0070714_100039545 | 3300005435 | Bacteria | 3971 |
| 47 | Ga0070714_100047946 | 3300005435 | Bacteria | 3631 |
| 48 | Ga0070714_100052104 | 3300005435 | Bacteria | 3490 |
| 49 | Ga0070714_100052804 | 3300005435 | Bacteria | 3468 |
| 50 | Ga0070714_100102045 | 3300005435 | Bacteria | 2529 |
| 51 | Ga0070714_100147764 | 3300005435 | Bacteria | 2115 |
| 52 | Ga0070714_100343059 | 3300005435 | Bacteria | 1401 |
| 53 | Ga0070714_100359820 | 3300005435 | Bacteria | 1368 |
| 54 | Ga0070714_100477902 | 3300005435 | Bacteria | 1186 |
| 55 | Ga0070714_101378043 | 3300005435 | Unclassified | 689 |
| 56 | Ga0070713_100138473 | 3300005436 | Bacteria | 2153 |
| 57 | Ga0070713_100163370 | 3300005436 | Bacteria | 1989 |
| 58 | Ga0070713_100734136 | 3300005436 | Bacteria | 944 |
| 59 | Ga0070713_100880423 | 3300005436 | Bacteria | 861 |
| 60 | Ga0070713_101251328 | 3300005436 | Bacteria | 719 |
| 61 | Ga0070713_101983327 | 3300005436 | Bacteria | 565 |
| 62 | Ga0070710_11244088 | 3300005437 | Bacteria | 552 |
| 63 | Ga0070701_10000667 | 3300005438 | Bacteria | 12056 |
| 64 | Ga0070701_11412199 | 3300005438 | Unclassified | 501 |
| 65 | Ga0070711_100001144 | 3300005439 | Bacteria | 14228 |
| 66 | Ga0070711_100595194 | 3300005439 | Bacteria | 922 |
| 67 | Ga0070705_100101662 | 3300005440 | Bacteria | 1816 |
| 68 | Ga0070700_100018297 | 3300005441 | Bacteria | 4026 |
| 69 | Ga0070700_101088827 | 3300005441 | Bacteria | 662 |
| 70 | Ga0070694_100014942 | 3300005444 | Bacteria | 4864 |
| 71 | Ga0070663_100020799 | 3300005455 | Bacteria | 4350 |
| 72 | Ga0070678_100071583 | 3300005456 | Bacteria | 2596 |
| 73 | Ga0070678_100101832 | 3300005456 | Bacteria | 2227 |
| 74 | Ga0070662_100441605 | 3300005457 | Bacteria | 1079 |
| 75 | Ga0070681_10013533 | 3300005458 | Bacteria | 8112 |
| 76 | Ga0070681_10067782 | 3300005458 | Bacteria | 3536 |
| 77 | Ga0070681_10073300 | 3300005458 | Bacteria | 3385 |
| 78 | Ga0070681_10105236 | 3300005458 | Bacteria | 2764 |
| 79 | Ga0070681_10148138 | 3300005458 | Bacteria | 2275 |
| 80 | Ga0070681_10263444 | 3300005458 | Bacteria | 1635 |
| 81 | Ga0068867_100007911 | 3300005459 | Bacteria | 7510 |
| 82 | Ga0068867_100205482 | 3300005459 | Bacteria | 1579 |
| 83 | Ga0070685_10005085 | 3300005466 | Bacteria | 6671 |
| 84 | Ga0070685_10165760 | 3300005466 | Bacteria | 1412 |
| 85 | Ga0070685_11174186 | 3300005466 | Bacteria | 582 |
| 86 | Ga0070706_101314748 | 3300005467 | Bacteria | 663 |
| 87 | Ga0070707_100048190 | 3300005468 | Bacteria | 4081 |
| 88 | Ga0070707_101011800 | 3300005468 | Bacteria | 796 |
| 89 | Ga0070707_101148774 | 3300005468 | Bacteria | 743 |
| 90 | Ga0070698_100022593 | 3300005471 | Bacteria | 6579 |
| 91 | Ga0070698_100172630 | 3300005471 | Bacteria | 2102 |
| 92 | Ga0070698_100277511 | 3300005471 | Bacteria | 1608 |
| 93 | Ga0070698_100298139 | 3300005471 | Bacteria | 1543 |
| 94 | Ga0070698_100342405 | 3300005471 | Bacteria | 1426 |
| 95 | Ga0070698_101802477 | 3300005471 | Bacteria | 565 |
| 96 | Ga0070699_100192797 | 3300005518 | Bacteria | 1811 |
| 97 | Ga0070699_100506653 | 3300005518 | Bacteria | 1097 |
| 98 | Ga0070699_101204270 | 3300005518 | Unclassified | 695 |
| 99 | Ga0070679_100022641 | 3300005530 | Bacteria | 6143 |
| 100 | Ga0070679_100036849 | 3300005530 | Bacteria | 4855 |
| 101 | Ga0070679_100078366 | 3300005530 | Bacteria | 3293 |
| 102 | Ga0070679_100084717 | 3300005530 | Bacteria | 3157 |
| 103 | Ga0070679_100094397 | 3300005530 | Bacteria | 2978 |
| 104 | Ga0070679_100125431 | 3300005530 | Bacteria | 2550 |
| 105 | Ga0070679_100851717 | 3300005530 | Bacteria | 855 |
| 106 | Ga0070684_100078419 | 3300005535 | Bacteria | 2919 |
| 107 | Ga0070684_100105782 | 3300005535 | Bacteria | 2518 |
| 108 | Ga0070684_101506609 | 3300005535 | Bacteria | 634 |
| 109 | Ga0068853_100011697 | 3300005539 | Bacteria | 7132 |
| 110 | Ga0070672_100078149 | 3300005543 | Bacteria | 2647 |
| 111 | Ga0070672_100176064 | 3300005543 | Bacteria | 1781 |
| 112 | Ga0070672_101281937 | 3300005543 | Bacteria | 654 |
| 113 | Ga0070686_100009622 | 3300005544 | Bacteria | 5434 |
| 114 | Ga0070695_100000005 | 3300005545 | Bacteria | 97484 |
| 115 | Ga0070696_100203246 | 3300005546 | Bacteria | 1480 |
| 116 | Ga0070696_100438317 | 3300005546 | Bacteria | 1029 |
| 117 | Ga0070693_100031252 | 3300005547 | Bacteria | 2917 |
| 118 | Ga0070693_100041697 | 3300005547 | Bacteria | 2583 |
| 119 | Ga0070693_100210712 | 3300005547 | Bacteria | 1268 |
| 120 | Ga0070665_100347398 | 3300005548 | Bacteria | 1488 |
| 121 | Ga0070665_100437539 | 3300005548 | Bacteria | 1317 |
| 122 | Ga0070704_100011254 | 3300005549 | Bacteria | 5477 |
| 123 | Ga0070704_100754504 | 3300005549 | Bacteria | 867 |
| 124 | Ga0070704_100934571 | 3300005549 | Bacteria | 781 |
| 125 | Ga0068855_100155542 | 3300005563 | Bacteria | 2598 |
| 126 | Ga0068855_100328463 | 3300005563 | Bacteria | 1689 |
| 127 | Ga0068855_100369478 | 3300005563 | Bacteria | 1577 |
| 128 | Ga0068855_100504358 | 3300005563 | Bacteria | 1314 |
| 129 | Ga0068855_101451379 | 3300005563 | Bacteria | 706 |
| 130 | Ga0068854_100424363 | 3300005578 | Bacteria | 1105 |
| 131 | Ga0068856_100006244 | 3300005614 | Bacteria | 11694 |
| 132 | Ga0068856_100140383 | 3300005614 | Bacteria | 2423 |
| 133 | Ga0068856_100172951 | 3300005614 | Bacteria | 2172 |
| 134 | Ga0070702_100004914 | 3300005615 | Bacteria | 6161 |
| 135 | Ga0070702_100148742 | 3300005615 | Bacteria | 1501 |
| 136 | Ga0070702_100739960 | 3300005615 | Bacteria | 754 |
| 137 | Ga0070702_100792425 | 3300005615 | Bacteria | 732 |
| 138 | Ga0068852_100061014 | 3300005616 | Bacteria | 3276 |
| 139 | Ga0068852_100265713 | 3300005616 | Bacteria | 1649 |
| 140 | Ga0068852_101179519 | 3300005616 | Bacteria | 787 |
| 141 | Ga0068859_100392405 | 3300005617 | Bacteria | 1484 |
| 142 | Ga0068866_10057482 | 3300005718 | Bacteria | 2005 |
| 143 | Ga0068861_101312358 | 3300005719 | Bacteria | 704 |
| 144 | Ga0068870_10464612 | 3300005840 | Bacteria | 837 |
| 145 | Ga0068863_100658592 | 3300005841 | Bacteria | 1039 |
| 146 | Ga0068858_100778311 | 3300005842 | Bacteria | 933 |
| 147 | Ga0070717_10016628 | 3300006028 | Bacteria | 5708 |
| 148 | Ga0070717_10074728 | 3300006028 | Bacteria | 2833 |
| 149 | Ga0070717_10087186 | 3300006028 | Bacteria | 2628 |
| 150 | Ga0070717_10310749 | 3300006028 | Bacteria | 1403 |
| 151 | Ga0070717_11180662 | 3300006028 | Bacteria | 697 |
| 152 | Ga0070716_100427209 | 3300006173 | Bacteria | 960 |
| 153 | Ga0070716_101261597 | 3300006173 | Bacteria | 596 |
| 154 | Ga0070712_100002015 | 3300006175 | Bacteria | 12440 |
| 155 | Ga0070712_101703875 | 3300006175 | Bacteria | 552 |
| 156 | Ga0097621_100436935 | 3300006237 | Bacteria | 1177 |
| 157 | Ga0068871_100012901 | 3300006358 | Bacteria | 6188 |
| 158 | Ga0075428_101479133 | 3300006844 | Bacteria | 712 |
| 159 | Ga0075433_11412755 | 3300006852 | Bacteria | 602 |
| 160 | Ga0075434_100035672 | 3300006871 | Bacteria | 4916 |
| 161 | Ga0068865_100007640 | 3300006881 | Bacteria | 6658 |
| 162 | Ga0068865_100687395 | 3300006881 | Bacteria | 873 |
| 163 | Ga0075436_100167748 | 3300006914 | Bacteria | 1550 |
| 164 | Ga0097620_100392396 | 3300006931 | Bacteria | 1484 |
| 165 | Ga0105240_10010198 | 3300009093 | Bacteria | 13222 |
| 166 | Ga0105240_10274583 | 3300009093 | Bacteria | 1939 |
| 167 | Ga0105245_10323422 | 3300009098 | Bacteria | 1520 |
| 168 | Ga0105245_10468511 | 3300009098 | Bacteria | 1271 |
| 169 | Ga0105245_10558588 | 3300009098 | Unclassified | 1167 |
| 170 | Ga0105245_11602609 | 3300009098 | Bacteria | 703 |
| 171 | Ga0114129_10114471 | 3300009147 | Bacteria | 3719 |
| 172 | Ga0114129_10861051 | 3300009147 | Bacteria | 1151 |
| 173 | Ga0114129_11970333 | 3300009147 | Bacteria | 707 |
| 174 | Ga0105243_10122570 | 3300009148 | Bacteria | 2194 |
| 175 | Ga0105243_10382603 | 3300009148 | Bacteria | 1302 |
| 176 | Ga0105241_11339273 | 3300009174 | Bacteria | 683 |
| 177 | Ga0105242_10015971 | 3300009176 | Bacteria | 5834 |
| 178 | Ga0105242_11563734 | 3300009176 | Bacteria | 692 |
| 179 | Ga0105248_10006882 | 3300009177 | Bacteria | 12462 |
| 180 | Ga0105248_10101951 | 3300009177 | Bacteria | 3235 |
| 181 | Ga0105237_10270186 | 3300009545 | Bacteria | 1703 |
| 182 | Ga0105237_11161570 | 3300009545 | Bacteria | 779 |
| 183 | Ga0105238_10256924 | 3300009551 | Bacteria | 1726 |
| 184 | Ga0105238_10917425 | 3300009551 | Bacteria | 895 |
| 185 | Ga0105249_10013630 | 3300009553 | Bacteria | 7178 |
| 186 | Ga0105239_10046172 | 3300010375 | Bacteria | 4773 |
| 187 | Ga0105239_11238522 | 3300010375 | Bacteria | 860 |
| 188 | Ga0105246_10062625 | 3300011119 | Bacteria | 2592 |
| 189 | Ga0105246_11922462 | 3300011119 | Bacteria | 569 |
| 190 | Ga0157373_10424328 | 3300013100 | Bacteria | 955 |
| 191 | Ga0157373_10952599 | 3300013100 | Bacteria | 639 |
| 192 | Ga0157373_11588498 | 3300013100 | Unclassified | 501 |
| 193 | Ga0157371_10269498 | 3300013102 | Unclassified | 1228 |
| 194 | Ga0157371_10295775 | 3300013102 | Bacteria | 1171 |
| 195 | Ga0157371_10440678 | 3300013102 | Bacteria | 957 |
| 196 | Ga0157371_10781992 | 3300013102 | Bacteria | 718 |
| 197 | Ga0157370_10056793 | 3300013104 | Bacteria | 3724 |
| 198 | Ga0157370_10082250 | 3300013104 | Bacteria | 3029 |
| 199 | Ga0157370_10745445 | 3300013104 | Bacteria | 892 |
| 200 | Ga0157369_10004869 | 3300013105 | Bacteria | 15753 |
| 201 | Ga0157369_10121772 | 3300013105 | Bacteria | 2767 |
| 202 | Ga0157369_10348925 | 3300013105 | Bacteria | 1537 |
| 203 | Ga0157369_10393652 | 3300013105 | Bacteria | 1437 |
| 204 | Ga0157369_10981899 | 3300013105 | Bacteria | 865 |
| 205 | Ga0157374_10019190 | 3300013296 | Bacteria | 6049 |
| 206 | Ga0157378_10028875 | 3300013297 | Bacteria | 4896 |
| 207 | Ga0163162_10012762 | 3300013306 | Bacteria | 8206 |
| 208 | Ga0157372_10369472 | 3300013307 | Bacteria | 1671 |
| 209 | Ga0157372_10372559 | 3300013307 | Bacteria | 1664 |
| 210 | Ga0157372_10495726 | 3300013307 | Bacteria | 1424 |
| 211 | Ga0157372_10813164 | 3300013307 | Unclassified | 1085 |
| 212 | Ga0157372_11731736 | 3300013307 | Bacteria | 719 |
| 213 | Ga0157375_10063681 | 3300013308 | Bacteria | 3670 |
| 214 | Ga0163163_10413047 | 3300014325 | Bacteria | 1408 |
| 215 | Ga0157380_10097954 | 3300014326 | Bacteria | 2435 |
| 216 | Ga0157380_10439445 | 3300014326 | Bacteria | 1250 |
| 217 | Ga0182008_10045355 | 3300014497 | Bacteria | 2186 |
| 218 | Ga0182008_10156198 | 3300014497 | Bacteria | 1146 |
| 219 | Ga0182008_10215678 | 3300014497 | Bacteria | 981 |
| 220 | Ga0182008_10636851 | 3300014497 | Unclassified | 602 |
| 221 | Ga0157377_10005058 | 3300014745 | Bacteria | 6157 |
| 222 | Ga0157377_10207614 | 3300014745 | Bacteria | 1247 |
| 223 | Ga0157377_10310866 | 3300014745 | Bacteria | 1044 |
| 224 | Ga0157379_10716874 | 3300014968 | Bacteria | 940 |
| 225 | Ga0157376_10171391 | 3300014969 | Bacteria | 1977 |
| 226 | Ga0157376_10186284 | 3300014969 | Bacteria | 1900 |
| 227 | Ga0182007_10275842 | 3300015262 | Unclassified | 610 |
| 228 | Ga0197907_10050932 | 3300020069 | Bacteria | 534 |
| 229 | Ga0206356_10299671 | 3300020070 | Bacteria | 2542 |
| 230 | Ga0206356_10582843 | 3300020070 | Unclassified | 786 |
| 231 | Ga0206352_10068530 | 3300020078 | Unclassified | 558 |
| 232 | Ga0206353_10109980 | 3300020082 | Bacteria | 746 |
| 233 | Ga0213871_10018698 | 3300021441 | Bacteria | 1698 |
| 234 | Ga0224712_10016639 | 3300022467 | Bacteria | 2421 |
| 235 | Ga0224712_10035711 | 3300022467 | Unclassified | 1836 |
| 236 | Ga0224712_10041278 | 3300022467 | Bacteria | 1741 |
| 237 | Ga0224712_10210951 | 3300022467 | Unclassified | 886 |
| 238 | Ga0207656_10405025 | 3300025321 | Bacteria | 686 |
| 239 | Ga0207653_10013144 | 3300025885 | Bacteria | 2591 |
| 240 | Ga0207692_10233232 | 3300025898 | Bacteria | 1096 |
| 241 | Ga0207692_10406766 | 3300025898 | Bacteria | 850 |
| 242 | Ga0207642_10015885 | 3300025899 | Bacteria | 2820 |
| 243 | Ga0207680_10564234 | 3300025903 | Bacteria | 813 |
| 244 | Ga0207647_10092471 | 3300025904 | Bacteria | 1803 |
| 245 | Ga0207685_10414717 | 3300025905 | Bacteria | 693 |
| 246 | Ga0207699_10048632 | 3300025906 | Bacteria | 2492 |
| 247 | Ga0207699_10064031 | 3300025906 | Bacteria | 2223 |
| 248 | Ga0207699_10262767 | 3300025906 | Bacteria | 1194 |
| 249 | Ga0207699_10430105 | 3300025906 | Bacteria | 944 |
| 250 | Ga0207705_10121664 | 3300025909 | Bacteria | 1937 |
| 251 | Ga0207705_10129895 | 3300025909 | Bacteria | 1874 |
| 252 | Ga0207705_10809109 | 3300025909 | Bacteria | 727 |
| 253 | Ga0207684_11152806 | 3300025910 | Bacteria | 643 |
| 254 | Ga0207707_10079405 | 3300025912 | Bacteria | 2865 |
| 255 | Ga0207707_10116132 | 3300025912 | Bacteria | 2339 |
| 256 | Ga0207707_10205268 | 3300025912 | Bacteria | 1717 |
| 257 | Ga0207707_10224658 | 3300025912 | Bacteria | 1634 |
| 258 | Ga0207707_10258877 | 3300025912 | Bacteria | 1510 |
| 259 | Ga0207707_10282621 | 3300025912 | Bacteria | 1437 |
| 260 | Ga0207707_10762766 | 3300025912 | Unclassified | 808 |
| 261 | Ga0207707_11222234 | 3300025912 | Bacteria | 607 |
| 262 | Ga0207695_10092844 | 3300025913 | Bacteria | 3028 |
| 263 | Ga0207695_10730837 | 3300025913 | Bacteria | 870 |
| 264 | Ga0207671_10183731 | 3300025914 | Bacteria | 1628 |
| 265 | Ga0207693_10001754 | 3300025915 | Bacteria | 19046 |
| 266 | Ga0207693_10346208 | 3300025915 | Bacteria | 1163 |
| 267 | Ga0207663_10009432 | 3300025916 | Bacteria | 5154 |
| 268 | Ga0207663_10355124 | 3300025916 | Bacteria | 1111 |
| 269 | Ga0207663_10405215 | 3300025916 | Bacteria | 1044 |
| 270 | Ga0207660_10074492 | 3300025917 | Bacteria | 2478 |
| 271 | Ga0207660_10298754 | 3300025917 | Bacteria | 1282 |
| 272 | Ga0207660_11294330 | 3300025917 | Bacteria | 592 |
| 273 | Ga0207657_10021891 | 3300025919 | Bacteria | 6003 |
| 274 | Ga0207657_10028683 | 3300025919 | Bacteria | 5072 |
| 275 | Ga0207657_10030731 | 3300025919 | Bacteria | 4872 |
| 276 | Ga0207657_10039137 | 3300025919 | Bacteria | 4215 |
| 277 | Ga0207657_10476174 | 3300025919 | Bacteria | 979 |
| 278 | Ga0207649_10798110 | 3300025920 | Unclassified | 737 |
| 279 | Ga0207649_11444521 | 3300025920 | Bacteria | 544 |
| 280 | Ga0207652_10028722 | 3300025921 | Bacteria | 4643 |
| 281 | Ga0207652_10076097 | 3300025921 | Bacteria | 2926 |
| 282 | Ga0207652_10112530 | 3300025921 | Bacteria | 2416 |
| 283 | Ga0207652_10239879 | 3300025921 | Bacteria | 1634 |
| 284 | Ga0207652_10503411 | 3300025921 | Bacteria | 1090 |
| 285 | Ga0207652_11289197 | 3300025921 | Bacteria | 633 |
| 286 | Ga0207652_11845839 | 3300025921 | Unclassified | 510 |
| 287 | Ga0207646_10002790 | 3300025922 | Bacteria | 20372 |
| 288 | Ga0207681_10146095 | 3300025923 | Bacteria | 1767 |
| 289 | Ga0207659_10742969 | 3300025926 | Bacteria | 841 |
| 290 | Ga0207687_10273211 | 3300025927 | Bacteria | 1352 |
| 291 | Ga0207687_10451001 | 3300025927 | Bacteria | 1067 |
| 292 | Ga0207700_10130803 | 3300025928 | Bacteria | 2049 |
| 293 | Ga0207700_10139996 | 3300025928 | Bacteria | 1987 |
| 294 | Ga0207700_10214100 | 3300025928 | Bacteria | 1630 |
| 295 | Ga0207700_10699629 | 3300025928 | Bacteria | 905 |
| 296 | Ga0207664_10006659 | 3300025929 | Bacteria | 7963 |
| 297 | Ga0207664_10063736 | 3300025929 | Bacteria | 2946 |
| 298 | Ga0207664_10067502 | 3300025929 | Bacteria | 2870 |
| 299 | Ga0207664_10080313 | 3300025929 | Bacteria | 2650 |
| 300 | Ga0207664_10117624 | 3300025929 | Bacteria | 2219 |
| 301 | Ga0207664_10487797 | 3300025929 | Bacteria | 1103 |
| 302 | Ga0207664_10590437 | 3300025929 | Bacteria | 997 |
| 303 | Ga0207664_10680341 | 3300025929 | Bacteria | 925 |
| 304 | Ga0207664_11606330 | 3300025929 | Bacteria | 572 |
| 305 | Ga0207644_10106716 | 3300025931 | Bacteria | 2112 |
| 306 | Ga0207690_10207563 | 3300025932 | Bacteria | 1492 |
| 307 | Ga0207690_10339600 | 3300025932 | Bacteria | 1185 |
| 308 | Ga0207706_10138511 | 3300025933 | Bacteria | 2140 |
| 309 | Ga0207686_10258507 | 3300025934 | Bacteria | 1275 |
| 310 | Ga0207709_10007985 | 3300025935 | Bacteria | 5860 |
| 311 | Ga0207670_10214215 | 3300025936 | Bacteria | 1471 |
| 312 | Ga0207669_10003162 | 3300025937 | Bacteria | 7104 |
| 313 | Ga0207669_10837368 | 3300025937 | Unclassified | 765 |
| 314 | Ga0207704_10564057 | 3300025938 | Bacteria | 927 |
| 315 | Ga0207665_10674103 | 3300025939 | Bacteria | 812 |
| 316 | Ga0207665_11472955 | 3300025939 | Bacteria | 541 |
| 317 | Ga0207691_10015425 | 3300025940 | Bacteria | 7267 |
| 318 | Ga0207691_10114872 | 3300025940 | Bacteria | 2391 |
| 319 | Ga0207661_10180752 | 3300025944 | Bacteria | 1842 |
| 320 | Ga0207661_10300625 | 3300025944 | Bacteria | 1439 |
| 321 | Ga0207661_10863549 | 3300025944 | Bacteria | 833 |
| 322 | Ga0207679_10209244 | 3300025945 | Bacteria | 1635 |
| 323 | Ga0207667_10222762 | 3300025949 | Bacteria | 1932 |
| 324 | Ga0207667_12234204 | 3300025949 | Bacteria | 504 |
| 325 | Ga0207651_10088819 | 3300025960 | Bacteria | 2254 |
| 326 | Ga0207712_10014470 | 3300025961 | Bacteria | 5077 |
| 327 | Ga0207668_10021394 | 3300025972 | Bacteria | 4125 |
| 328 | Ga0207640_10412063 | 3300025981 | Bacteria | 1103 |
| 329 | Ga0207640_10527980 | 3300025981 | Unclassified | 988 |
| 330 | Ga0207677_10615877 | 3300026023 | Bacteria | 954 |
| 331 | Ga0207677_11254204 | 3300026023 | Bacteria | 680 |
| 332 | Ga0207703_10802658 | 3300026035 | Bacteria | 898 |
| 333 | Ga0207639_10021934 | 3300026041 | Bacteria | 4593 |
| 334 | Ga0207678_10026059 | 3300026067 | Bacteria | 5101 |
| 335 | Ga0207708_10004755 | 3300026075 | Bacteria | 9992 |
| 336 | Ga0207708_10650794 | 3300026075 | Unclassified | 897 |
| 337 | Ga0207702_10082862 | 3300026078 | Bacteria | 2789 |
| 338 | Ga0207702_10153196 | 3300026078 | Bacteria | 2099 |
| 339 | Ga0207641_10303411 | 3300026088 | Bacteria | 1509 |
| 340 | Ga0207648_10000150 | 3300026089 | Bacteria | 70019 |
| 341 | Ga0207648_10095540 | 3300026089 | Bacteria | 2600 |
| 342 | Ga0207676_11764589 | 3300026095 | Bacteria | 617 |
| 343 | Ga0207674_10545665 | 3300026116 | Bacteria | 1120 |
| 344 | Ga0207675_100033801 | 3300026118 | Bacteria | 4765 |
| 345 | Ga0207683_10000131 | 3300026121 | Bacteria | 61423 |
| 346 | Ga0207683_10207959 | 3300026121 | Bacteria | 1780 |
| 347 | Ga0207698_10309512 | 3300026142 | Unclassified | 1474 |
| 348 | Ga0207698_10466409 | 3300026142 | Bacteria | 1222 |
| 349 | Ga0207698_12469730 | 3300026142 | Bacteria | 530 |
| 350 | Ga0268266_10024942 | 3300028379 | Bacteria | 5088 |
| 351 | Ga0268266_10377332 | 3300028379 | Bacteria | 1337 |
| 352 | Ga0268265_12445083 | 3300028380 | Bacteria | 529 |
| 353 | Ga0268264_10093608 | 3300028381 | Bacteria | 2596 |
| 354 | Ga0265337_1021347 | 3300028556 | Bacteria | 2019 |
| 355 | Ga0265337_1062938 | 3300028556 | Bacteria | 1026 |
| 356 | Ga0265337_1073858 | 3300028556 | Bacteria | 936 |
| 357 | Ga0265319_1008248 | 3300028563 | Bacteria | 4585 |
| 358 | Ga0265319_1051260 | 3300028563 | Bacteria | 1361 |
| 359 | Ga0265334_10064105 | 3300028573 | Bacteria | 1380 |
| 360 | Ga0265334_10108144 | 3300028573 | Bacteria | 1001 |
| 361 | Ga0265318_10002863 | 3300028577 | Bacteria | 8999 |
| 362 | Ga0265318_10066773 | 3300028577 | Bacteria | 1336 |
| 363 | Ga0265323_10031089 | 3300028653 | Bacteria | 1986 |
| 364 | Ga0265322_10003718 | 3300028654 | Bacteria | 4593 |
| 365 | Ga0265322_10052505 | 3300028654 | Bacteria | 1157 |
| 366 | Ga0265322_10072007 | 3300028654 | Bacteria | 981 |
| 367 | Ga0265322_10136571 | 3300028654 | Bacteria | 700 |
| 368 | Ga0265336_10002725 | 3300028666 | Bacteria | 7148 |
| 369 | Ga0265336_10088273 | 3300028666 | Bacteria | 924 |
| 370 | Ga0265338_10001061 | 3300028800 | Bacteria | 45726 |
| 371 | Ga0265338_10002640 | 3300028800 | Bacteria | 26412 |
| 372 | Ga0265338_10012416 | 3300028800 | Bacteria | 9712 |
| 373 | Ga0265338_10048855 | 3300028800 | Bacteria | 3843 |
| 374 | Ga0265338_10107316 | 3300028800 | Bacteria | 2258 |
| 375 | Ga0265324_10019591 | 3300029957 | Bacteria | 2435 |
| 376 | Ga0265324_10075388 | 3300029957 | Unclassified | 1148 |
| 377 | Ga0265330_10014792 | 3300031235 | Bacteria | 3619 |
| 378 | Ga0265330_10043846 | 3300031235 | Bacteria | 1977 |
| 379 | Ga0265330_10096428 | 3300031235 | Bacteria | 1267 |
| 380 | Ga0265332_10132480 | 3300031238 | Bacteria | 1045 |
| 381 | Ga0265328_10019588 | 3300031239 | Bacteria | 2596 |
| 382 | Ga0265320_10025091 | 3300031240 | Bacteria | 3140 |
| 383 | Ga0265320_10053501 | 3300031240 | Bacteria | 1951 |
| 384 | Ga0265320_10063568 | 3300031240 | Bacteria | 1755 |
| 385 | Ga0265320_10065597 | 3300031240 | Bacteria | 1722 |
| 386 | Ga0265320_10123093 | 3300031240 | Bacteria | 1182 |
| 387 | Ga0265320_10374860 | 3300031240 | Bacteria | 629 |
| 388 | Ga0265325_10034373 | 3300031241 | Bacteria | 2697 |
| 389 | Ga0265325_10045008 | 3300031241 | Bacteria | 2295 |
| 390 | Ga0265329_10009741 | 3300031242 | Bacteria | 3562 |
| 391 | Ga0265329_10016825 | 3300031242 | Bacteria | 2528 |
| 392 | Ga0265340_10010723 | 3300031247 | Bacteria | 4896 |
| 393 | Ga0265340_10095441 | 3300031247 | Bacteria | 1386 |
| 394 | Ga0265339_10014232 | 3300031249 | Bacteria | 4799 |
| 395 | Ga0265339_10095377 | 3300031249 | Bacteria | 1554 |
| 396 | Ga0265331_10110303 | 3300031250 | Bacteria | 1262 |
| 397 | Ga0265331_10428710 | 3300031250 | Bacteria | 594 |
| 398 | Ga0265327_10052022 | 3300031251 | Bacteria | 2134 |
| 399 | Ga0265327_10440031 | 3300031251 | Bacteria | 564 |
| 400 | Ga0265316_10015338 | 3300031344 | Bacteria | 6703 |
| 401 | Ga0265316_10094514 | 3300031344 | Bacteria | 2277 |
| 402 | Ga0265316_10400827 | 3300031344 | Bacteria | 988 |
| 403 | Ga0265316_10679332 | 3300031344 | Bacteria | 727 |
| 404 | Ga0307408_100629491 | 3300031548 | Bacteria | 957 |
| 405 | Ga0307408_101330340 | 3300031548 | Bacteria | 674 |
| 406 | Ga0265313_10028474 | 3300031595 | Bacteria | 2902 |
| 407 | Ga0265313_10088232 | 3300031595 | Bacteria | 1397 |
| 408 | Ga0265313_10110302 | 3300031595 | Bacteria | 1210 |
| 409 | Ga0265314_10012572 | 3300031711 | Bacteria | 6895 |
| 410 | Ga0265314_10031647 | 3300031711 | Bacteria | 3901 |
| 411 | Ga0265314_10657956 | 3300031711 | Bacteria | 534 |
| 412 | Ga0265342_10035672 | 3300031712 | Bacteria | 3043 |
| 413 | Ga0265342_10219956 | 3300031712 | Bacteria | 1023 |
| 414 | Ga0265342_10274112 | 3300031712 | Bacteria | 895 |
| 415 | Ga0265342_10303057 | 3300031712 | Bacteria | 841 |
| 416 | Ga0307405_11140255 | 3300031731 | Bacteria | 672 |
| 417 | Ga0307406_11791649 | 3300031901 | Unclassified | 546 |
| 418 | Ga0307409_100160605 | 3300031995 | Bacteria | 1965 |
| 419 | Ga0307409_100660154 | 3300031995 | Bacteria | 1041 |
| 420 | Ga0307409_101519549 | 3300031995 | Bacteria | 697 |
| 421 | Ga0307409_102282301 | 3300031995 | Bacteria | 570 |
| 422 | Ga0307416_100405156 | 3300032002 | Bacteria | 1403 |
| 423 | Ga0307416_100865999 | 3300032002 | Bacteria | 1002 |
| 424 | Ga0307415_100089435 | 3300032126 | Bacteria | 2224 |
| 425 | Ga0316583_10055375 | 3300032133 | Bacteria | 1395 |
| 426 | Ga0373945_0013400 | 3300035116 | Bacteria | 2735 |
| 427 | Ga0373945_0283195 | 3300035116 | Bacteria | 707 |
| 428 | Ga0373957_0062287 | 3300035120 | Bacteria | 1447 |
| 429 | Ga0373957_0071852 | 3300035120 | Unclassified | 1355 |
| 430 | Ga0373960_0382516 | 3300035121 | Bacteria | 540 |
| 431 | Ga0373943_0000443 | 3300035170 | Bacteria | 17555 |
| 432 | Ga0373946_0029789 | 3300035171 | Bacteria | 2175 |
| 433 | Ga0373946_0217564 | 3300035171 | Unclassified | 921 |
| 434 | Ga0373942_0098421 | 3300035207 | Bacteria | 891 |
| 435 | Ga0373924_0111278 | 3300035410 | Bacteria | 1184 |
| 436 | Ga0373935_0503240 | 3300035692 | Unclassified | 880 |
| 437 | Ga0373927_0016318 | 3300035695 | Bacteria | 4901 |
| 438 | Ga0373947_0006187 | 3300035725 | Bacteria | 6962 |
| 439 | Ga0373937_0045765 | 3300036401 | Bacteria | 3999 |
| 440 | Ga0373937_0277187 | 3300036401 | Bacteria | 1583 |
| 441 | Ga0373925_0000484 | 3300037068 | Bacteria | 39880 |
| 442 | Ga0395899_0105798 | 3300037312 | Bacteria | 2026 |
| 443 | Ga0395899_0225031 | 3300037312 | Bacteria | 1298 |
| 444 | Ga0395900_0128550 | 3300037418 | Bacteria | 2597 |
| 445 | Ga0395900_0399930 | 3300037418 | Bacteria | 1338 |
| 446 | Ga0395900_0492011 | 3300037418 | Bacteria | 1178 |
| 447 | Ga0395900_0751939 | 3300037418 | Bacteria | 905 |
| 448 | Ga0395900_0943507 | 3300037418 | Bacteria | 784 |
| 449 | Ga0395898_0190567 | 3300037466 | Bacteria | 1959 |
| 450 | Ga0395898_0231215 | 3300037466 | Bacteria | 1763 |
| 451 | Ga0395898_0358584 | 3300037466 | Bacteria | 1390 |
| 452 | Ga0395898_0652838 | 3300037466 | Bacteria | 994 |
| 453 | Ga0395898_1372905 | 3300037466 | Bacteria | 635 |
| 454 | Ga0395905_0594755 | 3300037471 | Bacteria | 1008 |
| 455 | Ga0395905_0769866 | 3300037471 | Unclassified | 865 |
| 456 | Ga0395901_0216662 | 3300038443 | Bacteria | 2002 |
| 457 | Ga0395901_0336003 | 3300038443 | Bacteria | 1561 |
| 458 | Ga0395901_0991855 | 3300038443 | Bacteria | 816 |
| 459 | Ga0436365_1081831 | 3300039437 | Bacteria | 911 |
| 460 | Ga0439461_0004684 | 3300041410 | Bacteria | 2296 |
| 461 | Ga0451787_752081 | 3300041441 | Bacteria | 519 |
| 462 | Ga0451800_1256723 | 3300041459 | Unclassified | 630 |
| 463 | Ga0451800_1606387 | 3300041459 | Unclassified | 697 |
| 464 | Ga0451807_1530868 | 3300041486 | Bacteria | 1107 |
| 465 | Ga0451835_0189308 | 3300041492 | Bacteria | 614 |
| 466 | Ga0451835_1052634 | 3300041492 | Bacteria | 539 |
| 467 | Ga0451835_1181250 | 3300041492 | Bacteria | 1042 |
| 468 | Ga0451841_0654153 | 3300041498 | Bacteria | 615 |
| 469 | Ga0451849_1110976 | 3300041505 | Unclassified | 785 |
| 470 | Ga0451849_1121762 | 3300041505 | Unclassified | 548 |
| 471 | Ga0451849_1517115 | 3300041505 | Bacteria | 1026 |
| 472 | Ga0451851_1046935 | 3300041507 | Bacteria | 1517 |
| 473 | Ga0451843_0324014 | 3300041509 | Bacteria | 1648 |
| 474 | Ga0451855_1001223 | 3300041511 | Bacteria | 1077 |
| 475 | Ga0451853_2833846 | 3300041512 | Unclassified | 727 |
| 476 | Ga0439433_0073916 | 3300041999 | Bacteria | 823 |
| 477 | Ga0439441_077168 | 3300042001 | Unclassified | 721 |
| 478 | Ga0439445_0149537 | 3300042004 | Bacteria | 679 |
| 479 | Ga0450920_007359 | 3300042122 | Bacteria | 1995 |
| 480 | Ga0450920_040731 | 3300042122 | Bacteria | 926 |
| 481 | Ga0450907_008091 | 3300042146 | Bacteria | 1750 |
| 482 | Ga0439446_0119725 | 3300042156 | Bacteria | 846 |
| 483 | Ga0439434_0127006 | 3300042435 | Bacteria | 835 |
| 484 | Ga0450918_015465 | 3300042531 | Bacteria | 1327 |
| 485 | Ga0466969_0047639 | 3300044656 | Bacteria | 2121 |
| 486 | Ga0466969_0123336 | 3300044656 | Bacteria | 1205 |
| 487 | Ga0466965_0051675 | 3300044683 | Bacteria | 2039 |
| 488 | Ga0466965_0077300 | 3300044683 | Bacteria | 1681 |
| 489 | Ga0466965_0156798 | 3300044683 | Bacteria | 1192 |
| 490 | Ga0466966_0087961 | 3300044684 | Bacteria | 1931 |
| 491 | Ga0466966_0110986 | 3300044684 | Bacteria | 1690 |
| 492 | Ga0466961_0003717 | 3300044693 | Bacteria | 9527 |
| 493 | Ga0466961_0009997 | 3300044693 | Bacteria | 6046 |
| 494 | Ga0466961_0027078 | 3300044693 | Bacteria | 3685 |
| 495 | Ga0466961_0158133 | 3300044693 | Bacteria | 1413 |
| 496 | Ga0466961_0267367 | 3300044693 | Bacteria | 1048 |
| 497 | Ga0466963_0000045 | 3300044694 | Bacteria | 40813 |
| 498 | Ga0466963_0001615 | 3300044694 | Bacteria | 12253 |
| 499 | Ga0466963_0002571 | 3300044694 | Bacteria | 10182 |
| 500 | Ga0466963_0003847 | 3300044694 | Bacteria | 8658 |
| 501 | Ga0466963_0009695 | 3300044694 | Bacteria | 5808 |
| 502 | Ga0466963_0017987 | 3300044694 | Bacteria | 4410 |
| 503 | Ga0466963_0025483 | 3300044694 | Bacteria | 3772 |
| 504 | Ga0466963_0030015 | 3300044694 | Bacteria | 3504 |
| 505 | Ga0466963_0037378 | 3300044694 | Bacteria | 3169 |
| 506 | Ga0466963_0038787 | 3300044694 | Bacteria | 3117 |
| 507 | Ga0466963_0052242 | 3300044694 | Bacteria | 2711 |
| 508 | Ga0466963_0147985 | 3300044694 | Bacteria | 1630 |
| 509 | Ga0466963_0149941 | 3300044694 | Bacteria | 1619 |
| 510 | Ga0466964_0001132 | 3300044706 | Bacteria | 8982 |
| 511 | Ga0466964_0001184 | 3300044706 | Bacteria | 8803 |
| 512 | Ga0466964_0014124 | 3300044706 | Bacteria | 3034 |
| 513 | Ga0466964_0014343 | 3300044706 | Bacteria | 3013 |
| 514 | Ga0466964_0019652 | 3300044706 | Bacteria | 2598 |
| 515 | Ga0466964_0021999 | 3300044706 | Bacteria | 2470 |
| 516 | Ga0466964_0023711 | 3300044706 | Bacteria | 2386 |
| 517 | Ga0466964_0448264 | 3300044706 | Bacteria | 684 |
| 518 | Ga0453684_0679587 | 3300044712 | Bacteria | 1121 |
| 519 | Ga0453684_2028565 | 3300044712 | Unclassified | 579 |
| 520 | Ga0466971_0001365 | 3300044719 | Bacteria | 10235 |
| 521 | Ga0466971_0003490 | 3300044719 | Bacteria | 6714 |
| 522 | Ga0466971_0004863 | 3300044719 | Bacteria | 5810 |
| 523 | Ga0466971_0007185 | 3300044719 | Bacteria | 4848 |
| 524 | Ga0466971_0012056 | 3300044719 | Bacteria | 3788 |
| 525 | Ga0466971_0056029 | 3300044719 | Bacteria | 1778 |
| 526 | Ga0466971_0289708 | 3300044719 | Unclassified | 785 |
| 527 | Ga0466971_0401467 | 3300044719 | Bacteria | 668 |
| 528 | Ga0466971_0664139 | 3300044719 | Bacteria | 522 |
| 529 | Ga0466971_0686603 | 3300044719 | Bacteria | 514 |
| 530 | Ga0466968_0032822 | 3300044735 | Bacteria | 2161 |
| 531 | Ga0466968_0040117 | 3300044735 | Bacteria | 1973 |
| 532 | Ga0466968_0093727 | 3300044735 | Bacteria | 1334 |
| 533 | Ga0466968_0496878 | 3300044735 | Bacteria | 607 |
| 534 | Ga0466970_0120440 | 3300044765 | Bacteria | 1437 |
| 535 | Ga0466970_0339620 | 3300044765 | Bacteria | 851 |
| 536 | Ga0466970_0731386 | 3300044765 | Bacteria | 578 |
| 537 | Ga0466957_0003129 | 3300044842 | Bacteria | 9010 |
| 538 | Ga0466957_0015028 | 3300044842 | Bacteria | 4516 |
| 539 | Ga0466957_0015833 | 3300044842 | Bacteria | 4406 |
| 540 | Ga0466957_0025038 | 3300044842 | Bacteria | 3535 |
| 541 | Ga0466957_0084229 | 3300044842 | Bacteria | 1984 |
| 542 | Ga0466957_0123661 | 3300044842 | Bacteria | 1651 |
| 543 | Ga0466957_0139388 | 3300044842 | Bacteria | 1561 |
| 544 | Ga0466957_0163410 | 3300044842 | Bacteria | 1447 |
| 545 | Ga0466957_0176641 | 3300044842 | Bacteria | 1393 |
| 546 | Ga0466957_0191817 | 3300044842 | Unclassified | 1339 |
| 547 | Ga0466957_0227545 | 3300044842 | Bacteria | 1233 |
| 548 | Ga0466957_0570399 | 3300044842 | Bacteria | 790 |
| 549 | Ga0466960_0015978 | 3300044901 | Bacteria | 3246 |
| 550 | Ga0466960_0181987 | 3300044901 | Bacteria | 1140 |
| 551 | Ga0466960_0190172 | 3300044901 | Bacteria | 1117 |
| 552 | Ga0466960_0319537 | 3300044901 | Bacteria | 879 |
| 553 | Ga0466960_0826177 | 3300044901 | Bacteria | 562 |
| 554 | Ga0466959_0002525 | 3300045049 | Bacteria | 11734 |
| 555 | Ga0466959_0028529 | 3300045049 | Bacteria | 4138 |
| 556 | Ga0466959_0036459 | 3300045049 | Bacteria | 3634 |
| 557 | Ga0466959_0043047 | 3300045049 | Bacteria | 3330 |
| 558 | Ga0466959_0080020 | 3300045049 | Bacteria | 2356 |
| 559 | Ga0466959_0933594 | 3300045049 | Bacteria | 578 |
| 560 | Ga0451576_1915353 | 3300045051 | Bacteria | 612 |
| 561 | Ga0466958_0013689 | 3300045836 | Bacteria | 4623 |
| 562 | Ga0466958_0018146 | 3300045836 | Bacteria | 4078 |
| 563 | Ga0466958_0023977 | 3300045836 | Bacteria | 3587 |
| 564 | Ga0466958_0026345 | 3300045836 | Bacteria | 3435 |
| 565 | Ga0466958_0042066 | 3300045836 | Bacteria | 2750 |
| 566 | Ga0466958_0043094 | 3300045836 | Bacteria | 2717 |
| 567 | Ga0466958_0083928 | 3300045836 | Bacteria | 1964 |
| 568 | Ga0466958_0146425 | 3300045836 | Bacteria | 1488 |
| 569 | Ga0466958_0230704 | 3300045836 | Bacteria | 1182 |
| 570 | Ga0466958_0339507 | 3300045836 | Unclassified | 966 |
| 571 | Ga0466958_0391534 | 3300045836 | Bacteria | 897 |
| 572 | Ga0466958_0535776 | 3300045836 | Bacteria | 760 |
| 573 | Ga0466958_1060110 | 3300045836 | Bacteria | 529 |
| 574 | Ga0466967_0000248 | 3300045976 | Bacteria | 23755 |
| 575 | Ga0466967_0000884 | 3300045976 | Bacteria | 15971 |
| 576 | Ga0466967_0014176 | 3300045976 | Bacteria | 6197 |
| 577 | Ga0466967_0018918 | 3300045976 | Bacteria | 5523 |
| 578 | Ga0466967_0020132 | 3300045976 | Bacteria | 5383 |
| 579 | Ga0466967_0023209 | 3300045976 | Bacteria | 5080 |
| 580 | Ga0466967_0035363 | 3300045976 | Bacteria | 4251 |
| 581 | Ga0466967_0049540 | 3300045976 | Bacteria | 3673 |
| 582 | Ga0466967_0094731 | 3300045976 | Bacteria | 2719 |
| 583 | Ga0466967_0136727 | 3300045976 | Bacteria | 2279 |
| 584 | Ga0466967_0182602 | 3300045976 | Bacteria | 1979 |
| 585 | Ga0466967_0196775 | 3300045976 | Bacteria | 1907 |
| 586 | Ga0466967_0477914 | 3300045976 | Bacteria | 1220 |
| 587 | Ga0466967_0628838 | 3300045976 | Bacteria | 1061 |
| 588 | Ga0466967_0634791 | 3300045976 | Bacteria | 1055 |
| 589 | Ga0466967_0980098 | 3300045976 | Bacteria | 841 |
| 590 | Ga0466967_1299988 | 3300045976 | Bacteria | 724 |
| 591 | Ga0466967_1471635 | 3300045976 | Bacteria | 678 |
| 592 | Ga0495592_0012566 | 3300046454 | Bacteria | 6434 |
| 593 | Ga0495592_0100772 | 3300046454 | Bacteria | 2059 |
| 594 | Ga0495592_0582740 | 3300046454 | Bacteria | 684 |
| 595 | Ga0495603_0010014 | 3300046455 | Bacteria | 5735 |
| 596 | Ga0495629_0036724 | 3300046459 | Bacteria | 3456 |
| 597 | Ga0495629_0048221 | 3300046459 | Bacteria | 2986 |
| 598 | Ga0495629_0085421 | 3300046459 | Bacteria | 2202 |
| 599 | Ga0495629_0256872 | 3300046459 | Bacteria | 1201 |
| 600 | Ga0495629_0502931 | 3300046459 | Bacteria | 817 |
| 601 | Ga0495641_0023607 | 3300046461 | Bacteria | 3050 |
| 602 | Ga0495641_0034933 | 3300046461 | Bacteria | 2373 |
| 603 | Ga0495641_0057705 | 3300046461 | Bacteria | 1758 |
| 604 | Ga0495641_0184890 | 3300046461 | Bacteria | 933 |
| 605 | Ga0495641_0374593 | 3300046461 | Bacteria | 645 |
| 606 | Ga0495651_0000080 | 3300046462 | Bacteria | 70453 |
| 607 | Ga0495651_0193268 | 3300046462 | Unclassified | 1430 |
| 608 | Ga0495651_0267047 | 3300046462 | Bacteria | 1162 |
| 609 | Ga0495651_0930829 | 3300046462 | Bacteria | 530 |
| 610 | Ga0495653_0006383 | 3300046463 | Bacteria | 9669 |
| 611 | Ga0495653_0023496 | 3300046463 | Bacteria | 4978 |
| 612 | Ga0495653_0172233 | 3300046463 | Bacteria | 1493 |
| 613 | Ga0495580_0126898 | 3300046472 | Bacteria | 1771 |
| 614 | Ga0495582_0032089 | 3300046473 | Bacteria | 2889 |
| 615 | Ga0495582_0193227 | 3300046473 | Bacteria | 1162 |
| 616 | Ga0495639_0000425 | 3300046475 | Bacteria | 20170 |
| 617 | Ga0495639_0356952 | 3300046475 | Bacteria | 734 |
| 618 | Ga0495639_0713236 | 3300046475 | Unclassified | 518 |
| 619 | Ga0495662_0002534 | 3300046476 | Bacteria | 9218 |
| 620 | Ga0495662_0314418 | 3300046476 | Bacteria | 770 |
| 621 | Ga0495664_0003077 | 3300046477 | Bacteria | 9037 |
| 622 | Ga0495664_0087924 | 3300046477 | Bacteria | 1867 |
| 623 | Ga0495664_0112560 | 3300046477 | Bacteria | 1643 |
| 624 | Ga0495584_0098185 | 3300046491 | Bacteria | 1480 |
| 625 | Ga0495596_0023014 | 3300046500 | Bacteria | 2531 |
| 626 | Ga0495596_0075365 | 3300046500 | Bacteria | 1310 |
| 627 | Ga0495607_0006178 | 3300046501 | Bacteria | 8467 |
| 628 | Ga0495608_0050015 | 3300046511 | Bacteria | 2774 |
| 629 | Ga0495608_0062369 | 3300046511 | Bacteria | 2449 |
| 630 | Ga0495608_0594582 | 3300046511 | Bacteria | 664 |
| 631 | Ga0495608_0850481 | 3300046511 | Bacteria | 536 |
| 632 | Ga0495618_0011918 | 3300046514 | Bacteria | 5276 |
| 633 | Ga0495618_0015670 | 3300046514 | Bacteria | 4626 |
| 634 | Ga0495618_0045190 | 3300046514 | Bacteria | 2778 |
| 635 | Ga0495618_0156973 | 3300046514 | Bacteria | 1452 |
| 636 | Ga0495618_0431424 | 3300046514 | Bacteria | 802 |
| 637 | Ga0495618_0515262 | 3300046514 | Bacteria | 719 |
| 638 | Ga0495628_0001647 | 3300046516 | Bacteria | 20433 |
| 639 | Ga0495628_0838939 | 3300046516 | Bacteria | 641 |
| 640 | Ga0495630_0001297 | 3300046517 | Bacteria | 17226 |
| 641 | Ga0495630_0069425 | 3300046517 | Bacteria | 2651 |
| 642 | Ga0495630_0236308 | 3300046517 | Bacteria | 1396 |
| 643 | Ga0495630_0543623 | 3300046517 | Bacteria | 891 |
| 644 | Ga0495630_0846306 | 3300046517 | Bacteria | 697 |
| 645 | Ga0495631_0354254 | 3300046518 | Unclassified | 625 |
| 646 | Ga0495644_0133090 | 3300046523 | Bacteria | 948 |
| 647 | Ga0495644_0159714 | 3300046523 | Bacteria | 864 |
| 648 | Ga0495663_0035081 | 3300046525 | Bacteria | 1505 |
| 649 | Ga0495666_0000168 | 3300046526 | Bacteria | 27728 |
| 650 | Ga0495666_0119540 | 3300046526 | Bacteria | 1235 |
| 651 | Ga0495652_0017232 | 3300046529 | Bacteria | 6449 |
| 652 | Ga0495652_0190715 | 3300046529 | Bacteria | 1564 |
| 653 | Ga0495652_0221810 | 3300046529 | Bacteria | 1420 |
| 654 | Ga0495652_0473703 | 3300046529 | Bacteria | 873 |
| 655 | Ga0495652_0892937 | 3300046529 | Bacteria | 587 |
| 656 | Ga0495652_1058144 | 3300046529 | Bacteria | 528 |
| 657 | Ga0495665_0000038 | 3300046531 | Bacteria | 51967 |
| 658 | Ga0495640_0263832 | 3300046533 | Bacteria | 1075 |
| 659 | Ga0495640_0648053 | 3300046533 | Bacteria | 636 |
| 660 | Ga0495586_0009342 | 3300046535 | Bacteria | 5216 |
| 661 | Ga0495586_0412520 | 3300046535 | Bacteria | 777 |
| 662 | Ga0495587_0000270 | 3300046536 | Bacteria | 37255 |
| 663 | Ga0495587_0291067 | 3300046536 | Bacteria | 914 |
| 664 | Ga0495621_0389574 | 3300046539 | Unclassified | 590 |
| 665 | Ga0495645_0025737 | 3300046543 | Bacteria | 4272 |
| 666 | Ga0495645_0088729 | 3300046543 | Bacteria | 2211 |
| 667 | Ga0495622_0395080 | 3300046557 | Bacteria | 596 |
| 668 | Ga0495667_0025477 | 3300046559 | Bacteria | 3985 |
| 669 | Ga0495667_0077237 | 3300046559 | Bacteria | 2166 |
| 670 | Ga0495667_0156720 | 3300046559 | Bacteria | 1465 |
| 671 | Ga0495667_0241352 | 3300046559 | Bacteria | 1151 |
| 672 | Ga0495634_0054491 | 3300046642 | Bacteria | 2676 |
| 673 | Ga0495634_0056825 | 3300046642 | Bacteria | 2613 |
| 674 | Ga0495634_0143553 | 3300046642 | Bacteria | 1514 |
| 675 | Ga0495634_0231535 | 3300046642 | Bacteria | 1136 |
| 676 | Ga0495635_0028984 | 3300046663 | Bacteria | 3849 |
| 677 | Ga0495635_0073882 | 3300046663 | Bacteria | 2335 |
| 678 | Ga0495635_0176102 | 3300046663 | Bacteria | 1454 |
| 679 | Ga0495635_0458165 | 3300046663 | Bacteria | 842 |
| 680 | Ga0495657_0008538 | 3300046675 | Bacteria | 7824 |
| 681 | Ga0495657_0079065 | 3300046675 | Bacteria | 2130 |
| 682 | Ga0495657_0162873 | 3300046675 | Bacteria | 1379 |
| 683 | Ga0495599_0000142 | 3300046678 | Bacteria | 46621 |
| 684 | Ga0495599_0301855 | 3300046678 | Bacteria | 966 |
| 685 | Ga0495623_0021271 | 3300046679 | Bacteria | 4189 |
| 686 | Ga0495623_0238450 | 3300046679 | Bacteria | 1028 |
| 687 | Ga0495646_0033947 | 3300046680 | Bacteria | 3171 |
| 688 | Ga0495646_0120943 | 3300046680 | Bacteria | 1482 |
| 689 | Ga0495646_0274244 | 3300046680 | Bacteria | 898 |
| 690 | Ga0495647_0002367 | 3300046681 | Bacteria | 5931 |
| 691 | Ga0495658_0022087 | 3300046683 | Bacteria | 3362 |
| 692 | Ga0495658_0025351 | 3300046683 | Bacteria | 3168 |
| 693 | Ga0495658_1081977 | 3300046683 | Bacteria | 511 |
| 694 | Ga0495613_0026214 | 3300046689 | Bacteria | 4342 |
| 695 | Ga0495613_0332418 | 3300046689 | Bacteria | 1047 |
| 696 | Ga0495613_0376133 | 3300046689 | Bacteria | 972 |
| 697 | Ga0495624_0001713 | 3300046690 | Bacteria | 16756 |
| 698 | Ga0495624_0486076 | 3300046690 | Bacteria | 739 |
| 699 | Ga0495624_0614865 | 3300046690 | Bacteria | 647 |
| 700 | Ga0495624_0627142 | 3300046690 | Unclassified | 640 |
| 701 | Ga0495624_0677853 | 3300046690 | Bacteria | 612 |
| 702 | Ga0495670_0474878 | 3300046691 | Bacteria | 678 |
| 703 | Ga0495589_0089172 | 3300046794 | Bacteria | 1498 |
| 704 | Ga0495600_0079549 | 3300046809 | Bacteria | 2140 |
| 705 | Ga0495600_0395810 | 3300046809 | Bacteria | 860 |
| 706 | Ga0495600_0623315 | 3300046809 | Unclassified | 654 |
| 707 | Ga0495600_0888608 | 3300046809 | Bacteria | 526 |
| 708 | Ga0495660_0375819 | 3300046810 | Bacteria | 627 |
| 709 | Ga0495581_0003666 | 3300047315 | Bacteria | 8846 |
| 710 | Ga0495604_0005999 | 3300047317 | Bacteria | 9644 |
| 711 | Ga0495604_0049561 | 3300047317 | Bacteria | 3262 |
| 712 | Ga0495604_0129837 | 3300047317 | Bacteria | 1813 |
| 713 | Ga0495674_0006925 | 3300047319 | Bacteria | 10845 |
| 714 | Ga0495674_0110144 | 3300047319 | Bacteria | 2335 |
| 715 | Ga0495676_0009737 | 3300047321 | Bacteria | 8736 |
| 716 | Ga0495676_0088731 | 3300047321 | Bacteria | 2318 |
| 717 | Ga0495676_0099937 | 3300047321 | Bacteria | 2149 |
| 718 | Ga0495676_0201702 | 3300047321 | Bacteria | 1382 |
| 719 | Ga0495676_0202398 | 3300047321 | Bacteria | 1379 |
| 720 | Ga0495680_0046394 | 3300047322 | Bacteria | 3426 |
| 721 | Ga0495680_0103729 | 3300047322 | Bacteria | 2116 |
| 722 | Ga0495680_0112048 | 3300047322 | Bacteria | 2021 |
| 723 | Ga0495680_0147048 | 3300047322 | Bacteria | 1720 |
| 724 | Ga0495680_0168634 | 3300047322 | Bacteria | 1586 |
| 725 | Ga0495680_0178799 | 3300047322 | Bacteria | 1532 |
| 726 | Ga0495680_0642144 | 3300047322 | Bacteria | 706 |
| 727 | Ga0495675_0000896 | 3300047444 | Bacteria | 18216 |
| 728 | Ga0495675_0222705 | 3300047444 | Bacteria | 1141 |
| 729 | Ga0495684_0008199 | 3300047471 | Bacteria | 8086 |
| 730 | Ga0495684_0096559 | 3300047471 | Bacteria | 2236 |
| 731 | Ga0495684_0445868 | 3300047471 | Unclassified | 900 |
| 732 | Ga0495593_0004870 | 3300047673 | Bacteria | 7967 |
| 733 | Ga0495593_0361300 | 3300047673 | Bacteria | 726 |
| 734 | Ga0495602_0021235 | 3300048088 | Bacteria | 6397 |
| 735 | Ga0495602_0043405 | 3300048088 | Bacteria | 4089 |
| 736 | Ga0495614_0010766 | 3300048089 | Bacteria | 4028 |
| 737 | Ga0495614_0457347 | 3300048089 | Bacteria | 604 |
| 738 | Ga0495614_0553148 | 3300048089 | Bacteria | 550 |
| 739 | Ga0496100_1535774 | 3300048903 | Bacteria | 526 |
| 740 | Ga0496101_0008648 | 3300048904 | Bacteria | 6655 |
| 741 | Ga0496101_0363140 | 3300048904 | Bacteria | 1138 |
| 742 | Ga0496101_0415438 | 3300048904 | Bacteria | 1060 |
| 743 | Ga0496101_0518845 | 3300048904 | Unclassified | 942 |
| 744 | Ga0496101_0982415 | 3300048904 | Bacteria | 664 |
| 745 | Ga0496102_0011192 | 3300048905 | Bacteria | 7726 |
| 746 | Ga0496102_0100809 | 3300048905 | Bacteria | 2682 |
| 747 | Ga0496102_0705304 | 3300048905 | Bacteria | 932 |
| 748 | Ga0496102_1113405 | 3300048905 | Bacteria | 709 |
| 749 | Ga0496102_1966013 | 3300048905 | Unclassified | 501 |
| 750 | Ga0496103_0014497 | 3300048906 | Bacteria | 4679 |
| 751 | Ga0496103_0109578 | 3300048906 | Bacteria | 1753 |
| 752 | Ga0496103_0113865 | 3300048906 | Bacteria | 1719 |
| 753 | Ga0496103_0672565 | 3300048906 | Bacteria | 657 |
| 754 | Ga0496104_0023441 | 3300048907 | Bacteria | 5674 |
| 755 | Ga0496104_0035809 | 3300048907 | Bacteria | 4636 |
| 756 | Ga0496104_0128766 | 3300048907 | Bacteria | 2431 |
| 757 | Ga0496104_0821564 | 3300048907 | Bacteria | 835 |
| 758 | Ga0496104_1012879 | 3300048907 | Bacteria | 734 |
| 759 | Ga0496105_0005405 | 3300048908 | Bacteria | 9694 |
| 760 | Ga0496105_0203172 | 3300048908 | Bacteria | 1617 |
| 761 | Ga0496105_0283758 | 3300048908 | Bacteria | 1334 |
| 762 | Ga0496105_0330574 | 3300048908 | Bacteria | 1220 |
| 763 | Ga0496106_0005740 | 3300048909 | Bacteria | 9180 |
| 764 | Ga0496106_0047193 | 3300048909 | Bacteria | 3241 |
| 765 | Ga0496106_0090495 | 3300048909 | Bacteria | 2361 |
| 766 | Ga0496106_0865804 | 3300048909 | Bacteria | 715 |
| 767 | Ga0496106_1275083 | 3300048909 | Bacteria | 571 |
| 768 | Ga0496107_0002238 | 3300048910 | Bacteria | 12466 |
| 769 | Ga0496107_0025839 | 3300048910 | Bacteria | 4160 |
| 770 | Ga0496107_0178844 | 3300048910 | Bacteria | 1575 |
| 771 | Ga0496107_0666084 | 3300048910 | Bacteria | 767 |
| 772 | Ga0496107_1131348 | 3300048910 | Bacteria | 565 |
| 773 | Ga0496108_0001117 | 3300048911 | Bacteria | 21001 |
| 774 | Ga0496108_0088475 | 3300048911 | Bacteria | 2631 |
| 775 | Ga0496108_0187592 | 3300048911 | Bacteria | 1791 |
| 776 | Ga0496108_0660757 | 3300048911 | Unclassified | 908 |
| 777 | Ga0496109_0021741 | 3300048912 | Bacteria | 5677 |
| 778 | Ga0496109_0059554 | 3300048912 | Bacteria | 3489 |
| 779 | Ga0496109_0099918 | 3300048912 | Bacteria | 2691 |
| 780 | Ga0496109_0124275 | 3300048912 | Bacteria | 2405 |
| 781 | Ga0496109_0300151 | 3300048912 | Bacteria | 1514 |
| 782 | Ga0496109_0335559 | 3300048912 | Bacteria | 1427 |
| 783 | Ga0496110_0125340 | 3300048913 | Bacteria | 2317 |
| 784 | Ga0496111_0035752 | 3300048914 | Bacteria | 3552 |
| 785 | Ga0496111_0109729 | 3300048914 | Bacteria | 2031 |
| 786 | Ga0496111_0254126 | 3300048914 | Bacteria | 1304 |
| 787 | Ga0496111_0407876 | 3300048914 | Bacteria | 1004 |
| 788 | Ga0496112_0023330 | 3300048915 | Bacteria | 5910 |
| 789 | Ga0496112_0033713 | 3300048915 | Bacteria | 4979 |
| 790 | Ga0496112_0054539 | 3300048915 | Bacteria | 3928 |
| 791 | Ga0496112_0062074 | 3300048915 | Bacteria | 3685 |
| 792 | Ga0496112_0067113 | 3300048915 | Bacteria | 3540 |
| 793 | Ga0496112_0098760 | 3300048915 | Bacteria | 2889 |
| 794 | Ga0496112_0126360 | 3300048915 | Bacteria | 2528 |
| 795 | Ga0496112_0206488 | 3300048915 | Bacteria | 1922 |
| 796 | Ga0496112_0495731 | 3300048915 | Bacteria | 1157 |
| 797 | Ga0496112_0575235 | 3300048915 | Bacteria | 1059 |
| 798 | Ga0496112_0708193 | 3300048915 | Bacteria | 935 |
| 799 | Ga0496112_0959830 | 3300048915 | Bacteria | 776 |
| 800 | Ga0496113_0074979 | 3300048916 | Bacteria | 2581 |
| 801 | Ga0496113_0092146 | 3300048916 | Bacteria | 2337 |
| 802 | Ga0496113_0482330 | 3300048916 | Bacteria | 996 |
| 803 | Ga0496113_0554042 | 3300048916 | Bacteria | 922 |
| 804 | Ga0496113_0691162 | 3300048916 | Bacteria | 815 |
| 805 | Ga0496114_0056462 | 3300048917 | Bacteria | 3277 |
| 806 | Ga0496114_0086165 | 3300048917 | Bacteria | 2661 |
| 807 | Ga0496114_0226394 | 3300048917 | Bacteria | 1642 |
| 808 | Ga0496115_0014867 | 3300048918 | Bacteria | 5902 |
| 809 | Ga0501033_0127828 | 3300049570 | Bacteria | 1842 |
| 810 | Ga0501036_0002946 | 3300049572 | Bacteria | 13521 |
| 811 | Ga0501036_0351584 | 3300049572 | Bacteria | 1231 |
| 812 | Ga0501037_0091291 | 3300049573 | Bacteria | 2203 |
| 813 | Ga0501038_0016048 | 3300049574 | Bacteria | 6801 |
| 814 | Ga0501039_0004575 | 3300049575 | Bacteria | 10452 |
| 815 | Ga0501040_0015142 | 3300049576 | Bacteria | 5095 |
| 816 | Ga0501040_0627652 | 3300049576 | Bacteria | 776 |
| 817 | Ga0501040_0675672 | 3300049576 | Bacteria | 747 |
| 818 | Ga0501041_0041455 | 3300049577 | Bacteria | 2796 |
| 819 | Ga0501041_0213283 | 3300049577 | Bacteria | 1211 |
| 820 | Ga0501042_0019312 | 3300049578 | Bacteria | 4730 |
| 821 | Ga0501043_0058309 | 3300049579 | Bacteria | 3031 |
| 822 | Ga0501043_1331359 | 3300049579 | Bacteria | 500 |
| 823 | Ga0501046_0041729 | 3300049580 | Bacteria | 3660 |
| 824 | Ga0501048_0018605 | 3300049582 | Bacteria | 5107 |
| 825 | Ga0501048_0340148 | 3300049582 | Bacteria | 1070 |
| 826 | Ga0501067_0028576 | 3300049583 | Bacteria | 3090 |
| 827 | Ga0501067_0189168 | 3300049583 | Bacteria | 1146 |
| 828 | Ga0501067_0467275 | 3300049583 | Bacteria | 705 |
| 829 | Ga0501068_0547868 | 3300049584 | Bacteria | 752 |
| 830 | Ga0501069_0036729 | 3300049585 | Bacteria | 2702 |
| 831 | Ga0501069_0172463 | 3300049585 | Bacteria | 1248 |
| 832 | Ga0501069_0295526 | 3300049585 | Bacteria | 949 |
| 833 | Ga0501069_0747904 | 3300049585 | Bacteria | 591 |
| 834 | Ga0501070_0000120 | 3300049586 | Bacteria | 70354 |
| 835 | Ga0501070_0046323 | 3300049586 | Bacteria | 3616 |
| 836 | Ga0501070_0065509 | 3300049586 | Bacteria | 3008 |
| 837 | Ga0501070_0081863 | 3300049586 | Bacteria | 2671 |
| 838 | Ga0501071_0048328 | 3300049587 | Bacteria | 3059 |
| 839 | Ga0501072_0039255 | 3300049588 | Bacteria | 3717 |
| 840 | Ga0501072_0571817 | 3300049588 | Bacteria | 892 |
| 841 | Ga0501072_0662959 | 3300049588 | Bacteria | 821 |
| 842 | Ga0501073_0050562 | 3300049589 | Bacteria | 2912 |
| 843 | Ga0501073_0157122 | 3300049589 | Bacteria | 1575 |
| 844 | Ga0501074_0180404 | 3300049590 | Bacteria | 1506 |
| 845 | Ga0501074_0409484 | 3300049590 | Bacteria | 962 |
| 846 | Ga0501075_0012968 | 3300049591 | Bacteria | 5938 |
| 847 | Ga0501075_1004113 | 3300049591 | Bacteria | 634 |
| 848 | Ga0501076_0051154 | 3300049592 | Bacteria | 3269 |
| 849 | Ga0501076_0127591 | 3300049592 | Bacteria | 2062 |
| 850 | Ga0501077_0001242 | 3300049593 | Bacteria | 15398 |
| 851 | Ga0501079_0002215 | 3300049741 | Bacteria | 14016 |
| 852 | Ga0501079_0238268 | 3300049741 | Bacteria | 1421 |
| 853 | Ga0501079_0292414 | 3300049741 | Bacteria | 1274 |
| 854 | Ga0501080_0016996 | 3300049742 | Bacteria | 6718 |
| 855 | Ga0501080_0044197 | 3300049742 | Bacteria | 4147 |
| 856 | Ga0501080_0048945 | 3300049742 | Bacteria | 3933 |
| 857 | Ga0501080_0083929 | 3300049742 | Bacteria | 2960 |
| 858 | Ga0501081_0043469 | 3300049743 | Bacteria | 3082 |
| 859 | Ga0501081_0442164 | 3300049743 | Bacteria | 965 |
| 860 | Ga0501083_0002282 | 3300049744 | Bacteria | 13123 |
| 861 | Ga0501083_0022883 | 3300049744 | Bacteria | 4337 |
| 862 | Ga0501035_0022438 | 3300049822 | Bacteria | 5797 |
| 863 | Ga0501045_0012614 | 3300049824 | Bacteria | 5950 |
| 864 | nmdc:mga05p37_263018_c1 | 3300050507 | Bacteria | 2064 |
| 865 | nmdc:mga05p37_623185_c1 | 3300050507 | Bacteria | 1213 |
| 866 | nmdc:mga09592_1059572_c1 | 3300050508 | Bacteria | 675 |
| 867 | nmdc:mga09592_1078272_c1 | 3300050508 | Bacteria | 668 |
| 868 | nmdc:mga0n895_30400_c1 | 3300050512 | Bacteria | 5162 |
| 869 | nmdc:mga0rr50_463871_c1 | 3300050513 | Bacteria | 1074 |
| 870 | nmdc:mga08x19_451609_c1 | 3300050514 | Bacteria | 905 |
| 871 | nmdc:mga0a205_1058725_c1 | 3300050515 | Bacteria | 658 |
| 872 | nmdc:mga0a205_33243_c1 | 3300050515 | Bacteria | 4945 |
| 873 | Ga0495601_0011114 | 3300053077 | Bacteria | 5378 |
| 874 | Ga0495601_0055787 | 3300053077 | Bacteria | 2501 |
| 875 | Ga0495601_0257813 | 3300053077 | Bacteria | 1138 |
| 876 | Ga0495601_0660532 | 3300053077 | Bacteria | 668 |
| 877 | Ga0495612_0013908 | 3300053078 | Bacteria | 3242 |
| 878 | Ga0495612_0020760 | 3300053078 | Bacteria | 2634 |
| 879 | Ga0495612_0021274 | 3300053078 | Bacteria | 2603 |
| 880 | Ga0495595_0139426 | 3300053084 | Bacteria | 1189 |
| 881 | Ga0495619_0027310 | 3300053085 | Bacteria | 3675 |
| 882 | Ga0495619_0029886 | 3300053085 | Bacteria | 3523 |
| 883 | Ga0495619_0051672 | 3300053085 | Bacteria | 2716 |
| 884 | Ga0495619_0167405 | 3300053085 | Bacteria | 1519 |
| 885 | Ga0495619_0399513 | 3300053085 | Bacteria | 949 |
| 886 | Ga0495619_0794904 | 3300053085 | Bacteria | 640 |
| 887 | Ga0500566_0388311 | 3300053094 | Unclassified | 628 |
| 888 | Ga0501084_0000569 | 3300054114 | Bacteria | 28211 |
| 889 | Ga0501084_0241425 | 3300054114 | Bacteria | 1525 |
| 890 | Ga0501082_0031277 | 3300060353 | Bacteria | 4588 |
| 891 | Ga0501082_0217041 | 3300060353 | Bacteria | 1664 |
| 892 | Ga0501082_0477201 | 3300060353 | Bacteria | 1090 |
| 893 | Ga0466962_0005742 | 3300061719 | Bacteria | 5961 |
| 894 | Ga0466962_0007194 | 3300061719 | Bacteria | 5330 |
| 895 | Ga0466962_0009676 | 3300061719 | Bacteria | 4623 |
| 896 | Ga0466962_0015579 | 3300061719 | Bacteria | 3666 |
| 897 | Ga0466962_0022520 | 3300061719 | Bacteria | 3027 |
| 898 | Ga0466962_0200358 | 3300061719 | Bacteria | 975 |
| 899 | Ga0466962_0432186 | 3300061719 | Bacteria | 662 |
| 900 | Ga0466962_0547586 | 3300061719 | Bacteria | 588 |
| 901 | Ga0530510_0003344 | 3300061734 | Bacteria | 11033 |
| 902 | Ga0530510_0275609 | 3300061734 | Bacteria | 1256 |
| 903 | Ga0530510_0549386 | 3300061734 | Bacteria | 877 |
| 904 | Ga0530510_0648588 | 3300061734 | Bacteria | 804 |
| 905 | Ga0466969_0059549 | |||
| 906 | JGI24742J22300_10002407 | |||
| 907 | Ga0070658_10016087 | |||
| 908 | Ga0070658_10062834 | |||
| 909 | Ga0070658_11169599 | |||
| 910 | Ga0070683_100796345 | |||
| 911 | Ga0070683_100957300 | |||
| 912 | Ga0068869_100659207 | |||
| 913 | Ga0070666_10264481 | |||
| 914 | Ga0070680_100065367 | |||
| 915 | Ga0070680_100206596 | |||
| 916 | Ga0070680_100236457 | |||
| 917 | Ga0070680_100311063 | |||
| 918 | Ga0070680_100361888 | |||
| 919 | Ga0070680_100518305 | |||
| 920 | Ga0070682_100106780 | |||
| 921 | Ga0070682_100164915 | |||
| 922 | Ga0070682_100200074 | |||
| 923 | Ga0068868_100117788 | |||
| 924 | Ga0070660_100024469 | |||
| 925 | Ga0070660_100045564 | |||
| 926 | Ga0070660_100054273 | |||
| 927 | Ga0070660_101121955 | |||
| 928 | Ga0070660_101250510 | |||
| 929 | Ga0070689_100137086 | |||
| 930 | Ga0070692_10034327 | |||
| 931 | Ga0070668_100228289 | |||
| 932 | Ga0070669_100135350 | |||
| 933 | Ga0070675_100109097 | |||
| 934 | Ga0070675_100121365 | |||
| 935 | Ga0070675_100856491 | |||
| 936 | Ga0070671_100109774 | |||
| 937 | Ga0070671_100176914 | |||
| 938 | Ga0070674_100114732 | |||
| 939 | Ga0070673_100069209 | |||
| 940 | Ga0070673_100563624 | |||
| 941 | Ga0070688_100008913 | |||
| 942 | Ga0070659_100018012 | |||
| 943 | Ga0070659_100120401 | |||
| 944 | Ga0070659_100464052 | |||
| 945 | Ga0070667_102228794 | |||
| 946 | Ga0070703_10011287 | |||
| 947 | Ga0070709_10006375 | |||
| 948 | Ga0070709_10422785 | |||
| 949 | Ga0070709_10578359 | |||
| 950 | Ga0070714_100039545 | |||
| 951 | Ga0070714_100047946 | |||
| 952 | Ga0070714_100052104 | |||
| 953 | Ga0070714_100052804 | |||
| 954 | Ga0070714_100102045 | |||
| 955 | Ga0070714_100147764 | |||
| 956 | Ga0070714_100343059 | |||
| 957 | Ga0070714_100359820 | |||
| 958 | Ga0070714_100477902 | |||
| 959 | Ga0070714_101378043 | |||
| 960 | Ga0070713_100138473 | |||
| 961 | Ga0070713_100163370 | |||
| 962 | Ga0070713_100734136 | |||
| 963 | Ga0070713_100880423 | |||
| 964 | Ga0070713_101251328 | |||
| 965 | Ga0070713_101983327 | |||
| 966 | Ga0070710_11244088 | |||
| 967 | Ga0070701_10000667 | |||
| 968 | Ga0070701_11412199 | |||
| 969 | Ga0070711_100001144 | |||
| 970 | Ga0070711_100595194 | |||
| 971 | Ga0070705_100101662 | |||
| 972 | Ga0070700_100018297 | |||
| 973 | Ga0070700_101088827 | |||
| 974 | Ga0070694_100014942 | |||
| 975 | Ga0070663_100020799 | |||
| 976 | Ga0070678_100071583 | |||
| 977 | Ga0070678_100101832 | |||
| 978 | Ga0070662_100441605 | |||
| 979 | Ga0070681_10013533 | |||
| 980 | Ga0070681_10067782 | |||
| 981 | Ga0070681_10073300 | |||
| 982 | Ga0070681_10105236 | |||
| 983 | Ga0070681_10148138 | |||
| 984 | Ga0070681_10263444 | |||
| 985 | Ga0068867_100007911 | |||
| 986 | Ga0068867_100205482 | |||
| 987 | Ga0070685_10005085 | |||
| 988 | Ga0070685_10165760 | |||
| 989 | Ga0070685_11174186 | |||
| 990 | Ga0070706_101314748 | |||
| 991 | Ga0070707_100048190 | |||
| 992 | Ga0070707_101011800 | |||
| 993 | Ga0070707_101148774 | |||
| 994 | Ga0070698_100022593 | |||
| 995 | Ga0070698_100172630 | |||
| 996 | Ga0070698_100277511 | |||
| 997 | Ga0070698_100298139 | |||
| 998 | Ga0070698_100342405 | |||
| 999 | Ga0070698_101802477 | |||
| 1000 | Ga0070699_100192797 | |||
| 1001 | Ga0070699_100506653 | |||
| 1002 | Ga0070699_101204270 | |||
| 1003 | Ga0070679_100022641 | |||
| 1004 | Ga0070679_100036849 | |||
| 1005 | Ga0070679_100078366 | |||
| 1006 | Ga0070679_100084717 | |||
| 1007 | Ga0070679_100094397 | |||
| 1008 | Ga0070679_100125431 | |||
| 1009 | Ga0070679_100851717 | |||
| 1010 | Ga0070684_100078419 | |||
| 1011 | Ga0070684_100105782 | |||
| 1012 | Ga0070684_101506609 | |||
| 1013 | Ga0068853_100011697 | |||
| 1014 | Ga0070672_100078149 | |||
| 1015 | Ga0070672_100176064 | |||
| 1016 | Ga0070672_101281937 | |||
| 1017 | Ga0070686_100009622 | |||
| 1018 | Ga0070695_100000005 | |||
| 1019 | Ga0070696_100203246 | |||
| 1020 | Ga0070696_100438317 | |||
| 1021 | Ga0070693_100031252 | |||
| 1022 | Ga0070693_100041697 | |||
| 1023 | Ga0070693_100210712 | |||
| 1024 | Ga0070665_100347398 | |||
| 1025 | Ga0070665_100437539 | |||
| 1026 | Ga0070704_100011254 | |||
| 1027 | Ga0070704_100754504 | |||
| 1028 | Ga0070704_100934571 | |||
| 1029 | Ga0068855_100155542 | |||
| 1030 | Ga0068855_100328463 | |||
| 1031 | Ga0068855_100369478 | |||
| 1032 | Ga0068855_100504358 | |||
| 1033 | Ga0068855_101451379 | |||
| 1034 | Ga0068854_100424363 | |||
| 1035 | Ga0068856_100006244 | |||
| 1036 | Ga0068856_100140383 | |||
| 1037 | Ga0068856_100172951 | |||
| 1038 | Ga0070702_100004914 | |||
| 1039 | Ga0070702_100148742 | |||
| 1040 | Ga0070702_100739960 | |||
| 1041 | Ga0070702_100792425 | |||
| 1042 | Ga0068852_100061014 | |||
| 1043 | Ga0068852_100265713 | |||
| 1044 | Ga0068852_101179519 | |||
| 1045 | Ga0068859_100392405 | |||
| 1046 | Ga0068866_10057482 | |||
| 1047 | Ga0068861_101312358 | |||
| 1048 | Ga0068870_10464612 | |||
| 1049 | Ga0068863_100658592 | |||
| 1050 | Ga0068858_100778311 | |||
| 1051 | Ga0070717_10016628 | |||
| 1052 | Ga0070717_10074728 | |||
| 1053 | Ga0070717_10087186 | |||
| 1054 | Ga0070717_10310749 | |||
| 1055 | Ga0070717_11180662 | |||
| 1056 | Ga0070716_100427209 | |||
| 1057 | Ga0070716_101261597 | |||
| 1058 | Ga0070712_100002015 | |||
| 1059 | Ga0070712_101703875 | |||
| 1060 | Ga0097621_100436935 | |||
| 1061 | Ga0068871_100012901 | |||
| 1062 | Ga0075428_101479133 | |||
| 1063 | Ga0075433_11412755 | |||
| 1064 | Ga0075434_100035672 | |||
| 1065 | Ga0068865_100007640 | |||
| 1066 | Ga0068865_100687395 | |||
| 1067 | Ga0075436_100167748 | |||
| 1068 | Ga0097620_100392396 | |||
| 1069 | Ga0105240_10010198 | |||
| 1070 | Ga0105240_10274583 | |||
| 1071 | Ga0105245_10323422 | |||
| 1072 | Ga0105245_10468511 | |||
| 1073 | Ga0105245_10558588 | |||
| 1074 | Ga0105245_11602609 | |||
| 1075 | Ga0114129_10114471 | |||
| 1076 | Ga0114129_10861051 | |||
| 1077 | Ga0114129_11970333 | |||
| 1078 | Ga0105243_10122570 | |||
| 1079 | Ga0105243_10382603 | |||
| 1080 | Ga0105241_11339273 | |||
| 1081 | Ga0105242_10015971 | |||
| 1082 | Ga0105242_11563734 | |||
| 1083 | Ga0105248_10006882 | |||
| 1084 | Ga0105248_10101951 | |||
| 1085 | Ga0105237_10270186 | |||
| 1086 | Ga0105237_11161570 | |||
| 1087 | Ga0105238_10256924 | |||
| 1088 | Ga0105238_10917425 | |||
| 1089 | Ga0105249_10013630 | |||
| 1090 | Ga0105239_10046172 | |||
| 1091 | Ga0105239_11238522 | |||
| 1092 | Ga0105246_10062625 | |||
| 1093 | Ga0105246_11922462 | |||
| 1094 | Ga0157373_10424328 | |||
| 1095 | Ga0157373_10952599 | |||
| 1096 | Ga0157373_11588498 | |||
| 1097 | Ga0157371_10269498 | |||
| 1098 | Ga0157371_10295775 | |||
| 1099 | Ga0157371_10440678 | |||
| 1100 | Ga0157371_10781992 | |||
| 1101 | Ga0157370_10056793 | |||
| 1102 | Ga0157370_10082250 | |||
| 1103 | Ga0157370_10745445 | |||
| 1104 | Ga0157369_10004869 | |||
| 1105 | Ga0157369_10121772 | |||
| 1106 | Ga0157369_10348925 | |||
| 1107 | Ga0157369_10393652 | |||
| 1108 | Ga0157369_10981899 | |||
| 1109 | Ga0157374_10019190 | |||
| 1110 | Ga0157378_10028875 | |||
| 1111 | Ga0163162_10012762 | |||
| 1112 | Ga0157372_10369472 | |||
| 1113 | Ga0157372_10372559 | |||
| 1114 | Ga0157372_10495726 | |||
| 1115 | Ga0157372_10813164 | |||
| 1116 | Ga0157372_11731736 | |||
| 1117 | Ga0157375_10063681 | |||
| 1118 | Ga0163163_10413047 | |||
| 1119 | Ga0157380_10097954 | |||
| 1120 | Ga0157380_10439445 | |||
| 1121 | Ga0182008_10045355 | |||
| 1122 | Ga0182008_10156198 | |||
| 1123 | Ga0182008_10215678 | |||
| 1124 | Ga0182008_10636851 | |||
| 1125 | Ga0157377_10005058 | |||
| 1126 | Ga0157377_10207614 | |||
| 1127 | Ga0157377_10310866 | |||
| 1128 | Ga0157379_10716874 | |||
| 1129 | Ga0157376_10171391 | |||
| 1130 | Ga0157376_10186284 | |||
| 1131 | Ga0182007_10275842 | |||
| 1132 | Ga0197907_10050932 | |||
| 1133 | Ga0206356_10299671 | |||
| 1134 | Ga0206356_10582843 | |||
| 1135 | Ga0206352_10068530 | |||
| 1136 | Ga0206353_10109980 | |||
| 1137 | Ga0213871_10018698 | |||
| 1138 | Ga0224712_10016639 | |||
| 1139 | Ga0224712_10035711 | |||
| 1140 | Ga0224712_10041278 | |||
| 1141 | Ga0224712_10210951 | |||
| 1142 | Ga0207656_10405025 | |||
| 1143 | Ga0207653_10013144 | |||
| 1144 | Ga0207692_10233232 | |||
| 1145 | Ga0207692_10406766 | |||
| 1146 | Ga0207642_10015885 | |||
| 1147 | Ga0207680_10564234 | |||
| 1148 | Ga0207647_10092471 | |||
| 1149 | Ga0207685_10414717 | |||
| 1150 | Ga0207699_10048632 | |||
| 1151 | Ga0207699_10064031 | |||
| 1152 | Ga0207699_10262767 | |||
| 1153 | Ga0207699_10430105 | |||
| 1154 | Ga0207705_10121664 | |||
| 1155 | Ga0207705_10129895 | |||
| 1156 | Ga0207705_10809109 | |||
| 1157 | Ga0207684_11152806 | |||
| 1158 | Ga0207707_10079405 | |||
| 1159 | Ga0207707_10116132 | |||
| 1160 | Ga0207707_10205268 | |||
| 1161 | Ga0207707_10224658 | |||
| 1162 | Ga0207707_10258877 | |||
| 1163 | Ga0207707_10282621 | |||
| 1164 | Ga0207707_10762766 | |||
| 1165 | Ga0207707_11222234 | |||
| 1166 | Ga0207695_10092844 | |||
| 1167 | Ga0207695_10730837 | |||
| 1168 | Ga0207671_10183731 | |||
| 1169 | Ga0207693_10001754 | |||
| 1170 | Ga0207693_10346208 | |||
| 1171 | Ga0207663_10009432 | |||
| 1172 | Ga0207663_10355124 | |||
| 1173 | Ga0207663_10405215 | |||
| 1174 | Ga0207660_10074492 | |||
| 1175 | Ga0207660_10298754 | |||
| 1176 | Ga0207660_11294330 | |||
| 1177 | Ga0207657_10021891 | |||
| 1178 | Ga0207657_10028683 | |||
| 1179 | Ga0207657_10030731 | |||
| 1180 | Ga0207657_10039137 | |||
| 1181 | Ga0207657_10476174 | |||
| 1182 | Ga0207649_10798110 | |||
| 1183 | Ga0207649_11444521 | |||
| 1184 | Ga0207652_10028722 | |||
| 1185 | Ga0207652_10076097 | |||
| 1186 | Ga0207652_10112530 | |||
| 1187 | Ga0207652_10239879 | |||
| 1188 | Ga0207652_10503411 | |||
| 1189 | Ga0207652_11289197 | |||
| 1190 | Ga0207652_11845839 | |||
| 1191 | Ga0207646_10002790 | |||
| 1192 | Ga0207681_10146095 | |||
| 1193 | Ga0207659_10742969 | |||
| 1194 | Ga0207687_10273211 | |||
| 1195 | Ga0207687_10451001 | |||
| 1196 | Ga0207700_10130803 | |||
| 1197 | Ga0207700_10139996 | |||
| 1198 | Ga0207700_10214100 | |||
| 1199 | Ga0207700_10699629 | |||
| 1200 | Ga0207664_10006659 | |||
| 1201 | Ga0207664_10063736 | |||
| 1202 | Ga0207664_10067502 | |||
| 1203 | Ga0207664_10080313 | |||
| 1204 | Ga0207664_10117624 | |||
| 1205 | Ga0207664_10487797 | |||
| 1206 | Ga0207664_10590437 | |||
| 1207 | Ga0207664_10680341 | |||
| 1208 | Ga0207664_11606330 | |||
| 1209 | Ga0207644_10106716 | |||
| 1210 | Ga0207690_10207563 | |||
| 1211 | Ga0207690_10339600 | |||
| 1212 | Ga0207706_10138511 | |||
| 1213 | Ga0207686_10258507 | |||
| 1214 | Ga0207709_10007985 | |||
| 1215 | Ga0207670_10214215 | |||
| 1216 | Ga0207669_10003162 | |||
| 1217 | Ga0207669_10837368 | |||
| 1218 | Ga0207704_10564057 | |||
| 1219 | Ga0207665_10674103 | |||
| 1220 | Ga0207665_11472955 | |||
| 1221 | Ga0207691_10015425 | |||
| 1222 | Ga0207691_10114872 | |||
| 1223 | Ga0207661_10180752 | |||
| 1224 | Ga0207661_10300625 | |||
| 1225 | Ga0207661_10863549 | |||
| 1226 | Ga0207679_10209244 | |||
| 1227 | Ga0207667_10222762 | |||
| 1228 | Ga0207667_12234204 | |||
| 1229 | Ga0207651_10088819 | |||
| 1230 | Ga0207712_10014470 | |||
| 1231 | Ga0207668_10021394 | |||
| 1232 | Ga0207640_10412063 | |||
| 1233 | Ga0207640_10527980 | |||
| 1234 | Ga0207677_10615877 | |||
| 1235 | Ga0207677_11254204 | |||
| 1236 | Ga0207703_10802658 | |||
| 1237 | Ga0207639_10021934 | |||
| 1238 | Ga0207678_10026059 | |||
| 1239 | Ga0207708_10004755 | |||
| 1240 | Ga0207708_10650794 | |||
| 1241 | Ga0207702_10082862 | |||
| 1242 | Ga0207702_10153196 | |||
| 1243 | Ga0207641_10303411 | |||
| 1244 | Ga0207648_10000150 | |||
| 1245 | Ga0207648_10095540 | |||
| 1246 | Ga0207676_11764589 | |||
| 1247 | Ga0207674_10545665 | |||
| 1248 | Ga0207675_100033801 | |||
| 1249 | Ga0207683_10000131 | |||
| 1250 | Ga0207683_10207959 | |||
| 1251 | Ga0207698_10309512 | |||
| 1252 | Ga0207698_10466409 | |||
| 1253 | Ga0207698_12469730 | |||
| 1254 | Ga0268266_10024942 | |||
| 1255 | Ga0268266_10377332 | |||
| 1256 | Ga0268265_12445083 | |||
| 1257 | Ga0268264_10093608 | |||
| 1258 | Ga0265337_1021347 | |||
| 1259 | Ga0265337_1062938 | |||
| 1260 | Ga0265337_1073858 | |||
| 1261 | Ga0265319_1008248 | |||
| 1262 | Ga0265319_1051260 | |||
| 1263 | Ga0265334_10064105 | |||
| 1264 | Ga0265334_10108144 | |||
| 1265 | Ga0265318_10002863 | |||
| 1266 | Ga0265318_10066773 | |||
| 1267 | Ga0265323_10031089 | |||
| 1268 | Ga0265322_10003718 | |||
| 1269 | Ga0265322_10052505 | |||
| 1270 | Ga0265322_10072007 | |||
| 1271 | Ga0265322_10136571 | |||
| 1272 | Ga0265336_10002725 | |||
| 1273 | Ga0265336_10088273 | |||
| 1274 | Ga0265338_10001061 | |||
| 1275 | Ga0265338_10002640 | |||
| 1276 | Ga0265338_10012416 | |||
| 1277 | Ga0265338_10048855 | |||
| 1278 | Ga0265338_10107316 | |||
| 1279 | Ga0265324_10019591 | |||
| 1280 | Ga0265324_10075388 | |||
| 1281 | Ga0265330_10014792 | |||
| 1282 | Ga0265330_10043846 | |||
| 1283 | Ga0265330_10096428 | |||
| 1284 | Ga0265332_10132480 | |||
| 1285 | Ga0265328_10019588 | |||
| 1286 | Ga0265320_10025091 | |||
| 1287 | Ga0265320_10053501 | |||
| 1288 | Ga0265320_10063568 | |||
| 1289 | Ga0265320_10065597 | |||
| 1290 | Ga0265320_10123093 | |||
| 1291 | Ga0265320_10374860 | |||
| 1292 | Ga0265325_10034373 | |||
| 1293 | Ga0265325_10045008 | |||
| 1294 | Ga0265329_10009741 | |||
| 1295 | Ga0265329_10016825 | |||
| 1296 | Ga0265340_10010723 | |||
| 1297 | Ga0265340_10095441 | |||
| 1298 | Ga0265339_10014232 | |||
| 1299 | Ga0265339_10095377 | |||
| 1300 | Ga0265331_10110303 | |||
| 1301 | Ga0265331_10428710 | |||
| 1302 | Ga0265327_10052022 | |||
| 1303 | Ga0265327_10440031 | |||
| 1304 | Ga0265316_10015338 | |||
| 1305 | Ga0265316_10094514 | |||
| 1306 | Ga0265316_10400827 | |||
| 1307 | Ga0265316_10679332 | |||
| 1308 | Ga0307408_100629491 | |||
| 1309 | Ga0307408_101330340 | |||
| 1310 | Ga0265313_10028474 | |||
| 1311 | Ga0265313_10088232 | |||
| 1312 | Ga0265313_10110302 | |||
| 1313 | Ga0265314_10012572 | |||
| 1314 | Ga0265314_10031647 | |||
| 1315 | Ga0265314_10657956 | |||
| 1316 | Ga0265342_10035672 | |||
| 1317 | Ga0265342_10219956 | |||
| 1318 | Ga0265342_10274112 | |||
| 1319 | Ga0265342_10303057 | |||
| 1320 | Ga0307405_11140255 | |||
| 1321 | Ga0307406_11791649 | |||
| 1322 | Ga0307409_100160605 | |||
| 1323 | Ga0307409_100660154 | |||
| 1324 | Ga0307409_101519549 | |||
| 1325 | Ga0307409_102282301 | |||
| 1326 | Ga0307416_100405156 | |||
| 1327 | Ga0307416_100865999 | |||
| 1328 | Ga0307415_100089435 | |||
| 1329 | Ga0316583_10055375 | |||
| 1330 | Ga0373945_0013400 | |||
| 1331 | Ga0373945_0283195 | |||
| 1332 | Ga0373957_0062287 | |||
| 1333 | Ga0373957_0071852 | |||
| 1334 | Ga0373960_0382516 | |||
| 1335 | Ga0373943_0000443 | |||
| 1336 | Ga0373946_0029789 | |||
| 1337 | Ga0373946_0217564 | |||
| 1338 | Ga0373942_0098421 | |||
| 1339 | Ga0373924_0111278 | |||
| 1340 | Ga0373935_0503240 | |||
| 1341 | Ga0373927_0016318 | |||
| 1342 | Ga0373947_0006187 | |||
| 1343 | Ga0373937_0045765 | |||
| 1344 | Ga0373937_0277187 | |||
| 1345 | Ga0373925_0000484 | |||
| 1346 | Ga0395899_0105798 | |||
| 1347 | Ga0395899_0225031 | |||
| 1348 | Ga0395900_0128550 | |||
| 1349 | Ga0395900_0399930 | |||
| 1350 | Ga0395900_0492011 | |||
| 1351 | Ga0395900_0751939 | |||
| 1352 | Ga0395900_0943507 | |||
| 1353 | Ga0395898_0190567 | |||
| 1354 | Ga0395898_0231215 | |||
| 1355 | Ga0395898_0358584 | |||
| 1356 | Ga0395898_0652838 | |||
| 1357 | Ga0395898_1372905 | |||
| 1358 | Ga0395905_0594755 | |||
| 1359 | Ga0395905_0769866 | |||
| 1360 | Ga0395901_0216662 | |||
| 1361 | Ga0395901_0336003 | |||
| 1362 | Ga0395901_0991855 | |||
| 1363 | Ga0436365_1081831 | |||
| 1364 | Ga0439461_0004684 | |||
| 1365 | Ga0451787_752081 | |||
| 1366 | Ga0451800_1256723 | |||
| 1367 | Ga0451800_1606387 | |||
| 1368 | Ga0451807_1530868 | |||
| 1369 | Ga0451835_0189308 | |||
| 1370 | Ga0451835_1052634 | |||
| 1371 | Ga0451835_1181250 | |||
| 1372 | Ga0451841_0654153 | |||
| 1373 | Ga0451849_1110976 | |||
| 1374 | Ga0451849_1121762 | |||
| 1375 | Ga0451849_1517115 | |||
| 1376 | Ga0451851_1046935 | |||
| 1377 | Ga0451843_0324014 | |||
| 1378 | Ga0451855_1001223 | |||
| 1379 | Ga0451853_2833846 | |||
| 1380 | Ga0439433_0073916 | |||
| 1381 | Ga0439441_077168 | |||
| 1382 | Ga0439445_0149537 | |||
| 1383 | Ga0450920_007359 | |||
| 1384 | Ga0450920_040731 | |||
| 1385 | Ga0450907_008091 | |||
| 1386 | Ga0439446_0119725 | |||
| 1387 | Ga0439434_0127006 | |||
| 1388 | Ga0450918_015465 | |||
| 1389 | Ga0466969_0047639 | |||
| 1390 | Ga0466969_0123336 | |||
| 1391 | Ga0466965_0051675 | |||
| 1392 | Ga0466965_0077300 | |||
| 1393 | Ga0466965_0156798 | |||
| 1394 | Ga0466966_0087961 | |||
| 1395 | Ga0466966_0110986 | |||
| 1396 | Ga0466961_0003717 | |||
| 1397 | Ga0466961_0009997 | |||
| 1398 | Ga0466961_0027078 | |||
| 1399 | Ga0466961_0158133 | |||
| 1400 | Ga0466961_0267367 | |||
| 1401 | Ga0466963_0000045 | |||
| 1402 | Ga0466963_0001615 | |||
| 1403 | Ga0466963_0002571 | |||
| 1404 | Ga0466963_0003847 | |||
| 1405 | Ga0466963_0009695 | |||
| 1406 | Ga0466963_0017987 | |||
| 1407 | Ga0466963_0025483 | |||
| 1408 | Ga0466963_0030015 | |||
| 1409 | Ga0466963_0037378 | |||
| 1410 | Ga0466963_0038787 | |||
| 1411 | Ga0466963_0052242 | |||
| 1412 | Ga0466963_0147985 | |||
| 1413 | Ga0466963_0149941 | |||
| 1414 | Ga0466964_0001132 | |||
| 1415 | Ga0466964_0001184 | |||
| 1416 | Ga0466964_0014124 | |||
| 1417 | Ga0466964_0014343 | |||
| 1418 | Ga0466964_0019652 | |||
| 1419 | Ga0466964_0021999 | |||
| 1420 | Ga0466964_0023711 | |||
| 1421 | Ga0466964_0448264 | |||
| 1422 | Ga0453684_0679587 | |||
| 1423 | Ga0453684_2028565 | |||
| 1424 | Ga0466971_0001365 | |||
| 1425 | Ga0466971_0003490 | |||
| 1426 | Ga0466971_0004863 | |||
| 1427 | Ga0466971_0007185 | |||
| 1428 | Ga0466971_0012056 | |||
| 1429 | Ga0466971_0056029 | |||
| 1430 | Ga0466971_0289708 | |||
| 1431 | Ga0466971_0401467 | |||
| 1432 | Ga0466971_0664139 | |||
| 1433 | Ga0466971_0686603 | |||
| 1434 | Ga0466968_0032822 | |||
| 1435 | Ga0466968_0040117 | |||
| 1436 | Ga0466968_0093727 | |||
| 1437 | Ga0466968_0496878 | |||
| 1438 | Ga0466970_0120440 | |||
| 1439 | Ga0466970_0339620 | |||
| 1440 | Ga0466970_0731386 | |||
| 1441 | Ga0466957_0003129 | |||
| 1442 | Ga0466957_0015028 | |||
| 1443 | Ga0466957_0015833 | |||
| 1444 | Ga0466957_0025038 | |||
| 1445 | Ga0466957_0084229 | |||
| 1446 | Ga0466957_0123661 | |||
| 1447 | Ga0466957_0139388 | |||
| 1448 | Ga0466957_0163410 | |||
| 1449 | Ga0466957_0176641 | |||
| 1450 | Ga0466957_0191817 | |||
| 1451 | Ga0466957_0227545 | |||
| 1452 | Ga0466957_0570399 | |||
| 1453 | Ga0466960_0015978 | |||
| 1454 | Ga0466960_0181987 | |||
| 1455 | Ga0466960_0190172 | |||
| 1456 | Ga0466960_0319537 | |||
| 1457 | Ga0466960_0826177 | |||
| 1458 | Ga0466959_0002525 | |||
| 1459 | Ga0466959_0028529 | |||
| 1460 | Ga0466959_0036459 | |||
| 1461 | Ga0466959_0043047 | |||
| 1462 | Ga0466959_0080020 | |||
| 1463 | Ga0466959_0933594 | |||
| 1464 | Ga0451576_1915353 | |||
| 1465 | Ga0466958_0013689 | |||
| 1466 | Ga0466958_0018146 | |||
| 1467 | Ga0466958_0023977 | |||
| 1468 | Ga0466958_0026345 | |||
| 1469 | Ga0466958_0042066 | |||
| 1470 | Ga0466958_0043094 | |||
| 1471 | Ga0466958_0083928 | |||
| 1472 | Ga0466958_0146425 | |||
| 1473 | Ga0466958_0230704 | |||
| 1474 | Ga0466958_0339507 | |||
| 1475 | Ga0466958_0391534 | |||
| 1476 | Ga0466958_0535776 | |||
| 1477 | Ga0466958_1060110 | |||
| 1478 | Ga0466967_0000248 | |||
| 1479 | Ga0466967_0000884 | |||
| 1480 | Ga0466967_0014176 | |||
| 1481 | Ga0466967_0018918 | |||
| 1482 | Ga0466967_0020132 | |||
| 1483 | Ga0466967_0023209 | |||
| 1484 | Ga0466967_0035363 | |||
| 1485 | Ga0466967_0049540 | |||
| 1486 | Ga0466967_0094731 | |||
| 1487 | Ga0466967_0136727 | |||
| 1488 | Ga0466967_0182602 | |||
| 1489 | Ga0466967_0196775 | |||
| 1490 | Ga0466967_0477914 | |||
| 1491 | Ga0466967_0628838 | |||
| 1492 | Ga0466967_0634791 | |||
| 1493 | Ga0466967_0980098 | |||
| 1494 | Ga0466967_1299988 | |||
| 1495 | Ga0466967_1471635 | |||
| 1496 | Ga0495592_0012566 | |||
| 1497 | Ga0495592_0100772 | |||
| 1498 | Ga0495592_0582740 | |||
| 1499 | Ga0495603_0010014 | |||
| 1500 | Ga0495629_0036724 | |||
| 1501 | Ga0495629_0048221 | |||
| 1502 | Ga0495629_0085421 | |||
| 1503 | Ga0495629_0256872 | |||
| 1504 | Ga0495629_0502931 | |||
| 1505 | Ga0495641_0023607 | |||
| 1506 | Ga0495641_0034933 | |||
| 1507 | Ga0495641_0057705 | |||
| 1508 | Ga0495641_0184890 | |||
| 1509 | Ga0495641_0374593 | |||
| 1510 | Ga0495651_0000080 | |||
| 1511 | Ga0495651_0193268 | |||
| 1512 | Ga0495651_0267047 | |||
| 1513 | Ga0495651_0930829 | |||
| 1514 | Ga0495653_0006383 | |||
| 1515 | Ga0495653_0023496 | |||
| 1516 | Ga0495653_0172233 | |||
| 1517 | Ga0495580_0126898 | |||
| 1518 | Ga0495582_0032089 | |||
| 1519 | Ga0495582_0193227 | |||
| 1520 | Ga0495639_0000425 | |||
| 1521 | Ga0495639_0356952 | |||
| 1522 | Ga0495639_0713236 | |||
| 1523 | Ga0495662_0002534 | |||
| 1524 | Ga0495662_0314418 | |||
| 1525 | Ga0495664_0003077 | |||
| 1526 | Ga0495664_0087924 | |||
| 1527 | Ga0495664_0112560 | |||
| 1528 | Ga0495584_0098185 | |||
| 1529 | Ga0495596_0023014 | |||
| 1530 | Ga0495596_0075365 | |||
| 1531 | Ga0495607_0006178 | |||
| 1532 | Ga0495608_0050015 | |||
| 1533 | Ga0495608_0062369 | |||
| 1534 | Ga0495608_0594582 | |||
| 1535 | Ga0495608_0850481 | |||
| 1536 | Ga0495618_0011918 | |||
| 1537 | Ga0495618_0015670 | |||
| 1538 | Ga0495618_0045190 | |||
| 1539 | Ga0495618_0156973 | |||
| 1540 | Ga0495618_0431424 | |||
| 1541 | Ga0495618_0515262 | |||
| 1542 | Ga0495628_0001647 | |||
| 1543 | Ga0495628_0838939 | |||
| 1544 | Ga0495630_0001297 | |||
| 1545 | Ga0495630_0069425 | |||
| 1546 | Ga0495630_0236308 | |||
| 1547 | Ga0495630_0543623 | |||
| 1548 | Ga0495630_0846306 | |||
| 1549 | Ga0495631_0354254 | |||
| 1550 | Ga0495644_0133090 | |||
| 1551 | Ga0495644_0159714 | |||
| 1552 | Ga0495663_0035081 | |||
| 1553 | Ga0495666_0000168 | |||
| 1554 | Ga0495666_0119540 | |||
| 1555 | Ga0495652_0017232 | |||
| 1556 | Ga0495652_0190715 | |||
| 1557 | Ga0495652_0221810 | |||
| 1558 | Ga0495652_0473703 | |||
| 1559 | Ga0495652_0892937 | |||
| 1560 | Ga0495652_1058144 | |||
| 1561 | Ga0495665_0000038 | |||
| 1562 | Ga0495640_0263832 | |||
| 1563 | Ga0495640_0648053 | |||
| 1564 | Ga0495586_0009342 | |||
| 1565 | Ga0495586_0412520 | |||
| 1566 | Ga0495587_0000270 | |||
| 1567 | Ga0495587_0291067 | |||
| 1568 | Ga0495621_0389574 | |||
| 1569 | Ga0495645_0025737 | |||
| 1570 | Ga0495645_0088729 | |||
| 1571 | Ga0495622_0395080 | |||
| 1572 | Ga0495667_0025477 | |||
| 1573 | Ga0495667_0077237 | |||
| 1574 | Ga0495667_0156720 | |||
| 1575 | Ga0495667_0241352 | |||
| 1576 | Ga0495634_0054491 | |||
| 1577 | Ga0495634_0056825 | |||
| 1578 | Ga0495634_0143553 | |||
| 1579 | Ga0495634_0231535 | |||
| 1580 | Ga0495635_0028984 | |||
| 1581 | Ga0495635_0073882 | |||
| 1582 | Ga0495635_0176102 | |||
| 1583 | Ga0495635_0458165 | |||
| 1584 | Ga0495657_0008538 | |||
| 1585 | Ga0495657_0079065 | |||
| 1586 | Ga0495657_0162873 | |||
| 1587 | Ga0495599_0000142 | |||
| 1588 | Ga0495599_0301855 | |||
| 1589 | Ga0495623_0021271 | |||
| 1590 | Ga0495623_0238450 | |||
| 1591 | Ga0495646_0033947 | |||
| 1592 | Ga0495646_0120943 | |||
| 1593 | Ga0495646_0274244 | |||
| 1594 | Ga0495647_0002367 | |||
| 1595 | Ga0495658_0022087 | |||
| 1596 | Ga0495658_0025351 | |||
| 1597 | Ga0495658_1081977 | |||
| 1598 | Ga0495613_0026214 | |||
| 1599 | Ga0495613_0332418 | |||
| 1600 | Ga0495613_0376133 | |||
| 1601 | Ga0495624_0001713 | |||
| 1602 | Ga0495624_0486076 | |||
| 1603 | Ga0495624_0614865 | |||
| 1604 | Ga0495624_0627142 | |||
| 1605 | Ga0495624_0677853 | |||
| 1606 | Ga0495670_0474878 | |||
| 1607 | Ga0495589_0089172 | |||
| 1608 | Ga0495600_0079549 | |||
| 1609 | Ga0495600_0395810 | |||
| 1610 | Ga0495600_0623315 | |||
| 1611 | Ga0495600_0888608 | |||
| 1612 | Ga0495660_0375819 | |||
| 1613 | Ga0495581_0003666 | |||
| 1614 | Ga0495604_0005999 | |||
| 1615 | Ga0495604_0049561 | |||
| 1616 | Ga0495604_0129837 | |||
| 1617 | Ga0495674_0006925 | |||
| 1618 | Ga0495674_0110144 | |||
| 1619 | Ga0495676_0009737 | |||
| 1620 | Ga0495676_0088731 | |||
| 1621 | Ga0495676_0099937 | |||
| 1622 | Ga0495676_0201702 | |||
| 1623 | Ga0495676_0202398 | |||
| 1624 | Ga0495680_0046394 | |||
| 1625 | Ga0495680_0103729 | |||
| 1626 | Ga0495680_0112048 | |||
| 1627 | Ga0495680_0147048 | |||
| 1628 | Ga0495680_0168634 | |||
| 1629 | Ga0495680_0178799 | |||
| 1630 | Ga0495680_0642144 | |||
| 1631 | Ga0495675_0000896 | |||
| 1632 | Ga0495675_0222705 | |||
| 1633 | Ga0495684_0008199 | |||
| 1634 | Ga0495684_0096559 | |||
| 1635 | Ga0495684_0445868 | |||
| 1636 | Ga0495593_0004870 | |||
| 1637 | Ga0495593_0361300 | |||
| 1638 | Ga0495602_0021235 | |||
| 1639 | Ga0495602_0043405 | |||
| 1640 | Ga0495614_0010766 | |||
| 1641 | Ga0495614_0457347 | |||
| 1642 | Ga0495614_0553148 | |||
| 1643 | Ga0496100_1535774 | |||
| 1644 | Ga0496101_0008648 | |||
| 1645 | Ga0496101_0363140 | |||
| 1646 | Ga0496101_0415438 | |||
| 1647 | Ga0496101_0518845 | |||
| 1648 | Ga0496101_0982415 | |||
| 1649 | Ga0496102_0011192 | |||
| 1650 | Ga0496102_0100809 | |||
| 1651 | Ga0496102_0705304 | |||
| 1652 | Ga0496102_1113405 | |||
| 1653 | Ga0496102_1966013 | |||
| 1654 | Ga0496103_0014497 | |||
| 1655 | Ga0496103_0109578 | |||
| 1656 | Ga0496103_0113865 | |||
| 1657 | Ga0496103_0672565 | |||
| 1658 | Ga0496104_0023441 | |||
| 1659 | Ga0496104_0035809 | |||
| 1660 | Ga0496104_0128766 | |||
| 1661 | Ga0496104_0821564 | |||
| 1662 | Ga0496104_1012879 | |||
| 1663 | Ga0496105_0005405 | |||
| 1664 | Ga0496105_0203172 | |||
| 1665 | Ga0496105_0283758 | |||
| 1666 | Ga0496105_0330574 | |||
| 1667 | Ga0496106_0005740 | |||
| 1668 | Ga0496106_0047193 | |||
| 1669 | Ga0496106_0090495 | |||
| 1670 | Ga0496106_0865804 | |||
| 1671 | Ga0496106_1275083 | |||
| 1672 | Ga0496107_0002238 | |||
| 1673 | Ga0496107_0025839 | |||
| 1674 | Ga0496107_0178844 | |||
| 1675 | Ga0496107_0666084 | |||
| 1676 | Ga0496107_1131348 | |||
| 1677 | Ga0496108_0001117 | |||
| 1678 | Ga0496108_0088475 | |||
| 1679 | Ga0496108_0187592 | |||
| 1680 | Ga0496108_0660757 | |||
| 1681 | Ga0496109_0021741 | |||
| 1682 | Ga0496109_0059554 | |||
| 1683 | Ga0496109_0099918 | |||
| 1684 | Ga0496109_0124275 | |||
| 1685 | Ga0496109_0300151 | |||
| 1686 | Ga0496109_0335559 | |||
| 1687 | Ga0496110_0125340 | |||
| 1688 | Ga0496111_0035752 | |||
| 1689 | Ga0496111_0109729 | |||
| 1690 | Ga0496111_0254126 | |||
| 1691 | Ga0496111_0407876 | |||
| 1692 | Ga0496112_0023330 | |||
| 1693 | Ga0496112_0033713 | |||
| 1694 | Ga0496112_0054539 | |||
| 1695 | Ga0496112_0062074 | |||
| 1696 | Ga0496112_0067113 | |||
| 1697 | Ga0496112_0098760 | |||
| 1698 | Ga0496112_0126360 | |||
| 1699 | Ga0496112_0206488 | |||
| 1700 | Ga0496112_0495731 | |||
| 1701 | Ga0496112_0575235 | |||
| 1702 | Ga0496112_0708193 | |||
| 1703 | Ga0496112_0959830 | |||
| 1704 | Ga0496113_0074979 | |||
| 1705 | Ga0496113_0092146 | |||
| 1706 | Ga0496113_0482330 | |||
| 1707 | Ga0496113_0554042 | |||
| 1708 | Ga0496113_0691162 | |||
| 1709 | Ga0496114_0056462 | |||
| 1710 | Ga0496114_0086165 | |||
| 1711 | Ga0496114_0226394 | |||
| 1712 | Ga0496115_0014867 | |||
| 1713 | Ga0501033_0127828 | |||
| 1714 | Ga0501036_0002946 | |||
| 1715 | Ga0501036_0351584 | |||
| 1716 | Ga0501037_0091291 | |||
| 1717 | Ga0501038_0016048 | |||
| 1718 | Ga0501039_0004575 | |||
| 1719 | Ga0501040_0015142 | |||
| 1720 | Ga0501040_0627652 | |||
| 1721 | Ga0501040_0675672 | |||
| 1722 | Ga0501041_0041455 | |||
| 1723 | Ga0501041_0213283 | |||
| 1724 | Ga0501042_0019312 | |||
| 1725 | Ga0501043_0058309 | |||
| 1726 | Ga0501043_1331359 | |||
| 1727 | Ga0501046_0041729 | |||
| 1728 | Ga0501048_0018605 | |||
| 1729 | Ga0501048_0340148 | |||
| 1730 | Ga0501067_0028576 | |||
| 1731 | Ga0501067_0189168 | |||
| 1732 | Ga0501067_0467275 | |||
| 1733 | Ga0501068_0547868 | |||
| 1734 | Ga0501069_0036729 | |||
| 1735 | Ga0501069_0172463 | |||
| 1736 | Ga0501069_0295526 | |||
| 1737 | Ga0501069_0747904 | |||
| 1738 | Ga0501070_0000120 | |||
| 1739 | Ga0501070_0046323 | |||
| 1740 | Ga0501070_0065509 | |||
| 1741 | Ga0501070_0081863 | |||
| 1742 | Ga0501071_0048328 | |||
| 1743 | Ga0501072_0039255 | |||
| 1744 | Ga0501072_0571817 | |||
| 1745 | Ga0501072_0662959 | |||
| 1746 | Ga0501073_0050562 | |||
| 1747 | Ga0501073_0157122 | |||
| 1748 | Ga0501074_0180404 | |||
| 1749 | Ga0501074_0409484 | |||
| 1750 | Ga0501075_0012968 | |||
| 1751 | Ga0501075_1004113 | |||
| 1752 | Ga0501076_0051154 | |||
| 1753 | Ga0501076_0127591 | |||
| 1754 | Ga0501077_0001242 | |||
| 1755 | Ga0501079_0002215 | |||
| 1756 | Ga0501079_0238268 | |||
| 1757 | Ga0501079_0292414 | |||
| 1758 | Ga0501080_0016996 | |||
| 1759 | Ga0501080_0044197 | |||
| 1760 | Ga0501080_0048945 | |||
| 1761 | Ga0501080_0083929 | |||
| 1762 | Ga0501081_0043469 | |||
| 1763 | Ga0501081_0442164 | |||
| 1764 | Ga0501083_0002282 | |||
| 1765 | Ga0501083_0022883 | |||
| 1766 | Ga0501035_0022438 | |||
| 1767 | Ga0501045_0012614 | |||
| 1768 | nmdc:mga05p37_263018_c1 | |||
| 1769 | nmdc:mga05p37_623185_c1 | |||
| 1770 | nmdc:mga09592_1059572_c1 | |||
| 1771 | nmdc:mga09592_1078272_c1 | |||
| 1772 | nmdc:mga0n895_30400_c1 | |||
| 1773 | nmdc:mga0rr50_463871_c1 | |||
| 1774 | nmdc:mga08x19_451609_c1 | |||
| 1775 | nmdc:mga0a205_1058725_c1 | |||
| 1776 | nmdc:mga0a205_33243_c1 | |||
| 1777 | Ga0495601_0011114 | |||
| 1778 | Ga0495601_0055787 | |||
| 1779 | Ga0495601_0257813 | |||
| 1780 | Ga0495601_0660532 | |||
| 1781 | Ga0495612_0013908 | |||
| 1782 | Ga0495612_0020760 | |||
| 1783 | Ga0495612_0021274 | |||
| 1784 | Ga0495595_0139426 | |||
| 1785 | Ga0495619_0027310 | |||
| 1786 | Ga0495619_0029886 | |||
| 1787 | Ga0495619_0051672 | |||
| 1788 | Ga0495619_0167405 | |||
| 1789 | Ga0495619_0399513 | |||
| 1790 | Ga0495619_0794904 | |||
| 1791 | Ga0500566_0388311 | |||
| 1792 | Ga0501084_0000569 | |||
| 1793 | Ga0501084_0241425 | |||
| 1794 | Ga0501082_0031277 | |||
| 1795 | Ga0501082_0217041 | |||
| 1796 | Ga0501082_0477201 | |||
| 1797 | Ga0466962_0005742 | |||
| 1798 | Ga0466962_0007194 | |||
| 1799 | Ga0466962_0009676 | |||
| 1800 | Ga0466962_0015579 | |||
| 1801 | Ga0466962_0022520 | |||
| 1802 | Ga0466962_0200358 | |||
| 1803 | Ga0466962_0432186 | |||
| 1804 | Ga0466962_0547586 | |||
| 1805 | Ga0530510_0003344 | |||
| 1806 | Ga0530510_0275609 | |||
| 1807 | Ga0530510_0549386 | |||
| 1808 | Ga0530510_0648588 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7tea-assembly2.cif.gz_C | crystal structure of s. aureus glnr-dna complex | 0.9649 | 1 | 73 |
| 2dg6-assembly1.cif.gz_A-2 | crystal structure of the putative transcriptional regulator sco5550 from streptomyces coelicolor a3(2) | 0.9521 | 7 | 73 |
| 4r4e-assembly1.cif.gz_B | structure of glnr-dna complex | 0.9513 | 3 | 77 |
| 7tec-assembly1.cif.gz_A-2 | structure of the listeria monocytogenes glnr-dna complex to 3.45 angstrom | 0.939 | 4 | 68 |
| 4r24-assembly1.cif.gz_B | complete dissection of b. subtilis nitrogen homeostatic circuitry | 0.9388 | 3 | 83 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06302_4_79_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.952 | 3 | 72 | 1.10.1660.10 |
| af_P33358_1_73_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9478 | 7 | 74 | 1.10.1660.10 |
| af_P9WME7_10_96_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9312 | 7 | 69 | 1.10.1660.10 |
| 4r22B00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.93 | 3 | 81 | 1.10.1660.10 |
| 4r4eA00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9248 | 3 | 78 | 1.10.1660.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X0X5I0-F1-model_v4 | HTH merR-type domain-containing protein | 0.9866 | 2 | 73 |
GO:0003677
GO:0003700 |
| AF-A0A1Q3TSJ7-F1-model_v4 | HTH merR-type domain-containing protein | 0.9857 | 3 | 82 |
GO:0003677
GO:0003700 |
| AF-A0A2W4N5C0-F1-model_v4 | MerR family transcriptional regulator | 0.9842 | 1 | 78 |
GO:0003677
GO:0003700 |
| AF-A0A535J6Q8-F1-model_v4 | MerR family transcriptional regulator | 0.983 | 3 | 81 |
GO:0003677
GO:0003700 |
| AF-A0A7X9PC67-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9818 | 2 | 90 |
GO:0003677
GO:0003700 |