F485213

General Info

Members Datasets Scaffolds Average Seq Length
902 593 680 423

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10008365|Ga0207661_100083653
Length 439
Sequence VFPSNRILIESGDNMTAPRDKFGRPMVVVTGMGVVTSLGAGKTDNWARLTAGESGIRTLTRFPIEGLKTTMAGTIDFIPVAPFSSVGLSERLAELAVEEAIAQAGIGKKGDFPGPLFLAVPPVEIEWPHREELGKAVGTTEFSYDDLLSICGGGRFEPYHHRFQMGSVADFIAETFGTKGSPISLSTACASGATAIQLGVEAIRRGETDAALCAGTEASVNQEGLVRFSLLSALSTQNDPPQAASKPFSKNRDGFVMAEGAGALVLESYEAAVARGAPILGVIAGCGELTDSFHRTRSSPDGKPIIGCMLKTLADAGMTPEQIDHINAHGTATPENDKMEFQTTSTVFGERTKQIPVTSNKSMVGHTISAAGAVEAVFSLLTLEHQRIPPTINYEIPDPTIQFDVVGNKARDARVTAVMSNSFGFGGQNASLILTREPA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
27 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
28 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
29 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
30 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
31 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
32 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
33 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
34 2791355199
35 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
36 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
37 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
38 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
39 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
40 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
41 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
42 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
43 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
44 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
45 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
46 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
47 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
48 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
49 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
50 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
51 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
52 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
53 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
54 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
55 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
56 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
57 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
58 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
59 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
60 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
61 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
62 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
63 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
64 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
65 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
66 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
67 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
68 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
69 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
70 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
71 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
72 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
73 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
74 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
75 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
76 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
77 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
78 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
79 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
80 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
81 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
82 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
83 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
84 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
85 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
86 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
87 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
88 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
89 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
90 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
91 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
92 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
93 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
94 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
95 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
96 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
97 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
98 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
99 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
100 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
101 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
102 2904699407
103 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
104 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
105 2906610324
106 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
107 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
108 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
109 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
110 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
111 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
112 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
113 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
114 2922368715
115 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
116 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
117 2922425934
118 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
119 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
120 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
121 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
122 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
123 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
124 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
125 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
126 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
127 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
128 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
129 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
130 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
131 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
132 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
133 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
134 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
135 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
136 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
137 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
138 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
139 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
140 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
141 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
142 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
143 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
144 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
145 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
146 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
147 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
148 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
149 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
150 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
151 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
152 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
153 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
154 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
155 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
156 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
157 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
158 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
159 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
160 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
161 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
162 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
163 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
164 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
165 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
166 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
167 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
168 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
169 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
170 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
171 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
172 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
173 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
174 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
175 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
176 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
177 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
178 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
179 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
180 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
181 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
182 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
183 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
184 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
185 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
186 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
187 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
188 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
189 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
190 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
191 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
192 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
193 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
194 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
195 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
196 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
197 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
198 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
199 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
200 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
201 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
202 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
203 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
204 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
205 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
206 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
207 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
208 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
209 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
210 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
211 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
212 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
213 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
214 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
215 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
216 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
217 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
218 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
219 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
220 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
221 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
222 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
223 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
224 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
225 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
226 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
227 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
228 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
229 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
230 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
231 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
232 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
233 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
234 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
235 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
236 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
237 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
238 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
239 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
240 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
241 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
242 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
243 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
244 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
245 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
246 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
247 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
248 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
249 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
250 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
251 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
252 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
253 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
254 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
255 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
256 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
257 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
258 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
259 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
260 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
261 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
262 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
263 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
264 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
265 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
266 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
267 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
268 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
269 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
270 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
271 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
272 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
273 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
274 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
275 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
276 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
277 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
278 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
279 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
280 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
281 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
282 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
283 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
284 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
285 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
286 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
287 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
288 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
289 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
290 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
291 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
292 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
293 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
294 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
295 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
296 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
297 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
299 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
301 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
302 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
303 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
304 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
305 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
306 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
307 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
365 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
366 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
367 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
368 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
371 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
374 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
375 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
376 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
377 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
378 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
379 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
380 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
381 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
382 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
383 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
384 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
385 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
386 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
387 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
388 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
389 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
390 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
391 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
392 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
393 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
394 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
395 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
396 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
397 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
398 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
399 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
400 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
401 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
402 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
403 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
404 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
405 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
406 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
407 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
408 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
409 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
410 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
411 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
412 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
413 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
414 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
415 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
416 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
417 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
418 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
419 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
420 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
421 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
422 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
423 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
424 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
425 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
426 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
427 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
428 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
429 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
430 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
431 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
432 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
433 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
434 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
435 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
436 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
437 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
438 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
439 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
440 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
441 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
442 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
443 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
444 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
445 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
446 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
447 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
448 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
449 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
450 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
451 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
452 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
453 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
454 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
455 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
456 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
457 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
458 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
459 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
460 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
461 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
462 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
463 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
464 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
465 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
466 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
467 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
468 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
469 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
470 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
471 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
472 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
473 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
474 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
475 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
476 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
477 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
478 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
479 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
480 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
481 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
482 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
483 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
484 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
485 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
486 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
487 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
488 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
489 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
490 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
491 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
492 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
493 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
494 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
495 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
496 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
497 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
498 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
499 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
500 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
501 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
502 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
503 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
504 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
505 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
506 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
508 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
509 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
510 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
511 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
512 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
513 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
514 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
515 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
516 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
517 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
518 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
519 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
520 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
521 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
522 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
523 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
524 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
525 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
526 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
527 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
528 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
529 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
530 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
531 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
532 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
533 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
534 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
535 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
536 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
537 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
538 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
539 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
540 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
541 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
542 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
543 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
544 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
545 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
546 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
547 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
548 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
549 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
550 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
551 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
552 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
553 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
554 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
555 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
556 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
557 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
558 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
559 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
560 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
561 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
562 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
563 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
564 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
565 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
566 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
567 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
568 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
569 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
570 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
571 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
572 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
573 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
574 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
575 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
576 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
577 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
578 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
579 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
580 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
581 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
582 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
583 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
584 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
585 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
586 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
587 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
588 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
589 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
590 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
591 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
592 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
593 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.59
Metatranscriptomes 0.22
Isolates 24.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.76
Nodule 19.51
Rhizoplane 7.21
Rhizosphere 53.1
Stem 0
Stem Tuber 0
Unclassified 11.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000091 3300000041 Bacteria 16524
2 JGI24032J14994_100331 3300001430 Bacteria 2517
3 JGI24740J21852_10007980 3300001979 Bacteria 4258
4 JGI24737J22298_10001022 3300001990 Bacteria 9909
5 JGI25406J46586_10000027 3300003203 Bacteria 70625
6 JGI25153J46596_10001910 3300003215 Bacteria 12359
7 JGI25153J46596_10007386 3300003215 Bacteria 5415
8 JGI25160J50197_1003482 3300003354 Bacteria 7034
9 Ga0065165_1001157 3300005262 Bacteria 30758
10 Ga0065165_1001250 3300005262 Bacteria 28850
11 Ga0065165_1013791 3300005262 Bacteria 3184
12 Ga0070658_10037250 3300005327 Bacteria 3920
13 Ga0070658_10037583 3300005327 Bacteria 3903
14 Ga0070658_10189564 3300005327 Bacteria 1733
15 Ga0070676_10110293 3300005328 Bacteria 1713
16 Ga0070683_100007257 3300005329 Bacteria 9349
17 Ga0070683_100041674 3300005329 Bacteria 4226
18 Ga0070677_10001849 3300005333 Bacteria 6692
19 Ga0070680_100037008 3300005336 Bacteria 3943
20 Ga0070680_100046889 3300005336 Bacteria 3517
21 Ga0070682_100119280 3300005337 Bacteria 1768
22 Ga0068868_100033605 3300005338 Bacteria 3954
23 Ga0070660_100116491 3300005339 Bacteria 2131
24 Ga0070689_100011851 3300005340 Bacteria 6259
25 Ga0070661_100165579 3300005344 Bacteria 1676
26 Ga0070692_10117649 3300005345 Bacteria 1478
27 Ga0070668_100116225 3300005347 Bacteria 2133
28 Ga0070671_100044589 3300005355 Bacteria 3685
29 Ga0070674_100001777 3300005356 Bacteria 11690
30 Ga0070674_100038774 3300005356 Bacteria 3213
31 Ga0070673_100082352 3300005364 Bacteria 2612
32 Ga0070673_100101825 3300005364 Bacteria 2367
33 Ga0070688_100019250 3300005365 Bacteria 3953
34 Ga0070659_100080254 3300005366 Bacteria 2605
35 Ga0070667_100217489 3300005367 Bacteria 1700
36 Ga0070709_10006118 3300005434 Bacteria 6547
37 Ga0070709_10009846 3300005434 Bacteria 5280
38 Ga0070709_10013900 3300005434 Bacteria 4538
39 Ga0070714_100006896 3300005435 Bacteria 8807
40 Ga0070714_100054219 3300005435 Bacteria 3425
41 Ga0070714_100120760 3300005435 Bacteria 2331
42 Ga0070713_100006657 3300005436 Bacteria 8039
43 Ga0070713_100018188 3300005436 Bacteria 5339
44 Ga0070713_100029306 3300005436 Bacteria 4357
45 Ga0070713_100081025 3300005436 Bacteria 2769
46 Ga0070713_100156741 3300005436 Bacteria 2030
47 Ga0070710_10001287 3300005437 Bacteria 11902
48 Ga0070710_10008883 3300005437 Bacteria 4904
49 Ga0070711_100004377 3300005439 Bacteria 8321
50 Ga0070711_100007383 3300005439 Bacteria 6686
51 Ga0070711_100018998 3300005439 Bacteria 4399
52 Ga0070708_100187817 3300005445 Bacteria 1933
53 Ga0070663_100025670 3300005455 Bacteria 3981
54 Ga0070663_100026936 3300005455 Bacteria 3898
55 Ga0070678_100035084 3300005456 Bacteria 3499
56 Ga0070678_100036024 3300005456 Bacteria 3460
57 Ga0070681_10009117 3300005458 Bacteria 9750
58 Ga0070681_10014556 3300005458 Bacteria 7827
59 Ga0070706_100186628 3300005467 Bacteria 1938
60 Ga0070707_100307055 3300005468 Bacteria 1542
61 Ga0070698_100122608 3300005471 Bacteria 2558
62 Ga0070679_100013382 3300005530 Bacteria 7856
63 Ga0070679_100020776 3300005530 Bacteria 6404
64 Ga0070679_100064758 3300005530 Bacteria 3643
65 Ga0070679_100073029 3300005530 Bacteria 3423
66 Ga0070697_100181907 3300005536 Bacteria 1782
67 Ga0068853_100000785 3300005539 Bacteria 22086
68 Ga0068853_100002462 3300005539 Bacteria 13860
69 Ga0068853_100047159 3300005539 Bacteria 3697
70 Ga0068853_100149314 3300005539 Bacteria 2103
71 Ga0070686_100010545 3300005544 Bacteria 5215
72 Ga0070665_100021594 3300005548 Bacteria 6472
73 Ga0070665_100094902 3300005548 Bacteria 2987
74 Ga0070704_100147792 3300005549 Bacteria 1844
75 Ga0068855_100062119 3300005563 Bacteria 4362
76 Ga0068857_100049082 3300005577 Bacteria 3745
77 Ga0068857_100088587 3300005577 Bacteria 2769
78 Ga0068857_100140978 3300005577 Bacteria 2179
79 Ga0068854_100002059 3300005578 Bacteria 12329
80 Ga0068854_100175546 3300005578 Bacteria 1670
81 Ga0068856_100001874 3300005614 Bacteria 21950
82 Ga0068856_100015688 3300005614 Bacteria 7326
83 Ga0068852_100142022 3300005616 Bacteria 2223
84 Ga0068852_100156924 3300005616 Bacteria 2121
85 Ga0068861_100040451 3300005719 Bacteria 3487
86 Ga0068851_10000665 3300005834 Bacteria 14682
87 Ga0068851_10001506 3300005834 Bacteria 10221
88 Ga0068863_100049875 3300005841 Bacteria 3969
89 Ga0068860_100000213 3300005843 Bacteria 91105
90 Ga0068860_100307018 3300005843 Bacteria 1555
91 Ga0068862_100187925 3300005844 Bacteria 1857
92 Ga0081455_10000009 3300005937 Bacteria 249885
93 Ga0081455_10012693 3300005937 Bacteria 8385
94 Ga0081455_10018614 3300005937 Bacteria 6603
95 Ga0081455_10052412 3300005937 Bacteria 3493
96 Ga0081540_1001168 3300005983 Bacteria 23063
97 Ga0081540_1004236 3300005983 Bacteria 11018
98 Ga0081540_1015828 3300005983 Bacteria 4754
99 Ga0081540_1016341 3300005983 Bacteria 4647
100 Ga0081540_1018868 3300005983 Bacteria 4214
101 Ga0081540_1025956 3300005983 Bacteria 3357
102 Ga0081540_1028166 3300005983 Bacteria 3162
103 Ga0081540_1028488 3300005983 Bacteria 3136
104 Ga0081540_1067595 3300005983 Bacteria 1669
105 Ga0081539_10000051 3300005985 Bacteria 268337
106 Ga0081539_10017427 3300005985 Bacteria 5044
107 Ga0081539_10038018 3300005985 Bacteria 2858
108 Ga0081539_10077999 3300005985 Bacteria 1750
109 Ga0081539_10098967 3300005985 Bacteria 1490
110 Ga0070717_10000905 3300006028 Bacteria 19709
111 Ga0070717_10003205 3300006028 Bacteria 11688
112 Ga0075365_10013621 3300006038 Bacteria 4873
113 Ga0075365_10031750 3300006038 Bacteria 3389
114 Ga0075368_10007756 3300006042 Bacteria 3801
115 Ga0075368_10013110 3300006042 Bacteria 3041
116 Ga0075363_100030494 3300006048 Bacteria 2793
117 Ga0070716_100021118 3300006173 Bacteria 3427
118 Ga0070716_100055228 3300006173 Bacteria 2272
119 Ga0070712_100018569 3300006175 Bacteria 4520
120 Ga0070712_100095539 3300006175 Bacteria 2187
121 Ga0070712_100128936 3300006175 Bacteria 1915
122 Ga0070712_100244997 3300006175 Bacteria 1429
123 Ga0075367_10065300 3300006178 Bacteria 2179
124 Ga0075366_10039838 3300006195 Bacteria 2777
125 Ga0097621_100074025 3300006237 Bacteria 2820
126 Ga0075370_10014925 3300006353 Bacteria 4151
127 Ga0075428_100005630 3300006844 Bacteria 13921
128 Ga0075428_100232820 3300006844 Bacteria 1988
129 Ga0075431_100000196 3300006847 Bacteria 44288
130 Ga0075429_100002073 3300006880 Bacteria 16727
131 Ga0099824_1010553 3300006942 Bacteria 10831
132 Ga0099822_1001130 3300006943 Bacteria 29740
133 Ga0099794_10001814 3300007265 Bacteria 7623
134 Ga0099794_10052661 3300007265 Bacteria 1962
135 Ga0099795_10000154 3300007788 Bacteria 11507
136 Ga0099795_10021402 3300007788 Bacteria 2121
137 Ga0105240_10019779 3300009093 Bacteria 8991
138 Ga0105240_10020186 3300009093 Bacteria 8895
139 Ga0105240_10056805 3300009093 Bacteria 4895
140 Ga0105240_10069157 3300009093 Bacteria 4371
141 Ga0111539_10008246 3300009094 Bacteria 13262
142 Ga0111539_10269847 3300009094 Bacteria 1981
143 Ga0105245_10027991 3300009098 Bacteria 4968
144 Ga0105247_10025399 3300009101 Bacteria 3573
145 Ga0105247_10117536 3300009101 Bacteria 1719
146 Ga0114129_10039302 3300009147 Bacteria 6670
147 Ga0114129_10227768 3300009147 Bacteria 2511
148 Ga0105241_10001128 3300009174 Bacteria 20332
149 Ga0105241_10017590 3300009174 Bacteria 5256
150 Ga0105241_10039945 3300009174 Bacteria 3540
151 Ga0105241_10127327 3300009174 Bacteria 2058
152 Ga0105242_10124784 3300009176 Bacteria 2215
153 Ga0105248_10058178 3300009177 Bacteria 4340
154 Ga0105248_10062849 3300009177 Bacteria 4168
155 Ga0105248_10110074 3300009177 Bacteria 3106
156 Ga0105237_10013465 3300009545 Bacteria 8575
157 Ga0105237_10018185 3300009545 Bacteria 7275
158 Ga0105237_10033149 3300009545 Bacteria 5233
159 Ga0105237_10038959 3300009545 Bacteria 4798
160 Ga0105237_10063877 3300009545 Bacteria 3678
161 Ga0105237_10072147 3300009545 Bacteria 3446
162 Ga0105237_10082546 3300009545 Bacteria 3204
163 Ga0105237_10151315 3300009545 Bacteria 2317
164 Ga0105237_10335137 3300009545 Bacteria 1517
165 Ga0105238_10011980 3300009551 Bacteria 8735
166 Ga0105238_10018757 3300009551 Bacteria 7045
167 Ga0105238_10031278 3300009551 Bacteria 5418
168 Ga0105238_10055394 3300009551 Bacteria 3980
169 Ga0105238_10097311 3300009551 Bacteria 2929
170 Ga0105249_10065948 3300009553 Bacteria 3332
171 Ga0099796_10000092 3300010159 Bacteria 14577
172 Ga0099796_10007421 3300010159 Bacteria 2865
173 Ga0105239_10013525 3300010375 Bacteria 9059
174 Ga0105239_10014647 3300010375 Bacteria 8695
175 Ga0105239_10021881 3300010375 Bacteria 7049
176 Ga0105239_10110596 3300010375 Bacteria 3046
177 Ga0105239_10197400 3300010375 Bacteria 2253
178 Ga0105239_10238348 3300010375 Bacteria 2042
179 Ga0105246_10013370 3300011119 Bacteria 5144
180 Ga0157373_10031343 3300013100 Bacteria 3827
181 Ga0157370_10030840 3300013104 Bacteria 5251
182 Ga0157370_10051707 3300013104 Bacteria 3924
183 Ga0157369_10005049 3300013105 Bacteria 15450
184 Ga0157369_10009441 3300013105 Bacteria 11153
185 Ga0157369_10016741 3300013105 Bacteria 8241
186 Ga0157369_10160768 3300013105 Bacteria 2371
187 Ga0157374_10052593 3300013296 Bacteria 3794
188 Ga0157374_10130102 3300013296 Bacteria 2436
189 Ga0157374_10160532 3300013296 Bacteria 2189
190 Ga0157378_10013278 3300013297 Bacteria 7202
191 Ga0163162_10062640 3300013306 Bacteria 3760
192 Ga0163162_10149875 3300013306 Bacteria 2449
193 Ga0163162_10307840 3300013306 Bacteria 1716
194 Ga0163162_10384649 3300013306 Bacteria 1536
195 Ga0157372_10174902 3300013307 Bacteria 2485
196 Ga0157372_10404700 3300013307 Bacteria 1590
197 Ga0157375_10044677 3300013308 Bacteria 4306
198 Ga0157375_10084779 3300013308 Bacteria 3218
199 Ga0157375_10158570 3300013308 Bacteria 2403
200 Ga0157375_10226846 3300013308 Bacteria 2027
201 Ga0157380_10041401 3300014326 Bacteria 3595
202 Ga0157377_10028838 3300014745 Bacteria 2990
203 Ga0157379_10182868 3300014968 Bacteria 1894
204 Ga0163161_10193280 3300017792 Bacteria 1565
205 Ga0206353_10887329 3300020082 Bacteria 1713
206 Ga0214544_1000002 3300021320 Bacteria 753857
207 Ga0214542_1000001 3300021321 Bacteria 1018696
208 Ga0214545_1000001 3300021324 Bacteria 1092817
209 Ga0214543_1000001 3300021327 Bacteria 776921
210 Ga0213874_10002688 3300021377 Bacteria 3861
211 Ga0213876_10004192 3300021384 Bacteria 8083
212 Ga0224712_10022413 3300022467 Bacteria 2177
213 Ga0209563_105305 3300025230 Bacteria 2355
214 Ga0209677_102534 3300025253 Bacteria 6765
215 Ga0209148_1000374 3300025254 Bacteria 54657
216 Ga0209233_1007575 3300025261 Bacteria 3427
217 Ga0209455_1001411 3300025272 Bacteria 10891
218 Ga0209455_1003883 3300025272 Bacteria 5098
219 Ga0209673_1029820 3300025273 Bacteria 1729
220 Ga0209564_1011932 3300025295 Bacteria 3839
221 Ga0209758_1000024 3300025297 Bacteria 591966
222 Ga0209758_1000068 3300025297 Bacteria 286488
223 Ga0209758_1001579 3300025297 Bacteria 26050
224 Ga0209758_1002091 3300025297 Bacteria 21224
225 Ga0209758_1005630 3300025297 Bacteria 9509
226 Ga0209758_1015196 3300025297 Bacteria 4012
227 Ga0209256_1008086 3300025299 Bacteria 4968
228 Ga0207426_1000238 3300025302 Bacteria 124393
229 Ga0207426_1000726 3300025302 Bacteria 37826
230 Ga0207426_1021118 3300025302 Bacteria 2253
231 Ga0209257_1004927 3300025304 Bacteria 9810
232 Ga0209257_1018552 3300025304 Bacteria 2669
233 Ga0207653_10010122 3300025885 Bacteria 2941
234 Ga0207682_10000451 3300025893 Bacteria 18904
235 Ga0207692_10000175 3300025898 Bacteria 20519
236 Ga0207692_10006739 3300025898 Bacteria 4670
237 Ga0207692_10037770 3300025898 Bacteria 2364
238 Ga0207642_10023088 3300025899 Bacteria 2479
239 Ga0207710_10022920 3300025900 Bacteria 2680
240 Ga0207710_10030595 3300025900 Bacteria 2350
241 Ga0207710_10036667 3300025900 Bacteria 2163
242 Ga0207710_10063399 3300025900 Bacteria 1681
243 Ga0207688_10060214 3300025901 Bacteria 2138
244 Ga0207680_10047992 3300025903 Bacteria 2533
245 Ga0207647_10001739 3300025904 Bacteria 16681
246 Ga0207647_10017311 3300025904 Bacteria 4900
247 Ga0207699_10001765 3300025906 Bacteria 10215
248 Ga0207699_10022952 3300025906 Bacteria 3389
249 Ga0207645_10119720 3300025907 Bacteria 1708
250 Ga0207643_10037942 3300025908 Bacteria 2705
251 Ga0207654_10000232 3300025911 Bacteria 34089
252 Ga0207654_10011815 3300025911 Bacteria 4461
253 Ga0207707_10000950 3300025912 Bacteria 27902
254 Ga0207707_10004626 3300025912 Bacteria 12087
255 Ga0207707_10212389 3300025912 Bacteria 1685
256 Ga0207695_10000008 3300025913 Bacteria 1058268
257 Ga0207695_10001547 3300025913 Bacteria 37828
258 Ga0207695_10083099 3300025913 Bacteria 3235
259 Ga0207695_10101991 3300025913 Bacteria 2863
260 Ga0207695_10113971 3300025913 Bacteria 2679
261 Ga0207671_10008090 3300025914 Bacteria 8979
262 Ga0207671_10019334 3300025914 Bacteria 5209
263 Ga0207671_10050109 3300025914 Bacteria 3092
264 Ga0207671_10117695 3300025914 Bacteria 2028
265 Ga0207693_10007591 3300025915 Bacteria 8911
266 Ga0207693_10110162 3300025915 Bacteria 2159
267 Ga0207693_10124909 3300025915 Bacteria 2022
268 Ga0207663_10017604 3300025916 Bacteria 3986
269 Ga0207663_10039585 3300025916 Bacteria 2857
270 Ga0207660_10059240 3300025917 Bacteria 2748
271 Ga0207660_10064021 3300025917 Bacteria 2653
272 Ga0207660_10159286 3300025917 Bacteria 1740
273 Ga0207657_10000658 3300025919 Bacteria 36762
274 Ga0207657_10074301 3300025919 Bacteria 2871
275 Ga0207649_10071474 3300025920 Bacteria 2216
276 Ga0207652_10051870 3300025921 Bacteria 3518
277 Ga0207646_10258564 3300025922 Bacteria 1574
278 Ga0207681_10070191 3300025923 Bacteria 2439
279 Ga0207681_10210640 3300025923 Bacteria 1498
280 Ga0207694_10000050 3300025924 Bacteria 159920
281 Ga0207694_10055781 3300025924 Bacteria 3067
282 Ga0207694_10068746 3300025924 Bacteria 2766
283 Ga0207694_10136966 3300025924 Bacteria 1967
284 Ga0207650_10209014 3300025925 Bacteria 1567
285 Ga0207687_10024233 3300025927 Bacteria 4051
286 Ga0207687_10113235 3300025927 Bacteria 2017
287 Ga0207687_10176312 3300025927 Bacteria 1653
288 Ga0207700_10001663 3300025928 Bacteria 12623
289 Ga0207700_10071109 3300025928 Bacteria 2678
290 Ga0207664_10007161 3300025929 Bacteria 7734
291 Ga0207664_10020650 3300025929 Bacteria 4886
292 Ga0207644_10025423 3300025931 Bacteria 4072
293 Ga0207706_10028525 3300025933 Bacteria 4985
294 Ga0207686_10016885 3300025934 Bacteria 4102
295 Ga0207686_10058938 3300025934 Bacteria 2423
296 Ga0207670_10006752 3300025936 Bacteria 6380
297 Ga0207669_10000863 3300025937 Bacteria 12890
298 Ga0207704_10046904 3300025938 Bacteria 2579
299 Ga0207665_10015055 3300025939 Bacteria 5079
300 Ga0207665_10023005 3300025939 Bacteria 4104
301 Ga0207691_10001066 3300025940 Bacteria 27265
302 Ga0207691_10115165 3300025940 Bacteria 2387
303 Ga0207691_10223324 3300025940 Bacteria 1633
304 Ga0207711_10033586 3300025941 Bacteria 4343
305 Ga0207711_10053295 3300025941 Bacteria 3469
306 Ga0207689_10014103 3300025942 Bacteria 6802
307 Ga0207689_10064470 3300025942 Bacteria 3015
308 Ga0207661_10008365 3300025944 Bacteria 7390
309 Ga0207679_10082238 3300025945 Bacteria 2465
310 Ga0207667_10015706 3300025949 Bacteria 8586
311 Ga0207667_10086188 3300025949 Bacteria 3250
312 Ga0207667_10112620 3300025949 Bacteria 2806
313 Ga0207651_10052593 3300025960 Bacteria 2778
314 Ga0207668_10027564 3300025972 Bacteria 3701
315 Ga0207668_10056041 3300025972 Bacteria 2743
316 Ga0207668_10096998 3300025972 Bacteria 2180
317 Ga0207640_10043782 3300025981 Bacteria 2863
318 Ga0207640_10062950 3300025981 Bacteria 2463
319 Ga0207658_10187558 3300025986 Bacteria 1716
320 Ga0207677_10020594 3300026023 Bacteria 4008
321 Ga0207677_10021941 3300026023 Bacteria 3914
322 Ga0207703_10081755 3300026035 Bacteria 2694
323 Ga0207639_10016102 3300026041 Bacteria 5283
324 Ga0207639_10042274 3300026041 Bacteria 3415
325 Ga0207639_10161817 3300026041 Bacteria 1887
326 Ga0207639_10187317 3300026041 Bacteria 1765
327 Ga0207678_10015480 3300026067 Bacteria 6704
328 Ga0207678_10021335 3300026067 Bacteria 5680
329 Ga0207678_10033024 3300026067 Bacteria 4510
330 Ga0207702_10000002 3300026078 Bacteria 491507
331 Ga0207702_10224340 3300026078 Bacteria 1752
332 Ga0207641_10102572 3300026088 Bacteria 2523
333 Ga0207676_10014678 3300026095 Bacteria 5642
334 Ga0207674_10035719 3300026116 Bacteria 5186
335 Ga0207675_100047170 3300026118 Bacteria 4023
336 Ga0207675_100054178 3300026118 Bacteria 3741
337 Ga0207683_10000733 3300026121 Bacteria 29828
338 Ga0207683_10026522 3300026121 Bacteria 5000
339 Ga0207683_10040572 3300026121 Bacteria 4063
340 Ga0207683_10062061 3300026121 Bacteria 3291
341 Ga0207683_10155676 3300026121 Bacteria 2064
342 Ga0207698_10042438 3300026142 Bacteria 3398
343 Ga0207698_10134375 3300026142 Bacteria 2120
344 Ga0209389_1000107 3300027296 Bacteria 74129
345 Ga0209389_1005934 3300027296 Bacteria 10512
346 Ga0209589_1000001 3300027357 Bacteria 794224
347 Ga0209589_1000092 3300027357 Bacteria 89530
348 Ga0209489_100001 3300027361 Bacteria 794224
349 Ga0209489_100006 3300027361 Bacteria 475698
350 Ga0209489_107740 3300027361 Bacteria 15589
351 Ga0209700_100001 3300027363 Bacteria 794224
352 Ga0209700_100005 3300027363 Bacteria 573969
353 Ga0209179_1007546 3300027512 Bacteria 1799
354 Ga0209588_1004492 3300027671 Bacteria 3940
355 Ga0207428_10002661 3300027907 Bacteria 17803
356 Ga0268266_10019676 3300028379 Bacteria 5752
357 Ga0268266_10020771 3300028379 Bacteria 5598
358 Ga0268266_10032939 3300028379 Bacteria 4404
359 Ga0268266_10061421 3300028379 Bacteria 3241
360 Ga0268266_10103673 3300028379 Bacteria 2510
361 Ga0268264_10000065 3300028381 Bacteria 298403
362 Ga0265337_1002468 3300028556 Bacteria 8449
363 Ga0265326_10003263 3300028558 Bacteria 5347
364 Ga0265319_1007768 3300028563 Bacteria 4778
365 Ga0265334_10000456 3300028573 Bacteria 21294
366 Ga0265322_10005214 3300028654 Bacteria 3846
367 Ga0265336_10000431 3300028666 Bacteria 25844
368 Ga0307517_10000008 3300028786 Bacteria 243202
369 Ga0307515_10078762 3300028794 Bacteria 4327
370 Ga0265338_10000321 3300028800 Bacteria 87046
371 Ga0265325_10002771 3300031241 Bacteria 11703
372 Ga0307509_10010951 3300031507 Bacteria 11053
373 Ga0265313_10000057 3300031595 Bacteria 108544
374 Ga0307508_10000018 3300031616 Bacteria 202701
375 Ga0265342_10062453 3300031712 Bacteria 2192
376 Ga0307516_10004992 3300031730 Bacteria 16102
377 Ga0307516_10007832 3300031730 Bacteria 12187
378 Ga0307516_10074500 3300031730 Bacteria 3250
379 Ga0316583_10008041 3300032133 Bacteria 3799
380 Ga0307507_10054896 3300033179 Bacteria 3785
381 Ga0307510_10041204 3300033180 Bacteria 5055
382 Ga0315911_1000006 3300033442 Bacteria 414563
383 Ga0373930_0002890 3300034816 Bacteria 2698
384 Ga0373928_0008155 3300035084 Bacteria 2029
385 Ga0373951_0006833 3300035091 Bacteria 2606
386 Ga0373932_0014422 3300035112 Bacteria 1986
387 Ga0373932_0028239 3300035112 Bacteria 1541
388 Ga0373936_0007586 3300035113 Bacteria 4079
389 Ga0373945_0014942 3300035116 Bacteria 2607
390 Ga0373946_0016547 3300035171 Bacteria 2811
391 Ga0373961_0014265 3300035241 Bacteria 2016
392 Ga0373924_0003483 3300035410 Bacteria 5419
393 Ga0373931_0026734 3300035691 Bacteria 2940
394 Ga0373931_0062617 3300035691 Bacteria 2009
395 Ga0373935_0086268 3300035692 Bacteria 2048
396 Ga0373935_0157113 3300035692 Bacteria 1547
397 Ga0373935_0169814 3300035692 Bacteria 1491
398 Ga0373927_0011069 3300035695 Bacteria 6008
399 Ga0373927_0015919 3300035695 Bacteria 4963
400 Ga0373927_0032991 3300035695 Bacteria 3371
401 Ga0373927_0032996 3300035695 Bacteria 3371
402 Ga0373927_0078608 3300035695 Bacteria 2136
403 Ga0373927_0122259 3300035695 Bacteria 1699
404 Ga0373933_0000199 3300035724 Bacteria 39593
405 Ga0373933_0017531 3300035724 Bacteria 4017
406 Ga0373947_0032400 3300035725 Bacteria 3080
407 Ga0373937_0009602 3300036401 Bacteria 8421
408 Ga0395899_0003643 3300037312 Bacteria 12197
409 Ga0395900_0000820 3300037418 Bacteria 41179
410 Ga0395900_0005923 3300037418 Bacteria 12759
411 Ga0395900_0121081 3300037418 Bacteria 2685
412 Ga0395898_0026506 3300037466 Bacteria 5830
413 Ga0395898_0034063 3300037466 Bacteria 5079
414 Ga0395898_0065753 3300037466 Bacteria 3515
415 Ga0395898_0183684 3300037466 Bacteria 1998
416 Ga0395898_0200538 3300037466 Bacteria 1905
417 Ga0395905_0006498 3300037471 Bacteria 11758
418 Ga0395901_0081268 3300038443 Bacteria 3385
419 Ga0395901_0143576 3300038443 Bacteria 2509
420 Ga0395901_0181866 3300038443 Bacteria 2205
421 Ga0395901_0301519 3300038443 Bacteria 1661
422 Ga0436365_1358938 3300039437 Bacteria 3386
423 Ga0436365_1434183 3300039437 Bacteria 5621
424 Ga0436365_1827614 3300039437 Bacteria 7728
425 Ga0436365_1840276 3300039437 Bacteria 14090
426 Ga0436360_0105255 3300039438 Bacteria 5973
427 Ga0436360_0457068 3300039438 Bacteria 1730
428 Ga0436363_0602269 3300039450 Bacteria 5606
429 Ga0436363_1661094 3300039450 Bacteria 3360
430 Ga0436362_1200408 3300039453 Bacteria 1980
431 Ga0439465_0025951 3300041413 Bacteria 1851
432 Ga0451802_0581573 3300041460 Bacteria 1768
433 Ga0451833_0611236 3300041491 Bacteria 2362
434 Ga0439459_0011511 3300042438 Bacteria 1560
435 Ga0466972_0000846 3300044658 Bacteria 14671
436 Ga0466966_0000334 3300044684 Bacteria 30532
437 Ga0466961_0000509 3300044693 Bacteria 24794
438 Ga0466964_0032631 3300044706 Bacteria 2070
439 Ga0466971_0088137 3300044719 Bacteria 1419
440 Ga0466957_0039507 3300044842 Bacteria 2847
441 Ga0466959_0041260 3300045049 Bacteria 3407
442 Ga0466959_0128941 3300045049 Bacteria 1793
443 Ga0466959_0149357 3300045049 Bacteria 1648
444 Ga0466967_0009054 3300045976 Bacteria 7360
445 Ga0495592_0021156 3300046454 Bacteria 4947
446 Ga0495592_0038824 3300046454 Bacteria 3580
447 Ga0495590_0020654 3300046457 Bacteria 2339
448 Ga0495629_0027278 3300046459 Bacteria 4055
449 Ga0495629_0093125 3300046459 Bacteria 2103
450 Ga0495638_0023142 3300046460 Bacteria 4068
451 Ga0495651_0001733 3300046462 Bacteria 16846
452 Ga0495651_0035514 3300046462 Bacteria 3880
453 Ga0495653_0032482 3300046463 Bacteria 4143
454 Ga0495580_0007795 3300046472 Bacteria 8578
455 Ga0495580_0027236 3300046472 Bacteria 4159
456 Ga0495582_0004536 3300046473 Bacteria 7799
457 Ga0495582_0079896 3300046473 Bacteria 1816
458 Ga0495662_0002900 3300046476 Bacteria 8669
459 Ga0495664_0001939 3300046477 Bacteria 11029
460 Ga0495664_0086349 3300046477 Bacteria 1884
461 Ga0495585_0023733 3300046492 Bacteria 3519
462 Ga0495607_0122772 3300046501 Bacteria 1361
463 Ga0495606_0003754 3300046507 Bacteria 15805
464 Ga0495606_0028614 3300046507 Bacteria 3927
465 Ga0495606_0054429 3300046507 Bacteria 2591
466 Ga0495608_0005911 3300046511 Bacteria 8704
467 Ga0495618_0011828 3300046514 Bacteria 5296
468 Ga0495620_0039513 3300046515 Bacteria 2084
469 Ga0495628_0038168 3300046516 Bacteria 3846
470 Ga0495630_0025233 3300046517 Bacteria 4394
471 Ga0495632_0023647 3300046519 Bacteria 3278
472 Ga0495648_0107139 3300046524 Bacteria 1528
473 Ga0495666_0055889 3300046526 Bacteria 1891
474 Ga0495652_0062463 3300046529 Bacteria 3141
475 Ga0495665_0026130 3300046531 Bacteria 3136
476 Ga0495640_0085120 3300046533 Bacteria 2095
477 Ga0495587_0008847 3300046536 Bacteria 6463
478 Ga0495597_0066507 3300046542 Bacteria 1562
479 Ga0495645_0008821 3300046543 Bacteria 7043
480 Ga0495645_0157617 3300046543 Bacteria 1572
481 Ga0495622_0034647 3300046557 Bacteria 2355
482 Ga0495633_0032679 3300046558 Bacteria 2513
483 Ga0495633_0067740 3300046558 Bacteria 1666
484 Ga0495667_0003089 3300046559 Bacteria 11169
485 Ga0495667_0077291 3300046559 Bacteria 2165
486 Ga0495634_0055198 3300046642 Bacteria 2656
487 Ga0495611_0062309 3300046648 Bacteria 1696
488 Ga0495625_0086017 3300046660 Bacteria 2181
489 Ga0495635_0203174 3300046663 Bacteria 1343
490 Ga0495588_0013307 3300046674 Bacteria 3918
491 Ga0495588_0081212 3300046674 Bacteria 1692
492 Ga0495657_0007669 3300046675 Bacteria 8308
493 Ga0495657_0033170 3300046675 Bacteria 3597
494 Ga0495599_0025195 3300046678 Bacteria 3723
495 Ga0495599_0077350 3300046678 Bacteria 2077
496 Ga0495647_0007665 3300046681 Bacteria 3625
497 Ga0495658_0051124 3300046683 Bacteria 2340
498 Ga0495669_0015398 3300046684 Bacteria 3274
499 Ga0495669_0031811 3300046684 Bacteria 2317
500 Ga0495613_0051818 3300046689 Bacteria 3024
501 Ga0495613_0095977 3300046689 Bacteria 2144
502 Ga0495624_0024439 3300046690 Bacteria 3975
503 Ga0495670_0077501 3300046691 Bacteria 1690
504 Ga0495589_0081114 3300046794 Bacteria 1578
505 Ga0495589_0107393 3300046794 Bacteria 1348
506 Ga0495600_0008276 3300046809 Bacteria 6384
507 Ga0495581_0014251 3300047315 Bacteria 4610
508 Ga0495581_0053165 3300047315 Bacteria 2340
509 Ga0495604_0007727 3300047317 Bacteria 8516
510 Ga0495604_0185659 3300047317 Bacteria 1452
511 Ga0495674_0006216 3300047319 Bacteria 11455
512 Ga0495674_0029090 3300047319 Bacteria 5033
513 Ga0495674_0212053 3300047319 Bacteria 1604
514 Ga0495675_0009070 3300047444 Bacteria 6181
515 Ga0495677_0032688 3300047445 Bacteria 1895
516 Ga0495685_014509 3300047447 Bacteria 2678
517 Ga0495684_0023878 3300047471 Bacteria 4702
518 Ga0495684_0032468 3300047471 Bacteria 4009
519 Ga0495686_0074158 3300047472 Bacteria 2089
520 Ga0495686_0133937 3300047472 Bacteria 1467
521 Ga0495593_0043880 3300047673 Bacteria 2394
522 Ga0495593_0058470 3300047673 Bacteria 2022
523 Ga0495602_0058638 3300048088 Bacteria 3368
524 Ga0496100_0017591 3300048903 Bacteria 4223
525 Ga0496100_0022944 3300048903 Bacteria 3783
526 Ga0496100_0035027 3300048903 Bacteria 3155
527 Ga0496100_0052915 3300048903 Bacteria 2642
528 Ga0496100_0139005 3300048903 Bacteria 1719
529 Ga0496101_0021665 3300048904 Bacteria 4416
530 Ga0496101_0036585 3300048904 Bacteria 3477
531 Ga0496101_0091342 3300048904 Bacteria 2266
532 Ga0496102_0012241 3300048905 Bacteria 7420
533 Ga0496102_0040005 3300048905 Bacteria 4239
534 Ga0496102_0041888 3300048905 Bacteria 4148
535 Ga0496102_0042845 3300048905 Bacteria 4103
536 Ga0496102_0093932 3300048905 Bacteria 2779
537 Ga0496102_0133598 3300048905 Bacteria 2324
538 Ga0496102_0230263 3300048905 Bacteria 1747
539 Ga0496103_0017531 3300048906 Bacteria 4287
540 Ga0496104_0033245 3300048907 Bacteria 4803
541 Ga0496104_0173382 3300048907 Bacteria 2067
542 Ga0496105_0000527 3300048908 Bacteria 25240
543 Ga0496105_0012981 3300048908 Bacteria 6599
544 Ga0496105_0019719 3300048908 Bacteria 5440
545 Ga0496105_0039702 3300048908 Bacteria 3881
546 Ga0496105_0056097 3300048908 Bacteria 3252
547 Ga0496106_0002824 3300048909 Bacteria 12877
548 Ga0496106_0022677 3300048909 Bacteria 4665
549 Ga0496106_0025243 3300048909 Bacteria 4421
550 Ga0496106_0035401 3300048909 Bacteria 3733
551 Ga0496106_0091486 3300048909 Bacteria 2349
552 Ga0496106_0159657 3300048909 Bacteria 1782
553 Ga0496107_0010480 3300048910 Bacteria 6443
554 Ga0496107_0043491 3300048910 Bacteria 3227
555 Ga0496107_0175572 3300048910 Bacteria 1590
556 Ga0496108_0038348 3300048911 Bacteria 3991
557 Ga0496108_0049993 3300048911 Bacteria 3498
558 Ga0496108_0286721 3300048911 Bacteria 1433
559 Ga0496108_0337881 3300048911 Bacteria 1314
560 Ga0496109_0039798 3300048912 Bacteria 4256
561 Ga0496109_0126886 3300048912 Bacteria 2379
562 Ga0496110_0020119 3300048913 Bacteria 5630
563 Ga0496110_0030628 3300048913 Bacteria 4638
564 Ga0496110_0038517 3300048913 Bacteria 4161
565 Ga0496110_0075282 3300048913 Bacteria 2999
566 Ga0496112_0000004 3300048915 Bacteria 553294
567 Ga0496112_0025892 3300048915 Bacteria 5637
568 Ga0496112_0080722 3300048915 Bacteria 3216
569 Ga0496112_0088836 3300048915 Bacteria 3058
570 Ga0496112_0127498 3300048915 Bacteria 2515
571 Ga0496112_0137207 3300048915 Bacteria 2416
572 Ga0496112_0160489 3300048915 Bacteria 2215
573 Ga0496112_0160931 3300048915 Bacteria 2211
574 Ga0496113_0016119 3300048916 Bacteria 5157
575 Ga0496113_0020357 3300048916 Bacteria 4663
576 Ga0496113_0087530 3300048916 Bacteria 2395
577 Ga0496113_0107667 3300048916 Bacteria 2166
578 Ga0496114_0017928 3300048917 Bacteria 5722
579 Ga0496114_0029802 3300048917 Bacteria 4486
580 Ga0496114_0030675 3300048917 Bacteria 4423
581 Ga0496114_0306772 3300048917 Bacteria 1402
582 Ga0496115_0006668 3300048918 Bacteria 8471
583 Ga0496115_0011990 3300048918 Bacteria 6514
584 Ga0496115_0022969 3300048918 Bacteria 4837
585 Ga0496115_0054034 3300048918 Bacteria 3224
586 Ga0496115_0073822 3300048918 Bacteria 2769
587 Ga0496117_0038468 3300048920 Bacteria 3546
588 Ga0496118_0004964 3300048921 Bacteria 15387
589 Ga0496118_0034989 3300048921 Bacteria 4087
590 Ga0496119_0064811 3300048922 Bacteria 2167
591 Ga0496121_0000594 3300048924 Bacteria 67953
592 Ga0496121_0002820 3300048924 Bacteria 25702
593 Ga0496121_0017933 3300048924 Bacteria 7181
594 Ga0496121_0019022 3300048924 Bacteria 6890
595 Ga0496121_0043405 3300048924 Bacteria 3894
596 Ga0496121_0064220 3300048924 Bacteria 2994
597 Ga0496122_0154419 3300048925 Bacteria 1411
598 Ga0496124_0002651 3300048927 Bacteria 22984
599 Ga0496125_0090455 3300048928 Bacteria 2297
600 Ga0496125_0177172 3300048928 Bacteria 1425
601 Ga0496126_0004957 3300048929 Bacteria 15524
602 Ga0496126_0014996 3300048929 Bacteria 7812
603 Ga0496126_0031625 3300048929 Bacteria 4995
604 Ga0496126_0040728 3300048929 Bacteria 4305
605 Ga0496126_0051557 3300048929 Bacteria 3745
606 Ga0496126_0057631 3300048929 Bacteria 3505
607 Ga0496126_0074051 3300048929 Bacteria 3025
608 Ga0496126_0080022 3300048929 Bacteria 2892
609 Ga0496126_0092051 3300048929 Bacteria 2665
610 Ga0496126_0130321 3300048929 Bacteria 2174
611 Ga0496126_0250356 3300048929 Bacteria 1477
612 Ga0501031_0107942 3300049568 Bacteria 1817
613 Ga0501033_0107514 3300049570 Bacteria 2032
614 Ga0501034_0015888 3300049571 Bacteria 7730
615 Ga0501036_0163739 3300049572 Bacteria 1875
616 Ga0501040_0193437 3300049576 Bacteria 1444
617 Ga0501041_0087879 3300049577 Bacteria 1919
618 Ga0501046_0156502 3300049580 Bacteria 1716
619 Ga0501047_0007358 3300049581 Bacteria 10352
620 Ga0501067_0039560 3300049583 Bacteria 2618
621 Ga0501067_0078902 3300049583 Bacteria 1824
622 Ga0501070_0003226 3300049586 Bacteria 14186
623 Ga0501080_0125288 3300049742 Bacteria 2379
624 nmdc:mga03n38_428_c1 3300050490 Bacteria 10457
625 nmdc:mga0k408_97893_c1 3300050493 Bacteria 1728
626 nmdc:mga06z11_38973_c1 3300050494 Bacteria 2363
627 nmdc:mga07m45_12666_c1 3300050496 Bacteria 4461
628 nmdc:mga07m45_30295_c1 3300050496 Bacteria 2996
629 nmdc:mga05p37_180885_c1 3300050507 Bacteria 2565
630 nmdc:mga05p37_7887_c1 3300050507 Bacteria 12566
631 nmdc:mga09592_2960_c1 3300050508 Bacteria 13764
632 nmdc:mga06r32_1710_c1 3300050510 Bacteria 19764
633 nmdc:mga06r32_32730_c1 3300050510 Bacteria 4894
634 nmdc:mga08y16_213_c1 3300050511 Bacteria 51950
635 nmdc:mga0n895_36971_c1 3300050512 Bacteria 4719
636 nmdc:mga0rr50_69712_c1 3300050513 Bacteria 2677
637 nmdc:mga0sz30_1328_c1 3300050516 Bacteria 8808
638 Ga0495601_0029670 3300053077 Bacteria 3394
639 Ga0500635_0008920 3300053080 Bacteria 2766
640 Ga0495595_0016428 3300053084 Bacteria 3167
641 Ga0495619_0033553 3300053085 Bacteria 3334
642 Ga0495619_0148854 3300053085 Bacteria 1614
643 Ga0500643_000007 3300053087 Bacteria 462836
644 Ga0500647_0010746 3300053091 Bacteria 4062
645 Ga0500647_0036572 3300053091 Bacteria 2348
646 Ga0500566_0000204 3300053094 Bacteria 31169
647 Ga0500566_0003695 3300053094 Bacteria 9139
648 Ga0500566_0035645 3300053094 Bacteria 2890
649 Ga0500640_062702 3300053095 Bacteria 1608
650 Ga0500641_0074714 3300053096 Bacteria 1431
651 Ga0500556_0005665 3300053104 Bacteria 3526
652 Ga0500557_000052 3300053105 Bacteria 50636
653 Ga0500562_018107 3300053108 Bacteria 1818
654 Ga0500572_000307 3300053111 Bacteria 17413
655 Ga0500572_000451 3300053111 Bacteria 14277
656 Ga0500595_002911 3300053119 Bacteria 8191
657 Ga0500595_009999 3300053119 Bacteria 3794
658 Ga0500595_020826 3300053119 Bacteria 2351
659 Ga0500607_024838 3300053121 Bacteria 3340
660 Ga0500608_003260 3300053122 Bacteria 6047
661 Ga0500642_0029960 3300053130 Bacteria 2260
662 Ga0500655_007298 3300053133 Bacteria 1988
663 Ga0500559_0000143 3300053136 Bacteria 55572
664 Ga0500559_0001636 3300053136 Bacteria 12414
665 Ga0500590_010413 3300053148 Bacteria 4697
666 Ga0500603_000834 3300053150 Bacteria 7360
667 Ga0500616_0007501 3300053153 Bacteria 6916
668 Ga0500622_0008171 3300053156 Bacteria 5878
669 Ga0500630_000027 3300053159 Bacteria 42085
670 Ga0500638_003956 3300053162 Bacteria 5606
671 Ga0500639_000020 3300053163 Bacteria 102959
672 Ga0500639_008513 3300053163 Bacteria 5351
673 Ga0500636_0000042 3300053177 Bacteria 69412
674 Ga0500637_0000132 3300053178 Bacteria 27236
675 Ga0500596_004772 3300053735 Bacteria 2452
676 Ga0500596_006899 3300053735 Bacteria 1888
677 Ga0500599_002750 3300053736 Bacteria 2123
678 Ga0500601_000228 3300053737 Bacteria 11112
679 Ga0500661_002508 3300055283 Bacteria 3465
680 Ga0500661_021927 3300055283 Bacteria 1133

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0337881 Ga0496108_0337881_248_1300 347
2 3300047317 Ga0495604_0185659 Ga0495604_0185659_384_1442 350
3 3300053096 Ga0500641_0074714 Ga0500641_0074714_10_1068 350
4 3300047472 Ga0495686_0074158 Ga0495686_0074158_967_2076 360
5 3300048920 Ga0496117_0038468 Ga0496117_0038468_2438_3535 362
6 3300055283 Ga0500661_021927 Ga0500661_021927_26_1123 362
7 iso_pu_bacteria 8019629233 8019634047 362
8 3300046501 Ga0495607_0122772 Ga0495607_0122772_239_1348 366
9 3300046691 Ga0495670_0077501 Ga0495670_0077501_20_1129 366
10 3300053085 Ga0495619_0148854 Ga0495619_0148854_20_1129 366
11 3300035091 Ga0373951_0006833 Ga0373951_0006833_17_1132 371
12 3300046543 Ga0495645_0157617 Ga0495645_0157617_411_1556 378
13 3300035692 Ga0373935_0169814 Ga0373935_0169814_255_1481 397
14 3300053153 Ga0500616_0007501 Ga0500616_0007501_4586_5863 397
15 3300005340 Ga0070689_100011851 Ga0070689_1000118514 398
16 3300025936 Ga0207670_10006752 Ga0207670_100067525 398
17 3300048917 Ga0496114_0306772 Ga0496114_0306772_134_1366 398
18 iso_pu_bacteria 8019565922 8019569111 401
19 3300053735 Ga0500596_004772 Ga0500596_004772_1222_2439 402
20 3300046472 Ga0495580_0027236 Ga0495580_0027236_631_1842 403
21 3300046476 Ga0495662_0002900 Ga0495662_0002900_6828_8039 403
22 3300046648 Ga0495611_0062309 Ga0495611_0062309_18_1229 403
23 3300048907 Ga0496104_0173382 Ga0496104_0173382_12_1223 403
24 3300005468 Ga0070707_100307055 Ga0070707_1003070551 405
25 3300005539 Ga0068853_100047159 Ga0068853_1000471592 405
26 3300025917 Ga0207660_10059240 Ga0207660_100592402 405
27 3300035692 Ga0373935_0086268 Ga0373935_0086268_667_1947 405
28 3300036401 Ga0373937_0009602 Ga0373937_0009602_4673_5953 405
29 3300046558 Ga0495633_0067740 Ga0495633_0067740_15_1241 405
30 3300048911 Ga0496108_0286721 Ga0496108_0286721_38_1264 405
31 3300048925 Ga0496122_0154419 Ga0496122_0154419_136_1362 405
32 3300048928 Ga0496125_0177172 Ga0496125_0177172_187_1413 405
33 3300050493 nmdc:mga0k408_97893_c1 nmdc:mga0k408_97893_c1_489_1715 405
34 3300005436 Ga0070713_100156741 Ga0070713_1001567412 406
35 3300035695 Ga0373927_0122259 Ga0373927_0122259_45_1274 406
36 3300035241 Ga0373961_0014265 Ga0373961_0014265_621_1898 407
37 3300039437 Ga0436365_1827614 Ga0436365_1827614_4985_6268 408
38 3300005436 Ga0070713_100006657 Ga0070713_1000066571 410
39 3300006028 Ga0070717_10000905 Ga0070717_1000090515 410
40 3300025928 Ga0207700_10001663 Ga0207700_1000166313 410
41 3300005439 Ga0070711_100018998 Ga0070711_1000189984 414
42 3300006175 Ga0070712_100128936 Ga0070712_1001289362 414
43 3300013306 Ga0163162_10149875 Ga0163162_101498752 414
44 3300017792 Ga0163161_10193280 Ga0163161_101932802 414
45 3300025915 Ga0207693_10124909 Ga0207693_101249092 414
46 3300035695 Ga0373927_0032996 Ga0373927_0032996_1305_2582 414
47 3300046674 Ga0495588_0081212 Ga0495588_0081212_158_1435 414
48 3300047315 Ga0495581_0053165 Ga0495581_0053165_425_1702 414
49 3300048903 Ga0496100_0139005 Ga0496100_0139005_422_1699 414
50 3300048905 Ga0496102_0042845 Ga0496102_0042845_1959_3236 414
51 3300048918 Ga0496115_0011990 Ga0496115_0011990_1004_2281 414
52 3300045049 Ga0466959_0041260 Ga0466959_0041260_20_1276 415
53 3300005985 Ga0081539_10017427 Ga0081539_100174275 416
54 3300037418 Ga0395900_0121081 Ga0395900_0121081_301_1578 416
55 3300048924 Ga0496121_0000594 Ga0496121_0000594_53723_55000 416
56 3300028379 Ga0268266_10103673 Ga0268266_101036732 417
57 iso_pu_bacteria 2507262055 2507508207 418
58 iso_pu_bacteria 2508501009 2508542273 418
59 iso_pu_bacteria 2508501042 2508691961 418
60 iso_pu_bacteria 2508501128 2509151473 418
61 iso_pu_bacteria 2511231028 2511398750 418
62 iso_pu_bacteria 2513237092 2513622337 418
63 iso_pu_bacteria 2513237094 2513640514 418
64 iso_pu_bacteria 2513237095 2513645426 418
65 iso_pu_bacteria 2513237096 2513657068 418
66 iso_pu_bacteria 2513237098 2513676602 418
67 iso_pu_bacteria 2513237101 2513692912 418
68 iso_pu_bacteria 2513237102 2513701733 418
69 iso_pu_bacteria 2513237104 2513718375 418
70 iso_pu_bacteria 2513237137 2513855509 418
71 iso_pu_bacteria 2513237139 2513873155 418
72 iso_pu_bacteria 2513237141 2513890002 418
73 iso_pu_bacteria 2513237145 2513918808 418
74 iso_pu_bacteria 2513237161 2514016500 418
75 iso_pu_bacteria 2515154112 2515627286 418
76 iso_pu_bacteria 2517093001 2517102603 418
77 iso_pu_bacteria 2517572143 2517892055 418
78 iso_pu_bacteria 2524023205 2524437752 418
79 iso_pu_bacteria 2524023210 2524470380 418
80 iso_pu_bacteria 2524023228 2524534138 418
81 iso_pu_bacteria 2528768022 2528848724 418
82 iso_pu_bacteria 2617270735 2617346978 418
83 iso_pu_bacteria 2617270741 2617375396 418
84 iso_pu_bacteria 2667528175 2671121908 418
85 iso_pu_bacteria 2721755755 2723846539 418
86 iso_pu_bacteria 2728368998 2728753005 418
87 iso_pu_bacteria 2744054633 2745074840 418
88 iso_pu_bacteria 2791355196 2793062579 418
89 iso_pu_bacteria 2791355197 2793068870 418
90 iso_pu_bacteria 2791355199 2793079947 418
91 iso_pu_bacteria 2802429603 2805914946 418
92 iso_pu_bacteria 2816332527 2818239663 418
93 iso_pu_bacteria 2824600985 2824602341 418
94 iso_pu_bacteria 2824609381 2824610565 418
95 iso_pu_bacteria 2824617872 2824618126 418
96 iso_pu_bacteria 2824626560 2824626794 418
97 iso_pu_bacteria 2824635225 2824636571 418
98 iso_pu_bacteria 2824644064 2824645105 418
99 iso_pu_bacteria 2824653114 2824654310 418
100 iso_pu_bacteria 2824661429 2824661611 418
101 iso_pu_bacteria 2824671348 2824672057 418
102 iso_pu_bacteria 2824679649 2824679885 418
103 iso_pu_bacteria 2824687955 2824688656 418
104 iso_pu_bacteria 2824696289 2824697106 418
105 iso_pu_bacteria 2824704595 2824705070 418
106 iso_pu_bacteria 2824714736 2824720399 418
107 iso_pu_bacteria 2824723954 2824729467 418
108 iso_pu_bacteria 2824732956 2824734586 418
109 iso_pu_bacteria 2824746037 2824749878 418
110 iso_pu_bacteria 2824753945 2824754392 418
111 iso_pu_bacteria 2824763712 2824767891 418
112 iso_pu_bacteria 2824773399 2824780370 418
113 iso_pu_bacteria 2838122688 2838123330 418
114 iso_pu_bacteria 2841941048 2841946623 418
115 iso_pu_bacteria 2841949485 2841954145 418
116 iso_pu_bacteria 2841957949 2841960996 418
117 iso_pu_bacteria 2841966195 2841969521 418
118 iso_pu_bacteria 2841974524 2841974594 418
119 iso_pu_bacteria 2841983080 2841983845 418
120 iso_pu_bacteria 2842038055 2842040200 418
121 iso_pu_bacteria 2842045827 2842046855 418
122 iso_pu_bacteria 2844315083 2844319426 418
123 iso_pu_bacteria 2847930680 2847936597 418
124 iso_pu_bacteria 2847939898 2847946946 418
125 iso_pu_bacteria 2849076700 2849078945 418
126 iso_pu_bacteria 2857509624 2857515927 418
127 iso_pu_bacteria 2874590934 2874598422 418
128 iso_pu_bacteria 2874604998 2874605560 418
129 iso_pu_bacteria 2874612657 2874619356 418
130 iso_pu_bacteria 2874620515 2874626425 418
131 iso_pu_bacteria 2874628541 2874632289 418
132 iso_pu_bacteria 2874645413 2874652523 418
133 iso_pu_bacteria 2876761206 2876764971 418
134 iso_pu_bacteria 2876771140 2876778100 418
135 iso_pu_bacteria 2876808645 2876816514 418
136 iso_pu_bacteria 2876818435 2876826031 418
137 iso_pu_bacteria 2879074833 2879081894 418
138 iso_pu_bacteria 2879083081 2879088059 418
139 iso_pu_bacteria 2879099564 2879108365 418
140 iso_pu_bacteria 2879110137 2879115874 418
141 iso_pu_bacteria 2879127579 2879135016 418
142 iso_pu_bacteria 2879142872 2879149701 418
143 iso_pu_bacteria 2881364244 2881368449 418
144 iso_pu_bacteria 2881665667 2881672518 418
145 iso_pu_bacteria 2885366525 2885369274 418
146 iso_pu_bacteria 2885374607 2885375917 418
147 iso_pu_bacteria 2885383462 2885387861 418
148 iso_pu_bacteria 2885409591 2885413299 418
149 iso_pu_bacteria 2888378607 2888384495 418
150 iso_pu_bacteria 2888388044 2888393413 418
151 iso_pu_bacteria 2888419890 2888424940 418
152 iso_pu_bacteria 2889033259 2889039395 418
153 iso_pu_bacteria 2903727486 2903734368 418
154 iso_pu_bacteria 2903748898 2903753437 418
155 iso_pu_bacteria 2903768456 2903771877 418
156 iso_pu_bacteria 2904666416 2904671764 418
157 iso_pu_bacteria 2904690495 2904694888 418
158 iso_pu_bacteria 2904699407 2904702166 418
159 iso_pu_bacteria 2904711408 2904715115 418
160 iso_pu_bacteria 2906602504 2906605612 418
161 iso_pu_bacteria 2906610324 2906617182 418
162 iso_pu_bacteria 2906626472 2906627147 418
163 iso_pu_bacteria 2906635258 2906639245 418
164 iso_pu_bacteria 2906643746 2906646178 418
165 iso_pu_bacteria 2906660503 2906662444 418
166 iso_pu_bacteria 2908739725 2908742330 418
167 iso_pu_bacteria 2908756301 2908759971 418
168 iso_pu_bacteria 2908775508 2908780546 418
169 iso_pu_bacteria 2922361189 2922365745 418
170 iso_pu_bacteria 2922368715 2922374911 418
171 iso_pu_bacteria 2922386360 2922391316 418
172 iso_pu_bacteria 2922393267 2922394552 418
173 iso_pu_bacteria 2922425934 2922430647 418
174 iso_pu_bacteria 2929615660 2929621953 418
175 iso_pu_bacteria 2929624759 2929629740 418
176 iso_pu_bacteria 2932784394 2932788818 418
177 iso_pu_bacteria 2932794094 2932797979 418
178 iso_pu_bacteria 2932801729 2932807178 418
179 iso_pu_bacteria 2932809354 2932812793 418
180 iso_pu_bacteria 2932818245 2932819115 418
181 iso_pu_bacteria 2932828146 2932830484 418
182 iso_pu_bacteria 2933577622 2933583772 418
183 iso_pu_bacteria 2935608549 2935609310 418
184 iso_pu_bacteria 2935616580 2935616779 418
185 iso_pu_bacteria 2935630451 2935631190 418
186 iso_pu_bacteria 2935638405 2935641891 418
187 iso_pu_bacteria 2935648319 2935650901 418
188 iso_pu_bacteria 2935656913 2935659082 418
189 iso_pu_bacteria 2935665750 2935673022 418
190 iso_pu_bacteria 2935675223 2935675827 418
191 iso_pu_bacteria 2935684952 2935685824 418
192 iso_pu_bacteria 2935694250 2935697930 418
193 iso_pu_bacteria 2935703347 2935705664 418
194 iso_pu_bacteria 2935713505 2935714376 418
195 iso_pu_bacteria 2935722832 2935724995 418
196 iso_pu_bacteria 2935732158 2935732646 418
197 iso_pu_bacteria 2935741537 2935742025 418
198 iso_pu_bacteria 2935750917 2935751789 418
199 iso_pu_bacteria 2935760218 2935765046 418
200 iso_pu_bacteria 2935769743 2935771663 418
201 iso_pu_bacteria 2935777560 2935778922 418
202 iso_pu_bacteria 2935785616 2935791157 418
203 iso_pu_bacteria 2935793552 2935795514 418
204 iso_pu_bacteria 2935801545 2935802642 418
205 iso_pu_bacteria 2935810662 2935813528 418
206 iso_pu_bacteria 2935819856 2935822470 418
207 iso_pu_bacteria 2935827899 2935830058 418
208 iso_pu_bacteria 2935837841 2935837976 418
209 iso_pu_bacteria 2935847175 2935848053 418
210 iso_pu_bacteria 2935855204 2935855403 418
211 iso_pu_bacteria 2935864058 2935867353 418
212 iso_pu_bacteria 2935873716 2935875828 418
213 iso_pu_bacteria 2935883170 2935885826 418
214 iso_pu_bacteria 2935908558 2935908724 418
215 iso_pu_bacteria 2935916978 2935917870 418
216 iso_pu_bacteria 2935926038 2935926702 418
217 iso_pu_bacteria 2935934488 2935935152 418
218 iso_pu_bacteria 2935942939 2935943602 418
219 iso_pu_bacteria 2935951376 2935952040 418
220 iso_pu_bacteria 2935959822 2935960813 418
221 iso_pu_bacteria 2935967501 2935968165 418
222 iso_pu_bacteria 2935975950 2935978780 418
223 iso_pu_bacteria 2935984226 2935987351 418
224 iso_pu_bacteria 2935992306 2935996492 418
225 iso_pu_bacteria 2936002035 2936003772 418
226 iso_pu_bacteria 2936011229 2936013497 418
227 iso_pu_bacteria 2936019824 2936022376 418
228 iso_pu_bacteria 2936028420 2936030822 418
229 iso_pu_bacteria 2936037263 2936042477 418
230 iso_pu_bacteria 2936046547 2936048635 418
231 iso_pu_bacteria 2936055302 2936058849 418
232 iso_pu_bacteria 2940556831 2940557408 418
233 iso_pu_bacteria 2941507105 2941509931 418
234 iso_pu_bacteria 2941515067 2941518982 418
235 iso_pu_bacteria 2941523033 2941525330 418
236 iso_pu_bacteria 2941531003 2941533197 418
237 iso_pu_bacteria 2941538514 2941539358 418
238 iso_pu_bacteria 3005474847 3005480565 418
239 iso_pu_bacteria 3005483717 3005484676 418
240 iso_pu_bacteria 3005506211 3005510687 418
241 iso_pu_bacteria 3005587118 3005587674 418
242 iso_pu_bacteria 3005594810 3005599638 418
243 iso_pu_bacteria 3005710791 3005715288 418
244 iso_pu_bacteria 3005718088 3005722666 418
245 iso_pu_bacteria 8006926726 8006933135 418
246 iso_pu_bacteria 8006964411 8006969659 418
247 iso_pu_bacteria 8006984368 8006987878 418
248 iso_pu_bacteria 8006994254 8006995652 418
249 iso_pu_bacteria 8016522445 8016529217 418
250 iso_pu_bacteria 8016539877 8016547652 418
251 iso_pu_bacteria 8016548790 8016554487 418
252 iso_pu_bacteria 8016557553 8016562860 418
253 iso_pu_bacteria 8016566248 8016572769 418
254 iso_pu_bacteria 8016595262 8016600635 418
255 iso_pu_bacteria 8016603502 8016610102 418
256 iso_pu_bacteria 8016613128 8016614836 418
257 iso_pu_bacteria 8016622563 8016626145 418
258 iso_pu_bacteria 8016630954 8016639927 418
259 iso_pu_bacteria 8017057580 8017063844 418
260 iso_pu_bacteria 8019530166 8019534190 418
261 iso_pu_bacteria 8019538911 8019545272 418
262 iso_pu_bacteria 8019555841 8019556198 418
263 iso_pu_bacteria 8019576017 8019583194 418
264 iso_pu_bacteria 8019586578 8019591001 418
265 iso_pu_bacteria 8019597564 8019600344 418
266 iso_pu_bacteria 8019619141 8019628589 418
267 iso_pu_bacteria 8019638758 8019645683 418
268 iso_pu_bacteria 8019648815 8019658950 418
269 iso_pu_bacteria 8019659431 8019661927 418
270 iso_pu_bacteria 8019668869 8019671449 418
271 iso_pu_bacteria 8019678201 8019684655 418
272 iso_pu_bacteria 8019687851 8019690480 418
273 iso_pu_bacteria 8055742211 8055745882 418
274 iso_pu_bacteria 8056673599 8056676935 418
275 iso_pu_bacteria 8056689827 8056692235 418
276 iso_pu_bacteria 8056967851 8056968417 418
277 3300005985 Ga0081539_10077999 Ga0081539_100779992 419
278 3300049570 Ga0501033_0107514 Ga0501033_0107514_172_1440 420
279 3300005333 Ga0070677_10001849 Ga0070677_100018494 421
280 3300005356 Ga0070674_100001777 Ga0070674_1000017778 421
281 3300005364 Ga0070673_100101825 Ga0070673_1001018253 421
282 3300005365 Ga0070688_100019250 Ga0070688_1000192502 421
283 3300005544 Ga0070686_100010545 Ga0070686_1000105456 421
284 3300005843 Ga0068860_100000213 Ga0068860_10000021366 421
285 3300005937 Ga0081455_10012693 Ga0081455_100126939 421
286 3300005983 Ga0081540_1018868 Ga0081540_10188684 421
287 3300005983 Ga0081540_1028488 Ga0081540_10284882 421
288 3300007788 Ga0099795_10000154 Ga0099795_100001543 421
289 3300009551 Ga0105238_10011980 Ga0105238_100119807 421
290 3300010159 Ga0099796_10000092 Ga0099796_1000009214 421
291 3300014745 Ga0157377_10028838 Ga0157377_100288382 421
292 3300025893 Ga0207682_10000451 Ga0207682_100004516 421
293 3300025899 Ga0207642_10023088 Ga0207642_100230882 421
294 3300025900 Ga0207710_10063399 Ga0207710_100633992 421
295 3300025901 Ga0207688_10060214 Ga0207688_100602142 421
296 3300025938 Ga0207704_10046904 Ga0207704_100469042 421
297 3300025940 Ga0207691_10001066 Ga0207691_1000106612 421
298 3300026035 Ga0207703_10081755 Ga0207703_100817552 421
299 3300026121 Ga0207683_10000733 Ga0207683_100007336 421
300 3300027512 Ga0209179_1007546 Ga0209179_10075462 421
301 3300028381 Ga0268264_10000065 Ga0268264_10000065165 421
302 3300028556 Ga0265337_1002468 Ga0265337_10024685 421
303 3300028558 Ga0265326_10003263 Ga0265326_100032633 421
304 3300028563 Ga0265319_1007768 Ga0265319_10077686 421
305 3300028573 Ga0265334_10000456 Ga0265334_100004566 421
306 3300028654 Ga0265322_10005214 Ga0265322_100052143 421
307 3300028666 Ga0265336_10000431 Ga0265336_100004313 421
308 3300028800 Ga0265338_10000321 Ga0265338_1000032147 421
309 3300035691 Ga0373931_0062617 Ga0373931_0062617_465_1736 421
310 3300047472 Ga0495686_0133937 Ga0495686_0133937_37_1308 421
311 3300049571 Ga0501034_0015888 Ga0501034_0015888_4870_6138 421
312 3300049583 Ga0501067_0039560 Ga0501067_0039560_474_1748 421
313 3300001979 JGI24740J21852_10007980 JGI24740J21852_100079802 422
314 3300001990 JGI24737J22298_10001022 JGI24737J22298_100010228 422
315 3300003203 JGI25406J46586_10000027 JGI25406J46586_1000002730 422
316 3300003215 JGI25153J46596_10001910 JGI25153J46596_100019109 422
317 3300003215 JGI25153J46596_10007386 JGI25153J46596_100073862 422
318 3300003354 JGI25160J50197_1003482 JGI25160J50197_10034824 422
319 3300005262 Ga0065165_1001157 Ga0065165_100115724 422
320 3300005262 Ga0065165_1001250 Ga0065165_10012504 422
321 3300005262 Ga0065165_1013791 Ga0065165_10137912 422
322 3300005327 Ga0070658_10037250 Ga0070658_100372503 422
323 3300005327 Ga0070658_10037583 Ga0070658_100375832 422
324 3300005327 Ga0070658_10189564 Ga0070658_101895641 422
325 3300005328 Ga0070676_10110293 Ga0070676_101102932 422
326 3300005329 Ga0070683_100007257 Ga0070683_1000072573 422
327 3300005329 Ga0070683_100041674 Ga0070683_1000416742 422
328 3300005336 Ga0070680_100037008 Ga0070680_1000370082 422
329 3300005336 Ga0070680_100046889 Ga0070680_1000468893 422
330 3300005337 Ga0070682_100119280 Ga0070682_1001192802 422
331 3300005338 Ga0068868_100033605 Ga0068868_1000336052 422
332 3300005339 Ga0070660_100116491 Ga0070660_1001164911 422
333 3300005344 Ga0070661_100165579 Ga0070661_1001655791 422
334 3300005345 Ga0070692_10117649 Ga0070692_101176491 422
335 3300005347 Ga0070668_100116225 Ga0070668_1001162251 422
336 3300005355 Ga0070671_100044589 Ga0070671_1000445894 422
337 3300005356 Ga0070674_100038774 Ga0070674_1000387743 422
338 3300005364 Ga0070673_100082352 Ga0070673_1000823521 422
339 3300005366 Ga0070659_100080254 Ga0070659_1000802542 422
340 3300005367 Ga0070667_100217489 Ga0070667_1002174891 422
341 3300005434 Ga0070709_10006118 Ga0070709_100061184 422
342 3300005434 Ga0070709_10009846 Ga0070709_100098466 422
343 3300005435 Ga0070714_100006896 Ga0070714_1000068966 422
344 3300005435 Ga0070714_100054219 Ga0070714_1000542194 422
345 3300005435 Ga0070714_100120760 Ga0070714_1001207602 422
346 3300005436 Ga0070713_100018188 Ga0070713_1000181885 422
347 3300005436 Ga0070713_100029306 Ga0070713_1000293062 422
348 3300005436 Ga0070713_100081025 Ga0070713_1000810252 422
349 3300005437 Ga0070710_10001287 Ga0070710_1000128710 422
350 3300005437 Ga0070710_10008883 Ga0070710_100088836 422
351 3300005439 Ga0070711_100004377 Ga0070711_1000043777 422
352 3300005439 Ga0070711_100007383 Ga0070711_1000073834 422
353 3300005445 Ga0070708_100187817 Ga0070708_1001878172 422
354 3300005455 Ga0070663_100025670 Ga0070663_1000256703 422
355 3300005455 Ga0070663_100026936 Ga0070663_1000269363 422
356 3300005456 Ga0070678_100035084 Ga0070678_1000350842 422
357 3300005456 Ga0070678_100036024 Ga0070678_1000360242 422
358 3300005458 Ga0070681_10009117 Ga0070681_100091174 422
359 3300005458 Ga0070681_10014556 Ga0070681_100145564 422
360 3300005467 Ga0070706_100186628 Ga0070706_1001866281 422
361 3300005471 Ga0070698_100122608 Ga0070698_1001226082 422
362 3300005530 Ga0070679_100013382 Ga0070679_1000133826 422
363 3300005530 Ga0070679_100020776 Ga0070679_1000207764 422
364 3300005530 Ga0070679_100064758 Ga0070679_1000647582 422
365 3300005536 Ga0070697_100181907 Ga0070697_1001819072 422
366 3300005539 Ga0068853_100000785 Ga0068853_1000007852 422
367 3300005539 Ga0068853_100002462 Ga0068853_1000024622 422
368 3300005539 Ga0068853_100149314 Ga0068853_1001493141 422
369 3300005548 Ga0070665_100021594 Ga0070665_1000215945 422
370 3300005548 Ga0070665_100094902 Ga0070665_1000949022 422
371 3300005549 Ga0070704_100147792 Ga0070704_1001477922 422
372 3300005563 Ga0068855_100062119 Ga0068855_1000621191 422
373 3300005577 Ga0068857_100049082 Ga0068857_1000490822 422
374 3300005577 Ga0068857_100088587 Ga0068857_1000885873 422
375 3300005577 Ga0068857_100140978 Ga0068857_1001409782 422
376 3300005578 Ga0068854_100002059 Ga0068854_10000205912 422
377 3300005578 Ga0068854_100175546 Ga0068854_1001755462 422
378 3300005614 Ga0068856_100001874 Ga0068856_1000018749 422
379 3300005614 Ga0068856_100015688 Ga0068856_1000156882 422
380 3300005616 Ga0068852_100142022 Ga0068852_1001420222 422
381 3300005616 Ga0068852_100156924 Ga0068852_1001569242 422
382 3300005719 Ga0068861_100040451 Ga0068861_1000404512 422
383 3300005834 Ga0068851_10000665 Ga0068851_1000066513 422
384 3300005834 Ga0068851_10001506 Ga0068851_100015062 422
385 3300005841 Ga0068863_100049875 Ga0068863_1000498752 422
386 3300005843 Ga0068860_100307018 Ga0068860_1003070181 422
387 3300005844 Ga0068862_100187925 Ga0068862_1001879252 422
388 3300005937 Ga0081455_10018614 Ga0081455_100186145 422
389 3300005937 Ga0081455_10052412 Ga0081455_100524122 422
390 3300005983 Ga0081540_1001168 Ga0081540_100116828 422
391 3300005983 Ga0081540_1004236 Ga0081540_100423610 422
392 3300005983 Ga0081540_1015828 Ga0081540_10158284 422
393 3300005983 Ga0081540_1016341 Ga0081540_10163413 422
394 3300005983 Ga0081540_1025956 Ga0081540_10259562 422
395 3300005983 Ga0081540_1028166 Ga0081540_10281663 422
396 3300005983 Ga0081540_1067595 Ga0081540_10675952 422
397 3300005985 Ga0081539_10000051 Ga0081539_1000005130 422
398 3300005985 Ga0081539_10038018 Ga0081539_100380182 422
399 3300005985 Ga0081539_10098967 Ga0081539_100989671 422
400 3300006028 Ga0070717_10003205 Ga0070717_100032059 422
401 3300006038 Ga0075365_10013621 Ga0075365_100136214 422
402 3300006038 Ga0075365_10031750 Ga0075365_100317504 422
403 3300006042 Ga0075368_10007756 Ga0075368_100077564 422
404 3300006042 Ga0075368_10013110 Ga0075368_100131102 422
405 3300006048 Ga0075363_100030494 Ga0075363_1000304942 422
406 3300006173 Ga0070716_100021118 Ga0070716_1000211184 422
407 3300006173 Ga0070716_100055228 Ga0070716_1000552282 422
408 3300006175 Ga0070712_100018569 Ga0070712_1000185694 422
409 3300006195 Ga0075366_10039838 Ga0075366_100398382 422
410 3300006237 Ga0097621_100074025 Ga0097621_1000740252 422
411 3300006353 Ga0075370_10014925 Ga0075370_100149252 422
412 3300006844 Ga0075428_100005630 Ga0075428_10000563013 422
413 3300006847 Ga0075431_100000196 Ga0075431_10000019625 422
414 3300006880 Ga0075429_100002073 Ga0075429_10000207314 422
415 3300006942 Ga0099824_1010553 Ga0099824_10105539 422
416 3300006943 Ga0099822_1001130 Ga0099822_10011309 422
417 3300007265 Ga0099794_10001814 Ga0099794_1000181411 422
418 3300007265 Ga0099794_10052661 Ga0099794_100526612 422
419 3300007788 Ga0099795_10021402 Ga0099795_100214022 422
420 3300009093 Ga0105240_10019779 Ga0105240_100197798 422
421 3300009093 Ga0105240_10020186 Ga0105240_100201866 422
422 3300009093 Ga0105240_10056805 Ga0105240_100568055 422
423 3300009093 Ga0105240_10069157 Ga0105240_100691572 422
424 3300009094 Ga0111539_10008246 Ga0111539_100082462 422
425 3300009098 Ga0105245_10027991 Ga0105245_100279915 422
426 3300009101 Ga0105247_10025399 Ga0105247_100253992 422
427 3300009101 Ga0105247_10117536 Ga0105247_101175362 422
428 3300009147 Ga0114129_10039302 Ga0114129_100393024 422
429 3300009147 Ga0114129_10227768 Ga0114129_102277682 422
430 3300009174 Ga0105241_10001128 Ga0105241_1000112819 422
431 3300009174 Ga0105241_10017590 Ga0105241_100175903 422
432 3300009174 Ga0105241_10039945 Ga0105241_100399451 422
433 3300009176 Ga0105242_10124784 Ga0105242_101247842 422
434 3300009177 Ga0105248_10058178 Ga0105248_100581784 422
435 3300009177 Ga0105248_10062849 Ga0105248_100628494 422
436 3300009177 Ga0105248_10110074 Ga0105248_101100743 422
437 3300009545 Ga0105237_10013465 Ga0105237_100134655 422
438 3300009545 Ga0105237_10018185 Ga0105237_100181856 422
439 3300009545 Ga0105237_10033149 Ga0105237_100331493 422
440 3300009545 Ga0105237_10038959 Ga0105237_100389593 422
441 3300009545 Ga0105237_10063877 Ga0105237_100638773 422
442 3300009545 Ga0105237_10072147 Ga0105237_100721472 422
443 3300009545 Ga0105237_10082546 Ga0105237_100825463 422
444 3300009545 Ga0105237_10151315 Ga0105237_101513152 422
445 3300009545 Ga0105237_10335137 Ga0105237_103351372 422
446 3300009551 Ga0105238_10018757 Ga0105238_100187576 422
447 3300009551 Ga0105238_10031278 Ga0105238_100312785 422
448 3300009551 Ga0105238_10055394 Ga0105238_100553944 422
449 3300009551 Ga0105238_10097311 Ga0105238_100973111 422
450 3300009553 Ga0105249_10065948 Ga0105249_100659484 422
451 3300010159 Ga0099796_10007421 Ga0099796_100074211 422
452 3300010375 Ga0105239_10013525 Ga0105239_100135252 422
453 3300010375 Ga0105239_10014647 Ga0105239_100146476 422
454 3300010375 Ga0105239_10021881 Ga0105239_100218816 422
455 3300010375 Ga0105239_10110596 Ga0105239_101105962 422
456 3300010375 Ga0105239_10197400 Ga0105239_101974001 422
457 3300011119 Ga0105246_10013370 Ga0105246_100133702 422
458 3300013104 Ga0157370_10051707 Ga0157370_100517075 422
459 3300013105 Ga0157369_10005049 Ga0157369_100050499 422
460 3300013105 Ga0157369_10009441 Ga0157369_100094417 422
461 3300013105 Ga0157369_10016741 Ga0157369_100167416 422
462 3300013105 Ga0157369_10160768 Ga0157369_101607682 422
463 3300013296 Ga0157374_10052593 Ga0157374_100525934 422
464 3300013296 Ga0157374_10130102 Ga0157374_101301022 422
465 3300013296 Ga0157374_10160532 Ga0157374_101605321 422
466 3300013297 Ga0157378_10013278 Ga0157378_100132781 422
467 3300013306 Ga0163162_10062640 Ga0163162_100626402 422
468 3300013306 Ga0163162_10307840 Ga0163162_103078401 422
469 3300013306 Ga0163162_10384649 Ga0163162_103846492 422
470 3300013307 Ga0157372_10404700 Ga0157372_104047002 422
471 3300013308 Ga0157375_10044677 Ga0157375_100446771 422
472 3300013308 Ga0157375_10084779 Ga0157375_100847794 422
473 3300013308 Ga0157375_10158570 Ga0157375_101585702 422
474 3300013308 Ga0157375_10226846 Ga0157375_102268462 422
475 3300014326 Ga0157380_10041401 Ga0157380_100414012 422
476 3300014968 Ga0157379_10182868 Ga0157379_101828682 422
477 3300020082 Ga0206353_10887329 Ga0206353_108873292 422
478 3300021320 Ga0214544_1000002 Ga0214544_100000274 422
479 3300021321 Ga0214542_1000001 Ga0214542_1000001424 422
480 3300021324 Ga0214545_1000001 Ga0214545_1000001490 422
481 3300021327 Ga0214543_1000001 Ga0214543_1000001706 422
482 3300021377 Ga0213874_10002688 Ga0213874_100026882 422
483 3300021384 Ga0213876_10004192 Ga0213876_100041926 422
484 3300022467 Ga0224712_10022413 Ga0224712_100224132 422
485 3300025230 Ga0209563_105305 Ga0209563_1053051 422
486 3300025253 Ga0209677_102534 Ga0209677_1025345 422
487 3300025254 Ga0209148_1000374 Ga0209148_10003745 422
488 3300025261 Ga0209233_1007575 Ga0209233_10075753 422
489 3300025272 Ga0209455_1001411 Ga0209455_100141110 422
490 3300025272 Ga0209455_1003883 Ga0209455_10038834 422
491 3300025273 Ga0209673_1029820 Ga0209673_10298202 422
492 3300025295 Ga0209564_1011932 Ga0209564_10119324 422
493 3300025297 Ga0209758_1000024 Ga0209758_1000024104 422
494 3300025297 Ga0209758_1000068 Ga0209758_100006859 422
495 3300025297 Ga0209758_1001579 Ga0209758_100157910 422
496 3300025297 Ga0209758_1002091 Ga0209758_100209118 422
497 3300025297 Ga0209758_1005630 Ga0209758_10056302 422
498 3300025297 Ga0209758_1015196 Ga0209758_10151962 422
499 3300025299 Ga0209256_1008086 Ga0209256_10080864 422
500 3300025302 Ga0207426_1000238 Ga0207426_10002383 422
501 3300025302 Ga0207426_1000726 Ga0207426_100072624 422
502 3300025302 Ga0207426_1021118 Ga0207426_10211182 422
503 3300025304 Ga0209257_1004927 Ga0209257_10049276 422
504 3300025304 Ga0209257_1018552 Ga0209257_10185523 422
505 3300025885 Ga0207653_10010122 Ga0207653_100101222 422
506 3300025898 Ga0207692_10000175 Ga0207692_100001758 422
507 3300025898 Ga0207692_10006739 Ga0207692_100067392 422
508 3300025898 Ga0207692_10037770 Ga0207692_100377702 422
509 3300025900 Ga0207710_10022920 Ga0207710_100229202 422
510 3300025900 Ga0207710_10030595 Ga0207710_100305952 422
511 3300025900 Ga0207710_10036667 Ga0207710_100366672 422
512 3300025903 Ga0207680_10047992 Ga0207680_100479922 422
513 3300025904 Ga0207647_10001739 Ga0207647_1000173912 422
514 3300025904 Ga0207647_10017311 Ga0207647_100173111 422
515 3300025906 Ga0207699_10001765 Ga0207699_100017657 422
516 3300025906 Ga0207699_10022952 Ga0207699_100229522 422
517 3300025907 Ga0207645_10119720 Ga0207645_101197202 422
518 3300025908 Ga0207643_10037942 Ga0207643_100379422 422
519 3300025911 Ga0207654_10000232 Ga0207654_100002326 422
520 3300025911 Ga0207654_10011815 Ga0207654_100118152 422
521 3300025912 Ga0207707_10000950 Ga0207707_1000095018 422
522 3300025912 Ga0207707_10004626 Ga0207707_100046261 422
523 3300025913 Ga0207695_10000008 Ga0207695_10000008180 422
524 3300025913 Ga0207695_10001547 Ga0207695_1000154717 422
525 3300025913 Ga0207695_10083099 Ga0207695_100830992 422
526 3300025913 Ga0207695_10101991 Ga0207695_101019913 422
527 3300025913 Ga0207695_10113971 Ga0207695_101139712 422
528 3300025914 Ga0207671_10008090 Ga0207671_100080904 422
529 3300025914 Ga0207671_10019334 Ga0207671_100193346 422
530 3300025914 Ga0207671_10050109 Ga0207671_100501092 422
531 3300025914 Ga0207671_10117695 Ga0207671_101176952 422
532 3300025916 Ga0207663_10017604 Ga0207663_100176043 422
533 3300025917 Ga0207660_10159286 Ga0207660_101592862 422
534 3300025919 Ga0207657_10000658 Ga0207657_1000065815 422
535 3300025919 Ga0207657_10074301 Ga0207657_100743012 422
536 3300025920 Ga0207649_10071474 Ga0207649_100714742 422
537 3300025921 Ga0207652_10051870 Ga0207652_100518704 422
538 3300025922 Ga0207646_10258564 Ga0207646_102585642 422
539 3300025923 Ga0207681_10070191 Ga0207681_100701912 422
540 3300025924 Ga0207694_10000050 Ga0207694_1000005094 422
541 3300025924 Ga0207694_10055781 Ga0207694_100557813 422
542 3300025924 Ga0207694_10068746 Ga0207694_100687462 422
543 3300025924 Ga0207694_10136966 Ga0207694_101369661 422
544 3300025925 Ga0207650_10209014 Ga0207650_102090141 422
545 3300025927 Ga0207687_10024233 Ga0207687_100242334 422
546 3300025927 Ga0207687_10113235 Ga0207687_101132352 422
547 3300025927 Ga0207687_10176312 Ga0207687_101763122 422
548 3300025928 Ga0207700_10071109 Ga0207700_100711091 422
549 3300025929 Ga0207664_10007161 Ga0207664_100071619 422
550 3300025929 Ga0207664_10020650 Ga0207664_100206502 422
551 3300025931 Ga0207644_10025423 Ga0207644_100254234 422
552 3300025933 Ga0207706_10028525 Ga0207706_100285254 422
553 3300025934 Ga0207686_10016885 Ga0207686_100168853 422
554 3300025934 Ga0207686_10058938 Ga0207686_100589382 422
555 3300025937 Ga0207669_10000863 Ga0207669_100008634 422
556 3300025939 Ga0207665_10015055 Ga0207665_100150552 422
557 3300025939 Ga0207665_10023005 Ga0207665_100230056 422
558 3300025940 Ga0207691_10115165 Ga0207691_101151652 422
559 3300025940 Ga0207691_10223324 Ga0207691_102233242 422
560 3300025941 Ga0207711_10033586 Ga0207711_100335864 422
561 3300025941 Ga0207711_10053295 Ga0207711_100532952 422
562 3300025942 Ga0207689_10014103 Ga0207689_100141034 422
563 3300025942 Ga0207689_10064470 Ga0207689_100644704 422
564 3300025944 Ga0207661_10008365 Ga0207661_100083653 422
565 3300025945 Ga0207679_10082238 Ga0207679_100822382 422
566 3300025949 Ga0207667_10015706 Ga0207667_1001570611 422
567 3300025949 Ga0207667_10086188 Ga0207667_100861882 422
568 3300025949 Ga0207667_10112620 Ga0207667_101126201 422
569 3300025960 Ga0207651_10052593 Ga0207651_100525932 422
570 3300025972 Ga0207668_10027564 Ga0207668_100275642 422
571 3300025972 Ga0207668_10056041 Ga0207668_100560412 422
572 3300025972 Ga0207668_10096998 Ga0207668_100969982 422
573 3300025981 Ga0207640_10043782 Ga0207640_100437822 422
574 3300025981 Ga0207640_10062950 Ga0207640_100629502 422
575 3300025986 Ga0207658_10187558 Ga0207658_101875582 422
576 3300026023 Ga0207677_10020594 Ga0207677_100205944 422
577 3300026023 Ga0207677_10021941 Ga0207677_100219412 422
578 3300026041 Ga0207639_10016102 Ga0207639_100161023 422
579 3300026041 Ga0207639_10042274 Ga0207639_100422742 422
580 3300026041 Ga0207639_10161817 Ga0207639_101618172 422
581 3300026041 Ga0207639_10187317 Ga0207639_101873171 422
582 3300026067 Ga0207678_10015480 Ga0207678_100154802 422
583 3300026067 Ga0207678_10021335 Ga0207678_100213354 422
584 3300026067 Ga0207678_10033024 Ga0207678_100330242 422
585 3300026078 Ga0207702_10000002 Ga0207702_10000002204 422
586 3300026078 Ga0207702_10224340 Ga0207702_102243402 422
587 3300026088 Ga0207641_10102572 Ga0207641_101025722 422
588 3300026095 Ga0207676_10014678 Ga0207676_100146786 422
589 3300026116 Ga0207674_10035719 Ga0207674_100357194 422
590 3300026118 Ga0207675_100047170 Ga0207675_1000471702 422
591 3300026118 Ga0207675_100054178 Ga0207675_1000541784 422
592 3300026121 Ga0207683_10026522 Ga0207683_100265224 422
593 3300026121 Ga0207683_10040572 Ga0207683_100405723 422
594 3300026121 Ga0207683_10062061 Ga0207683_100620612 422
595 3300026121 Ga0207683_10155676 Ga0207683_101556762 422
596 3300026142 Ga0207698_10042438 Ga0207698_100424385 422
597 3300026142 Ga0207698_10134375 Ga0207698_101343751 422
598 3300027296 Ga0209389_1000107 Ga0209389_100010744 422
599 3300027296 Ga0209389_1005934 Ga0209389_10059342 422
600 3300027357 Ga0209589_1000001 Ga0209589_1000001286 422
601 3300027357 Ga0209589_1000092 Ga0209589_100009210 422
602 3300027361 Ga0209489_100001 Ga0209489_100001286 422
603 3300027361 Ga0209489_100006 Ga0209489_100006467 422
604 3300027361 Ga0209489_107740 Ga0209489_1077406 422
605 3300027363 Ga0209700_100001 Ga0209700_100001286 422
606 3300027363 Ga0209700_100005 Ga0209700_100005335 422
607 3300027671 Ga0209588_1004492 Ga0209588_10044924 422
608 3300027907 Ga0207428_10002661 Ga0207428_100026612 422
609 3300028379 Ga0268266_10019676 Ga0268266_100196762 422
610 3300028379 Ga0268266_10020771 Ga0268266_100207716 422
611 3300028379 Ga0268266_10032939 Ga0268266_100329394 422
612 3300028379 Ga0268266_10061421 Ga0268266_100614212 422
613 3300028786 Ga0307517_10000008 Ga0307517_10000008180 422
614 3300028794 Ga0307515_10078762 Ga0307515_100787623 422
615 3300031507 Ga0307509_10010951 Ga0307509_1001095111 422
616 3300031616 Ga0307508_10000018 Ga0307508_10000018174 422
617 3300031730 Ga0307516_10004992 Ga0307516_100049922 422
618 3300031730 Ga0307516_10007832 Ga0307516_100078329 422
619 3300031730 Ga0307516_10074500 Ga0307516_100745001 422
620 3300033179 Ga0307507_10054896 Ga0307507_100548965 422
621 3300033180 Ga0307510_10041204 Ga0307510_100412043 422
622 3300033442 Ga0315911_1000006 Ga0315911_1000006361 422
623 3300034816 Ga0373930_0002890 Ga0373930_0002890_1117_2394 422
624 3300035084 Ga0373928_0008155 Ga0373928_0008155_450_1727 422
625 3300035112 Ga0373932_0014422 Ga0373932_0014422_598_1875 422
626 3300035112 Ga0373932_0028239 Ga0373932_0028239_70_1347 422
627 3300035113 Ga0373936_0007586 Ga0373936_0007586_1467_2750 422
628 3300035116 Ga0373945_0014942 Ga0373945_0014942_339_1616 422
629 3300035171 Ga0373946_0016547 Ga0373946_0016547_1177_2454 422
630 3300035410 Ga0373924_0003483 Ga0373924_0003483_2503_3780 422
631 3300035691 Ga0373931_0026734 Ga0373931_0026734_108_1385 422
632 3300035692 Ga0373935_0157113 Ga0373935_0157113_108_1385 422
633 3300035695 Ga0373927_0011069 Ga0373927_0011069_1326_2603 422
634 3300035695 Ga0373927_0015919 Ga0373927_0015919_2862_4139 422
635 3300035695 Ga0373927_0032991 Ga0373927_0032991_1580_2857 422
636 3300035695 Ga0373927_0078608 Ga0373927_0078608_36_1313 422
637 3300035724 Ga0373933_0000199 Ga0373933_0000199_25103_26380 422
638 3300035724 Ga0373933_0017531 Ga0373933_0017531_16_1293 422
639 3300035725 Ga0373947_0032400 Ga0373947_0032400_1709_2986 422
640 3300037418 Ga0395900_0000820 Ga0395900_0000820_2872_4149 422
641 3300037466 Ga0395898_0026506 Ga0395898_0026506_3314_4591 422
642 3300037466 Ga0395898_0034063 Ga0395898_0034063_1538_2815 422
643 3300037466 Ga0395898_0065753 Ga0395898_0065753_670_1947 422
644 3300037471 Ga0395905_0006498 Ga0395905_0006498_4130_5407 422
645 3300038443 Ga0395901_0081268 Ga0395901_0081268_214_1491 422
646 3300038443 Ga0395901_0143576 Ga0395901_0143576_1161_2438 422
647 3300038443 Ga0395901_0181866 Ga0395901_0181866_889_2166 422
648 3300039437 Ga0436365_1358938 Ga0436365_1358938_2000_3277 422
649 3300039437 Ga0436365_1840276 Ga0436365_1840276_1513_2790 422
650 3300039438 Ga0436360_0105255 Ga0436360_0105255_3661_4938 422
651 3300039438 Ga0436360_0457068 Ga0436360_0457068_43_1320 422
652 3300039450 Ga0436363_0602269 Ga0436363_0602269_1701_2978 422
653 3300039450 Ga0436363_1661094 Ga0436363_1661094_461_1738 422
654 3300039453 Ga0436362_1200408 Ga0436362_1200408_522_1799 422
655 3300041413 Ga0439465_0025951 Ga0439465_0025951_393_1670 422
656 3300041460 Ga0451802_0581573 Ga0451802_0581573_106_1416 422
657 3300041491 Ga0451833_0611236 Ga0451833_0611236_760_2037 422
658 3300042438 Ga0439459_0011511 Ga0439459_0011511_51_1328 422
659 3300044658 Ga0466972_0000846 Ga0466972_0000846_8900_10177 422
660 3300044684 Ga0466966_0000334 Ga0466966_0000334_12838_14115 422
661 3300044693 Ga0466961_0000509 Ga0466961_0000509_6366_7643 422
662 3300044706 Ga0466964_0032631 Ga0466964_0032631_140_1417 422
663 3300044719 Ga0466971_0088137 Ga0466971_0088137_63_1340 422
664 3300044842 Ga0466957_0039507 Ga0466957_0039507_56_1333 422
665 3300045049 Ga0466959_0128941 Ga0466959_0128941_367_1644 422
666 3300045049 Ga0466959_0149357 Ga0466959_0149357_329_1606 422
667 3300045976 Ga0466967_0009054 Ga0466967_0009054_5929_7206 422
668 3300046454 Ga0495592_0021156 Ga0495592_0021156_3257_4534 422
669 3300046454 Ga0495592_0038824 Ga0495592_0038824_1219_2496 422
670 3300046457 Ga0495590_0020654 Ga0495590_0020654_105_1382 422
671 3300046459 Ga0495629_0027278 Ga0495629_0027278_2431_3708 422
672 3300046459 Ga0495629_0093125 Ga0495629_0093125_55_1332 422
673 3300046460 Ga0495638_0023142 Ga0495638_0023142_2290_3567 422
674 3300046462 Ga0495651_0001733 Ga0495651_0001733_7315_8592 422
675 3300046462 Ga0495651_0035514 Ga0495651_0035514_2043_3320 422
676 3300046463 Ga0495653_0032482 Ga0495653_0032482_938_2215 422
677 3300046472 Ga0495580_0007795 Ga0495580_0007795_1044_2321 422
678 3300046473 Ga0495582_0004536 Ga0495582_0004536_4817_6094 422
679 3300046473 Ga0495582_0079896 Ga0495582_0079896_294_1571 422
680 3300046477 Ga0495664_0001939 Ga0495664_0001939_5996_7273 422
681 3300046477 Ga0495664_0086349 Ga0495664_0086349_267_1544 422
682 3300046492 Ga0495585_0023733 Ga0495585_0023733_1586_2863 422
683 3300046507 Ga0495606_0003754 Ga0495606_0003754_7801_9078 422
684 3300046507 Ga0495606_0028614 Ga0495606_0028614_1716_2993 422
685 3300046507 Ga0495606_0054429 Ga0495606_0054429_334_1611 422
686 3300046511 Ga0495608_0005911 Ga0495608_0005911_4368_5645 422
687 3300046514 Ga0495618_0011828 Ga0495618_0011828_2802_4079 422
688 3300046515 Ga0495620_0039513 Ga0495620_0039513_512_1789 422
689 3300046516 Ga0495628_0038168 Ga0495628_0038168_2380_3657 422
690 3300046517 Ga0495630_0025233 Ga0495630_0025233_2503_3780 422
691 3300046519 Ga0495632_0023647 Ga0495632_0023647_1616_2893 422
692 3300046524 Ga0495648_0107139 Ga0495648_0107139_198_1475 422
693 3300046526 Ga0495666_0055889 Ga0495666_0055889_205_1482 422
694 3300046529 Ga0495652_0062463 Ga0495652_0062463_847_2124 422
695 3300046531 Ga0495665_0026130 Ga0495665_0026130_1525_2802 422
696 3300046533 Ga0495640_0085120 Ga0495640_0085120_148_1425 422
697 3300046536 Ga0495587_0008847 Ga0495587_0008847_2665_3942 422
698 3300046542 Ga0495597_0066507 Ga0495597_0066507_70_1347 422
699 3300046543 Ga0495645_0008821 Ga0495645_0008821_1056_2333 422
700 3300046557 Ga0495622_0034647 Ga0495622_0034647_566_1843 422
701 3300046558 Ga0495633_0032679 Ga0495633_0032679_301_1578 422
702 3300046559 Ga0495667_0003089 Ga0495667_0003089_7621_8898 422
703 3300046559 Ga0495667_0077291 Ga0495667_0077291_163_1440 422
704 3300046642 Ga0495634_0055198 Ga0495634_0055198_19_1296 422
705 3300046660 Ga0495625_0086017 Ga0495625_0086017_91_1368 422
706 3300046663 Ga0495635_0203174 Ga0495635_0203174_12_1289 422
707 3300046674 Ga0495588_0013307 Ga0495588_0013307_1455_2732 422
708 3300046675 Ga0495657_0007669 Ga0495657_0007669_2845_4122 422
709 3300046675 Ga0495657_0033170 Ga0495657_0033170_1976_3253 422
710 3300046678 Ga0495599_0025195 Ga0495599_0025195_736_2013 422
711 3300046678 Ga0495599_0077350 Ga0495599_0077350_24_1301 422
712 3300046681 Ga0495647_0007665 Ga0495647_0007665_962_2239 422
713 3300046683 Ga0495658_0051124 Ga0495658_0051124_59_1336 422
714 3300046684 Ga0495669_0015398 Ga0495669_0015398_1830_3107 422
715 3300046684 Ga0495669_0031811 Ga0495669_0031811_684_1961 422
716 3300046689 Ga0495613_0051818 Ga0495613_0051818_1222_2499 422
717 3300046689 Ga0495613_0095977 Ga0495613_0095977_417_1694 422
718 3300046690 Ga0495624_0024439 Ga0495624_0024439_893_2170 422
719 3300046794 Ga0495589_0081114 Ga0495589_0081114_254_1531 422
720 3300046794 Ga0495589_0107393 Ga0495589_0107393_14_1291 422
721 3300046809 Ga0495600_0008276 Ga0495600_0008276_4054_5331 422
722 3300047315 Ga0495581_0014251 Ga0495581_0014251_2423_3700 422
723 3300047317 Ga0495604_0007727 Ga0495604_0007727_1928_3205 422
724 3300047319 Ga0495674_0006216 Ga0495674_0006216_3840_5117 422
725 3300047319 Ga0495674_0029090 Ga0495674_0029090_1353_2630 422
726 3300047319 Ga0495674_0212053 Ga0495674_0212053_136_1413 422
727 3300047444 Ga0495675_0009070 Ga0495675_0009070_4145_5422 422
728 3300047445 Ga0495677_0032688 Ga0495677_0032688_254_1531 422
729 3300047447 Ga0495685_014509 Ga0495685_014509_833_2110 422
730 3300047471 Ga0495684_0023878 Ga0495684_0023878_1178_2455 422
731 3300047471 Ga0495684_0032468 Ga0495684_0032468_1903_3180 422
732 3300047673 Ga0495593_0043880 Ga0495593_0043880_994_2271 422
733 3300047673 Ga0495593_0058470 Ga0495593_0058470_669_1946 422
734 3300048088 Ga0495602_0058638 Ga0495602_0058638_1840_3117 422
735 3300048903 Ga0496100_0017591 Ga0496100_0017591_1861_3138 422
736 3300048903 Ga0496100_0022944 Ga0496100_0022944_1451_2728 422
737 3300048903 Ga0496100_0035027 Ga0496100_0035027_457_1734 422
738 3300048904 Ga0496101_0021665 Ga0496101_0021665_1205_2482 422
739 3300048904 Ga0496101_0036585 Ga0496101_0036585_1752_3029 422
740 3300048904 Ga0496101_0091342 Ga0496101_0091342_372_1649 422
741 3300048905 Ga0496102_0012241 Ga0496102_0012241_2547_3824 422
742 3300048905 Ga0496102_0040005 Ga0496102_0040005_328_1605 422
743 3300048905 Ga0496102_0041888 Ga0496102_0041888_1408_2685 422
744 3300048905 Ga0496102_0093932 Ga0496102_0093932_1070_2347 422
745 3300048905 Ga0496102_0133598 Ga0496102_0133598_560_1837 422
746 3300048905 Ga0496102_0230263 Ga0496102_0230263_280_1557 422
747 3300048906 Ga0496103_0017531 Ga0496103_0017531_2889_4166 422
748 3300048907 Ga0496104_0033245 Ga0496104_0033245_2792_4069 422
749 3300048908 Ga0496105_0000527 Ga0496105_0000527_21857_23134 422
750 3300048908 Ga0496105_0012981 Ga0496105_0012981_4204_5481 422
751 3300048908 Ga0496105_0019719 Ga0496105_0019719_433_1710 422
752 3300048908 Ga0496105_0056097 Ga0496105_0056097_1890_3167 422
753 3300048909 Ga0496106_0002824 Ga0496106_0002824_4814_6091 422
754 3300048909 Ga0496106_0022677 Ga0496106_0022677_1599_2876 422
755 3300048909 Ga0496106_0025243 Ga0496106_0025243_2832_4109 422
756 3300048909 Ga0496106_0035401 Ga0496106_0035401_1094_2371 422
757 3300048909 Ga0496106_0091486 Ga0496106_0091486_360_1637 422
758 3300048909 Ga0496106_0159657 Ga0496106_0159657_291_1568 422
759 3300048910 Ga0496107_0010480 Ga0496107_0010480_724_2001 422
760 3300048910 Ga0496107_0043491 Ga0496107_0043491_1788_3065 422
761 3300048910 Ga0496107_0175572 Ga0496107_0175572_53_1330 422
762 3300048911 Ga0496108_0038348 Ga0496108_0038348_634_1911 422
763 3300048911 Ga0496108_0049993 Ga0496108_0049993_1667_2944 422
764 3300048912 Ga0496109_0039798 Ga0496109_0039798_626_1903 422
765 3300048912 Ga0496109_0126886 Ga0496109_0126886_316_1593 422
766 3300048913 Ga0496110_0020119 Ga0496110_0020119_2687_3964 422
767 3300048913 Ga0496110_0030628 Ga0496110_0030628_3165_4442 422
768 3300048913 Ga0496110_0075282 Ga0496110_0075282_1554_2831 422
769 3300048915 Ga0496112_0000004 Ga0496112_0000004_376223_377500 422
770 3300048915 Ga0496112_0025892 Ga0496112_0025892_1647_2924 422
771 3300048915 Ga0496112_0080722 Ga0496112_0080722_829_2106 422
772 3300048915 Ga0496112_0088836 Ga0496112_0088836_37_1314 422
773 3300048915 Ga0496112_0127498 Ga0496112_0127498_289_1566 422
774 3300048915 Ga0496112_0137207 Ga0496112_0137207_291_1568 422
775 3300048915 Ga0496112_0160931 Ga0496112_0160931_346_1623 422
776 3300048916 Ga0496113_0016119 Ga0496113_0016119_2533_3810 422
777 3300048916 Ga0496113_0020357 Ga0496113_0020357_2760_4037 422
778 3300048916 Ga0496113_0087530 Ga0496113_0087530_634_1911 422
779 3300048916 Ga0496113_0107667 Ga0496113_0107667_137_1414 422
780 3300048917 Ga0496114_0017928 Ga0496114_0017928_3390_4667 422
781 3300048917 Ga0496114_0029802 Ga0496114_0029802_2790_4067 422
782 3300048917 Ga0496114_0030675 Ga0496114_0030675_2328_3605 422
783 3300048918 Ga0496115_0006668 Ga0496115_0006668_5459_6736 422
784 3300048918 Ga0496115_0022969 Ga0496115_0022969_2561_3838 422
785 3300048918 Ga0496115_0054034 Ga0496115_0054034_584_1861 422
786 3300048918 Ga0496115_0073822 Ga0496115_0073822_721_1998 422
787 3300048921 Ga0496118_0004964 Ga0496118_0004964_2996_4273 422
788 3300048921 Ga0496118_0034989 Ga0496118_0034989_151_1428 422
789 3300048922 Ga0496119_0064811 Ga0496119_0064811_605_1882 422
790 3300048924 Ga0496121_0002820 Ga0496121_0002820_7874_9151 422
791 3300048924 Ga0496121_0017933 Ga0496121_0017933_1682_2959 422
792 3300048924 Ga0496121_0019022 Ga0496121_0019022_2111_3391 422
793 3300048924 Ga0496121_0043405 Ga0496121_0043405_680_1957 422
794 3300048924 Ga0496121_0064220 Ga0496121_0064220_345_1622 422
795 3300048927 Ga0496124_0002651 Ga0496124_0002651_12015_13292 422
796 3300048928 Ga0496125_0090455 Ga0496125_0090455_965_2242 422
797 3300048929 Ga0496126_0004957 Ga0496126_0004957_6680_7957 422
798 3300048929 Ga0496126_0014996 Ga0496126_0014996_4784_6061 422
799 3300048929 Ga0496126_0031625 Ga0496126_0031625_3188_4465 422
800 3300048929 Ga0496126_0040728 Ga0496126_0040728_1803_3080 422
801 3300048929 Ga0496126_0051557 Ga0496126_0051557_1498_2775 422
802 3300048929 Ga0496126_0057631 Ga0496126_0057631_1500_2777 422
803 3300048929 Ga0496126_0074051 Ga0496126_0074051_34_1311 422
804 3300048929 Ga0496126_0080022 Ga0496126_0080022_482_1759 422
805 3300048929 Ga0496126_0092051 Ga0496126_0092051_793_2070 422
806 3300048929 Ga0496126_0130321 Ga0496126_0130321_128_1405 422
807 3300048929 Ga0496126_0250356 Ga0496126_0250356_45_1322 422
808 3300049572 Ga0501036_0163739 Ga0501036_0163739_552_1829 422
809 3300049576 Ga0501040_0193437 Ga0501040_0193437_100_1404 422
810 3300049577 Ga0501041_0087879 Ga0501041_0087879_14_1291 422
811 3300049580 Ga0501046_0156502 Ga0501046_0156502_379_1656 422
812 3300049581 Ga0501047_0007358 Ga0501047_0007358_56_1333 422
813 3300049583 Ga0501067_0078902 Ga0501067_0078902_82_1359 422
814 3300049586 Ga0501070_0003226 Ga0501070_0003226_12545_13822 422
815 3300049742 Ga0501080_0125288 Ga0501080_0125288_945_2222 422
816 3300050490 nmdc:mga03n38_428_c1 nmdc:mga03n38_428_c1_7871_9148 422
817 3300050494 nmdc:mga06z11_38973_c1 nmdc:mga06z11_38973_c1_15_1292 422
818 3300050496 nmdc:mga07m45_12666_c1 nmdc:mga07m45_12666_c1_1167_2444 422
819 3300050496 nmdc:mga07m45_30295_c1 nmdc:mga07m45_30295_c1_1474_2751 422
820 3300050507 nmdc:mga05p37_180885_c1 nmdc:mga05p37_180885_c1_47_1324 422
821 3300050507 nmdc:mga05p37_7887_c1 nmdc:mga05p37_7887_c1_1834_3111 422
822 3300050508 nmdc:mga09592_2960_c1 nmdc:mga09592_2960_c1_2054_3331 422
823 3300050510 nmdc:mga06r32_1710_c1 nmdc:mga06r32_1710_c1_2077_3354 422
824 3300050510 nmdc:mga06r32_32730_c1 nmdc:mga06r32_32730_c1_913_2190 422
825 3300050511 nmdc:mga08y16_213_c1 nmdc:mga08y16_213_c1_48775_50052 422
826 3300050512 nmdc:mga0n895_36971_c1 nmdc:mga0n895_36971_c1_2256_3533 422
827 3300050516 nmdc:mga0sz30_1328_c1 nmdc:mga0sz30_1328_c1_822_2099 422
828 3300053077 Ga0495601_0029670 Ga0495601_0029670_1036_2313 422
829 3300053080 Ga0500635_0008920 Ga0500635_0008920_943_2226 422
830 3300053084 Ga0495595_0016428 Ga0495595_0016428_1392_2669 422
831 3300053085 Ga0495619_0033553 Ga0495619_0033553_1891_3168 422
832 3300053087 Ga0500643_000007 Ga0500643_000007_21724_23001 422
833 3300053091 Ga0500647_0010746 Ga0500647_0010746_1051_2328 422
834 3300053091 Ga0500647_0036572 Ga0500647_0036572_733_2010 422
835 3300053094 Ga0500566_0000204 Ga0500566_0000204_15345_16628 422
836 3300053094 Ga0500566_0003695 Ga0500566_0003695_5694_6971 422
837 3300053094 Ga0500566_0035645 Ga0500566_0035645_436_1713 422
838 3300053095 Ga0500640_062702 Ga0500640_062702_20_1297 422
839 3300053104 Ga0500556_0005665 Ga0500556_0005665_1492_2769 422
840 3300053105 Ga0500557_000052 Ga0500557_000052_4183_5460 422
841 3300053108 Ga0500562_018107 Ga0500562_018107_361_1638 422
842 3300053111 Ga0500572_000307 Ga0500572_000307_10872_12149 422
843 3300053111 Ga0500572_000451 Ga0500572_000451_1663_2946 422
844 3300053119 Ga0500595_002911 Ga0500595_002911_3878_5155 422
845 3300053119 Ga0500595_009999 Ga0500595_009999_1953_3230 422
846 3300053119 Ga0500595_020826 Ga0500595_020826_885_2162 422
847 3300053121 Ga0500607_024838 Ga0500607_024838_1901_3178 422
848 3300053122 Ga0500608_003260 Ga0500608_003260_2012_3295 422
849 3300053130 Ga0500642_0029960 Ga0500642_0029960_477_1754 422
850 3300053133 Ga0500655_007298 Ga0500655_007298_31_1308 422
851 3300053136 Ga0500559_0000143 Ga0500559_0000143_39025_40302 422
852 3300053136 Ga0500559_0001636 Ga0500559_0001636_9403_10686 422
853 3300053148 Ga0500590_010413 Ga0500590_010413_1656_2933 422
854 3300053150 Ga0500603_000834 Ga0500603_000834_1911_3194 422
855 3300053156 Ga0500622_0008171 Ga0500622_0008171_2289_3566 422
856 3300053159 Ga0500630_000027 Ga0500630_000027_12633_13916 422
857 3300053162 Ga0500638_003956 Ga0500638_003956_1794_3071 422
858 3300053163 Ga0500639_000020 Ga0500639_000020_2189_3472 422
859 3300053163 Ga0500639_008513 Ga0500639_008513_3395_4672 422
860 3300053177 Ga0500636_0000042 Ga0500636_0000042_38196_39473 422
861 3300053178 Ga0500637_0000132 Ga0500637_0000132_6643_7920 422
862 3300053735 Ga0500596_006899 Ga0500596_006899_106_1389 422
863 3300053736 Ga0500599_002750 Ga0500599_002750_680_1957 422
864 3300053737 Ga0500601_000228 Ga0500601_000228_3648_4925 422
865 3300055283 Ga0500661_002508 Ga0500661_002508_949_2226 422
866 3300000041 ARcpr5oldR_c000091 ARcpr5oldR_00009114 423
867 3300001430 JGI24032J14994_100331 JGI24032J14994_1003312 423
868 3300005434 Ga0070709_10013900 Ga0070709_100139005 423
869 3300005530 Ga0070679_100073029 Ga0070679_1000730292 423
870 3300005937 Ga0081455_10000009 Ga0081455_100000097 423
871 3300006175 Ga0070712_100095539 Ga0070712_1000955392 423
872 3300006175 Ga0070712_100244997 Ga0070712_1002449972 423
873 3300006178 Ga0075367_10065300 Ga0075367_100653001 423
874 3300006844 Ga0075428_100232820 Ga0075428_1002328202 423
875 3300009094 Ga0111539_10269847 Ga0111539_102698472 423
876 3300009174 Ga0105241_10127327 Ga0105241_101273272 423
877 3300010375 Ga0105239_10238348 Ga0105239_102383482 423
878 3300013100 Ga0157373_10031343 Ga0157373_100313434 423
879 3300013104 Ga0157370_10030840 Ga0157370_100308403 423
880 3300013307 Ga0157372_10174902 Ga0157372_101749022 423
881 3300025912 Ga0207707_10212389 Ga0207707_102123892 423
882 3300025915 Ga0207693_10007591 Ga0207693_100075914 423
883 3300025915 Ga0207693_10110162 Ga0207693_101101622 423
884 3300025916 Ga0207663_10039585 Ga0207663_100395852 423
885 3300025917 Ga0207660_10064021 Ga0207660_100640212 423
886 3300025923 Ga0207681_10210640 Ga0207681_102106402 423
887 3300031241 Ga0265325_10002771 Ga0265325_100027716 423
888 3300031595 Ga0265313_10000057 Ga0265313_1000005726 423
889 3300031712 Ga0265342_10062453 Ga0265342_100624532 423
890 3300032133 Ga0316583_10008041 Ga0316583_100080413 423
891 3300037312 Ga0395899_0003643 Ga0395899_0003643_10493_11764 423
892 3300037418 Ga0395900_0005923 Ga0395900_0005923_4419_5690 423
893 3300037466 Ga0395898_0183684 Ga0395898_0183684_140_1411 423
894 3300037466 Ga0395898_0200538 Ga0395898_0200538_550_1821 423
895 3300038443 Ga0395901_0301519 Ga0395901_0301519_295_1566 423
896 3300039437 Ga0436365_1434183 Ga0436365_1434183_3021_4304 423
897 3300048903 Ga0496100_0052915 Ga0496100_0052915_759_2042 423
898 3300048908 Ga0496105_0039702 Ga0496105_0039702_2163_3446 423
899 3300048913 Ga0496110_0038517 Ga0496110_0038517_743_2035 423
900 3300048915 Ga0496112_0160489 Ga0496112_0160489_526_1797 423
901 3300049568 Ga0501031_0107942 Ga0501031_0107942_365_1639 423
902 3300050513 nmdc:mga0rr50_69712_c1 nmdc:mga0rr50_69712_c1_674_1945 423

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02801

Ketoacyl-synt_C

Beta-ketoacyl synthase, C-terminal domain

280

395

0.97

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

24

272

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ls5-assembly1.cif.gz_B crystal structure of beta-ketoacyl-acp synthase ii (fabf) from bacillus subtilis 0.9066 10 422
4ls6-assembly1.cif.gz_B crystal structure of beta-ketoacyl-acp synthase ii (fabf) i108f mutant from bacillus subtilis 0.9048 10 422
4ls6-assembly1.cif.gz_B crystal structure of beta-ketoacyl-acp synthase ii (fabf) i108f mutant from bacillus subtilis 0.9005 10 422
4ls5-assembly1.cif.gz_B crystal structure of beta-ketoacyl-acp synthase ii (fabf) from bacillus subtilis 0.9002 10 422
6smp-assembly4.cif.gz_K antde:antf (holo): type ii pks acyl-carrier protein in complex with its ketosynthase bound to the hexaketide 0.9001 1 422
ID Description Score Start End Superfamily
1tqyG02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9624 269 421 3.40.47.10
1j3nB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9624 273 414 3.40.47.10
af_Q0E328_1_239_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9536 190 422 3.40.47.10
af_I1N0K0_264_378_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9468 267 382 3.40.47.10
af_P9WQD9_267_416_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9405 269 419 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A7C7GJ16-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase II 0.9835 179 423 GO:0004315
GO:0005829
GO:0006633
AF-X1SLU4-F1-model_v4 Ketosynthase family 3 (KS3) domain-containing protein 0.9801 190 422 GO:0004315
GO:0005829
GO:0006633
AF-A0A7C7GJ16-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase II 0.9795 179 423 GO:0004315
GO:0005829
GO:0006633
AF-X1SLU4-F1-model_v4 Ketosynthase family 3 (KS3) domain-containing protein 0.9759 190 422 GO:0004315
GO:0005829
GO:0006633
AF-A0A440GXF1-F1-model_v4 deleted 0.9747 290 423

Feature Viewer

pLDDT pTM Quality
88.14 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map