F485288

General Info

Members Datasets Scaffolds Average Seq Length
904 361 1808 115

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0059549|Ga0466969_0059549_928_1290
Length 106
Sequence MDDRPIYMISVAADLVGMHPQTLRMYEAKGLIRPQRTPGGTRLYSEADIERLRIVQRLTTELGLNLAGVELVLRLEDELRKAHAQVERLQRRDLVVYREERHPERA

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
167 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
168 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
169 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
170 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
171 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
172 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
175 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
178 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
198 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
215 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
216 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
217 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
218 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
219 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
220 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
221 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
222 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
223 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
226 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
227 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
228 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
229 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
230 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
231 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
232 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
237 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
238 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
239 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
240 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
241 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
258 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
259 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
260 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
264 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
267 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
268 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
269 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
276 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
277 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
278 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
284 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
316 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
331 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
332 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
333 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
334 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
335 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
336 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
337 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
338 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
339 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
340 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
341 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
342 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
343 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
344 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
348 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
351 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
352 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
353 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
354 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
355 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
356 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
357 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
358 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
361 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 8.19
Rhizosphere 90.38
Stem 0
Stem Tuber 0
Unclassified 5.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0059549 3300044656 Bacteria 1857
2 JGI24742J22300_10002407 3300002244 Bacteria 2997
3 Ga0070658_10016087 3300005327 Bacteria 5983
4 Ga0070658_10062834 3300005327 Bacteria 3026
5 Ga0070658_11169599 3300005327 Bacteria 669
6 Ga0070683_100796345 3300005329 Bacteria 906
7 Ga0070683_100957300 3300005329 Bacteria 821
8 Ga0068869_100659207 3300005334 Bacteria 889
9 Ga0070666_10264481 3300005335 Bacteria 1220
10 Ga0070680_100065367 3300005336 Bacteria 2981
11 Ga0070680_100206596 3300005336 Bacteria 1656
12 Ga0070680_100236457 3300005336 Bacteria 1543
13 Ga0070680_100311063 3300005336 Bacteria 1337
14 Ga0070680_100361888 3300005336 Bacteria 1234
15 Ga0070680_100518305 3300005336 Bacteria 1020
16 Ga0070682_100106780 3300005337 Bacteria 1858
17 Ga0070682_100164915 3300005337 Bacteria 1534
18 Ga0070682_100200074 3300005337 Bacteria 1408
19 Ga0068868_100117788 3300005338 Bacteria 2164
20 Ga0070660_100024469 3300005339 Bacteria 4478
21 Ga0070660_100045564 3300005339 Bacteria 3358
22 Ga0070660_100054273 3300005339 Bacteria 3094
23 Ga0070660_101121955 3300005339 Bacteria 666
24 Ga0070660_101250510 3300005339 Bacteria 630
25 Ga0070689_100137086 3300005340 Bacteria 1966
26 Ga0070692_10034327 3300005345 Bacteria 2562
27 Ga0070668_100228289 3300005347 Bacteria 1538
28 Ga0070669_100135350 3300005353 Bacteria 1895
29 Ga0070675_100109097 3300005354 Bacteria 2339
30 Ga0070675_100121365 3300005354 Bacteria 2221
31 Ga0070675_100856491 3300005354 Bacteria 832
32 Ga0070671_100109774 3300005355 Bacteria 2317
33 Ga0070671_100176914 3300005355 Bacteria 1806
34 Ga0070674_100114732 3300005356 Bacteria 1984
35 Ga0070673_100069209 3300005364 Bacteria 2828
36 Ga0070673_100563624 3300005364 Bacteria 1036
37 Ga0070688_100008913 3300005365 Bacteria 5463
38 Ga0070659_100018012 3300005366 Bacteria 5325
39 Ga0070659_100120401 3300005366 Bacteria 2125
40 Ga0070659_100464052 3300005366 Bacteria 1076
41 Ga0070667_102228794 3300005367 Unclassified 516
42 Ga0070703_10011287 3300005406 Bacteria 2522
43 Ga0070709_10006375 3300005434 Bacteria 6426
44 Ga0070709_10422785 3300005434 Bacteria 999
45 Ga0070709_10578359 3300005434 Bacteria 862
46 Ga0070714_100039545 3300005435 Bacteria 3971
47 Ga0070714_100047946 3300005435 Bacteria 3631
48 Ga0070714_100052104 3300005435 Bacteria 3490
49 Ga0070714_100052804 3300005435 Bacteria 3468
50 Ga0070714_100102045 3300005435 Bacteria 2529
51 Ga0070714_100147764 3300005435 Bacteria 2115
52 Ga0070714_100343059 3300005435 Bacteria 1401
53 Ga0070714_100359820 3300005435 Bacteria 1368
54 Ga0070714_100477902 3300005435 Bacteria 1186
55 Ga0070714_101378043 3300005435 Unclassified 689
56 Ga0070713_100138473 3300005436 Bacteria 2153
57 Ga0070713_100163370 3300005436 Bacteria 1989
58 Ga0070713_100734136 3300005436 Bacteria 944
59 Ga0070713_100880423 3300005436 Bacteria 861
60 Ga0070713_101251328 3300005436 Bacteria 719
61 Ga0070713_101983327 3300005436 Bacteria 565
62 Ga0070710_11244088 3300005437 Bacteria 552
63 Ga0070701_10000667 3300005438 Bacteria 12056
64 Ga0070701_11412199 3300005438 Unclassified 501
65 Ga0070711_100001144 3300005439 Bacteria 14228
66 Ga0070711_100595194 3300005439 Bacteria 922
67 Ga0070705_100101662 3300005440 Bacteria 1816
68 Ga0070700_100018297 3300005441 Bacteria 4026
69 Ga0070700_101088827 3300005441 Bacteria 662
70 Ga0070694_100014942 3300005444 Bacteria 4864
71 Ga0070663_100020799 3300005455 Bacteria 4350
72 Ga0070678_100071583 3300005456 Bacteria 2596
73 Ga0070678_100101832 3300005456 Bacteria 2227
74 Ga0070662_100441605 3300005457 Bacteria 1079
75 Ga0070681_10013533 3300005458 Bacteria 8112
76 Ga0070681_10067782 3300005458 Bacteria 3536
77 Ga0070681_10073300 3300005458 Bacteria 3385
78 Ga0070681_10105236 3300005458 Bacteria 2764
79 Ga0070681_10148138 3300005458 Bacteria 2275
80 Ga0070681_10263444 3300005458 Bacteria 1635
81 Ga0068867_100007911 3300005459 Bacteria 7510
82 Ga0068867_100205482 3300005459 Bacteria 1579
83 Ga0070685_10005085 3300005466 Bacteria 6671
84 Ga0070685_10165760 3300005466 Bacteria 1412
85 Ga0070685_11174186 3300005466 Bacteria 582
86 Ga0070706_101314748 3300005467 Bacteria 663
87 Ga0070707_100048190 3300005468 Bacteria 4081
88 Ga0070707_101011800 3300005468 Bacteria 796
89 Ga0070707_101148774 3300005468 Bacteria 743
90 Ga0070698_100022593 3300005471 Bacteria 6579
91 Ga0070698_100172630 3300005471 Bacteria 2102
92 Ga0070698_100277511 3300005471 Bacteria 1608
93 Ga0070698_100298139 3300005471 Bacteria 1543
94 Ga0070698_100342405 3300005471 Bacteria 1426
95 Ga0070698_101802477 3300005471 Bacteria 565
96 Ga0070699_100192797 3300005518 Bacteria 1811
97 Ga0070699_100506653 3300005518 Bacteria 1097
98 Ga0070699_101204270 3300005518 Unclassified 695
99 Ga0070679_100022641 3300005530 Bacteria 6143
100 Ga0070679_100036849 3300005530 Bacteria 4855
101 Ga0070679_100078366 3300005530 Bacteria 3293
102 Ga0070679_100084717 3300005530 Bacteria 3157
103 Ga0070679_100094397 3300005530 Bacteria 2978
104 Ga0070679_100125431 3300005530 Bacteria 2550
105 Ga0070679_100851717 3300005530 Bacteria 855
106 Ga0070684_100078419 3300005535 Bacteria 2919
107 Ga0070684_100105782 3300005535 Bacteria 2518
108 Ga0070684_101506609 3300005535 Bacteria 634
109 Ga0068853_100011697 3300005539 Bacteria 7132
110 Ga0070672_100078149 3300005543 Bacteria 2647
111 Ga0070672_100176064 3300005543 Bacteria 1781
112 Ga0070672_101281937 3300005543 Bacteria 654
113 Ga0070686_100009622 3300005544 Bacteria 5434
114 Ga0070695_100000005 3300005545 Bacteria 97484
115 Ga0070696_100203246 3300005546 Bacteria 1480
116 Ga0070696_100438317 3300005546 Bacteria 1029
117 Ga0070693_100031252 3300005547 Bacteria 2917
118 Ga0070693_100041697 3300005547 Bacteria 2583
119 Ga0070693_100210712 3300005547 Bacteria 1268
120 Ga0070665_100347398 3300005548 Bacteria 1488
121 Ga0070665_100437539 3300005548 Bacteria 1317
122 Ga0070704_100011254 3300005549 Bacteria 5477
123 Ga0070704_100754504 3300005549 Bacteria 867
124 Ga0070704_100934571 3300005549 Bacteria 781
125 Ga0068855_100155542 3300005563 Bacteria 2598
126 Ga0068855_100328463 3300005563 Bacteria 1689
127 Ga0068855_100369478 3300005563 Bacteria 1577
128 Ga0068855_100504358 3300005563 Bacteria 1314
129 Ga0068855_101451379 3300005563 Bacteria 706
130 Ga0068854_100424363 3300005578 Bacteria 1105
131 Ga0068856_100006244 3300005614 Bacteria 11694
132 Ga0068856_100140383 3300005614 Bacteria 2423
133 Ga0068856_100172951 3300005614 Bacteria 2172
134 Ga0070702_100004914 3300005615 Bacteria 6161
135 Ga0070702_100148742 3300005615 Bacteria 1501
136 Ga0070702_100739960 3300005615 Bacteria 754
137 Ga0070702_100792425 3300005615 Bacteria 732
138 Ga0068852_100061014 3300005616 Bacteria 3276
139 Ga0068852_100265713 3300005616 Bacteria 1649
140 Ga0068852_101179519 3300005616 Bacteria 787
141 Ga0068859_100392405 3300005617 Bacteria 1484
142 Ga0068866_10057482 3300005718 Bacteria 2005
143 Ga0068861_101312358 3300005719 Bacteria 704
144 Ga0068870_10464612 3300005840 Bacteria 837
145 Ga0068863_100658592 3300005841 Bacteria 1039
146 Ga0068858_100778311 3300005842 Bacteria 933
147 Ga0070717_10016628 3300006028 Bacteria 5708
148 Ga0070717_10074728 3300006028 Bacteria 2833
149 Ga0070717_10087186 3300006028 Bacteria 2628
150 Ga0070717_10310749 3300006028 Bacteria 1403
151 Ga0070717_11180662 3300006028 Bacteria 697
152 Ga0070716_100427209 3300006173 Bacteria 960
153 Ga0070716_101261597 3300006173 Bacteria 596
154 Ga0070712_100002015 3300006175 Bacteria 12440
155 Ga0070712_101703875 3300006175 Bacteria 552
156 Ga0097621_100436935 3300006237 Bacteria 1177
157 Ga0068871_100012901 3300006358 Bacteria 6188
158 Ga0075428_101479133 3300006844 Bacteria 712
159 Ga0075433_11412755 3300006852 Bacteria 602
160 Ga0075434_100035672 3300006871 Bacteria 4916
161 Ga0068865_100007640 3300006881 Bacteria 6658
162 Ga0068865_100687395 3300006881 Bacteria 873
163 Ga0075436_100167748 3300006914 Bacteria 1550
164 Ga0097620_100392396 3300006931 Bacteria 1484
165 Ga0105240_10010198 3300009093 Bacteria 13222
166 Ga0105240_10274583 3300009093 Bacteria 1939
167 Ga0105245_10323422 3300009098 Bacteria 1520
168 Ga0105245_10468511 3300009098 Bacteria 1271
169 Ga0105245_10558588 3300009098 Unclassified 1167
170 Ga0105245_11602609 3300009098 Bacteria 703
171 Ga0114129_10114471 3300009147 Bacteria 3719
172 Ga0114129_10861051 3300009147 Bacteria 1151
173 Ga0114129_11970333 3300009147 Bacteria 707
174 Ga0105243_10122570 3300009148 Bacteria 2194
175 Ga0105243_10382603 3300009148 Bacteria 1302
176 Ga0105241_11339273 3300009174 Bacteria 683
177 Ga0105242_10015971 3300009176 Bacteria 5834
178 Ga0105242_11563734 3300009176 Bacteria 692
179 Ga0105248_10006882 3300009177 Bacteria 12462
180 Ga0105248_10101951 3300009177 Bacteria 3235
181 Ga0105237_10270186 3300009545 Bacteria 1703
182 Ga0105237_11161570 3300009545 Bacteria 779
183 Ga0105238_10256924 3300009551 Bacteria 1726
184 Ga0105238_10917425 3300009551 Bacteria 895
185 Ga0105249_10013630 3300009553 Bacteria 7178
186 Ga0105239_10046172 3300010375 Bacteria 4773
187 Ga0105239_11238522 3300010375 Bacteria 860
188 Ga0105246_10062625 3300011119 Bacteria 2592
189 Ga0105246_11922462 3300011119 Bacteria 569
190 Ga0157373_10424328 3300013100 Bacteria 955
191 Ga0157373_10952599 3300013100 Bacteria 639
192 Ga0157373_11588498 3300013100 Unclassified 501
193 Ga0157371_10269498 3300013102 Unclassified 1228
194 Ga0157371_10295775 3300013102 Bacteria 1171
195 Ga0157371_10440678 3300013102 Bacteria 957
196 Ga0157371_10781992 3300013102 Bacteria 718
197 Ga0157370_10056793 3300013104 Bacteria 3724
198 Ga0157370_10082250 3300013104 Bacteria 3029
199 Ga0157370_10745445 3300013104 Bacteria 892
200 Ga0157369_10004869 3300013105 Bacteria 15753
201 Ga0157369_10121772 3300013105 Bacteria 2767
202 Ga0157369_10348925 3300013105 Bacteria 1537
203 Ga0157369_10393652 3300013105 Bacteria 1437
204 Ga0157369_10981899 3300013105 Bacteria 865
205 Ga0157374_10019190 3300013296 Bacteria 6049
206 Ga0157378_10028875 3300013297 Bacteria 4896
207 Ga0163162_10012762 3300013306 Bacteria 8206
208 Ga0157372_10369472 3300013307 Bacteria 1671
209 Ga0157372_10372559 3300013307 Bacteria 1664
210 Ga0157372_10495726 3300013307 Bacteria 1424
211 Ga0157372_10813164 3300013307 Unclassified 1085
212 Ga0157372_11731736 3300013307 Bacteria 719
213 Ga0157375_10063681 3300013308 Bacteria 3670
214 Ga0163163_10413047 3300014325 Bacteria 1408
215 Ga0157380_10097954 3300014326 Bacteria 2435
216 Ga0157380_10439445 3300014326 Bacteria 1250
217 Ga0182008_10045355 3300014497 Bacteria 2186
218 Ga0182008_10156198 3300014497 Bacteria 1146
219 Ga0182008_10215678 3300014497 Bacteria 981
220 Ga0182008_10636851 3300014497 Unclassified 602
221 Ga0157377_10005058 3300014745 Bacteria 6157
222 Ga0157377_10207614 3300014745 Bacteria 1247
223 Ga0157377_10310866 3300014745 Bacteria 1044
224 Ga0157379_10716874 3300014968 Bacteria 940
225 Ga0157376_10171391 3300014969 Bacteria 1977
226 Ga0157376_10186284 3300014969 Bacteria 1900
227 Ga0182007_10275842 3300015262 Unclassified 610
228 Ga0197907_10050932 3300020069 Bacteria 534
229 Ga0206356_10299671 3300020070 Bacteria 2542
230 Ga0206356_10582843 3300020070 Unclassified 786
231 Ga0206352_10068530 3300020078 Unclassified 558
232 Ga0206353_10109980 3300020082 Bacteria 746
233 Ga0213871_10018698 3300021441 Bacteria 1698
234 Ga0224712_10016639 3300022467 Bacteria 2421
235 Ga0224712_10035711 3300022467 Unclassified 1836
236 Ga0224712_10041278 3300022467 Bacteria 1741
237 Ga0224712_10210951 3300022467 Unclassified 886
238 Ga0207656_10405025 3300025321 Bacteria 686
239 Ga0207653_10013144 3300025885 Bacteria 2591
240 Ga0207692_10233232 3300025898 Bacteria 1096
241 Ga0207692_10406766 3300025898 Bacteria 850
242 Ga0207642_10015885 3300025899 Bacteria 2820
243 Ga0207680_10564234 3300025903 Bacteria 813
244 Ga0207647_10092471 3300025904 Bacteria 1803
245 Ga0207685_10414717 3300025905 Bacteria 693
246 Ga0207699_10048632 3300025906 Bacteria 2492
247 Ga0207699_10064031 3300025906 Bacteria 2223
248 Ga0207699_10262767 3300025906 Bacteria 1194
249 Ga0207699_10430105 3300025906 Bacteria 944
250 Ga0207705_10121664 3300025909 Bacteria 1937
251 Ga0207705_10129895 3300025909 Bacteria 1874
252 Ga0207705_10809109 3300025909 Bacteria 727
253 Ga0207684_11152806 3300025910 Bacteria 643
254 Ga0207707_10079405 3300025912 Bacteria 2865
255 Ga0207707_10116132 3300025912 Bacteria 2339
256 Ga0207707_10205268 3300025912 Bacteria 1717
257 Ga0207707_10224658 3300025912 Bacteria 1634
258 Ga0207707_10258877 3300025912 Bacteria 1510
259 Ga0207707_10282621 3300025912 Bacteria 1437
260 Ga0207707_10762766 3300025912 Unclassified 808
261 Ga0207707_11222234 3300025912 Bacteria 607
262 Ga0207695_10092844 3300025913 Bacteria 3028
263 Ga0207695_10730837 3300025913 Bacteria 870
264 Ga0207671_10183731 3300025914 Bacteria 1628
265 Ga0207693_10001754 3300025915 Bacteria 19046
266 Ga0207693_10346208 3300025915 Bacteria 1163
267 Ga0207663_10009432 3300025916 Bacteria 5154
268 Ga0207663_10355124 3300025916 Bacteria 1111
269 Ga0207663_10405215 3300025916 Bacteria 1044
270 Ga0207660_10074492 3300025917 Bacteria 2478
271 Ga0207660_10298754 3300025917 Bacteria 1282
272 Ga0207660_11294330 3300025917 Bacteria 592
273 Ga0207657_10021891 3300025919 Bacteria 6003
274 Ga0207657_10028683 3300025919 Bacteria 5072
275 Ga0207657_10030731 3300025919 Bacteria 4872
276 Ga0207657_10039137 3300025919 Bacteria 4215
277 Ga0207657_10476174 3300025919 Bacteria 979
278 Ga0207649_10798110 3300025920 Unclassified 737
279 Ga0207649_11444521 3300025920 Bacteria 544
280 Ga0207652_10028722 3300025921 Bacteria 4643
281 Ga0207652_10076097 3300025921 Bacteria 2926
282 Ga0207652_10112530 3300025921 Bacteria 2416
283 Ga0207652_10239879 3300025921 Bacteria 1634
284 Ga0207652_10503411 3300025921 Bacteria 1090
285 Ga0207652_11289197 3300025921 Bacteria 633
286 Ga0207652_11845839 3300025921 Unclassified 510
287 Ga0207646_10002790 3300025922 Bacteria 20372
288 Ga0207681_10146095 3300025923 Bacteria 1767
289 Ga0207659_10742969 3300025926 Bacteria 841
290 Ga0207687_10273211 3300025927 Bacteria 1352
291 Ga0207687_10451001 3300025927 Bacteria 1067
292 Ga0207700_10130803 3300025928 Bacteria 2049
293 Ga0207700_10139996 3300025928 Bacteria 1987
294 Ga0207700_10214100 3300025928 Bacteria 1630
295 Ga0207700_10699629 3300025928 Bacteria 905
296 Ga0207664_10006659 3300025929 Bacteria 7963
297 Ga0207664_10063736 3300025929 Bacteria 2946
298 Ga0207664_10067502 3300025929 Bacteria 2870
299 Ga0207664_10080313 3300025929 Bacteria 2650
300 Ga0207664_10117624 3300025929 Bacteria 2219
301 Ga0207664_10487797 3300025929 Bacteria 1103
302 Ga0207664_10590437 3300025929 Bacteria 997
303 Ga0207664_10680341 3300025929 Bacteria 925
304 Ga0207664_11606330 3300025929 Bacteria 572
305 Ga0207644_10106716 3300025931 Bacteria 2112
306 Ga0207690_10207563 3300025932 Bacteria 1492
307 Ga0207690_10339600 3300025932 Bacteria 1185
308 Ga0207706_10138511 3300025933 Bacteria 2140
309 Ga0207686_10258507 3300025934 Bacteria 1275
310 Ga0207709_10007985 3300025935 Bacteria 5860
311 Ga0207670_10214215 3300025936 Bacteria 1471
312 Ga0207669_10003162 3300025937 Bacteria 7104
313 Ga0207669_10837368 3300025937 Unclassified 765
314 Ga0207704_10564057 3300025938 Bacteria 927
315 Ga0207665_10674103 3300025939 Bacteria 812
316 Ga0207665_11472955 3300025939 Bacteria 541
317 Ga0207691_10015425 3300025940 Bacteria 7267
318 Ga0207691_10114872 3300025940 Bacteria 2391
319 Ga0207661_10180752 3300025944 Bacteria 1842
320 Ga0207661_10300625 3300025944 Bacteria 1439
321 Ga0207661_10863549 3300025944 Bacteria 833
322 Ga0207679_10209244 3300025945 Bacteria 1635
323 Ga0207667_10222762 3300025949 Bacteria 1932
324 Ga0207667_12234204 3300025949 Bacteria 504
325 Ga0207651_10088819 3300025960 Bacteria 2254
326 Ga0207712_10014470 3300025961 Bacteria 5077
327 Ga0207668_10021394 3300025972 Bacteria 4125
328 Ga0207640_10412063 3300025981 Bacteria 1103
329 Ga0207640_10527980 3300025981 Unclassified 988
330 Ga0207677_10615877 3300026023 Bacteria 954
331 Ga0207677_11254204 3300026023 Bacteria 680
332 Ga0207703_10802658 3300026035 Bacteria 898
333 Ga0207639_10021934 3300026041 Bacteria 4593
334 Ga0207678_10026059 3300026067 Bacteria 5101
335 Ga0207708_10004755 3300026075 Bacteria 9992
336 Ga0207708_10650794 3300026075 Unclassified 897
337 Ga0207702_10082862 3300026078 Bacteria 2789
338 Ga0207702_10153196 3300026078 Bacteria 2099
339 Ga0207641_10303411 3300026088 Bacteria 1509
340 Ga0207648_10000150 3300026089 Bacteria 70019
341 Ga0207648_10095540 3300026089 Bacteria 2600
342 Ga0207676_11764589 3300026095 Bacteria 617
343 Ga0207674_10545665 3300026116 Bacteria 1120
344 Ga0207675_100033801 3300026118 Bacteria 4765
345 Ga0207683_10000131 3300026121 Bacteria 61423
346 Ga0207683_10207959 3300026121 Bacteria 1780
347 Ga0207698_10309512 3300026142 Unclassified 1474
348 Ga0207698_10466409 3300026142 Bacteria 1222
349 Ga0207698_12469730 3300026142 Bacteria 530
350 Ga0268266_10024942 3300028379 Bacteria 5088
351 Ga0268266_10377332 3300028379 Bacteria 1337
352 Ga0268265_12445083 3300028380 Bacteria 529
353 Ga0268264_10093608 3300028381 Bacteria 2596
354 Ga0265337_1021347 3300028556 Bacteria 2019
355 Ga0265337_1062938 3300028556 Bacteria 1026
356 Ga0265337_1073858 3300028556 Bacteria 936
357 Ga0265319_1008248 3300028563 Bacteria 4585
358 Ga0265319_1051260 3300028563 Bacteria 1361
359 Ga0265334_10064105 3300028573 Bacteria 1380
360 Ga0265334_10108144 3300028573 Bacteria 1001
361 Ga0265318_10002863 3300028577 Bacteria 8999
362 Ga0265318_10066773 3300028577 Bacteria 1336
363 Ga0265323_10031089 3300028653 Bacteria 1986
364 Ga0265322_10003718 3300028654 Bacteria 4593
365 Ga0265322_10052505 3300028654 Bacteria 1157
366 Ga0265322_10072007 3300028654 Bacteria 981
367 Ga0265322_10136571 3300028654 Bacteria 700
368 Ga0265336_10002725 3300028666 Bacteria 7148
369 Ga0265336_10088273 3300028666 Bacteria 924
370 Ga0265338_10001061 3300028800 Bacteria 45726
371 Ga0265338_10002640 3300028800 Bacteria 26412
372 Ga0265338_10012416 3300028800 Bacteria 9712
373 Ga0265338_10048855 3300028800 Bacteria 3843
374 Ga0265338_10107316 3300028800 Bacteria 2258
375 Ga0265324_10019591 3300029957 Bacteria 2435
376 Ga0265324_10075388 3300029957 Unclassified 1148
377 Ga0265330_10014792 3300031235 Bacteria 3619
378 Ga0265330_10043846 3300031235 Bacteria 1977
379 Ga0265330_10096428 3300031235 Bacteria 1267
380 Ga0265332_10132480 3300031238 Bacteria 1045
381 Ga0265328_10019588 3300031239 Bacteria 2596
382 Ga0265320_10025091 3300031240 Bacteria 3140
383 Ga0265320_10053501 3300031240 Bacteria 1951
384 Ga0265320_10063568 3300031240 Bacteria 1755
385 Ga0265320_10065597 3300031240 Bacteria 1722
386 Ga0265320_10123093 3300031240 Bacteria 1182
387 Ga0265320_10374860 3300031240 Bacteria 629
388 Ga0265325_10034373 3300031241 Bacteria 2697
389 Ga0265325_10045008 3300031241 Bacteria 2295
390 Ga0265329_10009741 3300031242 Bacteria 3562
391 Ga0265329_10016825 3300031242 Bacteria 2528
392 Ga0265340_10010723 3300031247 Bacteria 4896
393 Ga0265340_10095441 3300031247 Bacteria 1386
394 Ga0265339_10014232 3300031249 Bacteria 4799
395 Ga0265339_10095377 3300031249 Bacteria 1554
396 Ga0265331_10110303 3300031250 Bacteria 1262
397 Ga0265331_10428710 3300031250 Bacteria 594
398 Ga0265327_10052022 3300031251 Bacteria 2134
399 Ga0265327_10440031 3300031251 Bacteria 564
400 Ga0265316_10015338 3300031344 Bacteria 6703
401 Ga0265316_10094514 3300031344 Bacteria 2277
402 Ga0265316_10400827 3300031344 Bacteria 988
403 Ga0265316_10679332 3300031344 Bacteria 727
404 Ga0307408_100629491 3300031548 Bacteria 957
405 Ga0307408_101330340 3300031548 Bacteria 674
406 Ga0265313_10028474 3300031595 Bacteria 2902
407 Ga0265313_10088232 3300031595 Bacteria 1397
408 Ga0265313_10110302 3300031595 Bacteria 1210
409 Ga0265314_10012572 3300031711 Bacteria 6895
410 Ga0265314_10031647 3300031711 Bacteria 3901
411 Ga0265314_10657956 3300031711 Bacteria 534
412 Ga0265342_10035672 3300031712 Bacteria 3043
413 Ga0265342_10219956 3300031712 Bacteria 1023
414 Ga0265342_10274112 3300031712 Bacteria 895
415 Ga0265342_10303057 3300031712 Bacteria 841
416 Ga0307405_11140255 3300031731 Bacteria 672
417 Ga0307406_11791649 3300031901 Unclassified 546
418 Ga0307409_100160605 3300031995 Bacteria 1965
419 Ga0307409_100660154 3300031995 Bacteria 1041
420 Ga0307409_101519549 3300031995 Bacteria 697
421 Ga0307409_102282301 3300031995 Bacteria 570
422 Ga0307416_100405156 3300032002 Bacteria 1403
423 Ga0307416_100865999 3300032002 Bacteria 1002
424 Ga0307415_100089435 3300032126 Bacteria 2224
425 Ga0316583_10055375 3300032133 Bacteria 1395
426 Ga0373945_0013400 3300035116 Bacteria 2735
427 Ga0373945_0283195 3300035116 Bacteria 707
428 Ga0373957_0062287 3300035120 Bacteria 1447
429 Ga0373957_0071852 3300035120 Unclassified 1355
430 Ga0373960_0382516 3300035121 Bacteria 540
431 Ga0373943_0000443 3300035170 Bacteria 17555
432 Ga0373946_0029789 3300035171 Bacteria 2175
433 Ga0373946_0217564 3300035171 Unclassified 921
434 Ga0373942_0098421 3300035207 Bacteria 891
435 Ga0373924_0111278 3300035410 Bacteria 1184
436 Ga0373935_0503240 3300035692 Unclassified 880
437 Ga0373927_0016318 3300035695 Bacteria 4901
438 Ga0373947_0006187 3300035725 Bacteria 6962
439 Ga0373937_0045765 3300036401 Bacteria 3999
440 Ga0373937_0277187 3300036401 Bacteria 1583
441 Ga0373925_0000484 3300037068 Bacteria 39880
442 Ga0395899_0105798 3300037312 Bacteria 2026
443 Ga0395899_0225031 3300037312 Bacteria 1298
444 Ga0395900_0128550 3300037418 Bacteria 2597
445 Ga0395900_0399930 3300037418 Bacteria 1338
446 Ga0395900_0492011 3300037418 Bacteria 1178
447 Ga0395900_0751939 3300037418 Bacteria 905
448 Ga0395900_0943507 3300037418 Bacteria 784
449 Ga0395898_0190567 3300037466 Bacteria 1959
450 Ga0395898_0231215 3300037466 Bacteria 1763
451 Ga0395898_0358584 3300037466 Bacteria 1390
452 Ga0395898_0652838 3300037466 Bacteria 994
453 Ga0395898_1372905 3300037466 Bacteria 635
454 Ga0395905_0594755 3300037471 Bacteria 1008
455 Ga0395905_0769866 3300037471 Unclassified 865
456 Ga0395901_0216662 3300038443 Bacteria 2002
457 Ga0395901_0336003 3300038443 Bacteria 1561
458 Ga0395901_0991855 3300038443 Bacteria 816
459 Ga0436365_1081831 3300039437 Bacteria 911
460 Ga0439461_0004684 3300041410 Bacteria 2296
461 Ga0451787_752081 3300041441 Bacteria 519
462 Ga0451800_1256723 3300041459 Unclassified 630
463 Ga0451800_1606387 3300041459 Unclassified 697
464 Ga0451807_1530868 3300041486 Bacteria 1107
465 Ga0451835_0189308 3300041492 Bacteria 614
466 Ga0451835_1052634 3300041492 Bacteria 539
467 Ga0451835_1181250 3300041492 Bacteria 1042
468 Ga0451841_0654153 3300041498 Bacteria 615
469 Ga0451849_1110976 3300041505 Unclassified 785
470 Ga0451849_1121762 3300041505 Unclassified 548
471 Ga0451849_1517115 3300041505 Bacteria 1026
472 Ga0451851_1046935 3300041507 Bacteria 1517
473 Ga0451843_0324014 3300041509 Bacteria 1648
474 Ga0451855_1001223 3300041511 Bacteria 1077
475 Ga0451853_2833846 3300041512 Unclassified 727
476 Ga0439433_0073916 3300041999 Bacteria 823
477 Ga0439441_077168 3300042001 Unclassified 721
478 Ga0439445_0149537 3300042004 Bacteria 679
479 Ga0450920_007359 3300042122 Bacteria 1995
480 Ga0450920_040731 3300042122 Bacteria 926
481 Ga0450907_008091 3300042146 Bacteria 1750
482 Ga0439446_0119725 3300042156 Bacteria 846
483 Ga0439434_0127006 3300042435 Bacteria 835
484 Ga0450918_015465 3300042531 Bacteria 1327
485 Ga0466969_0047639 3300044656 Bacteria 2121
486 Ga0466969_0123336 3300044656 Bacteria 1205
487 Ga0466965_0051675 3300044683 Bacteria 2039
488 Ga0466965_0077300 3300044683 Bacteria 1681
489 Ga0466965_0156798 3300044683 Bacteria 1192
490 Ga0466966_0087961 3300044684 Bacteria 1931
491 Ga0466966_0110986 3300044684 Bacteria 1690
492 Ga0466961_0003717 3300044693 Bacteria 9527
493 Ga0466961_0009997 3300044693 Bacteria 6046
494 Ga0466961_0027078 3300044693 Bacteria 3685
495 Ga0466961_0158133 3300044693 Bacteria 1413
496 Ga0466961_0267367 3300044693 Bacteria 1048
497 Ga0466963_0000045 3300044694 Bacteria 40813
498 Ga0466963_0001615 3300044694 Bacteria 12253
499 Ga0466963_0002571 3300044694 Bacteria 10182
500 Ga0466963_0003847 3300044694 Bacteria 8658
501 Ga0466963_0009695 3300044694 Bacteria 5808
502 Ga0466963_0017987 3300044694 Bacteria 4410
503 Ga0466963_0025483 3300044694 Bacteria 3772
504 Ga0466963_0030015 3300044694 Bacteria 3504
505 Ga0466963_0037378 3300044694 Bacteria 3169
506 Ga0466963_0038787 3300044694 Bacteria 3117
507 Ga0466963_0052242 3300044694 Bacteria 2711
508 Ga0466963_0147985 3300044694 Bacteria 1630
509 Ga0466963_0149941 3300044694 Bacteria 1619
510 Ga0466964_0001132 3300044706 Bacteria 8982
511 Ga0466964_0001184 3300044706 Bacteria 8803
512 Ga0466964_0014124 3300044706 Bacteria 3034
513 Ga0466964_0014343 3300044706 Bacteria 3013
514 Ga0466964_0019652 3300044706 Bacteria 2598
515 Ga0466964_0021999 3300044706 Bacteria 2470
516 Ga0466964_0023711 3300044706 Bacteria 2386
517 Ga0466964_0448264 3300044706 Bacteria 684
518 Ga0453684_0679587 3300044712 Bacteria 1121
519 Ga0453684_2028565 3300044712 Unclassified 579
520 Ga0466971_0001365 3300044719 Bacteria 10235
521 Ga0466971_0003490 3300044719 Bacteria 6714
522 Ga0466971_0004863 3300044719 Bacteria 5810
523 Ga0466971_0007185 3300044719 Bacteria 4848
524 Ga0466971_0012056 3300044719 Bacteria 3788
525 Ga0466971_0056029 3300044719 Bacteria 1778
526 Ga0466971_0289708 3300044719 Unclassified 785
527 Ga0466971_0401467 3300044719 Bacteria 668
528 Ga0466971_0664139 3300044719 Bacteria 522
529 Ga0466971_0686603 3300044719 Bacteria 514
530 Ga0466968_0032822 3300044735 Bacteria 2161
531 Ga0466968_0040117 3300044735 Bacteria 1973
532 Ga0466968_0093727 3300044735 Bacteria 1334
533 Ga0466968_0496878 3300044735 Bacteria 607
534 Ga0466970_0120440 3300044765 Bacteria 1437
535 Ga0466970_0339620 3300044765 Bacteria 851
536 Ga0466970_0731386 3300044765 Bacteria 578
537 Ga0466957_0003129 3300044842 Bacteria 9010
538 Ga0466957_0015028 3300044842 Bacteria 4516
539 Ga0466957_0015833 3300044842 Bacteria 4406
540 Ga0466957_0025038 3300044842 Bacteria 3535
541 Ga0466957_0084229 3300044842 Bacteria 1984
542 Ga0466957_0123661 3300044842 Bacteria 1651
543 Ga0466957_0139388 3300044842 Bacteria 1561
544 Ga0466957_0163410 3300044842 Bacteria 1447
545 Ga0466957_0176641 3300044842 Bacteria 1393
546 Ga0466957_0191817 3300044842 Unclassified 1339
547 Ga0466957_0227545 3300044842 Bacteria 1233
548 Ga0466957_0570399 3300044842 Bacteria 790
549 Ga0466960_0015978 3300044901 Bacteria 3246
550 Ga0466960_0181987 3300044901 Bacteria 1140
551 Ga0466960_0190172 3300044901 Bacteria 1117
552 Ga0466960_0319537 3300044901 Bacteria 879
553 Ga0466960_0826177 3300044901 Bacteria 562
554 Ga0466959_0002525 3300045049 Bacteria 11734
555 Ga0466959_0028529 3300045049 Bacteria 4138
556 Ga0466959_0036459 3300045049 Bacteria 3634
557 Ga0466959_0043047 3300045049 Bacteria 3330
558 Ga0466959_0080020 3300045049 Bacteria 2356
559 Ga0466959_0933594 3300045049 Bacteria 578
560 Ga0451576_1915353 3300045051 Bacteria 612
561 Ga0466958_0013689 3300045836 Bacteria 4623
562 Ga0466958_0018146 3300045836 Bacteria 4078
563 Ga0466958_0023977 3300045836 Bacteria 3587
564 Ga0466958_0026345 3300045836 Bacteria 3435
565 Ga0466958_0042066 3300045836 Bacteria 2750
566 Ga0466958_0043094 3300045836 Bacteria 2717
567 Ga0466958_0083928 3300045836 Bacteria 1964
568 Ga0466958_0146425 3300045836 Bacteria 1488
569 Ga0466958_0230704 3300045836 Bacteria 1182
570 Ga0466958_0339507 3300045836 Unclassified 966
571 Ga0466958_0391534 3300045836 Bacteria 897
572 Ga0466958_0535776 3300045836 Bacteria 760
573 Ga0466958_1060110 3300045836 Bacteria 529
574 Ga0466967_0000248 3300045976 Bacteria 23755
575 Ga0466967_0000884 3300045976 Bacteria 15971
576 Ga0466967_0014176 3300045976 Bacteria 6197
577 Ga0466967_0018918 3300045976 Bacteria 5523
578 Ga0466967_0020132 3300045976 Bacteria 5383
579 Ga0466967_0023209 3300045976 Bacteria 5080
580 Ga0466967_0035363 3300045976 Bacteria 4251
581 Ga0466967_0049540 3300045976 Bacteria 3673
582 Ga0466967_0094731 3300045976 Bacteria 2719
583 Ga0466967_0136727 3300045976 Bacteria 2279
584 Ga0466967_0182602 3300045976 Bacteria 1979
585 Ga0466967_0196775 3300045976 Bacteria 1907
586 Ga0466967_0477914 3300045976 Bacteria 1220
587 Ga0466967_0628838 3300045976 Bacteria 1061
588 Ga0466967_0634791 3300045976 Bacteria 1055
589 Ga0466967_0980098 3300045976 Bacteria 841
590 Ga0466967_1299988 3300045976 Bacteria 724
591 Ga0466967_1471635 3300045976 Bacteria 678
592 Ga0495592_0012566 3300046454 Bacteria 6434
593 Ga0495592_0100772 3300046454 Bacteria 2059
594 Ga0495592_0582740 3300046454 Bacteria 684
595 Ga0495603_0010014 3300046455 Bacteria 5735
596 Ga0495629_0036724 3300046459 Bacteria 3456
597 Ga0495629_0048221 3300046459 Bacteria 2986
598 Ga0495629_0085421 3300046459 Bacteria 2202
599 Ga0495629_0256872 3300046459 Bacteria 1201
600 Ga0495629_0502931 3300046459 Bacteria 817
601 Ga0495641_0023607 3300046461 Bacteria 3050
602 Ga0495641_0034933 3300046461 Bacteria 2373
603 Ga0495641_0057705 3300046461 Bacteria 1758
604 Ga0495641_0184890 3300046461 Bacteria 933
605 Ga0495641_0374593 3300046461 Bacteria 645
606 Ga0495651_0000080 3300046462 Bacteria 70453
607 Ga0495651_0193268 3300046462 Unclassified 1430
608 Ga0495651_0267047 3300046462 Bacteria 1162
609 Ga0495651_0930829 3300046462 Bacteria 530
610 Ga0495653_0006383 3300046463 Bacteria 9669
611 Ga0495653_0023496 3300046463 Bacteria 4978
612 Ga0495653_0172233 3300046463 Bacteria 1493
613 Ga0495580_0126898 3300046472 Bacteria 1771
614 Ga0495582_0032089 3300046473 Bacteria 2889
615 Ga0495582_0193227 3300046473 Bacteria 1162
616 Ga0495639_0000425 3300046475 Bacteria 20170
617 Ga0495639_0356952 3300046475 Bacteria 734
618 Ga0495639_0713236 3300046475 Unclassified 518
619 Ga0495662_0002534 3300046476 Bacteria 9218
620 Ga0495662_0314418 3300046476 Bacteria 770
621 Ga0495664_0003077 3300046477 Bacteria 9037
622 Ga0495664_0087924 3300046477 Bacteria 1867
623 Ga0495664_0112560 3300046477 Bacteria 1643
624 Ga0495584_0098185 3300046491 Bacteria 1480
625 Ga0495596_0023014 3300046500 Bacteria 2531
626 Ga0495596_0075365 3300046500 Bacteria 1310
627 Ga0495607_0006178 3300046501 Bacteria 8467
628 Ga0495608_0050015 3300046511 Bacteria 2774
629 Ga0495608_0062369 3300046511 Bacteria 2449
630 Ga0495608_0594582 3300046511 Bacteria 664
631 Ga0495608_0850481 3300046511 Bacteria 536
632 Ga0495618_0011918 3300046514 Bacteria 5276
633 Ga0495618_0015670 3300046514 Bacteria 4626
634 Ga0495618_0045190 3300046514 Bacteria 2778
635 Ga0495618_0156973 3300046514 Bacteria 1452
636 Ga0495618_0431424 3300046514 Bacteria 802
637 Ga0495618_0515262 3300046514 Bacteria 719
638 Ga0495628_0001647 3300046516 Bacteria 20433
639 Ga0495628_0838939 3300046516 Bacteria 641
640 Ga0495630_0001297 3300046517 Bacteria 17226
641 Ga0495630_0069425 3300046517 Bacteria 2651
642 Ga0495630_0236308 3300046517 Bacteria 1396
643 Ga0495630_0543623 3300046517 Bacteria 891
644 Ga0495630_0846306 3300046517 Bacteria 697
645 Ga0495631_0354254 3300046518 Unclassified 625
646 Ga0495644_0133090 3300046523 Bacteria 948
647 Ga0495644_0159714 3300046523 Bacteria 864
648 Ga0495663_0035081 3300046525 Bacteria 1505
649 Ga0495666_0000168 3300046526 Bacteria 27728
650 Ga0495666_0119540 3300046526 Bacteria 1235
651 Ga0495652_0017232 3300046529 Bacteria 6449
652 Ga0495652_0190715 3300046529 Bacteria 1564
653 Ga0495652_0221810 3300046529 Bacteria 1420
654 Ga0495652_0473703 3300046529 Bacteria 873
655 Ga0495652_0892937 3300046529 Bacteria 587
656 Ga0495652_1058144 3300046529 Bacteria 528
657 Ga0495665_0000038 3300046531 Bacteria 51967
658 Ga0495640_0263832 3300046533 Bacteria 1075
659 Ga0495640_0648053 3300046533 Bacteria 636
660 Ga0495586_0009342 3300046535 Bacteria 5216
661 Ga0495586_0412520 3300046535 Bacteria 777
662 Ga0495587_0000270 3300046536 Bacteria 37255
663 Ga0495587_0291067 3300046536 Bacteria 914
664 Ga0495621_0389574 3300046539 Unclassified 590
665 Ga0495645_0025737 3300046543 Bacteria 4272
666 Ga0495645_0088729 3300046543 Bacteria 2211
667 Ga0495622_0395080 3300046557 Bacteria 596
668 Ga0495667_0025477 3300046559 Bacteria 3985
669 Ga0495667_0077237 3300046559 Bacteria 2166
670 Ga0495667_0156720 3300046559 Bacteria 1465
671 Ga0495667_0241352 3300046559 Bacteria 1151
672 Ga0495634_0054491 3300046642 Bacteria 2676
673 Ga0495634_0056825 3300046642 Bacteria 2613
674 Ga0495634_0143553 3300046642 Bacteria 1514
675 Ga0495634_0231535 3300046642 Bacteria 1136
676 Ga0495635_0028984 3300046663 Bacteria 3849
677 Ga0495635_0073882 3300046663 Bacteria 2335
678 Ga0495635_0176102 3300046663 Bacteria 1454
679 Ga0495635_0458165 3300046663 Bacteria 842
680 Ga0495657_0008538 3300046675 Bacteria 7824
681 Ga0495657_0079065 3300046675 Bacteria 2130
682 Ga0495657_0162873 3300046675 Bacteria 1379
683 Ga0495599_0000142 3300046678 Bacteria 46621
684 Ga0495599_0301855 3300046678 Bacteria 966
685 Ga0495623_0021271 3300046679 Bacteria 4189
686 Ga0495623_0238450 3300046679 Bacteria 1028
687 Ga0495646_0033947 3300046680 Bacteria 3171
688 Ga0495646_0120943 3300046680 Bacteria 1482
689 Ga0495646_0274244 3300046680 Bacteria 898
690 Ga0495647_0002367 3300046681 Bacteria 5931
691 Ga0495658_0022087 3300046683 Bacteria 3362
692 Ga0495658_0025351 3300046683 Bacteria 3168
693 Ga0495658_1081977 3300046683 Bacteria 511
694 Ga0495613_0026214 3300046689 Bacteria 4342
695 Ga0495613_0332418 3300046689 Bacteria 1047
696 Ga0495613_0376133 3300046689 Bacteria 972
697 Ga0495624_0001713 3300046690 Bacteria 16756
698 Ga0495624_0486076 3300046690 Bacteria 739
699 Ga0495624_0614865 3300046690 Bacteria 647
700 Ga0495624_0627142 3300046690 Unclassified 640
701 Ga0495624_0677853 3300046690 Bacteria 612
702 Ga0495670_0474878 3300046691 Bacteria 678
703 Ga0495589_0089172 3300046794 Bacteria 1498
704 Ga0495600_0079549 3300046809 Bacteria 2140
705 Ga0495600_0395810 3300046809 Bacteria 860
706 Ga0495600_0623315 3300046809 Unclassified 654
707 Ga0495600_0888608 3300046809 Bacteria 526
708 Ga0495660_0375819 3300046810 Bacteria 627
709 Ga0495581_0003666 3300047315 Bacteria 8846
710 Ga0495604_0005999 3300047317 Bacteria 9644
711 Ga0495604_0049561 3300047317 Bacteria 3262
712 Ga0495604_0129837 3300047317 Bacteria 1813
713 Ga0495674_0006925 3300047319 Bacteria 10845
714 Ga0495674_0110144 3300047319 Bacteria 2335
715 Ga0495676_0009737 3300047321 Bacteria 8736
716 Ga0495676_0088731 3300047321 Bacteria 2318
717 Ga0495676_0099937 3300047321 Bacteria 2149
718 Ga0495676_0201702 3300047321 Bacteria 1382
719 Ga0495676_0202398 3300047321 Bacteria 1379
720 Ga0495680_0046394 3300047322 Bacteria 3426
721 Ga0495680_0103729 3300047322 Bacteria 2116
722 Ga0495680_0112048 3300047322 Bacteria 2021
723 Ga0495680_0147048 3300047322 Bacteria 1720
724 Ga0495680_0168634 3300047322 Bacteria 1586
725 Ga0495680_0178799 3300047322 Bacteria 1532
726 Ga0495680_0642144 3300047322 Bacteria 706
727 Ga0495675_0000896 3300047444 Bacteria 18216
728 Ga0495675_0222705 3300047444 Bacteria 1141
729 Ga0495684_0008199 3300047471 Bacteria 8086
730 Ga0495684_0096559 3300047471 Bacteria 2236
731 Ga0495684_0445868 3300047471 Unclassified 900
732 Ga0495593_0004870 3300047673 Bacteria 7967
733 Ga0495593_0361300 3300047673 Bacteria 726
734 Ga0495602_0021235 3300048088 Bacteria 6397
735 Ga0495602_0043405 3300048088 Bacteria 4089
736 Ga0495614_0010766 3300048089 Bacteria 4028
737 Ga0495614_0457347 3300048089 Bacteria 604
738 Ga0495614_0553148 3300048089 Bacteria 550
739 Ga0496100_1535774 3300048903 Bacteria 526
740 Ga0496101_0008648 3300048904 Bacteria 6655
741 Ga0496101_0363140 3300048904 Bacteria 1138
742 Ga0496101_0415438 3300048904 Bacteria 1060
743 Ga0496101_0518845 3300048904 Unclassified 942
744 Ga0496101_0982415 3300048904 Bacteria 664
745 Ga0496102_0011192 3300048905 Bacteria 7726
746 Ga0496102_0100809 3300048905 Bacteria 2682
747 Ga0496102_0705304 3300048905 Bacteria 932
748 Ga0496102_1113405 3300048905 Bacteria 709
749 Ga0496102_1966013 3300048905 Unclassified 501
750 Ga0496103_0014497 3300048906 Bacteria 4679
751 Ga0496103_0109578 3300048906 Bacteria 1753
752 Ga0496103_0113865 3300048906 Bacteria 1719
753 Ga0496103_0672565 3300048906 Bacteria 657
754 Ga0496104_0023441 3300048907 Bacteria 5674
755 Ga0496104_0035809 3300048907 Bacteria 4636
756 Ga0496104_0128766 3300048907 Bacteria 2431
757 Ga0496104_0821564 3300048907 Bacteria 835
758 Ga0496104_1012879 3300048907 Bacteria 734
759 Ga0496105_0005405 3300048908 Bacteria 9694
760 Ga0496105_0203172 3300048908 Bacteria 1617
761 Ga0496105_0283758 3300048908 Bacteria 1334
762 Ga0496105_0330574 3300048908 Bacteria 1220
763 Ga0496106_0005740 3300048909 Bacteria 9180
764 Ga0496106_0047193 3300048909 Bacteria 3241
765 Ga0496106_0090495 3300048909 Bacteria 2361
766 Ga0496106_0865804 3300048909 Bacteria 715
767 Ga0496106_1275083 3300048909 Bacteria 571
768 Ga0496107_0002238 3300048910 Bacteria 12466
769 Ga0496107_0025839 3300048910 Bacteria 4160
770 Ga0496107_0178844 3300048910 Bacteria 1575
771 Ga0496107_0666084 3300048910 Bacteria 767
772 Ga0496107_1131348 3300048910 Bacteria 565
773 Ga0496108_0001117 3300048911 Bacteria 21001
774 Ga0496108_0088475 3300048911 Bacteria 2631
775 Ga0496108_0187592 3300048911 Bacteria 1791
776 Ga0496108_0660757 3300048911 Unclassified 908
777 Ga0496109_0021741 3300048912 Bacteria 5677
778 Ga0496109_0059554 3300048912 Bacteria 3489
779 Ga0496109_0099918 3300048912 Bacteria 2691
780 Ga0496109_0124275 3300048912 Bacteria 2405
781 Ga0496109_0300151 3300048912 Bacteria 1514
782 Ga0496109_0335559 3300048912 Bacteria 1427
783 Ga0496110_0125340 3300048913 Bacteria 2317
784 Ga0496111_0035752 3300048914 Bacteria 3552
785 Ga0496111_0109729 3300048914 Bacteria 2031
786 Ga0496111_0254126 3300048914 Bacteria 1304
787 Ga0496111_0407876 3300048914 Bacteria 1004
788 Ga0496112_0023330 3300048915 Bacteria 5910
789 Ga0496112_0033713 3300048915 Bacteria 4979
790 Ga0496112_0054539 3300048915 Bacteria 3928
791 Ga0496112_0062074 3300048915 Bacteria 3685
792 Ga0496112_0067113 3300048915 Bacteria 3540
793 Ga0496112_0098760 3300048915 Bacteria 2889
794 Ga0496112_0126360 3300048915 Bacteria 2528
795 Ga0496112_0206488 3300048915 Bacteria 1922
796 Ga0496112_0495731 3300048915 Bacteria 1157
797 Ga0496112_0575235 3300048915 Bacteria 1059
798 Ga0496112_0708193 3300048915 Bacteria 935
799 Ga0496112_0959830 3300048915 Bacteria 776
800 Ga0496113_0074979 3300048916 Bacteria 2581
801 Ga0496113_0092146 3300048916 Bacteria 2337
802 Ga0496113_0482330 3300048916 Bacteria 996
803 Ga0496113_0554042 3300048916 Bacteria 922
804 Ga0496113_0691162 3300048916 Bacteria 815
805 Ga0496114_0056462 3300048917 Bacteria 3277
806 Ga0496114_0086165 3300048917 Bacteria 2661
807 Ga0496114_0226394 3300048917 Bacteria 1642
808 Ga0496115_0014867 3300048918 Bacteria 5902
809 Ga0501033_0127828 3300049570 Bacteria 1842
810 Ga0501036_0002946 3300049572 Bacteria 13521
811 Ga0501036_0351584 3300049572 Bacteria 1231
812 Ga0501037_0091291 3300049573 Bacteria 2203
813 Ga0501038_0016048 3300049574 Bacteria 6801
814 Ga0501039_0004575 3300049575 Bacteria 10452
815 Ga0501040_0015142 3300049576 Bacteria 5095
816 Ga0501040_0627652 3300049576 Bacteria 776
817 Ga0501040_0675672 3300049576 Bacteria 747
818 Ga0501041_0041455 3300049577 Bacteria 2796
819 Ga0501041_0213283 3300049577 Bacteria 1211
820 Ga0501042_0019312 3300049578 Bacteria 4730
821 Ga0501043_0058309 3300049579 Bacteria 3031
822 Ga0501043_1331359 3300049579 Bacteria 500
823 Ga0501046_0041729 3300049580 Bacteria 3660
824 Ga0501048_0018605 3300049582 Bacteria 5107
825 Ga0501048_0340148 3300049582 Bacteria 1070
826 Ga0501067_0028576 3300049583 Bacteria 3090
827 Ga0501067_0189168 3300049583 Bacteria 1146
828 Ga0501067_0467275 3300049583 Bacteria 705
829 Ga0501068_0547868 3300049584 Bacteria 752
830 Ga0501069_0036729 3300049585 Bacteria 2702
831 Ga0501069_0172463 3300049585 Bacteria 1248
832 Ga0501069_0295526 3300049585 Bacteria 949
833 Ga0501069_0747904 3300049585 Bacteria 591
834 Ga0501070_0000120 3300049586 Bacteria 70354
835 Ga0501070_0046323 3300049586 Bacteria 3616
836 Ga0501070_0065509 3300049586 Bacteria 3008
837 Ga0501070_0081863 3300049586 Bacteria 2671
838 Ga0501071_0048328 3300049587 Bacteria 3059
839 Ga0501072_0039255 3300049588 Bacteria 3717
840 Ga0501072_0571817 3300049588 Bacteria 892
841 Ga0501072_0662959 3300049588 Bacteria 821
842 Ga0501073_0050562 3300049589 Bacteria 2912
843 Ga0501073_0157122 3300049589 Bacteria 1575
844 Ga0501074_0180404 3300049590 Bacteria 1506
845 Ga0501074_0409484 3300049590 Bacteria 962
846 Ga0501075_0012968 3300049591 Bacteria 5938
847 Ga0501075_1004113 3300049591 Bacteria 634
848 Ga0501076_0051154 3300049592 Bacteria 3269
849 Ga0501076_0127591 3300049592 Bacteria 2062
850 Ga0501077_0001242 3300049593 Bacteria 15398
851 Ga0501079_0002215 3300049741 Bacteria 14016
852 Ga0501079_0238268 3300049741 Bacteria 1421
853 Ga0501079_0292414 3300049741 Bacteria 1274
854 Ga0501080_0016996 3300049742 Bacteria 6718
855 Ga0501080_0044197 3300049742 Bacteria 4147
856 Ga0501080_0048945 3300049742 Bacteria 3933
857 Ga0501080_0083929 3300049742 Bacteria 2960
858 Ga0501081_0043469 3300049743 Bacteria 3082
859 Ga0501081_0442164 3300049743 Bacteria 965
860 Ga0501083_0002282 3300049744 Bacteria 13123
861 Ga0501083_0022883 3300049744 Bacteria 4337
862 Ga0501035_0022438 3300049822 Bacteria 5797
863 Ga0501045_0012614 3300049824 Bacteria 5950
864 nmdc:mga05p37_263018_c1 3300050507 Bacteria 2064
865 nmdc:mga05p37_623185_c1 3300050507 Bacteria 1213
866 nmdc:mga09592_1059572_c1 3300050508 Bacteria 675
867 nmdc:mga09592_1078272_c1 3300050508 Bacteria 668
868 nmdc:mga0n895_30400_c1 3300050512 Bacteria 5162
869 nmdc:mga0rr50_463871_c1 3300050513 Bacteria 1074
870 nmdc:mga08x19_451609_c1 3300050514 Bacteria 905
871 nmdc:mga0a205_1058725_c1 3300050515 Bacteria 658
872 nmdc:mga0a205_33243_c1 3300050515 Bacteria 4945
873 Ga0495601_0011114 3300053077 Bacteria 5378
874 Ga0495601_0055787 3300053077 Bacteria 2501
875 Ga0495601_0257813 3300053077 Bacteria 1138
876 Ga0495601_0660532 3300053077 Bacteria 668
877 Ga0495612_0013908 3300053078 Bacteria 3242
878 Ga0495612_0020760 3300053078 Bacteria 2634
879 Ga0495612_0021274 3300053078 Bacteria 2603
880 Ga0495595_0139426 3300053084 Bacteria 1189
881 Ga0495619_0027310 3300053085 Bacteria 3675
882 Ga0495619_0029886 3300053085 Bacteria 3523
883 Ga0495619_0051672 3300053085 Bacteria 2716
884 Ga0495619_0167405 3300053085 Bacteria 1519
885 Ga0495619_0399513 3300053085 Bacteria 949
886 Ga0495619_0794904 3300053085 Bacteria 640
887 Ga0500566_0388311 3300053094 Unclassified 628
888 Ga0501084_0000569 3300054114 Bacteria 28211
889 Ga0501084_0241425 3300054114 Bacteria 1525
890 Ga0501082_0031277 3300060353 Bacteria 4588
891 Ga0501082_0217041 3300060353 Bacteria 1664
892 Ga0501082_0477201 3300060353 Bacteria 1090
893 Ga0466962_0005742 3300061719 Bacteria 5961
894 Ga0466962_0007194 3300061719 Bacteria 5330
895 Ga0466962_0009676 3300061719 Bacteria 4623
896 Ga0466962_0015579 3300061719 Bacteria 3666
897 Ga0466962_0022520 3300061719 Bacteria 3027
898 Ga0466962_0200358 3300061719 Bacteria 975
899 Ga0466962_0432186 3300061719 Bacteria 662
900 Ga0466962_0547586 3300061719 Bacteria 588
901 Ga0530510_0003344 3300061734 Bacteria 11033
902 Ga0530510_0275609 3300061734 Bacteria 1256
903 Ga0530510_0549386 3300061734 Bacteria 877
904 Ga0530510_0648588 3300061734 Bacteria 804
905 Ga0466969_0059549
906 JGI24742J22300_10002407
907 Ga0070658_10016087
908 Ga0070658_10062834
909 Ga0070658_11169599
910 Ga0070683_100796345
911 Ga0070683_100957300
912 Ga0068869_100659207
913 Ga0070666_10264481
914 Ga0070680_100065367
915 Ga0070680_100206596
916 Ga0070680_100236457
917 Ga0070680_100311063
918 Ga0070680_100361888
919 Ga0070680_100518305
920 Ga0070682_100106780
921 Ga0070682_100164915
922 Ga0070682_100200074
923 Ga0068868_100117788
924 Ga0070660_100024469
925 Ga0070660_100045564
926 Ga0070660_100054273
927 Ga0070660_101121955
928 Ga0070660_101250510
929 Ga0070689_100137086
930 Ga0070692_10034327
931 Ga0070668_100228289
932 Ga0070669_100135350
933 Ga0070675_100109097
934 Ga0070675_100121365
935 Ga0070675_100856491
936 Ga0070671_100109774
937 Ga0070671_100176914
938 Ga0070674_100114732
939 Ga0070673_100069209
940 Ga0070673_100563624
941 Ga0070688_100008913
942 Ga0070659_100018012
943 Ga0070659_100120401
944 Ga0070659_100464052
945 Ga0070667_102228794
946 Ga0070703_10011287
947 Ga0070709_10006375
948 Ga0070709_10422785
949 Ga0070709_10578359
950 Ga0070714_100039545
951 Ga0070714_100047946
952 Ga0070714_100052104
953 Ga0070714_100052804
954 Ga0070714_100102045
955 Ga0070714_100147764
956 Ga0070714_100343059
957 Ga0070714_100359820
958 Ga0070714_100477902
959 Ga0070714_101378043
960 Ga0070713_100138473
961 Ga0070713_100163370
962 Ga0070713_100734136
963 Ga0070713_100880423
964 Ga0070713_101251328
965 Ga0070713_101983327
966 Ga0070710_11244088
967 Ga0070701_10000667
968 Ga0070701_11412199
969 Ga0070711_100001144
970 Ga0070711_100595194
971 Ga0070705_100101662
972 Ga0070700_100018297
973 Ga0070700_101088827
974 Ga0070694_100014942
975 Ga0070663_100020799
976 Ga0070678_100071583
977 Ga0070678_100101832
978 Ga0070662_100441605
979 Ga0070681_10013533
980 Ga0070681_10067782
981 Ga0070681_10073300
982 Ga0070681_10105236
983 Ga0070681_10148138
984 Ga0070681_10263444
985 Ga0068867_100007911
986 Ga0068867_100205482
987 Ga0070685_10005085
988 Ga0070685_10165760
989 Ga0070685_11174186
990 Ga0070706_101314748
991 Ga0070707_100048190
992 Ga0070707_101011800
993 Ga0070707_101148774
994 Ga0070698_100022593
995 Ga0070698_100172630
996 Ga0070698_100277511
997 Ga0070698_100298139
998 Ga0070698_100342405
999 Ga0070698_101802477
1000 Ga0070699_100192797
1001 Ga0070699_100506653
1002 Ga0070699_101204270
1003 Ga0070679_100022641
1004 Ga0070679_100036849
1005 Ga0070679_100078366
1006 Ga0070679_100084717
1007 Ga0070679_100094397
1008 Ga0070679_100125431
1009 Ga0070679_100851717
1010 Ga0070684_100078419
1011 Ga0070684_100105782
1012 Ga0070684_101506609
1013 Ga0068853_100011697
1014 Ga0070672_100078149
1015 Ga0070672_100176064
1016 Ga0070672_101281937
1017 Ga0070686_100009622
1018 Ga0070695_100000005
1019 Ga0070696_100203246
1020 Ga0070696_100438317
1021 Ga0070693_100031252
1022 Ga0070693_100041697
1023 Ga0070693_100210712
1024 Ga0070665_100347398
1025 Ga0070665_100437539
1026 Ga0070704_100011254
1027 Ga0070704_100754504
1028 Ga0070704_100934571
1029 Ga0068855_100155542
1030 Ga0068855_100328463
1031 Ga0068855_100369478
1032 Ga0068855_100504358
1033 Ga0068855_101451379
1034 Ga0068854_100424363
1035 Ga0068856_100006244
1036 Ga0068856_100140383
1037 Ga0068856_100172951
1038 Ga0070702_100004914
1039 Ga0070702_100148742
1040 Ga0070702_100739960
1041 Ga0070702_100792425
1042 Ga0068852_100061014
1043 Ga0068852_100265713
1044 Ga0068852_101179519
1045 Ga0068859_100392405
1046 Ga0068866_10057482
1047 Ga0068861_101312358
1048 Ga0068870_10464612
1049 Ga0068863_100658592
1050 Ga0068858_100778311
1051 Ga0070717_10016628
1052 Ga0070717_10074728
1053 Ga0070717_10087186
1054 Ga0070717_10310749
1055 Ga0070717_11180662
1056 Ga0070716_100427209
1057 Ga0070716_101261597
1058 Ga0070712_100002015
1059 Ga0070712_101703875
1060 Ga0097621_100436935
1061 Ga0068871_100012901
1062 Ga0075428_101479133
1063 Ga0075433_11412755
1064 Ga0075434_100035672
1065 Ga0068865_100007640
1066 Ga0068865_100687395
1067 Ga0075436_100167748
1068 Ga0097620_100392396
1069 Ga0105240_10010198
1070 Ga0105240_10274583
1071 Ga0105245_10323422
1072 Ga0105245_10468511
1073 Ga0105245_10558588
1074 Ga0105245_11602609
1075 Ga0114129_10114471
1076 Ga0114129_10861051
1077 Ga0114129_11970333
1078 Ga0105243_10122570
1079 Ga0105243_10382603
1080 Ga0105241_11339273
1081 Ga0105242_10015971
1082 Ga0105242_11563734
1083 Ga0105248_10006882
1084 Ga0105248_10101951
1085 Ga0105237_10270186
1086 Ga0105237_11161570
1087 Ga0105238_10256924
1088 Ga0105238_10917425
1089 Ga0105249_10013630
1090 Ga0105239_10046172
1091 Ga0105239_11238522
1092 Ga0105246_10062625
1093 Ga0105246_11922462
1094 Ga0157373_10424328
1095 Ga0157373_10952599
1096 Ga0157373_11588498
1097 Ga0157371_10269498
1098 Ga0157371_10295775
1099 Ga0157371_10440678
1100 Ga0157371_10781992
1101 Ga0157370_10056793
1102 Ga0157370_10082250
1103 Ga0157370_10745445
1104 Ga0157369_10004869
1105 Ga0157369_10121772
1106 Ga0157369_10348925
1107 Ga0157369_10393652
1108 Ga0157369_10981899
1109 Ga0157374_10019190
1110 Ga0157378_10028875
1111 Ga0163162_10012762
1112 Ga0157372_10369472
1113 Ga0157372_10372559
1114 Ga0157372_10495726
1115 Ga0157372_10813164
1116 Ga0157372_11731736
1117 Ga0157375_10063681
1118 Ga0163163_10413047
1119 Ga0157380_10097954
1120 Ga0157380_10439445
1121 Ga0182008_10045355
1122 Ga0182008_10156198
1123 Ga0182008_10215678
1124 Ga0182008_10636851
1125 Ga0157377_10005058
1126 Ga0157377_10207614
1127 Ga0157377_10310866
1128 Ga0157379_10716874
1129 Ga0157376_10171391
1130 Ga0157376_10186284
1131 Ga0182007_10275842
1132 Ga0197907_10050932
1133 Ga0206356_10299671
1134 Ga0206356_10582843
1135 Ga0206352_10068530
1136 Ga0206353_10109980
1137 Ga0213871_10018698
1138 Ga0224712_10016639
1139 Ga0224712_10035711
1140 Ga0224712_10041278
1141 Ga0224712_10210951
1142 Ga0207656_10405025
1143 Ga0207653_10013144
1144 Ga0207692_10233232
1145 Ga0207692_10406766
1146 Ga0207642_10015885
1147 Ga0207680_10564234
1148 Ga0207647_10092471
1149 Ga0207685_10414717
1150 Ga0207699_10048632
1151 Ga0207699_10064031
1152 Ga0207699_10262767
1153 Ga0207699_10430105
1154 Ga0207705_10121664
1155 Ga0207705_10129895
1156 Ga0207705_10809109
1157 Ga0207684_11152806
1158 Ga0207707_10079405
1159 Ga0207707_10116132
1160 Ga0207707_10205268
1161 Ga0207707_10224658
1162 Ga0207707_10258877
1163 Ga0207707_10282621
1164 Ga0207707_10762766
1165 Ga0207707_11222234
1166 Ga0207695_10092844
1167 Ga0207695_10730837
1168 Ga0207671_10183731
1169 Ga0207693_10001754
1170 Ga0207693_10346208
1171 Ga0207663_10009432
1172 Ga0207663_10355124
1173 Ga0207663_10405215
1174 Ga0207660_10074492
1175 Ga0207660_10298754
1176 Ga0207660_11294330
1177 Ga0207657_10021891
1178 Ga0207657_10028683
1179 Ga0207657_10030731
1180 Ga0207657_10039137
1181 Ga0207657_10476174
1182 Ga0207649_10798110
1183 Ga0207649_11444521
1184 Ga0207652_10028722
1185 Ga0207652_10076097
1186 Ga0207652_10112530
1187 Ga0207652_10239879
1188 Ga0207652_10503411
1189 Ga0207652_11289197
1190 Ga0207652_11845839
1191 Ga0207646_10002790
1192 Ga0207681_10146095
1193 Ga0207659_10742969
1194 Ga0207687_10273211
1195 Ga0207687_10451001
1196 Ga0207700_10130803
1197 Ga0207700_10139996
1198 Ga0207700_10214100
1199 Ga0207700_10699629
1200 Ga0207664_10006659
1201 Ga0207664_10063736
1202 Ga0207664_10067502
1203 Ga0207664_10080313
1204 Ga0207664_10117624
1205 Ga0207664_10487797
1206 Ga0207664_10590437
1207 Ga0207664_10680341
1208 Ga0207664_11606330
1209 Ga0207644_10106716
1210 Ga0207690_10207563
1211 Ga0207690_10339600
1212 Ga0207706_10138511
1213 Ga0207686_10258507
1214 Ga0207709_10007985
1215 Ga0207670_10214215
1216 Ga0207669_10003162
1217 Ga0207669_10837368
1218 Ga0207704_10564057
1219 Ga0207665_10674103
1220 Ga0207665_11472955
1221 Ga0207691_10015425
1222 Ga0207691_10114872
1223 Ga0207661_10180752
1224 Ga0207661_10300625
1225 Ga0207661_10863549
1226 Ga0207679_10209244
1227 Ga0207667_10222762
1228 Ga0207667_12234204
1229 Ga0207651_10088819
1230 Ga0207712_10014470
1231 Ga0207668_10021394
1232 Ga0207640_10412063
1233 Ga0207640_10527980
1234 Ga0207677_10615877
1235 Ga0207677_11254204
1236 Ga0207703_10802658
1237 Ga0207639_10021934
1238 Ga0207678_10026059
1239 Ga0207708_10004755
1240 Ga0207708_10650794
1241 Ga0207702_10082862
1242 Ga0207702_10153196
1243 Ga0207641_10303411
1244 Ga0207648_10000150
1245 Ga0207648_10095540
1246 Ga0207676_11764589
1247 Ga0207674_10545665
1248 Ga0207675_100033801
1249 Ga0207683_10000131
1250 Ga0207683_10207959
1251 Ga0207698_10309512
1252 Ga0207698_10466409
1253 Ga0207698_12469730
1254 Ga0268266_10024942
1255 Ga0268266_10377332
1256 Ga0268265_12445083
1257 Ga0268264_10093608
1258 Ga0265337_1021347
1259 Ga0265337_1062938
1260 Ga0265337_1073858
1261 Ga0265319_1008248
1262 Ga0265319_1051260
1263 Ga0265334_10064105
1264 Ga0265334_10108144
1265 Ga0265318_10002863
1266 Ga0265318_10066773
1267 Ga0265323_10031089
1268 Ga0265322_10003718
1269 Ga0265322_10052505
1270 Ga0265322_10072007
1271 Ga0265322_10136571
1272 Ga0265336_10002725
1273 Ga0265336_10088273
1274 Ga0265338_10001061
1275 Ga0265338_10002640
1276 Ga0265338_10012416
1277 Ga0265338_10048855
1278 Ga0265338_10107316
1279 Ga0265324_10019591
1280 Ga0265324_10075388
1281 Ga0265330_10014792
1282 Ga0265330_10043846
1283 Ga0265330_10096428
1284 Ga0265332_10132480
1285 Ga0265328_10019588
1286 Ga0265320_10025091
1287 Ga0265320_10053501
1288 Ga0265320_10063568
1289 Ga0265320_10065597
1290 Ga0265320_10123093
1291 Ga0265320_10374860
1292 Ga0265325_10034373
1293 Ga0265325_10045008
1294 Ga0265329_10009741
1295 Ga0265329_10016825
1296 Ga0265340_10010723
1297 Ga0265340_10095441
1298 Ga0265339_10014232
1299 Ga0265339_10095377
1300 Ga0265331_10110303
1301 Ga0265331_10428710
1302 Ga0265327_10052022
1303 Ga0265327_10440031
1304 Ga0265316_10015338
1305 Ga0265316_10094514
1306 Ga0265316_10400827
1307 Ga0265316_10679332
1308 Ga0307408_100629491
1309 Ga0307408_101330340
1310 Ga0265313_10028474
1311 Ga0265313_10088232
1312 Ga0265313_10110302
1313 Ga0265314_10012572
1314 Ga0265314_10031647
1315 Ga0265314_10657956
1316 Ga0265342_10035672
1317 Ga0265342_10219956
1318 Ga0265342_10274112
1319 Ga0265342_10303057
1320 Ga0307405_11140255
1321 Ga0307406_11791649
1322 Ga0307409_100160605
1323 Ga0307409_100660154
1324 Ga0307409_101519549
1325 Ga0307409_102282301
1326 Ga0307416_100405156
1327 Ga0307416_100865999
1328 Ga0307415_100089435
1329 Ga0316583_10055375
1330 Ga0373945_0013400
1331 Ga0373945_0283195
1332 Ga0373957_0062287
1333 Ga0373957_0071852
1334 Ga0373960_0382516
1335 Ga0373943_0000443
1336 Ga0373946_0029789
1337 Ga0373946_0217564
1338 Ga0373942_0098421
1339 Ga0373924_0111278
1340 Ga0373935_0503240
1341 Ga0373927_0016318
1342 Ga0373947_0006187
1343 Ga0373937_0045765
1344 Ga0373937_0277187
1345 Ga0373925_0000484
1346 Ga0395899_0105798
1347 Ga0395899_0225031
1348 Ga0395900_0128550
1349 Ga0395900_0399930
1350 Ga0395900_0492011
1351 Ga0395900_0751939
1352 Ga0395900_0943507
1353 Ga0395898_0190567
1354 Ga0395898_0231215
1355 Ga0395898_0358584
1356 Ga0395898_0652838
1357 Ga0395898_1372905
1358 Ga0395905_0594755
1359 Ga0395905_0769866
1360 Ga0395901_0216662
1361 Ga0395901_0336003
1362 Ga0395901_0991855
1363 Ga0436365_1081831
1364 Ga0439461_0004684
1365 Ga0451787_752081
1366 Ga0451800_1256723
1367 Ga0451800_1606387
1368 Ga0451807_1530868
1369 Ga0451835_0189308
1370 Ga0451835_1052634
1371 Ga0451835_1181250
1372 Ga0451841_0654153
1373 Ga0451849_1110976
1374 Ga0451849_1121762
1375 Ga0451849_1517115
1376 Ga0451851_1046935
1377 Ga0451843_0324014
1378 Ga0451855_1001223
1379 Ga0451853_2833846
1380 Ga0439433_0073916
1381 Ga0439441_077168
1382 Ga0439445_0149537
1383 Ga0450920_007359
1384 Ga0450920_040731
1385 Ga0450907_008091
1386 Ga0439446_0119725
1387 Ga0439434_0127006
1388 Ga0450918_015465
1389 Ga0466969_0047639
1390 Ga0466969_0123336
1391 Ga0466965_0051675
1392 Ga0466965_0077300
1393 Ga0466965_0156798
1394 Ga0466966_0087961
1395 Ga0466966_0110986
1396 Ga0466961_0003717
1397 Ga0466961_0009997
1398 Ga0466961_0027078
1399 Ga0466961_0158133
1400 Ga0466961_0267367
1401 Ga0466963_0000045
1402 Ga0466963_0001615
1403 Ga0466963_0002571
1404 Ga0466963_0003847
1405 Ga0466963_0009695
1406 Ga0466963_0017987
1407 Ga0466963_0025483
1408 Ga0466963_0030015
1409 Ga0466963_0037378
1410 Ga0466963_0038787
1411 Ga0466963_0052242
1412 Ga0466963_0147985
1413 Ga0466963_0149941
1414 Ga0466964_0001132
1415 Ga0466964_0001184
1416 Ga0466964_0014124
1417 Ga0466964_0014343
1418 Ga0466964_0019652
1419 Ga0466964_0021999
1420 Ga0466964_0023711
1421 Ga0466964_0448264
1422 Ga0453684_0679587
1423 Ga0453684_2028565
1424 Ga0466971_0001365
1425 Ga0466971_0003490
1426 Ga0466971_0004863
1427 Ga0466971_0007185
1428 Ga0466971_0012056
1429 Ga0466971_0056029
1430 Ga0466971_0289708
1431 Ga0466971_0401467
1432 Ga0466971_0664139
1433 Ga0466971_0686603
1434 Ga0466968_0032822
1435 Ga0466968_0040117
1436 Ga0466968_0093727
1437 Ga0466968_0496878
1438 Ga0466970_0120440
1439 Ga0466970_0339620
1440 Ga0466970_0731386
1441 Ga0466957_0003129
1442 Ga0466957_0015028
1443 Ga0466957_0015833
1444 Ga0466957_0025038
1445 Ga0466957_0084229
1446 Ga0466957_0123661
1447 Ga0466957_0139388
1448 Ga0466957_0163410
1449 Ga0466957_0176641
1450 Ga0466957_0191817
1451 Ga0466957_0227545
1452 Ga0466957_0570399
1453 Ga0466960_0015978
1454 Ga0466960_0181987
1455 Ga0466960_0190172
1456 Ga0466960_0319537
1457 Ga0466960_0826177
1458 Ga0466959_0002525
1459 Ga0466959_0028529
1460 Ga0466959_0036459
1461 Ga0466959_0043047
1462 Ga0466959_0080020
1463 Ga0466959_0933594
1464 Ga0451576_1915353
1465 Ga0466958_0013689
1466 Ga0466958_0018146
1467 Ga0466958_0023977
1468 Ga0466958_0026345
1469 Ga0466958_0042066
1470 Ga0466958_0043094
1471 Ga0466958_0083928
1472 Ga0466958_0146425
1473 Ga0466958_0230704
1474 Ga0466958_0339507
1475 Ga0466958_0391534
1476 Ga0466958_0535776
1477 Ga0466958_1060110
1478 Ga0466967_0000248
1479 Ga0466967_0000884
1480 Ga0466967_0014176
1481 Ga0466967_0018918
1482 Ga0466967_0020132
1483 Ga0466967_0023209
1484 Ga0466967_0035363
1485 Ga0466967_0049540
1486 Ga0466967_0094731
1487 Ga0466967_0136727
1488 Ga0466967_0182602
1489 Ga0466967_0196775
1490 Ga0466967_0477914
1491 Ga0466967_0628838
1492 Ga0466967_0634791
1493 Ga0466967_0980098
1494 Ga0466967_1299988
1495 Ga0466967_1471635
1496 Ga0495592_0012566
1497 Ga0495592_0100772
1498 Ga0495592_0582740
1499 Ga0495603_0010014
1500 Ga0495629_0036724
1501 Ga0495629_0048221
1502 Ga0495629_0085421
1503 Ga0495629_0256872
1504 Ga0495629_0502931
1505 Ga0495641_0023607
1506 Ga0495641_0034933
1507 Ga0495641_0057705
1508 Ga0495641_0184890
1509 Ga0495641_0374593
1510 Ga0495651_0000080
1511 Ga0495651_0193268
1512 Ga0495651_0267047
1513 Ga0495651_0930829
1514 Ga0495653_0006383
1515 Ga0495653_0023496
1516 Ga0495653_0172233
1517 Ga0495580_0126898
1518 Ga0495582_0032089
1519 Ga0495582_0193227
1520 Ga0495639_0000425
1521 Ga0495639_0356952
1522 Ga0495639_0713236
1523 Ga0495662_0002534
1524 Ga0495662_0314418
1525 Ga0495664_0003077
1526 Ga0495664_0087924
1527 Ga0495664_0112560
1528 Ga0495584_0098185
1529 Ga0495596_0023014
1530 Ga0495596_0075365
1531 Ga0495607_0006178
1532 Ga0495608_0050015
1533 Ga0495608_0062369
1534 Ga0495608_0594582
1535 Ga0495608_0850481
1536 Ga0495618_0011918
1537 Ga0495618_0015670
1538 Ga0495618_0045190
1539 Ga0495618_0156973
1540 Ga0495618_0431424
1541 Ga0495618_0515262
1542 Ga0495628_0001647
1543 Ga0495628_0838939
1544 Ga0495630_0001297
1545 Ga0495630_0069425
1546 Ga0495630_0236308
1547 Ga0495630_0543623
1548 Ga0495630_0846306
1549 Ga0495631_0354254
1550 Ga0495644_0133090
1551 Ga0495644_0159714
1552 Ga0495663_0035081
1553 Ga0495666_0000168
1554 Ga0495666_0119540
1555 Ga0495652_0017232
1556 Ga0495652_0190715
1557 Ga0495652_0221810
1558 Ga0495652_0473703
1559 Ga0495652_0892937
1560 Ga0495652_1058144
1561 Ga0495665_0000038
1562 Ga0495640_0263832
1563 Ga0495640_0648053
1564 Ga0495586_0009342
1565 Ga0495586_0412520
1566 Ga0495587_0000270
1567 Ga0495587_0291067
1568 Ga0495621_0389574
1569 Ga0495645_0025737
1570 Ga0495645_0088729
1571 Ga0495622_0395080
1572 Ga0495667_0025477
1573 Ga0495667_0077237
1574 Ga0495667_0156720
1575 Ga0495667_0241352
1576 Ga0495634_0054491
1577 Ga0495634_0056825
1578 Ga0495634_0143553
1579 Ga0495634_0231535
1580 Ga0495635_0028984
1581 Ga0495635_0073882
1582 Ga0495635_0176102
1583 Ga0495635_0458165
1584 Ga0495657_0008538
1585 Ga0495657_0079065
1586 Ga0495657_0162873
1587 Ga0495599_0000142
1588 Ga0495599_0301855
1589 Ga0495623_0021271
1590 Ga0495623_0238450
1591 Ga0495646_0033947
1592 Ga0495646_0120943
1593 Ga0495646_0274244
1594 Ga0495647_0002367
1595 Ga0495658_0022087
1596 Ga0495658_0025351
1597 Ga0495658_1081977
1598 Ga0495613_0026214
1599 Ga0495613_0332418
1600 Ga0495613_0376133
1601 Ga0495624_0001713
1602 Ga0495624_0486076
1603 Ga0495624_0614865
1604 Ga0495624_0627142
1605 Ga0495624_0677853
1606 Ga0495670_0474878
1607 Ga0495589_0089172
1608 Ga0495600_0079549
1609 Ga0495600_0395810
1610 Ga0495600_0623315
1611 Ga0495600_0888608
1612 Ga0495660_0375819
1613 Ga0495581_0003666
1614 Ga0495604_0005999
1615 Ga0495604_0049561
1616 Ga0495604_0129837
1617 Ga0495674_0006925
1618 Ga0495674_0110144
1619 Ga0495676_0009737
1620 Ga0495676_0088731
1621 Ga0495676_0099937
1622 Ga0495676_0201702
1623 Ga0495676_0202398
1624 Ga0495680_0046394
1625 Ga0495680_0103729
1626 Ga0495680_0112048
1627 Ga0495680_0147048
1628 Ga0495680_0168634
1629 Ga0495680_0178799
1630 Ga0495680_0642144
1631 Ga0495675_0000896
1632 Ga0495675_0222705
1633 Ga0495684_0008199
1634 Ga0495684_0096559
1635 Ga0495684_0445868
1636 Ga0495593_0004870
1637 Ga0495593_0361300
1638 Ga0495602_0021235
1639 Ga0495602_0043405
1640 Ga0495614_0010766
1641 Ga0495614_0457347
1642 Ga0495614_0553148
1643 Ga0496100_1535774
1644 Ga0496101_0008648
1645 Ga0496101_0363140
1646 Ga0496101_0415438
1647 Ga0496101_0518845
1648 Ga0496101_0982415
1649 Ga0496102_0011192
1650 Ga0496102_0100809
1651 Ga0496102_0705304
1652 Ga0496102_1113405
1653 Ga0496102_1966013
1654 Ga0496103_0014497
1655 Ga0496103_0109578
1656 Ga0496103_0113865
1657 Ga0496103_0672565
1658 Ga0496104_0023441
1659 Ga0496104_0035809
1660 Ga0496104_0128766
1661 Ga0496104_0821564
1662 Ga0496104_1012879
1663 Ga0496105_0005405
1664 Ga0496105_0203172
1665 Ga0496105_0283758
1666 Ga0496105_0330574
1667 Ga0496106_0005740
1668 Ga0496106_0047193
1669 Ga0496106_0090495
1670 Ga0496106_0865804
1671 Ga0496106_1275083
1672 Ga0496107_0002238
1673 Ga0496107_0025839
1674 Ga0496107_0178844
1675 Ga0496107_0666084
1676 Ga0496107_1131348
1677 Ga0496108_0001117
1678 Ga0496108_0088475
1679 Ga0496108_0187592
1680 Ga0496108_0660757
1681 Ga0496109_0021741
1682 Ga0496109_0059554
1683 Ga0496109_0099918
1684 Ga0496109_0124275
1685 Ga0496109_0300151
1686 Ga0496109_0335559
1687 Ga0496110_0125340
1688 Ga0496111_0035752
1689 Ga0496111_0109729
1690 Ga0496111_0254126
1691 Ga0496111_0407876
1692 Ga0496112_0023330
1693 Ga0496112_0033713
1694 Ga0496112_0054539
1695 Ga0496112_0062074
1696 Ga0496112_0067113
1697 Ga0496112_0098760
1698 Ga0496112_0126360
1699 Ga0496112_0206488
1700 Ga0496112_0495731
1701 Ga0496112_0575235
1702 Ga0496112_0708193
1703 Ga0496112_0959830
1704 Ga0496113_0074979
1705 Ga0496113_0092146
1706 Ga0496113_0482330
1707 Ga0496113_0554042
1708 Ga0496113_0691162
1709 Ga0496114_0056462
1710 Ga0496114_0086165
1711 Ga0496114_0226394
1712 Ga0496115_0014867
1713 Ga0501033_0127828
1714 Ga0501036_0002946
1715 Ga0501036_0351584
1716 Ga0501037_0091291
1717 Ga0501038_0016048
1718 Ga0501039_0004575
1719 Ga0501040_0015142
1720 Ga0501040_0627652
1721 Ga0501040_0675672
1722 Ga0501041_0041455
1723 Ga0501041_0213283
1724 Ga0501042_0019312
1725 Ga0501043_0058309
1726 Ga0501043_1331359
1727 Ga0501046_0041729
1728 Ga0501048_0018605
1729 Ga0501048_0340148
1730 Ga0501067_0028576
1731 Ga0501067_0189168
1732 Ga0501067_0467275
1733 Ga0501068_0547868
1734 Ga0501069_0036729
1735 Ga0501069_0172463
1736 Ga0501069_0295526
1737 Ga0501069_0747904
1738 Ga0501070_0000120
1739 Ga0501070_0046323
1740 Ga0501070_0065509
1741 Ga0501070_0081863
1742 Ga0501071_0048328
1743 Ga0501072_0039255
1744 Ga0501072_0571817
1745 Ga0501072_0662959
1746 Ga0501073_0050562
1747 Ga0501073_0157122
1748 Ga0501074_0180404
1749 Ga0501074_0409484
1750 Ga0501075_0012968
1751 Ga0501075_1004113
1752 Ga0501076_0051154
1753 Ga0501076_0127591
1754 Ga0501077_0001242
1755 Ga0501079_0002215
1756 Ga0501079_0238268
1757 Ga0501079_0292414
1758 Ga0501080_0016996
1759 Ga0501080_0044197
1760 Ga0501080_0048945
1761 Ga0501080_0083929
1762 Ga0501081_0043469
1763 Ga0501081_0442164
1764 Ga0501083_0002282
1765 Ga0501083_0022883
1766 Ga0501035_0022438
1767 Ga0501045_0012614
1768 nmdc:mga05p37_263018_c1
1769 nmdc:mga05p37_623185_c1
1770 nmdc:mga09592_1059572_c1
1771 nmdc:mga09592_1078272_c1
1772 nmdc:mga0n895_30400_c1
1773 nmdc:mga0rr50_463871_c1
1774 nmdc:mga08x19_451609_c1
1775 nmdc:mga0a205_1058725_c1
1776 nmdc:mga0a205_33243_c1
1777 Ga0495601_0011114
1778 Ga0495601_0055787
1779 Ga0495601_0257813
1780 Ga0495601_0660532
1781 Ga0495612_0013908
1782 Ga0495612_0020760
1783 Ga0495612_0021274
1784 Ga0495595_0139426
1785 Ga0495619_0027310
1786 Ga0495619_0029886
1787 Ga0495619_0051672
1788 Ga0495619_0167405
1789 Ga0495619_0399513
1790 Ga0495619_0794904
1791 Ga0500566_0388311
1792 Ga0501084_0000569
1793 Ga0501084_0241425
1794 Ga0501082_0031277
1795 Ga0501082_0217041
1796 Ga0501082_0477201
1797 Ga0466962_0005742
1798 Ga0466962_0007194
1799 Ga0466962_0009676
1800 Ga0466962_0015579
1801 Ga0466962_0022520
1802 Ga0466962_0200358
1803 Ga0466962_0432186
1804 Ga0466962_0547586
1805 Ga0530510_0003344
1806 Ga0530510_0275609
1807 Ga0530510_0549386
1808 Ga0530510_0648588

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

9

44

0.98

PF13411

MerR_1

MerR HTH family regulatory protein

7

76

0.97

PF13591

MerR_2

MerR HTH family regulatory protein

8

91

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.9649 1 73
2dg6-assembly1.cif.gz_A-2 crystal structure of the putative transcriptional regulator sco5550 from streptomyces coelicolor a3(2) 0.9521 7 73
4r4e-assembly1.cif.gz_B structure of glnr-dna complex 0.9513 3 77
7tec-assembly1.cif.gz_A-2 structure of the listeria monocytogenes glnr-dna complex to 3.45 angstrom 0.939 4 68
4r24-assembly1.cif.gz_B complete dissection of b. subtilis nitrogen homeostatic circuitry 0.9388 3 83
ID Description Score Start End Superfamily
af_O06302_4_79_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.952 3 72 1.10.1660.10
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9478 7 74 1.10.1660.10
af_P9WME7_10_96_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9312 7 69 1.10.1660.10
4r22B00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.93 3 81 1.10.1660.10
4r4eA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9248 3 78 1.10.1660.10
ID Description Score Start End GO Terms
AF-X0X5I0-F1-model_v4 HTH merR-type domain-containing protein 0.9866 2 73 GO:0003677
GO:0003700
AF-A0A1Q3TSJ7-F1-model_v4 HTH merR-type domain-containing protein 0.9857 3 82 GO:0003677
GO:0003700
AF-A0A2W4N5C0-F1-model_v4 MerR family transcriptional regulator 0.9842 1 78 GO:0003677
GO:0003700
AF-A0A535J6Q8-F1-model_v4 MerR family transcriptional regulator 0.983 3 81 GO:0003677
GO:0003700
AF-A0A7X9PC67-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9818 2 90 GO:0003677
GO:0003700

Map