F485213
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 902 | 593 | 680 | 423 |
Family's Representative Sequence
| Representative Sequence | 3300025944|Ga0207661_10008365|Ga0207661_100083653 |
| Length | 439 |
| Sequence | VFPSNRILIESGDNMTAPRDKFGRPMVVVTGMGVVTSLGAGKTDNWARLTAGESGIRTLTRFPIEGLKTTMAGTIDFIPVAPFSSVGLSERLAELAVEEAIAQAGIGKKGDFPGPLFLAVPPVEIEWPHREELGKAVGTTEFSYDDLLSICGGGRFEPYHHRFQMGSVADFIAETFGTKGSPISLSTACASGATAIQLGVEAIRRGETDAALCAGTEASVNQEGLVRFSLLSALSTQNDPPQAASKPFSKNRDGFVMAEGAGALVLESYEAAVARGAPILGVIAGCGELTDSFHRTRSSPDGKPIIGCMLKTLADAGMTPEQIDHINAHGTATPENDKMEFQTTSTVFGERTKQIPVTSNKSMVGHTISAAGAVEAVFSLLTLEHQRIPPTINYEIPDPTIQFDVVGNKARDARVTAVMSNSFGFGGQNASLILTREPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 25 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 26 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 27 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 28 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 29 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 30 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 31 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 32 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 33 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 34 | 2791355199 | |||
| 35 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 36 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 37 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 38 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 39 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 40 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 41 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 42 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 43 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 44 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 45 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 46 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 47 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 48 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 49 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 50 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 51 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 52 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 53 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 54 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 55 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 56 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 57 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 58 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 59 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 60 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 61 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 62 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 63 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 64 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 65 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 66 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 67 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 68 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 69 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 70 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 71 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 72 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 73 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 74 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 75 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 76 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 77 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 78 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 79 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 80 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 81 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 82 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 83 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 84 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 85 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 86 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 87 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 88 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 89 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 90 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 91 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 92 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 93 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 94 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 95 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 96 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 97 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 98 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 99 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 100 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 101 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 102 | 2904699407 | |||
| 103 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 104 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 105 | 2906610324 | |||
| 106 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 107 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 108 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 109 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 110 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 111 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 112 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 113 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 114 | 2922368715 | |||
| 115 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 116 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 117 | 2922425934 | |||
| 118 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 119 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 120 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 121 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 122 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 123 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 124 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 125 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 126 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 127 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 128 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 129 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 130 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 131 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 132 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 133 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 134 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 135 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 136 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 137 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 138 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 139 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 140 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 141 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 142 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 143 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 144 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 145 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 146 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 147 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 148 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 149 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 150 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 151 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 152 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 153 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 154 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 155 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 156 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 157 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 158 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 159 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 160 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 161 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 162 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 163 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 164 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 165 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 166 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 167 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 168 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 169 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 170 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 171 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 172 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 173 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 174 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 175 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 176 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 177 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 178 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 179 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 180 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 181 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 182 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 183 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 184 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 185 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 186 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 187 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 188 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 189 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 191 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 192 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 193 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 194 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 195 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 196 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 197 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 200 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 202 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 203 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 204 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 206 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 208 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 213 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 216 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 218 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 219 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 224 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 225 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 226 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 227 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 228 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 229 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 230 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 231 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 233 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 234 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 235 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 236 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 237 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 238 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 239 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 240 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 241 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 242 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 243 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 244 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 245 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 246 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 248 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 249 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 250 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 251 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 252 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 253 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 254 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 256 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 257 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 258 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 259 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 260 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 261 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 262 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 263 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 273 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 275 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 277 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 288 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 289 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 290 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 291 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 292 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 293 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 294 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 295 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 296 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 297 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 298 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 299 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 300 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 301 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 302 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 303 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 304 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 306 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 307 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 308 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 365 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 366 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 367 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 368 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 371 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 374 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 375 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 376 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 377 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 378 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 379 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 380 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 381 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 382 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 383 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 384 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 385 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 386 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 387 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 388 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 389 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 390 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 391 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 392 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 393 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 394 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 395 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 396 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 397 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 398 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 399 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 400 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 401 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 402 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 403 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 404 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 405 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 406 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 407 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 408 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 409 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 410 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 411 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 412 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 413 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 414 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 415 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 416 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 417 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 418 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 419 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 420 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 421 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 422 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 423 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 424 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 425 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 426 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 427 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 428 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 484 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 485 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 486 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 487 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 488 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 489 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 490 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 491 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 492 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 493 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 494 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 495 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 496 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 497 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 498 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 499 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 500 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 501 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 502 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 503 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 504 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 505 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 506 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 509 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 510 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 513 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 515 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 517 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 518 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 519 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 520 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 521 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 522 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 523 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 525 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 526 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 527 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 528 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 530 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 533 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 534 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 535 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 536 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 537 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 538 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 539 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 540 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 541 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 542 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 543 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 544 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 545 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 546 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 547 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 548 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 549 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 550 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 551 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 552 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 553 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 554 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 555 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 556 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 557 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 558 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 559 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 560 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 561 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 562 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 563 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 564 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 565 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 566 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 567 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 568 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 569 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 570 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 571 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 572 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 573 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 574 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 575 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 576 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 577 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 578 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 579 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 580 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 581 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 582 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 583 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 584 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 585 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 586 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 587 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 588 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 589 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 590 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 591 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 592 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 593 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.59 |
| Metatranscriptomes | 0.22 |
| Isolates | 24.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.76 |
| Nodule | 19.51 |
| Rhizoplane | 7.21 |
| Rhizosphere | 53.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c000091 | 3300000041 | Bacteria | 16524 |
| 2 | JGI24032J14994_100331 | 3300001430 | Bacteria | 2517 |
| 3 | JGI24740J21852_10007980 | 3300001979 | Bacteria | 4258 |
| 4 | JGI24737J22298_10001022 | 3300001990 | Bacteria | 9909 |
| 5 | JGI25406J46586_10000027 | 3300003203 | Bacteria | 70625 |
| 6 | JGI25153J46596_10001910 | 3300003215 | Bacteria | 12359 |
| 7 | JGI25153J46596_10007386 | 3300003215 | Bacteria | 5415 |
| 8 | JGI25160J50197_1003482 | 3300003354 | Bacteria | 7034 |
| 9 | Ga0065165_1001157 | 3300005262 | Bacteria | 30758 |
| 10 | Ga0065165_1001250 | 3300005262 | Bacteria | 28850 |
| 11 | Ga0065165_1013791 | 3300005262 | Bacteria | 3184 |
| 12 | Ga0070658_10037250 | 3300005327 | Bacteria | 3920 |
| 13 | Ga0070658_10037583 | 3300005327 | Bacteria | 3903 |
| 14 | Ga0070658_10189564 | 3300005327 | Bacteria | 1733 |
| 15 | Ga0070676_10110293 | 3300005328 | Bacteria | 1713 |
| 16 | Ga0070683_100007257 | 3300005329 | Bacteria | 9349 |
| 17 | Ga0070683_100041674 | 3300005329 | Bacteria | 4226 |
| 18 | Ga0070677_10001849 | 3300005333 | Bacteria | 6692 |
| 19 | Ga0070680_100037008 | 3300005336 | Bacteria | 3943 |
| 20 | Ga0070680_100046889 | 3300005336 | Bacteria | 3517 |
| 21 | Ga0070682_100119280 | 3300005337 | Bacteria | 1768 |
| 22 | Ga0068868_100033605 | 3300005338 | Bacteria | 3954 |
| 23 | Ga0070660_100116491 | 3300005339 | Bacteria | 2131 |
| 24 | Ga0070689_100011851 | 3300005340 | Bacteria | 6259 |
| 25 | Ga0070661_100165579 | 3300005344 | Bacteria | 1676 |
| 26 | Ga0070692_10117649 | 3300005345 | Bacteria | 1478 |
| 27 | Ga0070668_100116225 | 3300005347 | Bacteria | 2133 |
| 28 | Ga0070671_100044589 | 3300005355 | Bacteria | 3685 |
| 29 | Ga0070674_100001777 | 3300005356 | Bacteria | 11690 |
| 30 | Ga0070674_100038774 | 3300005356 | Bacteria | 3213 |
| 31 | Ga0070673_100082352 | 3300005364 | Bacteria | 2612 |
| 32 | Ga0070673_100101825 | 3300005364 | Bacteria | 2367 |
| 33 | Ga0070688_100019250 | 3300005365 | Bacteria | 3953 |
| 34 | Ga0070659_100080254 | 3300005366 | Bacteria | 2605 |
| 35 | Ga0070667_100217489 | 3300005367 | Bacteria | 1700 |
| 36 | Ga0070709_10006118 | 3300005434 | Bacteria | 6547 |
| 37 | Ga0070709_10009846 | 3300005434 | Bacteria | 5280 |
| 38 | Ga0070709_10013900 | 3300005434 | Bacteria | 4538 |
| 39 | Ga0070714_100006896 | 3300005435 | Bacteria | 8807 |
| 40 | Ga0070714_100054219 | 3300005435 | Bacteria | 3425 |
| 41 | Ga0070714_100120760 | 3300005435 | Bacteria | 2331 |
| 42 | Ga0070713_100006657 | 3300005436 | Bacteria | 8039 |
| 43 | Ga0070713_100018188 | 3300005436 | Bacteria | 5339 |
| 44 | Ga0070713_100029306 | 3300005436 | Bacteria | 4357 |
| 45 | Ga0070713_100081025 | 3300005436 | Bacteria | 2769 |
| 46 | Ga0070713_100156741 | 3300005436 | Bacteria | 2030 |
| 47 | Ga0070710_10001287 | 3300005437 | Bacteria | 11902 |
| 48 | Ga0070710_10008883 | 3300005437 | Bacteria | 4904 |
| 49 | Ga0070711_100004377 | 3300005439 | Bacteria | 8321 |
| 50 | Ga0070711_100007383 | 3300005439 | Bacteria | 6686 |
| 51 | Ga0070711_100018998 | 3300005439 | Bacteria | 4399 |
| 52 | Ga0070708_100187817 | 3300005445 | Bacteria | 1933 |
| 53 | Ga0070663_100025670 | 3300005455 | Bacteria | 3981 |
| 54 | Ga0070663_100026936 | 3300005455 | Bacteria | 3898 |
| 55 | Ga0070678_100035084 | 3300005456 | Bacteria | 3499 |
| 56 | Ga0070678_100036024 | 3300005456 | Bacteria | 3460 |
| 57 | Ga0070681_10009117 | 3300005458 | Bacteria | 9750 |
| 58 | Ga0070681_10014556 | 3300005458 | Bacteria | 7827 |
| 59 | Ga0070706_100186628 | 3300005467 | Bacteria | 1938 |
| 60 | Ga0070707_100307055 | 3300005468 | Bacteria | 1542 |
| 61 | Ga0070698_100122608 | 3300005471 | Bacteria | 2558 |
| 62 | Ga0070679_100013382 | 3300005530 | Bacteria | 7856 |
| 63 | Ga0070679_100020776 | 3300005530 | Bacteria | 6404 |
| 64 | Ga0070679_100064758 | 3300005530 | Bacteria | 3643 |
| 65 | Ga0070679_100073029 | 3300005530 | Bacteria | 3423 |
| 66 | Ga0070697_100181907 | 3300005536 | Bacteria | 1782 |
| 67 | Ga0068853_100000785 | 3300005539 | Bacteria | 22086 |
| 68 | Ga0068853_100002462 | 3300005539 | Bacteria | 13860 |
| 69 | Ga0068853_100047159 | 3300005539 | Bacteria | 3697 |
| 70 | Ga0068853_100149314 | 3300005539 | Bacteria | 2103 |
| 71 | Ga0070686_100010545 | 3300005544 | Bacteria | 5215 |
| 72 | Ga0070665_100021594 | 3300005548 | Bacteria | 6472 |
| 73 | Ga0070665_100094902 | 3300005548 | Bacteria | 2987 |
| 74 | Ga0070704_100147792 | 3300005549 | Bacteria | 1844 |
| 75 | Ga0068855_100062119 | 3300005563 | Bacteria | 4362 |
| 76 | Ga0068857_100049082 | 3300005577 | Bacteria | 3745 |
| 77 | Ga0068857_100088587 | 3300005577 | Bacteria | 2769 |
| 78 | Ga0068857_100140978 | 3300005577 | Bacteria | 2179 |
| 79 | Ga0068854_100002059 | 3300005578 | Bacteria | 12329 |
| 80 | Ga0068854_100175546 | 3300005578 | Bacteria | 1670 |
| 81 | Ga0068856_100001874 | 3300005614 | Bacteria | 21950 |
| 82 | Ga0068856_100015688 | 3300005614 | Bacteria | 7326 |
| 83 | Ga0068852_100142022 | 3300005616 | Bacteria | 2223 |
| 84 | Ga0068852_100156924 | 3300005616 | Bacteria | 2121 |
| 85 | Ga0068861_100040451 | 3300005719 | Bacteria | 3487 |
| 86 | Ga0068851_10000665 | 3300005834 | Bacteria | 14682 |
| 87 | Ga0068851_10001506 | 3300005834 | Bacteria | 10221 |
| 88 | Ga0068863_100049875 | 3300005841 | Bacteria | 3969 |
| 89 | Ga0068860_100000213 | 3300005843 | Bacteria | 91105 |
| 90 | Ga0068860_100307018 | 3300005843 | Bacteria | 1555 |
| 91 | Ga0068862_100187925 | 3300005844 | Bacteria | 1857 |
| 92 | Ga0081455_10000009 | 3300005937 | Bacteria | 249885 |
| 93 | Ga0081455_10012693 | 3300005937 | Bacteria | 8385 |
| 94 | Ga0081455_10018614 | 3300005937 | Bacteria | 6603 |
| 95 | Ga0081455_10052412 | 3300005937 | Bacteria | 3493 |
| 96 | Ga0081540_1001168 | 3300005983 | Bacteria | 23063 |
| 97 | Ga0081540_1004236 | 3300005983 | Bacteria | 11018 |
| 98 | Ga0081540_1015828 | 3300005983 | Bacteria | 4754 |
| 99 | Ga0081540_1016341 | 3300005983 | Bacteria | 4647 |
| 100 | Ga0081540_1018868 | 3300005983 | Bacteria | 4214 |
| 101 | Ga0081540_1025956 | 3300005983 | Bacteria | 3357 |
| 102 | Ga0081540_1028166 | 3300005983 | Bacteria | 3162 |
| 103 | Ga0081540_1028488 | 3300005983 | Bacteria | 3136 |
| 104 | Ga0081540_1067595 | 3300005983 | Bacteria | 1669 |
| 105 | Ga0081539_10000051 | 3300005985 | Bacteria | 268337 |
| 106 | Ga0081539_10017427 | 3300005985 | Bacteria | 5044 |
| 107 | Ga0081539_10038018 | 3300005985 | Bacteria | 2858 |
| 108 | Ga0081539_10077999 | 3300005985 | Bacteria | 1750 |
| 109 | Ga0081539_10098967 | 3300005985 | Bacteria | 1490 |
| 110 | Ga0070717_10000905 | 3300006028 | Bacteria | 19709 |
| 111 | Ga0070717_10003205 | 3300006028 | Bacteria | 11688 |
| 112 | Ga0075365_10013621 | 3300006038 | Bacteria | 4873 |
| 113 | Ga0075365_10031750 | 3300006038 | Bacteria | 3389 |
| 114 | Ga0075368_10007756 | 3300006042 | Bacteria | 3801 |
| 115 | Ga0075368_10013110 | 3300006042 | Bacteria | 3041 |
| 116 | Ga0075363_100030494 | 3300006048 | Bacteria | 2793 |
| 117 | Ga0070716_100021118 | 3300006173 | Bacteria | 3427 |
| 118 | Ga0070716_100055228 | 3300006173 | Bacteria | 2272 |
| 119 | Ga0070712_100018569 | 3300006175 | Bacteria | 4520 |
| 120 | Ga0070712_100095539 | 3300006175 | Bacteria | 2187 |
| 121 | Ga0070712_100128936 | 3300006175 | Bacteria | 1915 |
| 122 | Ga0070712_100244997 | 3300006175 | Bacteria | 1429 |
| 123 | Ga0075367_10065300 | 3300006178 | Bacteria | 2179 |
| 124 | Ga0075366_10039838 | 3300006195 | Bacteria | 2777 |
| 125 | Ga0097621_100074025 | 3300006237 | Bacteria | 2820 |
| 126 | Ga0075370_10014925 | 3300006353 | Bacteria | 4151 |
| 127 | Ga0075428_100005630 | 3300006844 | Bacteria | 13921 |
| 128 | Ga0075428_100232820 | 3300006844 | Bacteria | 1988 |
| 129 | Ga0075431_100000196 | 3300006847 | Bacteria | 44288 |
| 130 | Ga0075429_100002073 | 3300006880 | Bacteria | 16727 |
| 131 | Ga0099824_1010553 | 3300006942 | Bacteria | 10831 |
| 132 | Ga0099822_1001130 | 3300006943 | Bacteria | 29740 |
| 133 | Ga0099794_10001814 | 3300007265 | Bacteria | 7623 |
| 134 | Ga0099794_10052661 | 3300007265 | Bacteria | 1962 |
| 135 | Ga0099795_10000154 | 3300007788 | Bacteria | 11507 |
| 136 | Ga0099795_10021402 | 3300007788 | Bacteria | 2121 |
| 137 | Ga0105240_10019779 | 3300009093 | Bacteria | 8991 |
| 138 | Ga0105240_10020186 | 3300009093 | Bacteria | 8895 |
| 139 | Ga0105240_10056805 | 3300009093 | Bacteria | 4895 |
| 140 | Ga0105240_10069157 | 3300009093 | Bacteria | 4371 |
| 141 | Ga0111539_10008246 | 3300009094 | Bacteria | 13262 |
| 142 | Ga0111539_10269847 | 3300009094 | Bacteria | 1981 |
| 143 | Ga0105245_10027991 | 3300009098 | Bacteria | 4968 |
| 144 | Ga0105247_10025399 | 3300009101 | Bacteria | 3573 |
| 145 | Ga0105247_10117536 | 3300009101 | Bacteria | 1719 |
| 146 | Ga0114129_10039302 | 3300009147 | Bacteria | 6670 |
| 147 | Ga0114129_10227768 | 3300009147 | Bacteria | 2511 |
| 148 | Ga0105241_10001128 | 3300009174 | Bacteria | 20332 |
| 149 | Ga0105241_10017590 | 3300009174 | Bacteria | 5256 |
| 150 | Ga0105241_10039945 | 3300009174 | Bacteria | 3540 |
| 151 | Ga0105241_10127327 | 3300009174 | Bacteria | 2058 |
| 152 | Ga0105242_10124784 | 3300009176 | Bacteria | 2215 |
| 153 | Ga0105248_10058178 | 3300009177 | Bacteria | 4340 |
| 154 | Ga0105248_10062849 | 3300009177 | Bacteria | 4168 |
| 155 | Ga0105248_10110074 | 3300009177 | Bacteria | 3106 |
| 156 | Ga0105237_10013465 | 3300009545 | Bacteria | 8575 |
| 157 | Ga0105237_10018185 | 3300009545 | Bacteria | 7275 |
| 158 | Ga0105237_10033149 | 3300009545 | Bacteria | 5233 |
| 159 | Ga0105237_10038959 | 3300009545 | Bacteria | 4798 |
| 160 | Ga0105237_10063877 | 3300009545 | Bacteria | 3678 |
| 161 | Ga0105237_10072147 | 3300009545 | Bacteria | 3446 |
| 162 | Ga0105237_10082546 | 3300009545 | Bacteria | 3204 |
| 163 | Ga0105237_10151315 | 3300009545 | Bacteria | 2317 |
| 164 | Ga0105237_10335137 | 3300009545 | Bacteria | 1517 |
| 165 | Ga0105238_10011980 | 3300009551 | Bacteria | 8735 |
| 166 | Ga0105238_10018757 | 3300009551 | Bacteria | 7045 |
| 167 | Ga0105238_10031278 | 3300009551 | Bacteria | 5418 |
| 168 | Ga0105238_10055394 | 3300009551 | Bacteria | 3980 |
| 169 | Ga0105238_10097311 | 3300009551 | Bacteria | 2929 |
| 170 | Ga0105249_10065948 | 3300009553 | Bacteria | 3332 |
| 171 | Ga0099796_10000092 | 3300010159 | Bacteria | 14577 |
| 172 | Ga0099796_10007421 | 3300010159 | Bacteria | 2865 |
| 173 | Ga0105239_10013525 | 3300010375 | Bacteria | 9059 |
| 174 | Ga0105239_10014647 | 3300010375 | Bacteria | 8695 |
| 175 | Ga0105239_10021881 | 3300010375 | Bacteria | 7049 |
| 176 | Ga0105239_10110596 | 3300010375 | Bacteria | 3046 |
| 177 | Ga0105239_10197400 | 3300010375 | Bacteria | 2253 |
| 178 | Ga0105239_10238348 | 3300010375 | Bacteria | 2042 |
| 179 | Ga0105246_10013370 | 3300011119 | Bacteria | 5144 |
| 180 | Ga0157373_10031343 | 3300013100 | Bacteria | 3827 |
| 181 | Ga0157370_10030840 | 3300013104 | Bacteria | 5251 |
| 182 | Ga0157370_10051707 | 3300013104 | Bacteria | 3924 |
| 183 | Ga0157369_10005049 | 3300013105 | Bacteria | 15450 |
| 184 | Ga0157369_10009441 | 3300013105 | Bacteria | 11153 |
| 185 | Ga0157369_10016741 | 3300013105 | Bacteria | 8241 |
| 186 | Ga0157369_10160768 | 3300013105 | Bacteria | 2371 |
| 187 | Ga0157374_10052593 | 3300013296 | Bacteria | 3794 |
| 188 | Ga0157374_10130102 | 3300013296 | Bacteria | 2436 |
| 189 | Ga0157374_10160532 | 3300013296 | Bacteria | 2189 |
| 190 | Ga0157378_10013278 | 3300013297 | Bacteria | 7202 |
| 191 | Ga0163162_10062640 | 3300013306 | Bacteria | 3760 |
| 192 | Ga0163162_10149875 | 3300013306 | Bacteria | 2449 |
| 193 | Ga0163162_10307840 | 3300013306 | Bacteria | 1716 |
| 194 | Ga0163162_10384649 | 3300013306 | Bacteria | 1536 |
| 195 | Ga0157372_10174902 | 3300013307 | Bacteria | 2485 |
| 196 | Ga0157372_10404700 | 3300013307 | Bacteria | 1590 |
| 197 | Ga0157375_10044677 | 3300013308 | Bacteria | 4306 |
| 198 | Ga0157375_10084779 | 3300013308 | Bacteria | 3218 |
| 199 | Ga0157375_10158570 | 3300013308 | Bacteria | 2403 |
| 200 | Ga0157375_10226846 | 3300013308 | Bacteria | 2027 |
| 201 | Ga0157380_10041401 | 3300014326 | Bacteria | 3595 |
| 202 | Ga0157377_10028838 | 3300014745 | Bacteria | 2990 |
| 203 | Ga0157379_10182868 | 3300014968 | Bacteria | 1894 |
| 204 | Ga0163161_10193280 | 3300017792 | Bacteria | 1565 |
| 205 | Ga0206353_10887329 | 3300020082 | Bacteria | 1713 |
| 206 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 207 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 208 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 209 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 210 | Ga0213874_10002688 | 3300021377 | Bacteria | 3861 |
| 211 | Ga0213876_10004192 | 3300021384 | Bacteria | 8083 |
| 212 | Ga0224712_10022413 | 3300022467 | Bacteria | 2177 |
| 213 | Ga0209563_105305 | 3300025230 | Bacteria | 2355 |
| 214 | Ga0209677_102534 | 3300025253 | Bacteria | 6765 |
| 215 | Ga0209148_1000374 | 3300025254 | Bacteria | 54657 |
| 216 | Ga0209233_1007575 | 3300025261 | Bacteria | 3427 |
| 217 | Ga0209455_1001411 | 3300025272 | Bacteria | 10891 |
| 218 | Ga0209455_1003883 | 3300025272 | Bacteria | 5098 |
| 219 | Ga0209673_1029820 | 3300025273 | Bacteria | 1729 |
| 220 | Ga0209564_1011932 | 3300025295 | Bacteria | 3839 |
| 221 | Ga0209758_1000024 | 3300025297 | Bacteria | 591966 |
| 222 | Ga0209758_1000068 | 3300025297 | Bacteria | 286488 |
| 223 | Ga0209758_1001579 | 3300025297 | Bacteria | 26050 |
| 224 | Ga0209758_1002091 | 3300025297 | Bacteria | 21224 |
| 225 | Ga0209758_1005630 | 3300025297 | Bacteria | 9509 |
| 226 | Ga0209758_1015196 | 3300025297 | Bacteria | 4012 |
| 227 | Ga0209256_1008086 | 3300025299 | Bacteria | 4968 |
| 228 | Ga0207426_1000238 | 3300025302 | Bacteria | 124393 |
| 229 | Ga0207426_1000726 | 3300025302 | Bacteria | 37826 |
| 230 | Ga0207426_1021118 | 3300025302 | Bacteria | 2253 |
| 231 | Ga0209257_1004927 | 3300025304 | Bacteria | 9810 |
| 232 | Ga0209257_1018552 | 3300025304 | Bacteria | 2669 |
| 233 | Ga0207653_10010122 | 3300025885 | Bacteria | 2941 |
| 234 | Ga0207682_10000451 | 3300025893 | Bacteria | 18904 |
| 235 | Ga0207692_10000175 | 3300025898 | Bacteria | 20519 |
| 236 | Ga0207692_10006739 | 3300025898 | Bacteria | 4670 |
| 237 | Ga0207692_10037770 | 3300025898 | Bacteria | 2364 |
| 238 | Ga0207642_10023088 | 3300025899 | Bacteria | 2479 |
| 239 | Ga0207710_10022920 | 3300025900 | Bacteria | 2680 |
| 240 | Ga0207710_10030595 | 3300025900 | Bacteria | 2350 |
| 241 | Ga0207710_10036667 | 3300025900 | Bacteria | 2163 |
| 242 | Ga0207710_10063399 | 3300025900 | Bacteria | 1681 |
| 243 | Ga0207688_10060214 | 3300025901 | Bacteria | 2138 |
| 244 | Ga0207680_10047992 | 3300025903 | Bacteria | 2533 |
| 245 | Ga0207647_10001739 | 3300025904 | Bacteria | 16681 |
| 246 | Ga0207647_10017311 | 3300025904 | Bacteria | 4900 |
| 247 | Ga0207699_10001765 | 3300025906 | Bacteria | 10215 |
| 248 | Ga0207699_10022952 | 3300025906 | Bacteria | 3389 |
| 249 | Ga0207645_10119720 | 3300025907 | Bacteria | 1708 |
| 250 | Ga0207643_10037942 | 3300025908 | Bacteria | 2705 |
| 251 | Ga0207654_10000232 | 3300025911 | Bacteria | 34089 |
| 252 | Ga0207654_10011815 | 3300025911 | Bacteria | 4461 |
| 253 | Ga0207707_10000950 | 3300025912 | Bacteria | 27902 |
| 254 | Ga0207707_10004626 | 3300025912 | Bacteria | 12087 |
| 255 | Ga0207707_10212389 | 3300025912 | Bacteria | 1685 |
| 256 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 257 | Ga0207695_10001547 | 3300025913 | Bacteria | 37828 |
| 258 | Ga0207695_10083099 | 3300025913 | Bacteria | 3235 |
| 259 | Ga0207695_10101991 | 3300025913 | Bacteria | 2863 |
| 260 | Ga0207695_10113971 | 3300025913 | Bacteria | 2679 |
| 261 | Ga0207671_10008090 | 3300025914 | Bacteria | 8979 |
| 262 | Ga0207671_10019334 | 3300025914 | Bacteria | 5209 |
| 263 | Ga0207671_10050109 | 3300025914 | Bacteria | 3092 |
| 264 | Ga0207671_10117695 | 3300025914 | Bacteria | 2028 |
| 265 | Ga0207693_10007591 | 3300025915 | Bacteria | 8911 |
| 266 | Ga0207693_10110162 | 3300025915 | Bacteria | 2159 |
| 267 | Ga0207693_10124909 | 3300025915 | Bacteria | 2022 |
| 268 | Ga0207663_10017604 | 3300025916 | Bacteria | 3986 |
| 269 | Ga0207663_10039585 | 3300025916 | Bacteria | 2857 |
| 270 | Ga0207660_10059240 | 3300025917 | Bacteria | 2748 |
| 271 | Ga0207660_10064021 | 3300025917 | Bacteria | 2653 |
| 272 | Ga0207660_10159286 | 3300025917 | Bacteria | 1740 |
| 273 | Ga0207657_10000658 | 3300025919 | Bacteria | 36762 |
| 274 | Ga0207657_10074301 | 3300025919 | Bacteria | 2871 |
| 275 | Ga0207649_10071474 | 3300025920 | Bacteria | 2216 |
| 276 | Ga0207652_10051870 | 3300025921 | Bacteria | 3518 |
| 277 | Ga0207646_10258564 | 3300025922 | Bacteria | 1574 |
| 278 | Ga0207681_10070191 | 3300025923 | Bacteria | 2439 |
| 279 | Ga0207681_10210640 | 3300025923 | Bacteria | 1498 |
| 280 | Ga0207694_10000050 | 3300025924 | Bacteria | 159920 |
| 281 | Ga0207694_10055781 | 3300025924 | Bacteria | 3067 |
| 282 | Ga0207694_10068746 | 3300025924 | Bacteria | 2766 |
| 283 | Ga0207694_10136966 | 3300025924 | Bacteria | 1967 |
| 284 | Ga0207650_10209014 | 3300025925 | Bacteria | 1567 |
| 285 | Ga0207687_10024233 | 3300025927 | Bacteria | 4051 |
| 286 | Ga0207687_10113235 | 3300025927 | Bacteria | 2017 |
| 287 | Ga0207687_10176312 | 3300025927 | Bacteria | 1653 |
| 288 | Ga0207700_10001663 | 3300025928 | Bacteria | 12623 |
| 289 | Ga0207700_10071109 | 3300025928 | Bacteria | 2678 |
| 290 | Ga0207664_10007161 | 3300025929 | Bacteria | 7734 |
| 291 | Ga0207664_10020650 | 3300025929 | Bacteria | 4886 |
| 292 | Ga0207644_10025423 | 3300025931 | Bacteria | 4072 |
| 293 | Ga0207706_10028525 | 3300025933 | Bacteria | 4985 |
| 294 | Ga0207686_10016885 | 3300025934 | Bacteria | 4102 |
| 295 | Ga0207686_10058938 | 3300025934 | Bacteria | 2423 |
| 296 | Ga0207670_10006752 | 3300025936 | Bacteria | 6380 |
| 297 | Ga0207669_10000863 | 3300025937 | Bacteria | 12890 |
| 298 | Ga0207704_10046904 | 3300025938 | Bacteria | 2579 |
| 299 | Ga0207665_10015055 | 3300025939 | Bacteria | 5079 |
| 300 | Ga0207665_10023005 | 3300025939 | Bacteria | 4104 |
| 301 | Ga0207691_10001066 | 3300025940 | Bacteria | 27265 |
| 302 | Ga0207691_10115165 | 3300025940 | Bacteria | 2387 |
| 303 | Ga0207691_10223324 | 3300025940 | Bacteria | 1633 |
| 304 | Ga0207711_10033586 | 3300025941 | Bacteria | 4343 |
| 305 | Ga0207711_10053295 | 3300025941 | Bacteria | 3469 |
| 306 | Ga0207689_10014103 | 3300025942 | Bacteria | 6802 |
| 307 | Ga0207689_10064470 | 3300025942 | Bacteria | 3015 |
| 308 | Ga0207661_10008365 | 3300025944 | Bacteria | 7390 |
| 309 | Ga0207679_10082238 | 3300025945 | Bacteria | 2465 |
| 310 | Ga0207667_10015706 | 3300025949 | Bacteria | 8586 |
| 311 | Ga0207667_10086188 | 3300025949 | Bacteria | 3250 |
| 312 | Ga0207667_10112620 | 3300025949 | Bacteria | 2806 |
| 313 | Ga0207651_10052593 | 3300025960 | Bacteria | 2778 |
| 314 | Ga0207668_10027564 | 3300025972 | Bacteria | 3701 |
| 315 | Ga0207668_10056041 | 3300025972 | Bacteria | 2743 |
| 316 | Ga0207668_10096998 | 3300025972 | Bacteria | 2180 |
| 317 | Ga0207640_10043782 | 3300025981 | Bacteria | 2863 |
| 318 | Ga0207640_10062950 | 3300025981 | Bacteria | 2463 |
| 319 | Ga0207658_10187558 | 3300025986 | Bacteria | 1716 |
| 320 | Ga0207677_10020594 | 3300026023 | Bacteria | 4008 |
| 321 | Ga0207677_10021941 | 3300026023 | Bacteria | 3914 |
| 322 | Ga0207703_10081755 | 3300026035 | Bacteria | 2694 |
| 323 | Ga0207639_10016102 | 3300026041 | Bacteria | 5283 |
| 324 | Ga0207639_10042274 | 3300026041 | Bacteria | 3415 |
| 325 | Ga0207639_10161817 | 3300026041 | Bacteria | 1887 |
| 326 | Ga0207639_10187317 | 3300026041 | Bacteria | 1765 |
| 327 | Ga0207678_10015480 | 3300026067 | Bacteria | 6704 |
| 328 | Ga0207678_10021335 | 3300026067 | Bacteria | 5680 |
| 329 | Ga0207678_10033024 | 3300026067 | Bacteria | 4510 |
| 330 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 331 | Ga0207702_10224340 | 3300026078 | Bacteria | 1752 |
| 332 | Ga0207641_10102572 | 3300026088 | Bacteria | 2523 |
| 333 | Ga0207676_10014678 | 3300026095 | Bacteria | 5642 |
| 334 | Ga0207674_10035719 | 3300026116 | Bacteria | 5186 |
| 335 | Ga0207675_100047170 | 3300026118 | Bacteria | 4023 |
| 336 | Ga0207675_100054178 | 3300026118 | Bacteria | 3741 |
| 337 | Ga0207683_10000733 | 3300026121 | Bacteria | 29828 |
| 338 | Ga0207683_10026522 | 3300026121 | Bacteria | 5000 |
| 339 | Ga0207683_10040572 | 3300026121 | Bacteria | 4063 |
| 340 | Ga0207683_10062061 | 3300026121 | Bacteria | 3291 |
| 341 | Ga0207683_10155676 | 3300026121 | Bacteria | 2064 |
| 342 | Ga0207698_10042438 | 3300026142 | Bacteria | 3398 |
| 343 | Ga0207698_10134375 | 3300026142 | Bacteria | 2120 |
| 344 | Ga0209389_1000107 | 3300027296 | Bacteria | 74129 |
| 345 | Ga0209389_1005934 | 3300027296 | Bacteria | 10512 |
| 346 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 347 | Ga0209589_1000092 | 3300027357 | Bacteria | 89530 |
| 348 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 349 | Ga0209489_100006 | 3300027361 | Bacteria | 475698 |
| 350 | Ga0209489_107740 | 3300027361 | Bacteria | 15589 |
| 351 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 352 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 353 | Ga0209179_1007546 | 3300027512 | Bacteria | 1799 |
| 354 | Ga0209588_1004492 | 3300027671 | Bacteria | 3940 |
| 355 | Ga0207428_10002661 | 3300027907 | Bacteria | 17803 |
| 356 | Ga0268266_10019676 | 3300028379 | Bacteria | 5752 |
| 357 | Ga0268266_10020771 | 3300028379 | Bacteria | 5598 |
| 358 | Ga0268266_10032939 | 3300028379 | Bacteria | 4404 |
| 359 | Ga0268266_10061421 | 3300028379 | Bacteria | 3241 |
| 360 | Ga0268266_10103673 | 3300028379 | Bacteria | 2510 |
| 361 | Ga0268264_10000065 | 3300028381 | Bacteria | 298403 |
| 362 | Ga0265337_1002468 | 3300028556 | Bacteria | 8449 |
| 363 | Ga0265326_10003263 | 3300028558 | Bacteria | 5347 |
| 364 | Ga0265319_1007768 | 3300028563 | Bacteria | 4778 |
| 365 | Ga0265334_10000456 | 3300028573 | Bacteria | 21294 |
| 366 | Ga0265322_10005214 | 3300028654 | Bacteria | 3846 |
| 367 | Ga0265336_10000431 | 3300028666 | Bacteria | 25844 |
| 368 | Ga0307517_10000008 | 3300028786 | Bacteria | 243202 |
| 369 | Ga0307515_10078762 | 3300028794 | Bacteria | 4327 |
| 370 | Ga0265338_10000321 | 3300028800 | Bacteria | 87046 |
| 371 | Ga0265325_10002771 | 3300031241 | Bacteria | 11703 |
| 372 | Ga0307509_10010951 | 3300031507 | Bacteria | 11053 |
| 373 | Ga0265313_10000057 | 3300031595 | Bacteria | 108544 |
| 374 | Ga0307508_10000018 | 3300031616 | Bacteria | 202701 |
| 375 | Ga0265342_10062453 | 3300031712 | Bacteria | 2192 |
| 376 | Ga0307516_10004992 | 3300031730 | Bacteria | 16102 |
| 377 | Ga0307516_10007832 | 3300031730 | Bacteria | 12187 |
| 378 | Ga0307516_10074500 | 3300031730 | Bacteria | 3250 |
| 379 | Ga0316583_10008041 | 3300032133 | Bacteria | 3799 |
| 380 | Ga0307507_10054896 | 3300033179 | Bacteria | 3785 |
| 381 | Ga0307510_10041204 | 3300033180 | Bacteria | 5055 |
| 382 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 383 | Ga0373930_0002890 | 3300034816 | Bacteria | 2698 |
| 384 | Ga0373928_0008155 | 3300035084 | Bacteria | 2029 |
| 385 | Ga0373951_0006833 | 3300035091 | Bacteria | 2606 |
| 386 | Ga0373932_0014422 | 3300035112 | Bacteria | 1986 |
| 387 | Ga0373932_0028239 | 3300035112 | Bacteria | 1541 |
| 388 | Ga0373936_0007586 | 3300035113 | Bacteria | 4079 |
| 389 | Ga0373945_0014942 | 3300035116 | Bacteria | 2607 |
| 390 | Ga0373946_0016547 | 3300035171 | Bacteria | 2811 |
| 391 | Ga0373961_0014265 | 3300035241 | Bacteria | 2016 |
| 392 | Ga0373924_0003483 | 3300035410 | Bacteria | 5419 |
| 393 | Ga0373931_0026734 | 3300035691 | Bacteria | 2940 |
| 394 | Ga0373931_0062617 | 3300035691 | Bacteria | 2009 |
| 395 | Ga0373935_0086268 | 3300035692 | Bacteria | 2048 |
| 396 | Ga0373935_0157113 | 3300035692 | Bacteria | 1547 |
| 397 | Ga0373935_0169814 | 3300035692 | Bacteria | 1491 |
| 398 | Ga0373927_0011069 | 3300035695 | Bacteria | 6008 |
| 399 | Ga0373927_0015919 | 3300035695 | Bacteria | 4963 |
| 400 | Ga0373927_0032991 | 3300035695 | Bacteria | 3371 |
| 401 | Ga0373927_0032996 | 3300035695 | Bacteria | 3371 |
| 402 | Ga0373927_0078608 | 3300035695 | Bacteria | 2136 |
| 403 | Ga0373927_0122259 | 3300035695 | Bacteria | 1699 |
| 404 | Ga0373933_0000199 | 3300035724 | Bacteria | 39593 |
| 405 | Ga0373933_0017531 | 3300035724 | Bacteria | 4017 |
| 406 | Ga0373947_0032400 | 3300035725 | Bacteria | 3080 |
| 407 | Ga0373937_0009602 | 3300036401 | Bacteria | 8421 |
| 408 | Ga0395899_0003643 | 3300037312 | Bacteria | 12197 |
| 409 | Ga0395900_0000820 | 3300037418 | Bacteria | 41179 |
| 410 | Ga0395900_0005923 | 3300037418 | Bacteria | 12759 |
| 411 | Ga0395900_0121081 | 3300037418 | Bacteria | 2685 |
| 412 | Ga0395898_0026506 | 3300037466 | Bacteria | 5830 |
| 413 | Ga0395898_0034063 | 3300037466 | Bacteria | 5079 |
| 414 | Ga0395898_0065753 | 3300037466 | Bacteria | 3515 |
| 415 | Ga0395898_0183684 | 3300037466 | Bacteria | 1998 |
| 416 | Ga0395898_0200538 | 3300037466 | Bacteria | 1905 |
| 417 | Ga0395905_0006498 | 3300037471 | Bacteria | 11758 |
| 418 | Ga0395901_0081268 | 3300038443 | Bacteria | 3385 |
| 419 | Ga0395901_0143576 | 3300038443 | Bacteria | 2509 |
| 420 | Ga0395901_0181866 | 3300038443 | Bacteria | 2205 |
| 421 | Ga0395901_0301519 | 3300038443 | Bacteria | 1661 |
| 422 | Ga0436365_1358938 | 3300039437 | Bacteria | 3386 |
| 423 | Ga0436365_1434183 | 3300039437 | Bacteria | 5621 |
| 424 | Ga0436365_1827614 | 3300039437 | Bacteria | 7728 |
| 425 | Ga0436365_1840276 | 3300039437 | Bacteria | 14090 |
| 426 | Ga0436360_0105255 | 3300039438 | Bacteria | 5973 |
| 427 | Ga0436360_0457068 | 3300039438 | Bacteria | 1730 |
| 428 | Ga0436363_0602269 | 3300039450 | Bacteria | 5606 |
| 429 | Ga0436363_1661094 | 3300039450 | Bacteria | 3360 |
| 430 | Ga0436362_1200408 | 3300039453 | Bacteria | 1980 |
| 431 | Ga0439465_0025951 | 3300041413 | Bacteria | 1851 |
| 432 | Ga0451802_0581573 | 3300041460 | Bacteria | 1768 |
| 433 | Ga0451833_0611236 | 3300041491 | Bacteria | 2362 |
| 434 | Ga0439459_0011511 | 3300042438 | Bacteria | 1560 |
| 435 | Ga0466972_0000846 | 3300044658 | Bacteria | 14671 |
| 436 | Ga0466966_0000334 | 3300044684 | Bacteria | 30532 |
| 437 | Ga0466961_0000509 | 3300044693 | Bacteria | 24794 |
| 438 | Ga0466964_0032631 | 3300044706 | Bacteria | 2070 |
| 439 | Ga0466971_0088137 | 3300044719 | Bacteria | 1419 |
| 440 | Ga0466957_0039507 | 3300044842 | Bacteria | 2847 |
| 441 | Ga0466959_0041260 | 3300045049 | Bacteria | 3407 |
| 442 | Ga0466959_0128941 | 3300045049 | Bacteria | 1793 |
| 443 | Ga0466959_0149357 | 3300045049 | Bacteria | 1648 |
| 444 | Ga0466967_0009054 | 3300045976 | Bacteria | 7360 |
| 445 | Ga0495592_0021156 | 3300046454 | Bacteria | 4947 |
| 446 | Ga0495592_0038824 | 3300046454 | Bacteria | 3580 |
| 447 | Ga0495590_0020654 | 3300046457 | Bacteria | 2339 |
| 448 | Ga0495629_0027278 | 3300046459 | Bacteria | 4055 |
| 449 | Ga0495629_0093125 | 3300046459 | Bacteria | 2103 |
| 450 | Ga0495638_0023142 | 3300046460 | Bacteria | 4068 |
| 451 | Ga0495651_0001733 | 3300046462 | Bacteria | 16846 |
| 452 | Ga0495651_0035514 | 3300046462 | Bacteria | 3880 |
| 453 | Ga0495653_0032482 | 3300046463 | Bacteria | 4143 |
| 454 | Ga0495580_0007795 | 3300046472 | Bacteria | 8578 |
| 455 | Ga0495580_0027236 | 3300046472 | Bacteria | 4159 |
| 456 | Ga0495582_0004536 | 3300046473 | Bacteria | 7799 |
| 457 | Ga0495582_0079896 | 3300046473 | Bacteria | 1816 |
| 458 | Ga0495662_0002900 | 3300046476 | Bacteria | 8669 |
| 459 | Ga0495664_0001939 | 3300046477 | Bacteria | 11029 |
| 460 | Ga0495664_0086349 | 3300046477 | Bacteria | 1884 |
| 461 | Ga0495585_0023733 | 3300046492 | Bacteria | 3519 |
| 462 | Ga0495607_0122772 | 3300046501 | Bacteria | 1361 |
| 463 | Ga0495606_0003754 | 3300046507 | Bacteria | 15805 |
| 464 | Ga0495606_0028614 | 3300046507 | Bacteria | 3927 |
| 465 | Ga0495606_0054429 | 3300046507 | Bacteria | 2591 |
| 466 | Ga0495608_0005911 | 3300046511 | Bacteria | 8704 |
| 467 | Ga0495618_0011828 | 3300046514 | Bacteria | 5296 |
| 468 | Ga0495620_0039513 | 3300046515 | Bacteria | 2084 |
| 469 | Ga0495628_0038168 | 3300046516 | Bacteria | 3846 |
| 470 | Ga0495630_0025233 | 3300046517 | Bacteria | 4394 |
| 471 | Ga0495632_0023647 | 3300046519 | Bacteria | 3278 |
| 472 | Ga0495648_0107139 | 3300046524 | Bacteria | 1528 |
| 473 | Ga0495666_0055889 | 3300046526 | Bacteria | 1891 |
| 474 | Ga0495652_0062463 | 3300046529 | Bacteria | 3141 |
| 475 | Ga0495665_0026130 | 3300046531 | Bacteria | 3136 |
| 476 | Ga0495640_0085120 | 3300046533 | Bacteria | 2095 |
| 477 | Ga0495587_0008847 | 3300046536 | Bacteria | 6463 |
| 478 | Ga0495597_0066507 | 3300046542 | Bacteria | 1562 |
| 479 | Ga0495645_0008821 | 3300046543 | Bacteria | 7043 |
| 480 | Ga0495645_0157617 | 3300046543 | Bacteria | 1572 |
| 481 | Ga0495622_0034647 | 3300046557 | Bacteria | 2355 |
| 482 | Ga0495633_0032679 | 3300046558 | Bacteria | 2513 |
| 483 | Ga0495633_0067740 | 3300046558 | Bacteria | 1666 |
| 484 | Ga0495667_0003089 | 3300046559 | Bacteria | 11169 |
| 485 | Ga0495667_0077291 | 3300046559 | Bacteria | 2165 |
| 486 | Ga0495634_0055198 | 3300046642 | Bacteria | 2656 |
| 487 | Ga0495611_0062309 | 3300046648 | Bacteria | 1696 |
| 488 | Ga0495625_0086017 | 3300046660 | Bacteria | 2181 |
| 489 | Ga0495635_0203174 | 3300046663 | Bacteria | 1343 |
| 490 | Ga0495588_0013307 | 3300046674 | Bacteria | 3918 |
| 491 | Ga0495588_0081212 | 3300046674 | Bacteria | 1692 |
| 492 | Ga0495657_0007669 | 3300046675 | Bacteria | 8308 |
| 493 | Ga0495657_0033170 | 3300046675 | Bacteria | 3597 |
| 494 | Ga0495599_0025195 | 3300046678 | Bacteria | 3723 |
| 495 | Ga0495599_0077350 | 3300046678 | Bacteria | 2077 |
| 496 | Ga0495647_0007665 | 3300046681 | Bacteria | 3625 |
| 497 | Ga0495658_0051124 | 3300046683 | Bacteria | 2340 |
| 498 | Ga0495669_0015398 | 3300046684 | Bacteria | 3274 |
| 499 | Ga0495669_0031811 | 3300046684 | Bacteria | 2317 |
| 500 | Ga0495613_0051818 | 3300046689 | Bacteria | 3024 |
| 501 | Ga0495613_0095977 | 3300046689 | Bacteria | 2144 |
| 502 | Ga0495624_0024439 | 3300046690 | Bacteria | 3975 |
| 503 | Ga0495670_0077501 | 3300046691 | Bacteria | 1690 |
| 504 | Ga0495589_0081114 | 3300046794 | Bacteria | 1578 |
| 505 | Ga0495589_0107393 | 3300046794 | Bacteria | 1348 |
| 506 | Ga0495600_0008276 | 3300046809 | Bacteria | 6384 |
| 507 | Ga0495581_0014251 | 3300047315 | Bacteria | 4610 |
| 508 | Ga0495581_0053165 | 3300047315 | Bacteria | 2340 |
| 509 | Ga0495604_0007727 | 3300047317 | Bacteria | 8516 |
| 510 | Ga0495604_0185659 | 3300047317 | Bacteria | 1452 |
| 511 | Ga0495674_0006216 | 3300047319 | Bacteria | 11455 |
| 512 | Ga0495674_0029090 | 3300047319 | Bacteria | 5033 |
| 513 | Ga0495674_0212053 | 3300047319 | Bacteria | 1604 |
| 514 | Ga0495675_0009070 | 3300047444 | Bacteria | 6181 |
| 515 | Ga0495677_0032688 | 3300047445 | Bacteria | 1895 |
| 516 | Ga0495685_014509 | 3300047447 | Bacteria | 2678 |
| 517 | Ga0495684_0023878 | 3300047471 | Bacteria | 4702 |
| 518 | Ga0495684_0032468 | 3300047471 | Bacteria | 4009 |
| 519 | Ga0495686_0074158 | 3300047472 | Bacteria | 2089 |
| 520 | Ga0495686_0133937 | 3300047472 | Bacteria | 1467 |
| 521 | Ga0495593_0043880 | 3300047673 | Bacteria | 2394 |
| 522 | Ga0495593_0058470 | 3300047673 | Bacteria | 2022 |
| 523 | Ga0495602_0058638 | 3300048088 | Bacteria | 3368 |
| 524 | Ga0496100_0017591 | 3300048903 | Bacteria | 4223 |
| 525 | Ga0496100_0022944 | 3300048903 | Bacteria | 3783 |
| 526 | Ga0496100_0035027 | 3300048903 | Bacteria | 3155 |
| 527 | Ga0496100_0052915 | 3300048903 | Bacteria | 2642 |
| 528 | Ga0496100_0139005 | 3300048903 | Bacteria | 1719 |
| 529 | Ga0496101_0021665 | 3300048904 | Bacteria | 4416 |
| 530 | Ga0496101_0036585 | 3300048904 | Bacteria | 3477 |
| 531 | Ga0496101_0091342 | 3300048904 | Bacteria | 2266 |
| 532 | Ga0496102_0012241 | 3300048905 | Bacteria | 7420 |
| 533 | Ga0496102_0040005 | 3300048905 | Bacteria | 4239 |
| 534 | Ga0496102_0041888 | 3300048905 | Bacteria | 4148 |
| 535 | Ga0496102_0042845 | 3300048905 | Bacteria | 4103 |
| 536 | Ga0496102_0093932 | 3300048905 | Bacteria | 2779 |
| 537 | Ga0496102_0133598 | 3300048905 | Bacteria | 2324 |
| 538 | Ga0496102_0230263 | 3300048905 | Bacteria | 1747 |
| 539 | Ga0496103_0017531 | 3300048906 | Bacteria | 4287 |
| 540 | Ga0496104_0033245 | 3300048907 | Bacteria | 4803 |
| 541 | Ga0496104_0173382 | 3300048907 | Bacteria | 2067 |
| 542 | Ga0496105_0000527 | 3300048908 | Bacteria | 25240 |
| 543 | Ga0496105_0012981 | 3300048908 | Bacteria | 6599 |
| 544 | Ga0496105_0019719 | 3300048908 | Bacteria | 5440 |
| 545 | Ga0496105_0039702 | 3300048908 | Bacteria | 3881 |
| 546 | Ga0496105_0056097 | 3300048908 | Bacteria | 3252 |
| 547 | Ga0496106_0002824 | 3300048909 | Bacteria | 12877 |
| 548 | Ga0496106_0022677 | 3300048909 | Bacteria | 4665 |
| 549 | Ga0496106_0025243 | 3300048909 | Bacteria | 4421 |
| 550 | Ga0496106_0035401 | 3300048909 | Bacteria | 3733 |
| 551 | Ga0496106_0091486 | 3300048909 | Bacteria | 2349 |
| 552 | Ga0496106_0159657 | 3300048909 | Bacteria | 1782 |
| 553 | Ga0496107_0010480 | 3300048910 | Bacteria | 6443 |
| 554 | Ga0496107_0043491 | 3300048910 | Bacteria | 3227 |
| 555 | Ga0496107_0175572 | 3300048910 | Bacteria | 1590 |
| 556 | Ga0496108_0038348 | 3300048911 | Bacteria | 3991 |
| 557 | Ga0496108_0049993 | 3300048911 | Bacteria | 3498 |
| 558 | Ga0496108_0286721 | 3300048911 | Bacteria | 1433 |
| 559 | Ga0496108_0337881 | 3300048911 | Bacteria | 1314 |
| 560 | Ga0496109_0039798 | 3300048912 | Bacteria | 4256 |
| 561 | Ga0496109_0126886 | 3300048912 | Bacteria | 2379 |
| 562 | Ga0496110_0020119 | 3300048913 | Bacteria | 5630 |
| 563 | Ga0496110_0030628 | 3300048913 | Bacteria | 4638 |
| 564 | Ga0496110_0038517 | 3300048913 | Bacteria | 4161 |
| 565 | Ga0496110_0075282 | 3300048913 | Bacteria | 2999 |
| 566 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 567 | Ga0496112_0025892 | 3300048915 | Bacteria | 5637 |
| 568 | Ga0496112_0080722 | 3300048915 | Bacteria | 3216 |
| 569 | Ga0496112_0088836 | 3300048915 | Bacteria | 3058 |
| 570 | Ga0496112_0127498 | 3300048915 | Bacteria | 2515 |
| 571 | Ga0496112_0137207 | 3300048915 | Bacteria | 2416 |
| 572 | Ga0496112_0160489 | 3300048915 | Bacteria | 2215 |
| 573 | Ga0496112_0160931 | 3300048915 | Bacteria | 2211 |
| 574 | Ga0496113_0016119 | 3300048916 | Bacteria | 5157 |
| 575 | Ga0496113_0020357 | 3300048916 | Bacteria | 4663 |
| 576 | Ga0496113_0087530 | 3300048916 | Bacteria | 2395 |
| 577 | Ga0496113_0107667 | 3300048916 | Bacteria | 2166 |
| 578 | Ga0496114_0017928 | 3300048917 | Bacteria | 5722 |
| 579 | Ga0496114_0029802 | 3300048917 | Bacteria | 4486 |
| 580 | Ga0496114_0030675 | 3300048917 | Bacteria | 4423 |
| 581 | Ga0496114_0306772 | 3300048917 | Bacteria | 1402 |
| 582 | Ga0496115_0006668 | 3300048918 | Bacteria | 8471 |
| 583 | Ga0496115_0011990 | 3300048918 | Bacteria | 6514 |
| 584 | Ga0496115_0022969 | 3300048918 | Bacteria | 4837 |
| 585 | Ga0496115_0054034 | 3300048918 | Bacteria | 3224 |
| 586 | Ga0496115_0073822 | 3300048918 | Bacteria | 2769 |
| 587 | Ga0496117_0038468 | 3300048920 | Bacteria | 3546 |
| 588 | Ga0496118_0004964 | 3300048921 | Bacteria | 15387 |
| 589 | Ga0496118_0034989 | 3300048921 | Bacteria | 4087 |
| 590 | Ga0496119_0064811 | 3300048922 | Bacteria | 2167 |
| 591 | Ga0496121_0000594 | 3300048924 | Bacteria | 67953 |
| 592 | Ga0496121_0002820 | 3300048924 | Bacteria | 25702 |
| 593 | Ga0496121_0017933 | 3300048924 | Bacteria | 7181 |
| 594 | Ga0496121_0019022 | 3300048924 | Bacteria | 6890 |
| 595 | Ga0496121_0043405 | 3300048924 | Bacteria | 3894 |
| 596 | Ga0496121_0064220 | 3300048924 | Bacteria | 2994 |
| 597 | Ga0496122_0154419 | 3300048925 | Bacteria | 1411 |
| 598 | Ga0496124_0002651 | 3300048927 | Bacteria | 22984 |
| 599 | Ga0496125_0090455 | 3300048928 | Bacteria | 2297 |
| 600 | Ga0496125_0177172 | 3300048928 | Bacteria | 1425 |
| 601 | Ga0496126_0004957 | 3300048929 | Bacteria | 15524 |
| 602 | Ga0496126_0014996 | 3300048929 | Bacteria | 7812 |
| 603 | Ga0496126_0031625 | 3300048929 | Bacteria | 4995 |
| 604 | Ga0496126_0040728 | 3300048929 | Bacteria | 4305 |
| 605 | Ga0496126_0051557 | 3300048929 | Bacteria | 3745 |
| 606 | Ga0496126_0057631 | 3300048929 | Bacteria | 3505 |
| 607 | Ga0496126_0074051 | 3300048929 | Bacteria | 3025 |
| 608 | Ga0496126_0080022 | 3300048929 | Bacteria | 2892 |
| 609 | Ga0496126_0092051 | 3300048929 | Bacteria | 2665 |
| 610 | Ga0496126_0130321 | 3300048929 | Bacteria | 2174 |
| 611 | Ga0496126_0250356 | 3300048929 | Bacteria | 1477 |
| 612 | Ga0501031_0107942 | 3300049568 | Bacteria | 1817 |
| 613 | Ga0501033_0107514 | 3300049570 | Bacteria | 2032 |
| 614 | Ga0501034_0015888 | 3300049571 | Bacteria | 7730 |
| 615 | Ga0501036_0163739 | 3300049572 | Bacteria | 1875 |
| 616 | Ga0501040_0193437 | 3300049576 | Bacteria | 1444 |
| 617 | Ga0501041_0087879 | 3300049577 | Bacteria | 1919 |
| 618 | Ga0501046_0156502 | 3300049580 | Bacteria | 1716 |
| 619 | Ga0501047_0007358 | 3300049581 | Bacteria | 10352 |
| 620 | Ga0501067_0039560 | 3300049583 | Bacteria | 2618 |
| 621 | Ga0501067_0078902 | 3300049583 | Bacteria | 1824 |
| 622 | Ga0501070_0003226 | 3300049586 | Bacteria | 14186 |
| 623 | Ga0501080_0125288 | 3300049742 | Bacteria | 2379 |
| 624 | nmdc:mga03n38_428_c1 | 3300050490 | Bacteria | 10457 |
| 625 | nmdc:mga0k408_97893_c1 | 3300050493 | Bacteria | 1728 |
| 626 | nmdc:mga06z11_38973_c1 | 3300050494 | Bacteria | 2363 |
| 627 | nmdc:mga07m45_12666_c1 | 3300050496 | Bacteria | 4461 |
| 628 | nmdc:mga07m45_30295_c1 | 3300050496 | Bacteria | 2996 |
| 629 | nmdc:mga05p37_180885_c1 | 3300050507 | Bacteria | 2565 |
| 630 | nmdc:mga05p37_7887_c1 | 3300050507 | Bacteria | 12566 |
| 631 | nmdc:mga09592_2960_c1 | 3300050508 | Bacteria | 13764 |
| 632 | nmdc:mga06r32_1710_c1 | 3300050510 | Bacteria | 19764 |
| 633 | nmdc:mga06r32_32730_c1 | 3300050510 | Bacteria | 4894 |
| 634 | nmdc:mga08y16_213_c1 | 3300050511 | Bacteria | 51950 |
| 635 | nmdc:mga0n895_36971_c1 | 3300050512 | Bacteria | 4719 |
| 636 | nmdc:mga0rr50_69712_c1 | 3300050513 | Bacteria | 2677 |
| 637 | nmdc:mga0sz30_1328_c1 | 3300050516 | Bacteria | 8808 |
| 638 | Ga0495601_0029670 | 3300053077 | Bacteria | 3394 |
| 639 | Ga0500635_0008920 | 3300053080 | Bacteria | 2766 |
| 640 | Ga0495595_0016428 | 3300053084 | Bacteria | 3167 |
| 641 | Ga0495619_0033553 | 3300053085 | Bacteria | 3334 |
| 642 | Ga0495619_0148854 | 3300053085 | Bacteria | 1614 |
| 643 | Ga0500643_000007 | 3300053087 | Bacteria | 462836 |
| 644 | Ga0500647_0010746 | 3300053091 | Bacteria | 4062 |
| 645 | Ga0500647_0036572 | 3300053091 | Bacteria | 2348 |
| 646 | Ga0500566_0000204 | 3300053094 | Bacteria | 31169 |
| 647 | Ga0500566_0003695 | 3300053094 | Bacteria | 9139 |
| 648 | Ga0500566_0035645 | 3300053094 | Bacteria | 2890 |
| 649 | Ga0500640_062702 | 3300053095 | Bacteria | 1608 |
| 650 | Ga0500641_0074714 | 3300053096 | Bacteria | 1431 |
| 651 | Ga0500556_0005665 | 3300053104 | Bacteria | 3526 |
| 652 | Ga0500557_000052 | 3300053105 | Bacteria | 50636 |
| 653 | Ga0500562_018107 | 3300053108 | Bacteria | 1818 |
| 654 | Ga0500572_000307 | 3300053111 | Bacteria | 17413 |
| 655 | Ga0500572_000451 | 3300053111 | Bacteria | 14277 |
| 656 | Ga0500595_002911 | 3300053119 | Bacteria | 8191 |
| 657 | Ga0500595_009999 | 3300053119 | Bacteria | 3794 |
| 658 | Ga0500595_020826 | 3300053119 | Bacteria | 2351 |
| 659 | Ga0500607_024838 | 3300053121 | Bacteria | 3340 |
| 660 | Ga0500608_003260 | 3300053122 | Bacteria | 6047 |
| 661 | Ga0500642_0029960 | 3300053130 | Bacteria | 2260 |
| 662 | Ga0500655_007298 | 3300053133 | Bacteria | 1988 |
| 663 | Ga0500559_0000143 | 3300053136 | Bacteria | 55572 |
| 664 | Ga0500559_0001636 | 3300053136 | Bacteria | 12414 |
| 665 | Ga0500590_010413 | 3300053148 | Bacteria | 4697 |
| 666 | Ga0500603_000834 | 3300053150 | Bacteria | 7360 |
| 667 | Ga0500616_0007501 | 3300053153 | Bacteria | 6916 |
| 668 | Ga0500622_0008171 | 3300053156 | Bacteria | 5878 |
| 669 | Ga0500630_000027 | 3300053159 | Bacteria | 42085 |
| 670 | Ga0500638_003956 | 3300053162 | Bacteria | 5606 |
| 671 | Ga0500639_000020 | 3300053163 | Bacteria | 102959 |
| 672 | Ga0500639_008513 | 3300053163 | Bacteria | 5351 |
| 673 | Ga0500636_0000042 | 3300053177 | Bacteria | 69412 |
| 674 | Ga0500637_0000132 | 3300053178 | Bacteria | 27236 |
| 675 | Ga0500596_004772 | 3300053735 | Bacteria | 2452 |
| 676 | Ga0500596_006899 | 3300053735 | Bacteria | 1888 |
| 677 | Ga0500599_002750 | 3300053736 | Bacteria | 2123 |
| 678 | Ga0500601_000228 | 3300053737 | Bacteria | 11112 |
| 679 | Ga0500661_002508 | 3300055283 | Bacteria | 3465 |
| 680 | Ga0500661_021927 | 3300055283 | Bacteria | 1133 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048911 | Ga0496108_0337881 | Ga0496108_0337881_248_1300 | 347 |
| 2 | 3300047317 | Ga0495604_0185659 | Ga0495604_0185659_384_1442 | 350 |
| 3 | 3300053096 | Ga0500641_0074714 | Ga0500641_0074714_10_1068 | 350 |
| 4 | 3300047472 | Ga0495686_0074158 | Ga0495686_0074158_967_2076 | 360 |
| 5 | 3300048920 | Ga0496117_0038468 | Ga0496117_0038468_2438_3535 | 362 |
| 6 | 3300055283 | Ga0500661_021927 | Ga0500661_021927_26_1123 | 362 |
| 7 | iso_pu_bacteria | 8019629233 | 8019634047 | 362 |
| 8 | 3300046501 | Ga0495607_0122772 | Ga0495607_0122772_239_1348 | 366 |
| 9 | 3300046691 | Ga0495670_0077501 | Ga0495670_0077501_20_1129 | 366 |
| 10 | 3300053085 | Ga0495619_0148854 | Ga0495619_0148854_20_1129 | 366 |
| 11 | 3300035091 | Ga0373951_0006833 | Ga0373951_0006833_17_1132 | 371 |
| 12 | 3300046543 | Ga0495645_0157617 | Ga0495645_0157617_411_1556 | 378 |
| 13 | 3300035692 | Ga0373935_0169814 | Ga0373935_0169814_255_1481 | 397 |
| 14 | 3300053153 | Ga0500616_0007501 | Ga0500616_0007501_4586_5863 | 397 |
| 15 | 3300005340 | Ga0070689_100011851 | Ga0070689_1000118514 | 398 |
| 16 | 3300025936 | Ga0207670_10006752 | Ga0207670_100067525 | 398 |
| 17 | 3300048917 | Ga0496114_0306772 | Ga0496114_0306772_134_1366 | 398 |
| 18 | iso_pu_bacteria | 8019565922 | 8019569111 | 401 |
| 19 | 3300053735 | Ga0500596_004772 | Ga0500596_004772_1222_2439 | 402 |
| 20 | 3300046472 | Ga0495580_0027236 | Ga0495580_0027236_631_1842 | 403 |
| 21 | 3300046476 | Ga0495662_0002900 | Ga0495662_0002900_6828_8039 | 403 |
| 22 | 3300046648 | Ga0495611_0062309 | Ga0495611_0062309_18_1229 | 403 |
| 23 | 3300048907 | Ga0496104_0173382 | Ga0496104_0173382_12_1223 | 403 |
| 24 | 3300005468 | Ga0070707_100307055 | Ga0070707_1003070551 | 405 |
| 25 | 3300005539 | Ga0068853_100047159 | Ga0068853_1000471592 | 405 |
| 26 | 3300025917 | Ga0207660_10059240 | Ga0207660_100592402 | 405 |
| 27 | 3300035692 | Ga0373935_0086268 | Ga0373935_0086268_667_1947 | 405 |
| 28 | 3300036401 | Ga0373937_0009602 | Ga0373937_0009602_4673_5953 | 405 |
| 29 | 3300046558 | Ga0495633_0067740 | Ga0495633_0067740_15_1241 | 405 |
| 30 | 3300048911 | Ga0496108_0286721 | Ga0496108_0286721_38_1264 | 405 |
| 31 | 3300048925 | Ga0496122_0154419 | Ga0496122_0154419_136_1362 | 405 |
| 32 | 3300048928 | Ga0496125_0177172 | Ga0496125_0177172_187_1413 | 405 |
| 33 | 3300050493 | nmdc:mga0k408_97893_c1 | nmdc:mga0k408_97893_c1_489_1715 | 405 |
| 34 | 3300005436 | Ga0070713_100156741 | Ga0070713_1001567412 | 406 |
| 35 | 3300035695 | Ga0373927_0122259 | Ga0373927_0122259_45_1274 | 406 |
| 36 | 3300035241 | Ga0373961_0014265 | Ga0373961_0014265_621_1898 | 407 |
| 37 | 3300039437 | Ga0436365_1827614 | Ga0436365_1827614_4985_6268 | 408 |
| 38 | 3300005436 | Ga0070713_100006657 | Ga0070713_1000066571 | 410 |
| 39 | 3300006028 | Ga0070717_10000905 | Ga0070717_1000090515 | 410 |
| 40 | 3300025928 | Ga0207700_10001663 | Ga0207700_1000166313 | 410 |
| 41 | 3300005439 | Ga0070711_100018998 | Ga0070711_1000189984 | 414 |
| 42 | 3300006175 | Ga0070712_100128936 | Ga0070712_1001289362 | 414 |
| 43 | 3300013306 | Ga0163162_10149875 | Ga0163162_101498752 | 414 |
| 44 | 3300017792 | Ga0163161_10193280 | Ga0163161_101932802 | 414 |
| 45 | 3300025915 | Ga0207693_10124909 | Ga0207693_101249092 | 414 |
| 46 | 3300035695 | Ga0373927_0032996 | Ga0373927_0032996_1305_2582 | 414 |
| 47 | 3300046674 | Ga0495588_0081212 | Ga0495588_0081212_158_1435 | 414 |
| 48 | 3300047315 | Ga0495581_0053165 | Ga0495581_0053165_425_1702 | 414 |
| 49 | 3300048903 | Ga0496100_0139005 | Ga0496100_0139005_422_1699 | 414 |
| 50 | 3300048905 | Ga0496102_0042845 | Ga0496102_0042845_1959_3236 | 414 |
| 51 | 3300048918 | Ga0496115_0011990 | Ga0496115_0011990_1004_2281 | 414 |
| 52 | 3300045049 | Ga0466959_0041260 | Ga0466959_0041260_20_1276 | 415 |
| 53 | 3300005985 | Ga0081539_10017427 | Ga0081539_100174275 | 416 |
| 54 | 3300037418 | Ga0395900_0121081 | Ga0395900_0121081_301_1578 | 416 |
| 55 | 3300048924 | Ga0496121_0000594 | Ga0496121_0000594_53723_55000 | 416 |
| 56 | 3300028379 | Ga0268266_10103673 | Ga0268266_101036732 | 417 |
| 57 | iso_pu_bacteria | 2507262055 | 2507508207 | 418 |
| 58 | iso_pu_bacteria | 2508501009 | 2508542273 | 418 |
| 59 | iso_pu_bacteria | 2508501042 | 2508691961 | 418 |
| 60 | iso_pu_bacteria | 2508501128 | 2509151473 | 418 |
| 61 | iso_pu_bacteria | 2511231028 | 2511398750 | 418 |
| 62 | iso_pu_bacteria | 2513237092 | 2513622337 | 418 |
| 63 | iso_pu_bacteria | 2513237094 | 2513640514 | 418 |
| 64 | iso_pu_bacteria | 2513237095 | 2513645426 | 418 |
| 65 | iso_pu_bacteria | 2513237096 | 2513657068 | 418 |
| 66 | iso_pu_bacteria | 2513237098 | 2513676602 | 418 |
| 67 | iso_pu_bacteria | 2513237101 | 2513692912 | 418 |
| 68 | iso_pu_bacteria | 2513237102 | 2513701733 | 418 |
| 69 | iso_pu_bacteria | 2513237104 | 2513718375 | 418 |
| 70 | iso_pu_bacteria | 2513237137 | 2513855509 | 418 |
| 71 | iso_pu_bacteria | 2513237139 | 2513873155 | 418 |
| 72 | iso_pu_bacteria | 2513237141 | 2513890002 | 418 |
| 73 | iso_pu_bacteria | 2513237145 | 2513918808 | 418 |
| 74 | iso_pu_bacteria | 2513237161 | 2514016500 | 418 |
| 75 | iso_pu_bacteria | 2515154112 | 2515627286 | 418 |
| 76 | iso_pu_bacteria | 2517093001 | 2517102603 | 418 |
| 77 | iso_pu_bacteria | 2517572143 | 2517892055 | 418 |
| 78 | iso_pu_bacteria | 2524023205 | 2524437752 | 418 |
| 79 | iso_pu_bacteria | 2524023210 | 2524470380 | 418 |
| 80 | iso_pu_bacteria | 2524023228 | 2524534138 | 418 |
| 81 | iso_pu_bacteria | 2528768022 | 2528848724 | 418 |
| 82 | iso_pu_bacteria | 2617270735 | 2617346978 | 418 |
| 83 | iso_pu_bacteria | 2617270741 | 2617375396 | 418 |
| 84 | iso_pu_bacteria | 2667528175 | 2671121908 | 418 |
| 85 | iso_pu_bacteria | 2721755755 | 2723846539 | 418 |
| 86 | iso_pu_bacteria | 2728368998 | 2728753005 | 418 |
| 87 | iso_pu_bacteria | 2744054633 | 2745074840 | 418 |
| 88 | iso_pu_bacteria | 2791355196 | 2793062579 | 418 |
| 89 | iso_pu_bacteria | 2791355197 | 2793068870 | 418 |
| 90 | iso_pu_bacteria | 2791355199 | 2793079947 | 418 |
| 91 | iso_pu_bacteria | 2802429603 | 2805914946 | 418 |
| 92 | iso_pu_bacteria | 2816332527 | 2818239663 | 418 |
| 93 | iso_pu_bacteria | 2824600985 | 2824602341 | 418 |
| 94 | iso_pu_bacteria | 2824609381 | 2824610565 | 418 |
| 95 | iso_pu_bacteria | 2824617872 | 2824618126 | 418 |
| 96 | iso_pu_bacteria | 2824626560 | 2824626794 | 418 |
| 97 | iso_pu_bacteria | 2824635225 | 2824636571 | 418 |
| 98 | iso_pu_bacteria | 2824644064 | 2824645105 | 418 |
| 99 | iso_pu_bacteria | 2824653114 | 2824654310 | 418 |
| 100 | iso_pu_bacteria | 2824661429 | 2824661611 | 418 |
| 101 | iso_pu_bacteria | 2824671348 | 2824672057 | 418 |
| 102 | iso_pu_bacteria | 2824679649 | 2824679885 | 418 |
| 103 | iso_pu_bacteria | 2824687955 | 2824688656 | 418 |
| 104 | iso_pu_bacteria | 2824696289 | 2824697106 | 418 |
| 105 | iso_pu_bacteria | 2824704595 | 2824705070 | 418 |
| 106 | iso_pu_bacteria | 2824714736 | 2824720399 | 418 |
| 107 | iso_pu_bacteria | 2824723954 | 2824729467 | 418 |
| 108 | iso_pu_bacteria | 2824732956 | 2824734586 | 418 |
| 109 | iso_pu_bacteria | 2824746037 | 2824749878 | 418 |
| 110 | iso_pu_bacteria | 2824753945 | 2824754392 | 418 |
| 111 | iso_pu_bacteria | 2824763712 | 2824767891 | 418 |
| 112 | iso_pu_bacteria | 2824773399 | 2824780370 | 418 |
| 113 | iso_pu_bacteria | 2838122688 | 2838123330 | 418 |
| 114 | iso_pu_bacteria | 2841941048 | 2841946623 | 418 |
| 115 | iso_pu_bacteria | 2841949485 | 2841954145 | 418 |
| 116 | iso_pu_bacteria | 2841957949 | 2841960996 | 418 |
| 117 | iso_pu_bacteria | 2841966195 | 2841969521 | 418 |
| 118 | iso_pu_bacteria | 2841974524 | 2841974594 | 418 |
| 119 | iso_pu_bacteria | 2841983080 | 2841983845 | 418 |
| 120 | iso_pu_bacteria | 2842038055 | 2842040200 | 418 |
| 121 | iso_pu_bacteria | 2842045827 | 2842046855 | 418 |
| 122 | iso_pu_bacteria | 2844315083 | 2844319426 | 418 |
| 123 | iso_pu_bacteria | 2847930680 | 2847936597 | 418 |
| 124 | iso_pu_bacteria | 2847939898 | 2847946946 | 418 |
| 125 | iso_pu_bacteria | 2849076700 | 2849078945 | 418 |
| 126 | iso_pu_bacteria | 2857509624 | 2857515927 | 418 |
| 127 | iso_pu_bacteria | 2874590934 | 2874598422 | 418 |
| 128 | iso_pu_bacteria | 2874604998 | 2874605560 | 418 |
| 129 | iso_pu_bacteria | 2874612657 | 2874619356 | 418 |
| 130 | iso_pu_bacteria | 2874620515 | 2874626425 | 418 |
| 131 | iso_pu_bacteria | 2874628541 | 2874632289 | 418 |
| 132 | iso_pu_bacteria | 2874645413 | 2874652523 | 418 |
| 133 | iso_pu_bacteria | 2876761206 | 2876764971 | 418 |
| 134 | iso_pu_bacteria | 2876771140 | 2876778100 | 418 |
| 135 | iso_pu_bacteria | 2876808645 | 2876816514 | 418 |
| 136 | iso_pu_bacteria | 2876818435 | 2876826031 | 418 |
| 137 | iso_pu_bacteria | 2879074833 | 2879081894 | 418 |
| 138 | iso_pu_bacteria | 2879083081 | 2879088059 | 418 |
| 139 | iso_pu_bacteria | 2879099564 | 2879108365 | 418 |
| 140 | iso_pu_bacteria | 2879110137 | 2879115874 | 418 |
| 141 | iso_pu_bacteria | 2879127579 | 2879135016 | 418 |
| 142 | iso_pu_bacteria | 2879142872 | 2879149701 | 418 |
| 143 | iso_pu_bacteria | 2881364244 | 2881368449 | 418 |
| 144 | iso_pu_bacteria | 2881665667 | 2881672518 | 418 |
| 145 | iso_pu_bacteria | 2885366525 | 2885369274 | 418 |
| 146 | iso_pu_bacteria | 2885374607 | 2885375917 | 418 |
| 147 | iso_pu_bacteria | 2885383462 | 2885387861 | 418 |
| 148 | iso_pu_bacteria | 2885409591 | 2885413299 | 418 |
| 149 | iso_pu_bacteria | 2888378607 | 2888384495 | 418 |
| 150 | iso_pu_bacteria | 2888388044 | 2888393413 | 418 |
| 151 | iso_pu_bacteria | 2888419890 | 2888424940 | 418 |
| 152 | iso_pu_bacteria | 2889033259 | 2889039395 | 418 |
| 153 | iso_pu_bacteria | 2903727486 | 2903734368 | 418 |
| 154 | iso_pu_bacteria | 2903748898 | 2903753437 | 418 |
| 155 | iso_pu_bacteria | 2903768456 | 2903771877 | 418 |
| 156 | iso_pu_bacteria | 2904666416 | 2904671764 | 418 |
| 157 | iso_pu_bacteria | 2904690495 | 2904694888 | 418 |
| 158 | iso_pu_bacteria | 2904699407 | 2904702166 | 418 |
| 159 | iso_pu_bacteria | 2904711408 | 2904715115 | 418 |
| 160 | iso_pu_bacteria | 2906602504 | 2906605612 | 418 |
| 161 | iso_pu_bacteria | 2906610324 | 2906617182 | 418 |
| 162 | iso_pu_bacteria | 2906626472 | 2906627147 | 418 |
| 163 | iso_pu_bacteria | 2906635258 | 2906639245 | 418 |
| 164 | iso_pu_bacteria | 2906643746 | 2906646178 | 418 |
| 165 | iso_pu_bacteria | 2906660503 | 2906662444 | 418 |
| 166 | iso_pu_bacteria | 2908739725 | 2908742330 | 418 |
| 167 | iso_pu_bacteria | 2908756301 | 2908759971 | 418 |
| 168 | iso_pu_bacteria | 2908775508 | 2908780546 | 418 |
| 169 | iso_pu_bacteria | 2922361189 | 2922365745 | 418 |
| 170 | iso_pu_bacteria | 2922368715 | 2922374911 | 418 |
| 171 | iso_pu_bacteria | 2922386360 | 2922391316 | 418 |
| 172 | iso_pu_bacteria | 2922393267 | 2922394552 | 418 |
| 173 | iso_pu_bacteria | 2922425934 | 2922430647 | 418 |
| 174 | iso_pu_bacteria | 2929615660 | 2929621953 | 418 |
| 175 | iso_pu_bacteria | 2929624759 | 2929629740 | 418 |
| 176 | iso_pu_bacteria | 2932784394 | 2932788818 | 418 |
| 177 | iso_pu_bacteria | 2932794094 | 2932797979 | 418 |
| 178 | iso_pu_bacteria | 2932801729 | 2932807178 | 418 |
| 179 | iso_pu_bacteria | 2932809354 | 2932812793 | 418 |
| 180 | iso_pu_bacteria | 2932818245 | 2932819115 | 418 |
| 181 | iso_pu_bacteria | 2932828146 | 2932830484 | 418 |
| 182 | iso_pu_bacteria | 2933577622 | 2933583772 | 418 |
| 183 | iso_pu_bacteria | 2935608549 | 2935609310 | 418 |
| 184 | iso_pu_bacteria | 2935616580 | 2935616779 | 418 |
| 185 | iso_pu_bacteria | 2935630451 | 2935631190 | 418 |
| 186 | iso_pu_bacteria | 2935638405 | 2935641891 | 418 |
| 187 | iso_pu_bacteria | 2935648319 | 2935650901 | 418 |
| 188 | iso_pu_bacteria | 2935656913 | 2935659082 | 418 |
| 189 | iso_pu_bacteria | 2935665750 | 2935673022 | 418 |
| 190 | iso_pu_bacteria | 2935675223 | 2935675827 | 418 |
| 191 | iso_pu_bacteria | 2935684952 | 2935685824 | 418 |
| 192 | iso_pu_bacteria | 2935694250 | 2935697930 | 418 |
| 193 | iso_pu_bacteria | 2935703347 | 2935705664 | 418 |
| 194 | iso_pu_bacteria | 2935713505 | 2935714376 | 418 |
| 195 | iso_pu_bacteria | 2935722832 | 2935724995 | 418 |
| 196 | iso_pu_bacteria | 2935732158 | 2935732646 | 418 |
| 197 | iso_pu_bacteria | 2935741537 | 2935742025 | 418 |
| 198 | iso_pu_bacteria | 2935750917 | 2935751789 | 418 |
| 199 | iso_pu_bacteria | 2935760218 | 2935765046 | 418 |
| 200 | iso_pu_bacteria | 2935769743 | 2935771663 | 418 |
| 201 | iso_pu_bacteria | 2935777560 | 2935778922 | 418 |
| 202 | iso_pu_bacteria | 2935785616 | 2935791157 | 418 |
| 203 | iso_pu_bacteria | 2935793552 | 2935795514 | 418 |
| 204 | iso_pu_bacteria | 2935801545 | 2935802642 | 418 |
| 205 | iso_pu_bacteria | 2935810662 | 2935813528 | 418 |
| 206 | iso_pu_bacteria | 2935819856 | 2935822470 | 418 |
| 207 | iso_pu_bacteria | 2935827899 | 2935830058 | 418 |
| 208 | iso_pu_bacteria | 2935837841 | 2935837976 | 418 |
| 209 | iso_pu_bacteria | 2935847175 | 2935848053 | 418 |
| 210 | iso_pu_bacteria | 2935855204 | 2935855403 | 418 |
| 211 | iso_pu_bacteria | 2935864058 | 2935867353 | 418 |
| 212 | iso_pu_bacteria | 2935873716 | 2935875828 | 418 |
| 213 | iso_pu_bacteria | 2935883170 | 2935885826 | 418 |
| 214 | iso_pu_bacteria | 2935908558 | 2935908724 | 418 |
| 215 | iso_pu_bacteria | 2935916978 | 2935917870 | 418 |
| 216 | iso_pu_bacteria | 2935926038 | 2935926702 | 418 |
| 217 | iso_pu_bacteria | 2935934488 | 2935935152 | 418 |
| 218 | iso_pu_bacteria | 2935942939 | 2935943602 | 418 |
| 219 | iso_pu_bacteria | 2935951376 | 2935952040 | 418 |
| 220 | iso_pu_bacteria | 2935959822 | 2935960813 | 418 |
| 221 | iso_pu_bacteria | 2935967501 | 2935968165 | 418 |
| 222 | iso_pu_bacteria | 2935975950 | 2935978780 | 418 |
| 223 | iso_pu_bacteria | 2935984226 | 2935987351 | 418 |
| 224 | iso_pu_bacteria | 2935992306 | 2935996492 | 418 |
| 225 | iso_pu_bacteria | 2936002035 | 2936003772 | 418 |
| 226 | iso_pu_bacteria | 2936011229 | 2936013497 | 418 |
| 227 | iso_pu_bacteria | 2936019824 | 2936022376 | 418 |
| 228 | iso_pu_bacteria | 2936028420 | 2936030822 | 418 |
| 229 | iso_pu_bacteria | 2936037263 | 2936042477 | 418 |
| 230 | iso_pu_bacteria | 2936046547 | 2936048635 | 418 |
| 231 | iso_pu_bacteria | 2936055302 | 2936058849 | 418 |
| 232 | iso_pu_bacteria | 2940556831 | 2940557408 | 418 |
| 233 | iso_pu_bacteria | 2941507105 | 2941509931 | 418 |
| 234 | iso_pu_bacteria | 2941515067 | 2941518982 | 418 |
| 235 | iso_pu_bacteria | 2941523033 | 2941525330 | 418 |
| 236 | iso_pu_bacteria | 2941531003 | 2941533197 | 418 |
| 237 | iso_pu_bacteria | 2941538514 | 2941539358 | 418 |
| 238 | iso_pu_bacteria | 3005474847 | 3005480565 | 418 |
| 239 | iso_pu_bacteria | 3005483717 | 3005484676 | 418 |
| 240 | iso_pu_bacteria | 3005506211 | 3005510687 | 418 |
| 241 | iso_pu_bacteria | 3005587118 | 3005587674 | 418 |
| 242 | iso_pu_bacteria | 3005594810 | 3005599638 | 418 |
| 243 | iso_pu_bacteria | 3005710791 | 3005715288 | 418 |
| 244 | iso_pu_bacteria | 3005718088 | 3005722666 | 418 |
| 245 | iso_pu_bacteria | 8006926726 | 8006933135 | 418 |
| 246 | iso_pu_bacteria | 8006964411 | 8006969659 | 418 |
| 247 | iso_pu_bacteria | 8006984368 | 8006987878 | 418 |
| 248 | iso_pu_bacteria | 8006994254 | 8006995652 | 418 |
| 249 | iso_pu_bacteria | 8016522445 | 8016529217 | 418 |
| 250 | iso_pu_bacteria | 8016539877 | 8016547652 | 418 |
| 251 | iso_pu_bacteria | 8016548790 | 8016554487 | 418 |
| 252 | iso_pu_bacteria | 8016557553 | 8016562860 | 418 |
| 253 | iso_pu_bacteria | 8016566248 | 8016572769 | 418 |
| 254 | iso_pu_bacteria | 8016595262 | 8016600635 | 418 |
| 255 | iso_pu_bacteria | 8016603502 | 8016610102 | 418 |
| 256 | iso_pu_bacteria | 8016613128 | 8016614836 | 418 |
| 257 | iso_pu_bacteria | 8016622563 | 8016626145 | 418 |
| 258 | iso_pu_bacteria | 8016630954 | 8016639927 | 418 |
| 259 | iso_pu_bacteria | 8017057580 | 8017063844 | 418 |
| 260 | iso_pu_bacteria | 8019530166 | 8019534190 | 418 |
| 261 | iso_pu_bacteria | 8019538911 | 8019545272 | 418 |
| 262 | iso_pu_bacteria | 8019555841 | 8019556198 | 418 |
| 263 | iso_pu_bacteria | 8019576017 | 8019583194 | 418 |
| 264 | iso_pu_bacteria | 8019586578 | 8019591001 | 418 |
| 265 | iso_pu_bacteria | 8019597564 | 8019600344 | 418 |
| 266 | iso_pu_bacteria | 8019619141 | 8019628589 | 418 |
| 267 | iso_pu_bacteria | 8019638758 | 8019645683 | 418 |
| 268 | iso_pu_bacteria | 8019648815 | 8019658950 | 418 |
| 269 | iso_pu_bacteria | 8019659431 | 8019661927 | 418 |
| 270 | iso_pu_bacteria | 8019668869 | 8019671449 | 418 |
| 271 | iso_pu_bacteria | 8019678201 | 8019684655 | 418 |
| 272 | iso_pu_bacteria | 8019687851 | 8019690480 | 418 |
| 273 | iso_pu_bacteria | 8055742211 | 8055745882 | 418 |
| 274 | iso_pu_bacteria | 8056673599 | 8056676935 | 418 |
| 275 | iso_pu_bacteria | 8056689827 | 8056692235 | 418 |
| 276 | iso_pu_bacteria | 8056967851 | 8056968417 | 418 |
| 277 | 3300005985 | Ga0081539_10077999 | Ga0081539_100779992 | 419 |
| 278 | 3300049570 | Ga0501033_0107514 | Ga0501033_0107514_172_1440 | 420 |
| 279 | 3300005333 | Ga0070677_10001849 | Ga0070677_100018494 | 421 |
| 280 | 3300005356 | Ga0070674_100001777 | Ga0070674_1000017778 | 421 |
| 281 | 3300005364 | Ga0070673_100101825 | Ga0070673_1001018253 | 421 |
| 282 | 3300005365 | Ga0070688_100019250 | Ga0070688_1000192502 | 421 |
| 283 | 3300005544 | Ga0070686_100010545 | Ga0070686_1000105456 | 421 |
| 284 | 3300005843 | Ga0068860_100000213 | Ga0068860_10000021366 | 421 |
| 285 | 3300005937 | Ga0081455_10012693 | Ga0081455_100126939 | 421 |
| 286 | 3300005983 | Ga0081540_1018868 | Ga0081540_10188684 | 421 |
| 287 | 3300005983 | Ga0081540_1028488 | Ga0081540_10284882 | 421 |
| 288 | 3300007788 | Ga0099795_10000154 | Ga0099795_100001543 | 421 |
| 289 | 3300009551 | Ga0105238_10011980 | Ga0105238_100119807 | 421 |
| 290 | 3300010159 | Ga0099796_10000092 | Ga0099796_1000009214 | 421 |
| 291 | 3300014745 | Ga0157377_10028838 | Ga0157377_100288382 | 421 |
| 292 | 3300025893 | Ga0207682_10000451 | Ga0207682_100004516 | 421 |
| 293 | 3300025899 | Ga0207642_10023088 | Ga0207642_100230882 | 421 |
| 294 | 3300025900 | Ga0207710_10063399 | Ga0207710_100633992 | 421 |
| 295 | 3300025901 | Ga0207688_10060214 | Ga0207688_100602142 | 421 |
| 296 | 3300025938 | Ga0207704_10046904 | Ga0207704_100469042 | 421 |
| 297 | 3300025940 | Ga0207691_10001066 | Ga0207691_1000106612 | 421 |
| 298 | 3300026035 | Ga0207703_10081755 | Ga0207703_100817552 | 421 |
| 299 | 3300026121 | Ga0207683_10000733 | Ga0207683_100007336 | 421 |
| 300 | 3300027512 | Ga0209179_1007546 | Ga0209179_10075462 | 421 |
| 301 | 3300028381 | Ga0268264_10000065 | Ga0268264_10000065165 | 421 |
| 302 | 3300028556 | Ga0265337_1002468 | Ga0265337_10024685 | 421 |
| 303 | 3300028558 | Ga0265326_10003263 | Ga0265326_100032633 | 421 |
| 304 | 3300028563 | Ga0265319_1007768 | Ga0265319_10077686 | 421 |
| 305 | 3300028573 | Ga0265334_10000456 | Ga0265334_100004566 | 421 |
| 306 | 3300028654 | Ga0265322_10005214 | Ga0265322_100052143 | 421 |
| 307 | 3300028666 | Ga0265336_10000431 | Ga0265336_100004313 | 421 |
| 308 | 3300028800 | Ga0265338_10000321 | Ga0265338_1000032147 | 421 |
| 309 | 3300035691 | Ga0373931_0062617 | Ga0373931_0062617_465_1736 | 421 |
| 310 | 3300047472 | Ga0495686_0133937 | Ga0495686_0133937_37_1308 | 421 |
| 311 | 3300049571 | Ga0501034_0015888 | Ga0501034_0015888_4870_6138 | 421 |
| 312 | 3300049583 | Ga0501067_0039560 | Ga0501067_0039560_474_1748 | 421 |
| 313 | 3300001979 | JGI24740J21852_10007980 | JGI24740J21852_100079802 | 422 |
| 314 | 3300001990 | JGI24737J22298_10001022 | JGI24737J22298_100010228 | 422 |
| 315 | 3300003203 | JGI25406J46586_10000027 | JGI25406J46586_1000002730 | 422 |
| 316 | 3300003215 | JGI25153J46596_10001910 | JGI25153J46596_100019109 | 422 |
| 317 | 3300003215 | JGI25153J46596_10007386 | JGI25153J46596_100073862 | 422 |
| 318 | 3300003354 | JGI25160J50197_1003482 | JGI25160J50197_10034824 | 422 |
| 319 | 3300005262 | Ga0065165_1001157 | Ga0065165_100115724 | 422 |
| 320 | 3300005262 | Ga0065165_1001250 | Ga0065165_10012504 | 422 |
| 321 | 3300005262 | Ga0065165_1013791 | Ga0065165_10137912 | 422 |
| 322 | 3300005327 | Ga0070658_10037250 | Ga0070658_100372503 | 422 |
| 323 | 3300005327 | Ga0070658_10037583 | Ga0070658_100375832 | 422 |
| 324 | 3300005327 | Ga0070658_10189564 | Ga0070658_101895641 | 422 |
| 325 | 3300005328 | Ga0070676_10110293 | Ga0070676_101102932 | 422 |
| 326 | 3300005329 | Ga0070683_100007257 | Ga0070683_1000072573 | 422 |
| 327 | 3300005329 | Ga0070683_100041674 | Ga0070683_1000416742 | 422 |
| 328 | 3300005336 | Ga0070680_100037008 | Ga0070680_1000370082 | 422 |
| 329 | 3300005336 | Ga0070680_100046889 | Ga0070680_1000468893 | 422 |
| 330 | 3300005337 | Ga0070682_100119280 | Ga0070682_1001192802 | 422 |
| 331 | 3300005338 | Ga0068868_100033605 | Ga0068868_1000336052 | 422 |
| 332 | 3300005339 | Ga0070660_100116491 | Ga0070660_1001164911 | 422 |
| 333 | 3300005344 | Ga0070661_100165579 | Ga0070661_1001655791 | 422 |
| 334 | 3300005345 | Ga0070692_10117649 | Ga0070692_101176491 | 422 |
| 335 | 3300005347 | Ga0070668_100116225 | Ga0070668_1001162251 | 422 |
| 336 | 3300005355 | Ga0070671_100044589 | Ga0070671_1000445894 | 422 |
| 337 | 3300005356 | Ga0070674_100038774 | Ga0070674_1000387743 | 422 |
| 338 | 3300005364 | Ga0070673_100082352 | Ga0070673_1000823521 | 422 |
| 339 | 3300005366 | Ga0070659_100080254 | Ga0070659_1000802542 | 422 |
| 340 | 3300005367 | Ga0070667_100217489 | Ga0070667_1002174891 | 422 |
| 341 | 3300005434 | Ga0070709_10006118 | Ga0070709_100061184 | 422 |
| 342 | 3300005434 | Ga0070709_10009846 | Ga0070709_100098466 | 422 |
| 343 | 3300005435 | Ga0070714_100006896 | Ga0070714_1000068966 | 422 |
| 344 | 3300005435 | Ga0070714_100054219 | Ga0070714_1000542194 | 422 |
| 345 | 3300005435 | Ga0070714_100120760 | Ga0070714_1001207602 | 422 |
| 346 | 3300005436 | Ga0070713_100018188 | Ga0070713_1000181885 | 422 |
| 347 | 3300005436 | Ga0070713_100029306 | Ga0070713_1000293062 | 422 |
| 348 | 3300005436 | Ga0070713_100081025 | Ga0070713_1000810252 | 422 |
| 349 | 3300005437 | Ga0070710_10001287 | Ga0070710_1000128710 | 422 |
| 350 | 3300005437 | Ga0070710_10008883 | Ga0070710_100088836 | 422 |
| 351 | 3300005439 | Ga0070711_100004377 | Ga0070711_1000043777 | 422 |
| 352 | 3300005439 | Ga0070711_100007383 | Ga0070711_1000073834 | 422 |
| 353 | 3300005445 | Ga0070708_100187817 | Ga0070708_1001878172 | 422 |
| 354 | 3300005455 | Ga0070663_100025670 | Ga0070663_1000256703 | 422 |
| 355 | 3300005455 | Ga0070663_100026936 | Ga0070663_1000269363 | 422 |
| 356 | 3300005456 | Ga0070678_100035084 | Ga0070678_1000350842 | 422 |
| 357 | 3300005456 | Ga0070678_100036024 | Ga0070678_1000360242 | 422 |
| 358 | 3300005458 | Ga0070681_10009117 | Ga0070681_100091174 | 422 |
| 359 | 3300005458 | Ga0070681_10014556 | Ga0070681_100145564 | 422 |
| 360 | 3300005467 | Ga0070706_100186628 | Ga0070706_1001866281 | 422 |
| 361 | 3300005471 | Ga0070698_100122608 | Ga0070698_1001226082 | 422 |
| 362 | 3300005530 | Ga0070679_100013382 | Ga0070679_1000133826 | 422 |
| 363 | 3300005530 | Ga0070679_100020776 | Ga0070679_1000207764 | 422 |
| 364 | 3300005530 | Ga0070679_100064758 | Ga0070679_1000647582 | 422 |
| 365 | 3300005536 | Ga0070697_100181907 | Ga0070697_1001819072 | 422 |
| 366 | 3300005539 | Ga0068853_100000785 | Ga0068853_1000007852 | 422 |
| 367 | 3300005539 | Ga0068853_100002462 | Ga0068853_1000024622 | 422 |
| 368 | 3300005539 | Ga0068853_100149314 | Ga0068853_1001493141 | 422 |
| 369 | 3300005548 | Ga0070665_100021594 | Ga0070665_1000215945 | 422 |
| 370 | 3300005548 | Ga0070665_100094902 | Ga0070665_1000949022 | 422 |
| 371 | 3300005549 | Ga0070704_100147792 | Ga0070704_1001477922 | 422 |
| 372 | 3300005563 | Ga0068855_100062119 | Ga0068855_1000621191 | 422 |
| 373 | 3300005577 | Ga0068857_100049082 | Ga0068857_1000490822 | 422 |
| 374 | 3300005577 | Ga0068857_100088587 | Ga0068857_1000885873 | 422 |
| 375 | 3300005577 | Ga0068857_100140978 | Ga0068857_1001409782 | 422 |
| 376 | 3300005578 | Ga0068854_100002059 | Ga0068854_10000205912 | 422 |
| 377 | 3300005578 | Ga0068854_100175546 | Ga0068854_1001755462 | 422 |
| 378 | 3300005614 | Ga0068856_100001874 | Ga0068856_1000018749 | 422 |
| 379 | 3300005614 | Ga0068856_100015688 | Ga0068856_1000156882 | 422 |
| 380 | 3300005616 | Ga0068852_100142022 | Ga0068852_1001420222 | 422 |
| 381 | 3300005616 | Ga0068852_100156924 | Ga0068852_1001569242 | 422 |
| 382 | 3300005719 | Ga0068861_100040451 | Ga0068861_1000404512 | 422 |
| 383 | 3300005834 | Ga0068851_10000665 | Ga0068851_1000066513 | 422 |
| 384 | 3300005834 | Ga0068851_10001506 | Ga0068851_100015062 | 422 |
| 385 | 3300005841 | Ga0068863_100049875 | Ga0068863_1000498752 | 422 |
| 386 | 3300005843 | Ga0068860_100307018 | Ga0068860_1003070181 | 422 |
| 387 | 3300005844 | Ga0068862_100187925 | Ga0068862_1001879252 | 422 |
| 388 | 3300005937 | Ga0081455_10018614 | Ga0081455_100186145 | 422 |
| 389 | 3300005937 | Ga0081455_10052412 | Ga0081455_100524122 | 422 |
| 390 | 3300005983 | Ga0081540_1001168 | Ga0081540_100116828 | 422 |
| 391 | 3300005983 | Ga0081540_1004236 | Ga0081540_100423610 | 422 |
| 392 | 3300005983 | Ga0081540_1015828 | Ga0081540_10158284 | 422 |
| 393 | 3300005983 | Ga0081540_1016341 | Ga0081540_10163413 | 422 |
| 394 | 3300005983 | Ga0081540_1025956 | Ga0081540_10259562 | 422 |
| 395 | 3300005983 | Ga0081540_1028166 | Ga0081540_10281663 | 422 |
| 396 | 3300005983 | Ga0081540_1067595 | Ga0081540_10675952 | 422 |
| 397 | 3300005985 | Ga0081539_10000051 | Ga0081539_1000005130 | 422 |
| 398 | 3300005985 | Ga0081539_10038018 | Ga0081539_100380182 | 422 |
| 399 | 3300005985 | Ga0081539_10098967 | Ga0081539_100989671 | 422 |
| 400 | 3300006028 | Ga0070717_10003205 | Ga0070717_100032059 | 422 |
| 401 | 3300006038 | Ga0075365_10013621 | Ga0075365_100136214 | 422 |
| 402 | 3300006038 | Ga0075365_10031750 | Ga0075365_100317504 | 422 |
| 403 | 3300006042 | Ga0075368_10007756 | Ga0075368_100077564 | 422 |
| 404 | 3300006042 | Ga0075368_10013110 | Ga0075368_100131102 | 422 |
| 405 | 3300006048 | Ga0075363_100030494 | Ga0075363_1000304942 | 422 |
| 406 | 3300006173 | Ga0070716_100021118 | Ga0070716_1000211184 | 422 |
| 407 | 3300006173 | Ga0070716_100055228 | Ga0070716_1000552282 | 422 |
| 408 | 3300006175 | Ga0070712_100018569 | Ga0070712_1000185694 | 422 |
| 409 | 3300006195 | Ga0075366_10039838 | Ga0075366_100398382 | 422 |
| 410 | 3300006237 | Ga0097621_100074025 | Ga0097621_1000740252 | 422 |
| 411 | 3300006353 | Ga0075370_10014925 | Ga0075370_100149252 | 422 |
| 412 | 3300006844 | Ga0075428_100005630 | Ga0075428_10000563013 | 422 |
| 413 | 3300006847 | Ga0075431_100000196 | Ga0075431_10000019625 | 422 |
| 414 | 3300006880 | Ga0075429_100002073 | Ga0075429_10000207314 | 422 |
| 415 | 3300006942 | Ga0099824_1010553 | Ga0099824_10105539 | 422 |
| 416 | 3300006943 | Ga0099822_1001130 | Ga0099822_10011309 | 422 |
| 417 | 3300007265 | Ga0099794_10001814 | Ga0099794_1000181411 | 422 |
| 418 | 3300007265 | Ga0099794_10052661 | Ga0099794_100526612 | 422 |
| 419 | 3300007788 | Ga0099795_10021402 | Ga0099795_100214022 | 422 |
| 420 | 3300009093 | Ga0105240_10019779 | Ga0105240_100197798 | 422 |
| 421 | 3300009093 | Ga0105240_10020186 | Ga0105240_100201866 | 422 |
| 422 | 3300009093 | Ga0105240_10056805 | Ga0105240_100568055 | 422 |
| 423 | 3300009093 | Ga0105240_10069157 | Ga0105240_100691572 | 422 |
| 424 | 3300009094 | Ga0111539_10008246 | Ga0111539_100082462 | 422 |
| 425 | 3300009098 | Ga0105245_10027991 | Ga0105245_100279915 | 422 |
| 426 | 3300009101 | Ga0105247_10025399 | Ga0105247_100253992 | 422 |
| 427 | 3300009101 | Ga0105247_10117536 | Ga0105247_101175362 | 422 |
| 428 | 3300009147 | Ga0114129_10039302 | Ga0114129_100393024 | 422 |
| 429 | 3300009147 | Ga0114129_10227768 | Ga0114129_102277682 | 422 |
| 430 | 3300009174 | Ga0105241_10001128 | Ga0105241_1000112819 | 422 |
| 431 | 3300009174 | Ga0105241_10017590 | Ga0105241_100175903 | 422 |
| 432 | 3300009174 | Ga0105241_10039945 | Ga0105241_100399451 | 422 |
| 433 | 3300009176 | Ga0105242_10124784 | Ga0105242_101247842 | 422 |
| 434 | 3300009177 | Ga0105248_10058178 | Ga0105248_100581784 | 422 |
| 435 | 3300009177 | Ga0105248_10062849 | Ga0105248_100628494 | 422 |
| 436 | 3300009177 | Ga0105248_10110074 | Ga0105248_101100743 | 422 |
| 437 | 3300009545 | Ga0105237_10013465 | Ga0105237_100134655 | 422 |
| 438 | 3300009545 | Ga0105237_10018185 | Ga0105237_100181856 | 422 |
| 439 | 3300009545 | Ga0105237_10033149 | Ga0105237_100331493 | 422 |
| 440 | 3300009545 | Ga0105237_10038959 | Ga0105237_100389593 | 422 |
| 441 | 3300009545 | Ga0105237_10063877 | Ga0105237_100638773 | 422 |
| 442 | 3300009545 | Ga0105237_10072147 | Ga0105237_100721472 | 422 |
| 443 | 3300009545 | Ga0105237_10082546 | Ga0105237_100825463 | 422 |
| 444 | 3300009545 | Ga0105237_10151315 | Ga0105237_101513152 | 422 |
| 445 | 3300009545 | Ga0105237_10335137 | Ga0105237_103351372 | 422 |
| 446 | 3300009551 | Ga0105238_10018757 | Ga0105238_100187576 | 422 |
| 447 | 3300009551 | Ga0105238_10031278 | Ga0105238_100312785 | 422 |
| 448 | 3300009551 | Ga0105238_10055394 | Ga0105238_100553944 | 422 |
| 449 | 3300009551 | Ga0105238_10097311 | Ga0105238_100973111 | 422 |
| 450 | 3300009553 | Ga0105249_10065948 | Ga0105249_100659484 | 422 |
| 451 | 3300010159 | Ga0099796_10007421 | Ga0099796_100074211 | 422 |
| 452 | 3300010375 | Ga0105239_10013525 | Ga0105239_100135252 | 422 |
| 453 | 3300010375 | Ga0105239_10014647 | Ga0105239_100146476 | 422 |
| 454 | 3300010375 | Ga0105239_10021881 | Ga0105239_100218816 | 422 |
| 455 | 3300010375 | Ga0105239_10110596 | Ga0105239_101105962 | 422 |
| 456 | 3300010375 | Ga0105239_10197400 | Ga0105239_101974001 | 422 |
| 457 | 3300011119 | Ga0105246_10013370 | Ga0105246_100133702 | 422 |
| 458 | 3300013104 | Ga0157370_10051707 | Ga0157370_100517075 | 422 |
| 459 | 3300013105 | Ga0157369_10005049 | Ga0157369_100050499 | 422 |
| 460 | 3300013105 | Ga0157369_10009441 | Ga0157369_100094417 | 422 |
| 461 | 3300013105 | Ga0157369_10016741 | Ga0157369_100167416 | 422 |
| 462 | 3300013105 | Ga0157369_10160768 | Ga0157369_101607682 | 422 |
| 463 | 3300013296 | Ga0157374_10052593 | Ga0157374_100525934 | 422 |
| 464 | 3300013296 | Ga0157374_10130102 | Ga0157374_101301022 | 422 |
| 465 | 3300013296 | Ga0157374_10160532 | Ga0157374_101605321 | 422 |
| 466 | 3300013297 | Ga0157378_10013278 | Ga0157378_100132781 | 422 |
| 467 | 3300013306 | Ga0163162_10062640 | Ga0163162_100626402 | 422 |
| 468 | 3300013306 | Ga0163162_10307840 | Ga0163162_103078401 | 422 |
| 469 | 3300013306 | Ga0163162_10384649 | Ga0163162_103846492 | 422 |
| 470 | 3300013307 | Ga0157372_10404700 | Ga0157372_104047002 | 422 |
| 471 | 3300013308 | Ga0157375_10044677 | Ga0157375_100446771 | 422 |
| 472 | 3300013308 | Ga0157375_10084779 | Ga0157375_100847794 | 422 |
| 473 | 3300013308 | Ga0157375_10158570 | Ga0157375_101585702 | 422 |
| 474 | 3300013308 | Ga0157375_10226846 | Ga0157375_102268462 | 422 |
| 475 | 3300014326 | Ga0157380_10041401 | Ga0157380_100414012 | 422 |
| 476 | 3300014968 | Ga0157379_10182868 | Ga0157379_101828682 | 422 |
| 477 | 3300020082 | Ga0206353_10887329 | Ga0206353_108873292 | 422 |
| 478 | 3300021320 | Ga0214544_1000002 | Ga0214544_100000274 | 422 |
| 479 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001424 | 422 |
| 480 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001490 | 422 |
| 481 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001706 | 422 |
| 482 | 3300021377 | Ga0213874_10002688 | Ga0213874_100026882 | 422 |
| 483 | 3300021384 | Ga0213876_10004192 | Ga0213876_100041926 | 422 |
| 484 | 3300022467 | Ga0224712_10022413 | Ga0224712_100224132 | 422 |
| 485 | 3300025230 | Ga0209563_105305 | Ga0209563_1053051 | 422 |
| 486 | 3300025253 | Ga0209677_102534 | Ga0209677_1025345 | 422 |
| 487 | 3300025254 | Ga0209148_1000374 | Ga0209148_10003745 | 422 |
| 488 | 3300025261 | Ga0209233_1007575 | Ga0209233_10075753 | 422 |
| 489 | 3300025272 | Ga0209455_1001411 | Ga0209455_100141110 | 422 |
| 490 | 3300025272 | Ga0209455_1003883 | Ga0209455_10038834 | 422 |
| 491 | 3300025273 | Ga0209673_1029820 | Ga0209673_10298202 | 422 |
| 492 | 3300025295 | Ga0209564_1011932 | Ga0209564_10119324 | 422 |
| 493 | 3300025297 | Ga0209758_1000024 | Ga0209758_1000024104 | 422 |
| 494 | 3300025297 | Ga0209758_1000068 | Ga0209758_100006859 | 422 |
| 495 | 3300025297 | Ga0209758_1001579 | Ga0209758_100157910 | 422 |
| 496 | 3300025297 | Ga0209758_1002091 | Ga0209758_100209118 | 422 |
| 497 | 3300025297 | Ga0209758_1005630 | Ga0209758_10056302 | 422 |
| 498 | 3300025297 | Ga0209758_1015196 | Ga0209758_10151962 | 422 |
| 499 | 3300025299 | Ga0209256_1008086 | Ga0209256_10080864 | 422 |
| 500 | 3300025302 | Ga0207426_1000238 | Ga0207426_10002383 | 422 |
| 501 | 3300025302 | Ga0207426_1000726 | Ga0207426_100072624 | 422 |
| 502 | 3300025302 | Ga0207426_1021118 | Ga0207426_10211182 | 422 |
| 503 | 3300025304 | Ga0209257_1004927 | Ga0209257_10049276 | 422 |
| 504 | 3300025304 | Ga0209257_1018552 | Ga0209257_10185523 | 422 |
| 505 | 3300025885 | Ga0207653_10010122 | Ga0207653_100101222 | 422 |
| 506 | 3300025898 | Ga0207692_10000175 | Ga0207692_100001758 | 422 |
| 507 | 3300025898 | Ga0207692_10006739 | Ga0207692_100067392 | 422 |
| 508 | 3300025898 | Ga0207692_10037770 | Ga0207692_100377702 | 422 |
| 509 | 3300025900 | Ga0207710_10022920 | Ga0207710_100229202 | 422 |
| 510 | 3300025900 | Ga0207710_10030595 | Ga0207710_100305952 | 422 |
| 511 | 3300025900 | Ga0207710_10036667 | Ga0207710_100366672 | 422 |
| 512 | 3300025903 | Ga0207680_10047992 | Ga0207680_100479922 | 422 |
| 513 | 3300025904 | Ga0207647_10001739 | Ga0207647_1000173912 | 422 |
| 514 | 3300025904 | Ga0207647_10017311 | Ga0207647_100173111 | 422 |
| 515 | 3300025906 | Ga0207699_10001765 | Ga0207699_100017657 | 422 |
| 516 | 3300025906 | Ga0207699_10022952 | Ga0207699_100229522 | 422 |
| 517 | 3300025907 | Ga0207645_10119720 | Ga0207645_101197202 | 422 |
| 518 | 3300025908 | Ga0207643_10037942 | Ga0207643_100379422 | 422 |
| 519 | 3300025911 | Ga0207654_10000232 | Ga0207654_100002326 | 422 |
| 520 | 3300025911 | Ga0207654_10011815 | Ga0207654_100118152 | 422 |
| 521 | 3300025912 | Ga0207707_10000950 | Ga0207707_1000095018 | 422 |
| 522 | 3300025912 | Ga0207707_10004626 | Ga0207707_100046261 | 422 |
| 523 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008180 | 422 |
| 524 | 3300025913 | Ga0207695_10001547 | Ga0207695_1000154717 | 422 |
| 525 | 3300025913 | Ga0207695_10083099 | Ga0207695_100830992 | 422 |
| 526 | 3300025913 | Ga0207695_10101991 | Ga0207695_101019913 | 422 |
| 527 | 3300025913 | Ga0207695_10113971 | Ga0207695_101139712 | 422 |
| 528 | 3300025914 | Ga0207671_10008090 | Ga0207671_100080904 | 422 |
| 529 | 3300025914 | Ga0207671_10019334 | Ga0207671_100193346 | 422 |
| 530 | 3300025914 | Ga0207671_10050109 | Ga0207671_100501092 | 422 |
| 531 | 3300025914 | Ga0207671_10117695 | Ga0207671_101176952 | 422 |
| 532 | 3300025916 | Ga0207663_10017604 | Ga0207663_100176043 | 422 |
| 533 | 3300025917 | Ga0207660_10159286 | Ga0207660_101592862 | 422 |
| 534 | 3300025919 | Ga0207657_10000658 | Ga0207657_1000065815 | 422 |
| 535 | 3300025919 | Ga0207657_10074301 | Ga0207657_100743012 | 422 |
| 536 | 3300025920 | Ga0207649_10071474 | Ga0207649_100714742 | 422 |
| 537 | 3300025921 | Ga0207652_10051870 | Ga0207652_100518704 | 422 |
| 538 | 3300025922 | Ga0207646_10258564 | Ga0207646_102585642 | 422 |
| 539 | 3300025923 | Ga0207681_10070191 | Ga0207681_100701912 | 422 |
| 540 | 3300025924 | Ga0207694_10000050 | Ga0207694_1000005094 | 422 |
| 541 | 3300025924 | Ga0207694_10055781 | Ga0207694_100557813 | 422 |
| 542 | 3300025924 | Ga0207694_10068746 | Ga0207694_100687462 | 422 |
| 543 | 3300025924 | Ga0207694_10136966 | Ga0207694_101369661 | 422 |
| 544 | 3300025925 | Ga0207650_10209014 | Ga0207650_102090141 | 422 |
| 545 | 3300025927 | Ga0207687_10024233 | Ga0207687_100242334 | 422 |
| 546 | 3300025927 | Ga0207687_10113235 | Ga0207687_101132352 | 422 |
| 547 | 3300025927 | Ga0207687_10176312 | Ga0207687_101763122 | 422 |
| 548 | 3300025928 | Ga0207700_10071109 | Ga0207700_100711091 | 422 |
| 549 | 3300025929 | Ga0207664_10007161 | Ga0207664_100071619 | 422 |
| 550 | 3300025929 | Ga0207664_10020650 | Ga0207664_100206502 | 422 |
| 551 | 3300025931 | Ga0207644_10025423 | Ga0207644_100254234 | 422 |
| 552 | 3300025933 | Ga0207706_10028525 | Ga0207706_100285254 | 422 |
| 553 | 3300025934 | Ga0207686_10016885 | Ga0207686_100168853 | 422 |
| 554 | 3300025934 | Ga0207686_10058938 | Ga0207686_100589382 | 422 |
| 555 | 3300025937 | Ga0207669_10000863 | Ga0207669_100008634 | 422 |
| 556 | 3300025939 | Ga0207665_10015055 | Ga0207665_100150552 | 422 |
| 557 | 3300025939 | Ga0207665_10023005 | Ga0207665_100230056 | 422 |
| 558 | 3300025940 | Ga0207691_10115165 | Ga0207691_101151652 | 422 |
| 559 | 3300025940 | Ga0207691_10223324 | Ga0207691_102233242 | 422 |
| 560 | 3300025941 | Ga0207711_10033586 | Ga0207711_100335864 | 422 |
| 561 | 3300025941 | Ga0207711_10053295 | Ga0207711_100532952 | 422 |
| 562 | 3300025942 | Ga0207689_10014103 | Ga0207689_100141034 | 422 |
| 563 | 3300025942 | Ga0207689_10064470 | Ga0207689_100644704 | 422 |
| 564 | 3300025944 | Ga0207661_10008365 | Ga0207661_100083653 | 422 |
| 565 | 3300025945 | Ga0207679_10082238 | Ga0207679_100822382 | 422 |
| 566 | 3300025949 | Ga0207667_10015706 | Ga0207667_1001570611 | 422 |
| 567 | 3300025949 | Ga0207667_10086188 | Ga0207667_100861882 | 422 |
| 568 | 3300025949 | Ga0207667_10112620 | Ga0207667_101126201 | 422 |
| 569 | 3300025960 | Ga0207651_10052593 | Ga0207651_100525932 | 422 |
| 570 | 3300025972 | Ga0207668_10027564 | Ga0207668_100275642 | 422 |
| 571 | 3300025972 | Ga0207668_10056041 | Ga0207668_100560412 | 422 |
| 572 | 3300025972 | Ga0207668_10096998 | Ga0207668_100969982 | 422 |
| 573 | 3300025981 | Ga0207640_10043782 | Ga0207640_100437822 | 422 |
| 574 | 3300025981 | Ga0207640_10062950 | Ga0207640_100629502 | 422 |
| 575 | 3300025986 | Ga0207658_10187558 | Ga0207658_101875582 | 422 |
| 576 | 3300026023 | Ga0207677_10020594 | Ga0207677_100205944 | 422 |
| 577 | 3300026023 | Ga0207677_10021941 | Ga0207677_100219412 | 422 |
| 578 | 3300026041 | Ga0207639_10016102 | Ga0207639_100161023 | 422 |
| 579 | 3300026041 | Ga0207639_10042274 | Ga0207639_100422742 | 422 |
| 580 | 3300026041 | Ga0207639_10161817 | Ga0207639_101618172 | 422 |
| 581 | 3300026041 | Ga0207639_10187317 | Ga0207639_101873171 | 422 |
| 582 | 3300026067 | Ga0207678_10015480 | Ga0207678_100154802 | 422 |
| 583 | 3300026067 | Ga0207678_10021335 | Ga0207678_100213354 | 422 |
| 584 | 3300026067 | Ga0207678_10033024 | Ga0207678_100330242 | 422 |
| 585 | 3300026078 | Ga0207702_10000002 | Ga0207702_10000002204 | 422 |
| 586 | 3300026078 | Ga0207702_10224340 | Ga0207702_102243402 | 422 |
| 587 | 3300026088 | Ga0207641_10102572 | Ga0207641_101025722 | 422 |
| 588 | 3300026095 | Ga0207676_10014678 | Ga0207676_100146786 | 422 |
| 589 | 3300026116 | Ga0207674_10035719 | Ga0207674_100357194 | 422 |
| 590 | 3300026118 | Ga0207675_100047170 | Ga0207675_1000471702 | 422 |
| 591 | 3300026118 | Ga0207675_100054178 | Ga0207675_1000541784 | 422 |
| 592 | 3300026121 | Ga0207683_10026522 | Ga0207683_100265224 | 422 |
| 593 | 3300026121 | Ga0207683_10040572 | Ga0207683_100405723 | 422 |
| 594 | 3300026121 | Ga0207683_10062061 | Ga0207683_100620612 | 422 |
| 595 | 3300026121 | Ga0207683_10155676 | Ga0207683_101556762 | 422 |
| 596 | 3300026142 | Ga0207698_10042438 | Ga0207698_100424385 | 422 |
| 597 | 3300026142 | Ga0207698_10134375 | Ga0207698_101343751 | 422 |
| 598 | 3300027296 | Ga0209389_1000107 | Ga0209389_100010744 | 422 |
| 599 | 3300027296 | Ga0209389_1005934 | Ga0209389_10059342 | 422 |
| 600 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001286 | 422 |
| 601 | 3300027357 | Ga0209589_1000092 | Ga0209589_100009210 | 422 |
| 602 | 3300027361 | Ga0209489_100001 | Ga0209489_100001286 | 422 |
| 603 | 3300027361 | Ga0209489_100006 | Ga0209489_100006467 | 422 |
| 604 | 3300027361 | Ga0209489_107740 | Ga0209489_1077406 | 422 |
| 605 | 3300027363 | Ga0209700_100001 | Ga0209700_100001286 | 422 |
| 606 | 3300027363 | Ga0209700_100005 | Ga0209700_100005335 | 422 |
| 607 | 3300027671 | Ga0209588_1004492 | Ga0209588_10044924 | 422 |
| 608 | 3300027907 | Ga0207428_10002661 | Ga0207428_100026612 | 422 |
| 609 | 3300028379 | Ga0268266_10019676 | Ga0268266_100196762 | 422 |
| 610 | 3300028379 | Ga0268266_10020771 | Ga0268266_100207716 | 422 |
| 611 | 3300028379 | Ga0268266_10032939 | Ga0268266_100329394 | 422 |
| 612 | 3300028379 | Ga0268266_10061421 | Ga0268266_100614212 | 422 |
| 613 | 3300028786 | Ga0307517_10000008 | Ga0307517_10000008180 | 422 |
| 614 | 3300028794 | Ga0307515_10078762 | Ga0307515_100787623 | 422 |
| 615 | 3300031507 | Ga0307509_10010951 | Ga0307509_1001095111 | 422 |
| 616 | 3300031616 | Ga0307508_10000018 | Ga0307508_10000018174 | 422 |
| 617 | 3300031730 | Ga0307516_10004992 | Ga0307516_100049922 | 422 |
| 618 | 3300031730 | Ga0307516_10007832 | Ga0307516_100078329 | 422 |
| 619 | 3300031730 | Ga0307516_10074500 | Ga0307516_100745001 | 422 |
| 620 | 3300033179 | Ga0307507_10054896 | Ga0307507_100548965 | 422 |
| 621 | 3300033180 | Ga0307510_10041204 | Ga0307510_100412043 | 422 |
| 622 | 3300033442 | Ga0315911_1000006 | Ga0315911_1000006361 | 422 |
| 623 | 3300034816 | Ga0373930_0002890 | Ga0373930_0002890_1117_2394 | 422 |
| 624 | 3300035084 | Ga0373928_0008155 | Ga0373928_0008155_450_1727 | 422 |
| 625 | 3300035112 | Ga0373932_0014422 | Ga0373932_0014422_598_1875 | 422 |
| 626 | 3300035112 | Ga0373932_0028239 | Ga0373932_0028239_70_1347 | 422 |
| 627 | 3300035113 | Ga0373936_0007586 | Ga0373936_0007586_1467_2750 | 422 |
| 628 | 3300035116 | Ga0373945_0014942 | Ga0373945_0014942_339_1616 | 422 |
| 629 | 3300035171 | Ga0373946_0016547 | Ga0373946_0016547_1177_2454 | 422 |
| 630 | 3300035410 | Ga0373924_0003483 | Ga0373924_0003483_2503_3780 | 422 |
| 631 | 3300035691 | Ga0373931_0026734 | Ga0373931_0026734_108_1385 | 422 |
| 632 | 3300035692 | Ga0373935_0157113 | Ga0373935_0157113_108_1385 | 422 |
| 633 | 3300035695 | Ga0373927_0011069 | Ga0373927_0011069_1326_2603 | 422 |
| 634 | 3300035695 | Ga0373927_0015919 | Ga0373927_0015919_2862_4139 | 422 |
| 635 | 3300035695 | Ga0373927_0032991 | Ga0373927_0032991_1580_2857 | 422 |
| 636 | 3300035695 | Ga0373927_0078608 | Ga0373927_0078608_36_1313 | 422 |
| 637 | 3300035724 | Ga0373933_0000199 | Ga0373933_0000199_25103_26380 | 422 |
| 638 | 3300035724 | Ga0373933_0017531 | Ga0373933_0017531_16_1293 | 422 |
| 639 | 3300035725 | Ga0373947_0032400 | Ga0373947_0032400_1709_2986 | 422 |
| 640 | 3300037418 | Ga0395900_0000820 | Ga0395900_0000820_2872_4149 | 422 |
| 641 | 3300037466 | Ga0395898_0026506 | Ga0395898_0026506_3314_4591 | 422 |
| 642 | 3300037466 | Ga0395898_0034063 | Ga0395898_0034063_1538_2815 | 422 |
| 643 | 3300037466 | Ga0395898_0065753 | Ga0395898_0065753_670_1947 | 422 |
| 644 | 3300037471 | Ga0395905_0006498 | Ga0395905_0006498_4130_5407 | 422 |
| 645 | 3300038443 | Ga0395901_0081268 | Ga0395901_0081268_214_1491 | 422 |
| 646 | 3300038443 | Ga0395901_0143576 | Ga0395901_0143576_1161_2438 | 422 |
| 647 | 3300038443 | Ga0395901_0181866 | Ga0395901_0181866_889_2166 | 422 |
| 648 | 3300039437 | Ga0436365_1358938 | Ga0436365_1358938_2000_3277 | 422 |
| 649 | 3300039437 | Ga0436365_1840276 | Ga0436365_1840276_1513_2790 | 422 |
| 650 | 3300039438 | Ga0436360_0105255 | Ga0436360_0105255_3661_4938 | 422 |
| 651 | 3300039438 | Ga0436360_0457068 | Ga0436360_0457068_43_1320 | 422 |
| 652 | 3300039450 | Ga0436363_0602269 | Ga0436363_0602269_1701_2978 | 422 |
| 653 | 3300039450 | Ga0436363_1661094 | Ga0436363_1661094_461_1738 | 422 |
| 654 | 3300039453 | Ga0436362_1200408 | Ga0436362_1200408_522_1799 | 422 |
| 655 | 3300041413 | Ga0439465_0025951 | Ga0439465_0025951_393_1670 | 422 |
| 656 | 3300041460 | Ga0451802_0581573 | Ga0451802_0581573_106_1416 | 422 |
| 657 | 3300041491 | Ga0451833_0611236 | Ga0451833_0611236_760_2037 | 422 |
| 658 | 3300042438 | Ga0439459_0011511 | Ga0439459_0011511_51_1328 | 422 |
| 659 | 3300044658 | Ga0466972_0000846 | Ga0466972_0000846_8900_10177 | 422 |
| 660 | 3300044684 | Ga0466966_0000334 | Ga0466966_0000334_12838_14115 | 422 |
| 661 | 3300044693 | Ga0466961_0000509 | Ga0466961_0000509_6366_7643 | 422 |
| 662 | 3300044706 | Ga0466964_0032631 | Ga0466964_0032631_140_1417 | 422 |
| 663 | 3300044719 | Ga0466971_0088137 | Ga0466971_0088137_63_1340 | 422 |
| 664 | 3300044842 | Ga0466957_0039507 | Ga0466957_0039507_56_1333 | 422 |
| 665 | 3300045049 | Ga0466959_0128941 | Ga0466959_0128941_367_1644 | 422 |
| 666 | 3300045049 | Ga0466959_0149357 | Ga0466959_0149357_329_1606 | 422 |
| 667 | 3300045976 | Ga0466967_0009054 | Ga0466967_0009054_5929_7206 | 422 |
| 668 | 3300046454 | Ga0495592_0021156 | Ga0495592_0021156_3257_4534 | 422 |
| 669 | 3300046454 | Ga0495592_0038824 | Ga0495592_0038824_1219_2496 | 422 |
| 670 | 3300046457 | Ga0495590_0020654 | Ga0495590_0020654_105_1382 | 422 |
| 671 | 3300046459 | Ga0495629_0027278 | Ga0495629_0027278_2431_3708 | 422 |
| 672 | 3300046459 | Ga0495629_0093125 | Ga0495629_0093125_55_1332 | 422 |
| 673 | 3300046460 | Ga0495638_0023142 | Ga0495638_0023142_2290_3567 | 422 |
| 674 | 3300046462 | Ga0495651_0001733 | Ga0495651_0001733_7315_8592 | 422 |
| 675 | 3300046462 | Ga0495651_0035514 | Ga0495651_0035514_2043_3320 | 422 |
| 676 | 3300046463 | Ga0495653_0032482 | Ga0495653_0032482_938_2215 | 422 |
| 677 | 3300046472 | Ga0495580_0007795 | Ga0495580_0007795_1044_2321 | 422 |
| 678 | 3300046473 | Ga0495582_0004536 | Ga0495582_0004536_4817_6094 | 422 |
| 679 | 3300046473 | Ga0495582_0079896 | Ga0495582_0079896_294_1571 | 422 |
| 680 | 3300046477 | Ga0495664_0001939 | Ga0495664_0001939_5996_7273 | 422 |
| 681 | 3300046477 | Ga0495664_0086349 | Ga0495664_0086349_267_1544 | 422 |
| 682 | 3300046492 | Ga0495585_0023733 | Ga0495585_0023733_1586_2863 | 422 |
| 683 | 3300046507 | Ga0495606_0003754 | Ga0495606_0003754_7801_9078 | 422 |
| 684 | 3300046507 | Ga0495606_0028614 | Ga0495606_0028614_1716_2993 | 422 |
| 685 | 3300046507 | Ga0495606_0054429 | Ga0495606_0054429_334_1611 | 422 |
| 686 | 3300046511 | Ga0495608_0005911 | Ga0495608_0005911_4368_5645 | 422 |
| 687 | 3300046514 | Ga0495618_0011828 | Ga0495618_0011828_2802_4079 | 422 |
| 688 | 3300046515 | Ga0495620_0039513 | Ga0495620_0039513_512_1789 | 422 |
| 689 | 3300046516 | Ga0495628_0038168 | Ga0495628_0038168_2380_3657 | 422 |
| 690 | 3300046517 | Ga0495630_0025233 | Ga0495630_0025233_2503_3780 | 422 |
| 691 | 3300046519 | Ga0495632_0023647 | Ga0495632_0023647_1616_2893 | 422 |
| 692 | 3300046524 | Ga0495648_0107139 | Ga0495648_0107139_198_1475 | 422 |
| 693 | 3300046526 | Ga0495666_0055889 | Ga0495666_0055889_205_1482 | 422 |
| 694 | 3300046529 | Ga0495652_0062463 | Ga0495652_0062463_847_2124 | 422 |
| 695 | 3300046531 | Ga0495665_0026130 | Ga0495665_0026130_1525_2802 | 422 |
| 696 | 3300046533 | Ga0495640_0085120 | Ga0495640_0085120_148_1425 | 422 |
| 697 | 3300046536 | Ga0495587_0008847 | Ga0495587_0008847_2665_3942 | 422 |
| 698 | 3300046542 | Ga0495597_0066507 | Ga0495597_0066507_70_1347 | 422 |
| 699 | 3300046543 | Ga0495645_0008821 | Ga0495645_0008821_1056_2333 | 422 |
| 700 | 3300046557 | Ga0495622_0034647 | Ga0495622_0034647_566_1843 | 422 |
| 701 | 3300046558 | Ga0495633_0032679 | Ga0495633_0032679_301_1578 | 422 |
| 702 | 3300046559 | Ga0495667_0003089 | Ga0495667_0003089_7621_8898 | 422 |
| 703 | 3300046559 | Ga0495667_0077291 | Ga0495667_0077291_163_1440 | 422 |
| 704 | 3300046642 | Ga0495634_0055198 | Ga0495634_0055198_19_1296 | 422 |
| 705 | 3300046660 | Ga0495625_0086017 | Ga0495625_0086017_91_1368 | 422 |
| 706 | 3300046663 | Ga0495635_0203174 | Ga0495635_0203174_12_1289 | 422 |
| 707 | 3300046674 | Ga0495588_0013307 | Ga0495588_0013307_1455_2732 | 422 |
| 708 | 3300046675 | Ga0495657_0007669 | Ga0495657_0007669_2845_4122 | 422 |
| 709 | 3300046675 | Ga0495657_0033170 | Ga0495657_0033170_1976_3253 | 422 |
| 710 | 3300046678 | Ga0495599_0025195 | Ga0495599_0025195_736_2013 | 422 |
| 711 | 3300046678 | Ga0495599_0077350 | Ga0495599_0077350_24_1301 | 422 |
| 712 | 3300046681 | Ga0495647_0007665 | Ga0495647_0007665_962_2239 | 422 |
| 713 | 3300046683 | Ga0495658_0051124 | Ga0495658_0051124_59_1336 | 422 |
| 714 | 3300046684 | Ga0495669_0015398 | Ga0495669_0015398_1830_3107 | 422 |
| 715 | 3300046684 | Ga0495669_0031811 | Ga0495669_0031811_684_1961 | 422 |
| 716 | 3300046689 | Ga0495613_0051818 | Ga0495613_0051818_1222_2499 | 422 |
| 717 | 3300046689 | Ga0495613_0095977 | Ga0495613_0095977_417_1694 | 422 |
| 718 | 3300046690 | Ga0495624_0024439 | Ga0495624_0024439_893_2170 | 422 |
| 719 | 3300046794 | Ga0495589_0081114 | Ga0495589_0081114_254_1531 | 422 |
| 720 | 3300046794 | Ga0495589_0107393 | Ga0495589_0107393_14_1291 | 422 |
| 721 | 3300046809 | Ga0495600_0008276 | Ga0495600_0008276_4054_5331 | 422 |
| 722 | 3300047315 | Ga0495581_0014251 | Ga0495581_0014251_2423_3700 | 422 |
| 723 | 3300047317 | Ga0495604_0007727 | Ga0495604_0007727_1928_3205 | 422 |
| 724 | 3300047319 | Ga0495674_0006216 | Ga0495674_0006216_3840_5117 | 422 |
| 725 | 3300047319 | Ga0495674_0029090 | Ga0495674_0029090_1353_2630 | 422 |
| 726 | 3300047319 | Ga0495674_0212053 | Ga0495674_0212053_136_1413 | 422 |
| 727 | 3300047444 | Ga0495675_0009070 | Ga0495675_0009070_4145_5422 | 422 |
| 728 | 3300047445 | Ga0495677_0032688 | Ga0495677_0032688_254_1531 | 422 |
| 729 | 3300047447 | Ga0495685_014509 | Ga0495685_014509_833_2110 | 422 |
| 730 | 3300047471 | Ga0495684_0023878 | Ga0495684_0023878_1178_2455 | 422 |
| 731 | 3300047471 | Ga0495684_0032468 | Ga0495684_0032468_1903_3180 | 422 |
| 732 | 3300047673 | Ga0495593_0043880 | Ga0495593_0043880_994_2271 | 422 |
| 733 | 3300047673 | Ga0495593_0058470 | Ga0495593_0058470_669_1946 | 422 |
| 734 | 3300048088 | Ga0495602_0058638 | Ga0495602_0058638_1840_3117 | 422 |
| 735 | 3300048903 | Ga0496100_0017591 | Ga0496100_0017591_1861_3138 | 422 |
| 736 | 3300048903 | Ga0496100_0022944 | Ga0496100_0022944_1451_2728 | 422 |
| 737 | 3300048903 | Ga0496100_0035027 | Ga0496100_0035027_457_1734 | 422 |
| 738 | 3300048904 | Ga0496101_0021665 | Ga0496101_0021665_1205_2482 | 422 |
| 739 | 3300048904 | Ga0496101_0036585 | Ga0496101_0036585_1752_3029 | 422 |
| 740 | 3300048904 | Ga0496101_0091342 | Ga0496101_0091342_372_1649 | 422 |
| 741 | 3300048905 | Ga0496102_0012241 | Ga0496102_0012241_2547_3824 | 422 |
| 742 | 3300048905 | Ga0496102_0040005 | Ga0496102_0040005_328_1605 | 422 |
| 743 | 3300048905 | Ga0496102_0041888 | Ga0496102_0041888_1408_2685 | 422 |
| 744 | 3300048905 | Ga0496102_0093932 | Ga0496102_0093932_1070_2347 | 422 |
| 745 | 3300048905 | Ga0496102_0133598 | Ga0496102_0133598_560_1837 | 422 |
| 746 | 3300048905 | Ga0496102_0230263 | Ga0496102_0230263_280_1557 | 422 |
| 747 | 3300048906 | Ga0496103_0017531 | Ga0496103_0017531_2889_4166 | 422 |
| 748 | 3300048907 | Ga0496104_0033245 | Ga0496104_0033245_2792_4069 | 422 |
| 749 | 3300048908 | Ga0496105_0000527 | Ga0496105_0000527_21857_23134 | 422 |
| 750 | 3300048908 | Ga0496105_0012981 | Ga0496105_0012981_4204_5481 | 422 |
| 751 | 3300048908 | Ga0496105_0019719 | Ga0496105_0019719_433_1710 | 422 |
| 752 | 3300048908 | Ga0496105_0056097 | Ga0496105_0056097_1890_3167 | 422 |
| 753 | 3300048909 | Ga0496106_0002824 | Ga0496106_0002824_4814_6091 | 422 |
| 754 | 3300048909 | Ga0496106_0022677 | Ga0496106_0022677_1599_2876 | 422 |
| 755 | 3300048909 | Ga0496106_0025243 | Ga0496106_0025243_2832_4109 | 422 |
| 756 | 3300048909 | Ga0496106_0035401 | Ga0496106_0035401_1094_2371 | 422 |
| 757 | 3300048909 | Ga0496106_0091486 | Ga0496106_0091486_360_1637 | 422 |
| 758 | 3300048909 | Ga0496106_0159657 | Ga0496106_0159657_291_1568 | 422 |
| 759 | 3300048910 | Ga0496107_0010480 | Ga0496107_0010480_724_2001 | 422 |
| 760 | 3300048910 | Ga0496107_0043491 | Ga0496107_0043491_1788_3065 | 422 |
| 761 | 3300048910 | Ga0496107_0175572 | Ga0496107_0175572_53_1330 | 422 |
| 762 | 3300048911 | Ga0496108_0038348 | Ga0496108_0038348_634_1911 | 422 |
| 763 | 3300048911 | Ga0496108_0049993 | Ga0496108_0049993_1667_2944 | 422 |
| 764 | 3300048912 | Ga0496109_0039798 | Ga0496109_0039798_626_1903 | 422 |
| 765 | 3300048912 | Ga0496109_0126886 | Ga0496109_0126886_316_1593 | 422 |
| 766 | 3300048913 | Ga0496110_0020119 | Ga0496110_0020119_2687_3964 | 422 |
| 767 | 3300048913 | Ga0496110_0030628 | Ga0496110_0030628_3165_4442 | 422 |
| 768 | 3300048913 | Ga0496110_0075282 | Ga0496110_0075282_1554_2831 | 422 |
| 769 | 3300048915 | Ga0496112_0000004 | Ga0496112_0000004_376223_377500 | 422 |
| 770 | 3300048915 | Ga0496112_0025892 | Ga0496112_0025892_1647_2924 | 422 |
| 771 | 3300048915 | Ga0496112_0080722 | Ga0496112_0080722_829_2106 | 422 |
| 772 | 3300048915 | Ga0496112_0088836 | Ga0496112_0088836_37_1314 | 422 |
| 773 | 3300048915 | Ga0496112_0127498 | Ga0496112_0127498_289_1566 | 422 |
| 774 | 3300048915 | Ga0496112_0137207 | Ga0496112_0137207_291_1568 | 422 |
| 775 | 3300048915 | Ga0496112_0160931 | Ga0496112_0160931_346_1623 | 422 |
| 776 | 3300048916 | Ga0496113_0016119 | Ga0496113_0016119_2533_3810 | 422 |
| 777 | 3300048916 | Ga0496113_0020357 | Ga0496113_0020357_2760_4037 | 422 |
| 778 | 3300048916 | Ga0496113_0087530 | Ga0496113_0087530_634_1911 | 422 |
| 779 | 3300048916 | Ga0496113_0107667 | Ga0496113_0107667_137_1414 | 422 |
| 780 | 3300048917 | Ga0496114_0017928 | Ga0496114_0017928_3390_4667 | 422 |
| 781 | 3300048917 | Ga0496114_0029802 | Ga0496114_0029802_2790_4067 | 422 |
| 782 | 3300048917 | Ga0496114_0030675 | Ga0496114_0030675_2328_3605 | 422 |
| 783 | 3300048918 | Ga0496115_0006668 | Ga0496115_0006668_5459_6736 | 422 |
| 784 | 3300048918 | Ga0496115_0022969 | Ga0496115_0022969_2561_3838 | 422 |
| 785 | 3300048918 | Ga0496115_0054034 | Ga0496115_0054034_584_1861 | 422 |
| 786 | 3300048918 | Ga0496115_0073822 | Ga0496115_0073822_721_1998 | 422 |
| 787 | 3300048921 | Ga0496118_0004964 | Ga0496118_0004964_2996_4273 | 422 |
| 788 | 3300048921 | Ga0496118_0034989 | Ga0496118_0034989_151_1428 | 422 |
| 789 | 3300048922 | Ga0496119_0064811 | Ga0496119_0064811_605_1882 | 422 |
| 790 | 3300048924 | Ga0496121_0002820 | Ga0496121_0002820_7874_9151 | 422 |
| 791 | 3300048924 | Ga0496121_0017933 | Ga0496121_0017933_1682_2959 | 422 |
| 792 | 3300048924 | Ga0496121_0019022 | Ga0496121_0019022_2111_3391 | 422 |
| 793 | 3300048924 | Ga0496121_0043405 | Ga0496121_0043405_680_1957 | 422 |
| 794 | 3300048924 | Ga0496121_0064220 | Ga0496121_0064220_345_1622 | 422 |
| 795 | 3300048927 | Ga0496124_0002651 | Ga0496124_0002651_12015_13292 | 422 |
| 796 | 3300048928 | Ga0496125_0090455 | Ga0496125_0090455_965_2242 | 422 |
| 797 | 3300048929 | Ga0496126_0004957 | Ga0496126_0004957_6680_7957 | 422 |
| 798 | 3300048929 | Ga0496126_0014996 | Ga0496126_0014996_4784_6061 | 422 |
| 799 | 3300048929 | Ga0496126_0031625 | Ga0496126_0031625_3188_4465 | 422 |
| 800 | 3300048929 | Ga0496126_0040728 | Ga0496126_0040728_1803_3080 | 422 |
| 801 | 3300048929 | Ga0496126_0051557 | Ga0496126_0051557_1498_2775 | 422 |
| 802 | 3300048929 | Ga0496126_0057631 | Ga0496126_0057631_1500_2777 | 422 |
| 803 | 3300048929 | Ga0496126_0074051 | Ga0496126_0074051_34_1311 | 422 |
| 804 | 3300048929 | Ga0496126_0080022 | Ga0496126_0080022_482_1759 | 422 |
| 805 | 3300048929 | Ga0496126_0092051 | Ga0496126_0092051_793_2070 | 422 |
| 806 | 3300048929 | Ga0496126_0130321 | Ga0496126_0130321_128_1405 | 422 |
| 807 | 3300048929 | Ga0496126_0250356 | Ga0496126_0250356_45_1322 | 422 |
| 808 | 3300049572 | Ga0501036_0163739 | Ga0501036_0163739_552_1829 | 422 |
| 809 | 3300049576 | Ga0501040_0193437 | Ga0501040_0193437_100_1404 | 422 |
| 810 | 3300049577 | Ga0501041_0087879 | Ga0501041_0087879_14_1291 | 422 |
| 811 | 3300049580 | Ga0501046_0156502 | Ga0501046_0156502_379_1656 | 422 |
| 812 | 3300049581 | Ga0501047_0007358 | Ga0501047_0007358_56_1333 | 422 |
| 813 | 3300049583 | Ga0501067_0078902 | Ga0501067_0078902_82_1359 | 422 |
| 814 | 3300049586 | Ga0501070_0003226 | Ga0501070_0003226_12545_13822 | 422 |
| 815 | 3300049742 | Ga0501080_0125288 | Ga0501080_0125288_945_2222 | 422 |
| 816 | 3300050490 | nmdc:mga03n38_428_c1 | nmdc:mga03n38_428_c1_7871_9148 | 422 |
| 817 | 3300050494 | nmdc:mga06z11_38973_c1 | nmdc:mga06z11_38973_c1_15_1292 | 422 |
| 818 | 3300050496 | nmdc:mga07m45_12666_c1 | nmdc:mga07m45_12666_c1_1167_2444 | 422 |
| 819 | 3300050496 | nmdc:mga07m45_30295_c1 | nmdc:mga07m45_30295_c1_1474_2751 | 422 |
| 820 | 3300050507 | nmdc:mga05p37_180885_c1 | nmdc:mga05p37_180885_c1_47_1324 | 422 |
| 821 | 3300050507 | nmdc:mga05p37_7887_c1 | nmdc:mga05p37_7887_c1_1834_3111 | 422 |
| 822 | 3300050508 | nmdc:mga09592_2960_c1 | nmdc:mga09592_2960_c1_2054_3331 | 422 |
| 823 | 3300050510 | nmdc:mga06r32_1710_c1 | nmdc:mga06r32_1710_c1_2077_3354 | 422 |
| 824 | 3300050510 | nmdc:mga06r32_32730_c1 | nmdc:mga06r32_32730_c1_913_2190 | 422 |
| 825 | 3300050511 | nmdc:mga08y16_213_c1 | nmdc:mga08y16_213_c1_48775_50052 | 422 |
| 826 | 3300050512 | nmdc:mga0n895_36971_c1 | nmdc:mga0n895_36971_c1_2256_3533 | 422 |
| 827 | 3300050516 | nmdc:mga0sz30_1328_c1 | nmdc:mga0sz30_1328_c1_822_2099 | 422 |
| 828 | 3300053077 | Ga0495601_0029670 | Ga0495601_0029670_1036_2313 | 422 |
| 829 | 3300053080 | Ga0500635_0008920 | Ga0500635_0008920_943_2226 | 422 |
| 830 | 3300053084 | Ga0495595_0016428 | Ga0495595_0016428_1392_2669 | 422 |
| 831 | 3300053085 | Ga0495619_0033553 | Ga0495619_0033553_1891_3168 | 422 |
| 832 | 3300053087 | Ga0500643_000007 | Ga0500643_000007_21724_23001 | 422 |
| 833 | 3300053091 | Ga0500647_0010746 | Ga0500647_0010746_1051_2328 | 422 |
| 834 | 3300053091 | Ga0500647_0036572 | Ga0500647_0036572_733_2010 | 422 |
| 835 | 3300053094 | Ga0500566_0000204 | Ga0500566_0000204_15345_16628 | 422 |
| 836 | 3300053094 | Ga0500566_0003695 | Ga0500566_0003695_5694_6971 | 422 |
| 837 | 3300053094 | Ga0500566_0035645 | Ga0500566_0035645_436_1713 | 422 |
| 838 | 3300053095 | Ga0500640_062702 | Ga0500640_062702_20_1297 | 422 |
| 839 | 3300053104 | Ga0500556_0005665 | Ga0500556_0005665_1492_2769 | 422 |
| 840 | 3300053105 | Ga0500557_000052 | Ga0500557_000052_4183_5460 | 422 |
| 841 | 3300053108 | Ga0500562_018107 | Ga0500562_018107_361_1638 | 422 |
| 842 | 3300053111 | Ga0500572_000307 | Ga0500572_000307_10872_12149 | 422 |
| 843 | 3300053111 | Ga0500572_000451 | Ga0500572_000451_1663_2946 | 422 |
| 844 | 3300053119 | Ga0500595_002911 | Ga0500595_002911_3878_5155 | 422 |
| 845 | 3300053119 | Ga0500595_009999 | Ga0500595_009999_1953_3230 | 422 |
| 846 | 3300053119 | Ga0500595_020826 | Ga0500595_020826_885_2162 | 422 |
| 847 | 3300053121 | Ga0500607_024838 | Ga0500607_024838_1901_3178 | 422 |
| 848 | 3300053122 | Ga0500608_003260 | Ga0500608_003260_2012_3295 | 422 |
| 849 | 3300053130 | Ga0500642_0029960 | Ga0500642_0029960_477_1754 | 422 |
| 850 | 3300053133 | Ga0500655_007298 | Ga0500655_007298_31_1308 | 422 |
| 851 | 3300053136 | Ga0500559_0000143 | Ga0500559_0000143_39025_40302 | 422 |
| 852 | 3300053136 | Ga0500559_0001636 | Ga0500559_0001636_9403_10686 | 422 |
| 853 | 3300053148 | Ga0500590_010413 | Ga0500590_010413_1656_2933 | 422 |
| 854 | 3300053150 | Ga0500603_000834 | Ga0500603_000834_1911_3194 | 422 |
| 855 | 3300053156 | Ga0500622_0008171 | Ga0500622_0008171_2289_3566 | 422 |
| 856 | 3300053159 | Ga0500630_000027 | Ga0500630_000027_12633_13916 | 422 |
| 857 | 3300053162 | Ga0500638_003956 | Ga0500638_003956_1794_3071 | 422 |
| 858 | 3300053163 | Ga0500639_000020 | Ga0500639_000020_2189_3472 | 422 |
| 859 | 3300053163 | Ga0500639_008513 | Ga0500639_008513_3395_4672 | 422 |
| 860 | 3300053177 | Ga0500636_0000042 | Ga0500636_0000042_38196_39473 | 422 |
| 861 | 3300053178 | Ga0500637_0000132 | Ga0500637_0000132_6643_7920 | 422 |
| 862 | 3300053735 | Ga0500596_006899 | Ga0500596_006899_106_1389 | 422 |
| 863 | 3300053736 | Ga0500599_002750 | Ga0500599_002750_680_1957 | 422 |
| 864 | 3300053737 | Ga0500601_000228 | Ga0500601_000228_3648_4925 | 422 |
| 865 | 3300055283 | Ga0500661_002508 | Ga0500661_002508_949_2226 | 422 |
| 866 | 3300000041 | ARcpr5oldR_c000091 | ARcpr5oldR_00009114 | 423 |
| 867 | 3300001430 | JGI24032J14994_100331 | JGI24032J14994_1003312 | 423 |
| 868 | 3300005434 | Ga0070709_10013900 | Ga0070709_100139005 | 423 |
| 869 | 3300005530 | Ga0070679_100073029 | Ga0070679_1000730292 | 423 |
| 870 | 3300005937 | Ga0081455_10000009 | Ga0081455_100000097 | 423 |
| 871 | 3300006175 | Ga0070712_100095539 | Ga0070712_1000955392 | 423 |
| 872 | 3300006175 | Ga0070712_100244997 | Ga0070712_1002449972 | 423 |
| 873 | 3300006178 | Ga0075367_10065300 | Ga0075367_100653001 | 423 |
| 874 | 3300006844 | Ga0075428_100232820 | Ga0075428_1002328202 | 423 |
| 875 | 3300009094 | Ga0111539_10269847 | Ga0111539_102698472 | 423 |
| 876 | 3300009174 | Ga0105241_10127327 | Ga0105241_101273272 | 423 |
| 877 | 3300010375 | Ga0105239_10238348 | Ga0105239_102383482 | 423 |
| 878 | 3300013100 | Ga0157373_10031343 | Ga0157373_100313434 | 423 |
| 879 | 3300013104 | Ga0157370_10030840 | Ga0157370_100308403 | 423 |
| 880 | 3300013307 | Ga0157372_10174902 | Ga0157372_101749022 | 423 |
| 881 | 3300025912 | Ga0207707_10212389 | Ga0207707_102123892 | 423 |
| 882 | 3300025915 | Ga0207693_10007591 | Ga0207693_100075914 | 423 |
| 883 | 3300025915 | Ga0207693_10110162 | Ga0207693_101101622 | 423 |
| 884 | 3300025916 | Ga0207663_10039585 | Ga0207663_100395852 | 423 |
| 885 | 3300025917 | Ga0207660_10064021 | Ga0207660_100640212 | 423 |
| 886 | 3300025923 | Ga0207681_10210640 | Ga0207681_102106402 | 423 |
| 887 | 3300031241 | Ga0265325_10002771 | Ga0265325_100027716 | 423 |
| 888 | 3300031595 | Ga0265313_10000057 | Ga0265313_1000005726 | 423 |
| 889 | 3300031712 | Ga0265342_10062453 | Ga0265342_100624532 | 423 |
| 890 | 3300032133 | Ga0316583_10008041 | Ga0316583_100080413 | 423 |
| 891 | 3300037312 | Ga0395899_0003643 | Ga0395899_0003643_10493_11764 | 423 |
| 892 | 3300037418 | Ga0395900_0005923 | Ga0395900_0005923_4419_5690 | 423 |
| 893 | 3300037466 | Ga0395898_0183684 | Ga0395898_0183684_140_1411 | 423 |
| 894 | 3300037466 | Ga0395898_0200538 | Ga0395898_0200538_550_1821 | 423 |
| 895 | 3300038443 | Ga0395901_0301519 | Ga0395901_0301519_295_1566 | 423 |
| 896 | 3300039437 | Ga0436365_1434183 | Ga0436365_1434183_3021_4304 | 423 |
| 897 | 3300048903 | Ga0496100_0052915 | Ga0496100_0052915_759_2042 | 423 |
| 898 | 3300048908 | Ga0496105_0039702 | Ga0496105_0039702_2163_3446 | 423 |
| 899 | 3300048913 | Ga0496110_0038517 | Ga0496110_0038517_743_2035 | 423 |
| 900 | 3300048915 | Ga0496112_0160489 | Ga0496112_0160489_526_1797 | 423 |
| 901 | 3300049568 | Ga0501031_0107942 | Ga0501031_0107942_365_1639 | 423 |
| 902 | 3300050513 | nmdc:mga0rr50_69712_c1 | nmdc:mga0rr50_69712_c1_674_1945 | 423 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ls5-assembly1.cif.gz_B | crystal structure of beta-ketoacyl-acp synthase ii (fabf) from bacillus subtilis | 0.9066 | 10 | 422 |
| 4ls6-assembly1.cif.gz_B | crystal structure of beta-ketoacyl-acp synthase ii (fabf) i108f mutant from bacillus subtilis | 0.9048 | 10 | 422 |
| 4ls6-assembly1.cif.gz_B | crystal structure of beta-ketoacyl-acp synthase ii (fabf) i108f mutant from bacillus subtilis | 0.9005 | 10 | 422 |
| 4ls5-assembly1.cif.gz_B | crystal structure of beta-ketoacyl-acp synthase ii (fabf) from bacillus subtilis | 0.9002 | 10 | 422 |
| 6smp-assembly4.cif.gz_K | antde:antf (holo): type ii pks acyl-carrier protein in complex with its ketosynthase bound to the hexaketide | 0.9001 | 1 | 422 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tqyG02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9624 | 269 | 421 | 3.40.47.10 |
| 1j3nB02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9624 | 273 | 414 | 3.40.47.10 |
| af_Q0E328_1_239_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9536 | 190 | 422 | 3.40.47.10 |
| af_I1N0K0_264_378_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9468 | 267 | 382 | 3.40.47.10 |
| af_P9WQD9_267_416_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9405 | 269 | 419 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7GJ16-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase II | 0.9835 | 179 | 423 |
GO:0004315
GO:0005829 GO:0006633 |
| AF-X1SLU4-F1-model_v4 | Ketosynthase family 3 (KS3) domain-containing protein | 0.9801 | 190 | 422 |
GO:0004315
GO:0005829 GO:0006633 |
| AF-A0A7C7GJ16-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase II | 0.9795 | 179 | 423 |
GO:0004315
GO:0005829 GO:0006633 |
| AF-X1SLU4-F1-model_v4 | Ketosynthase family 3 (KS3) domain-containing protein | 0.9759 | 190 | 422 |
GO:0004315
GO:0005829 GO:0006633 |
| AF-A0A440GXF1-F1-model_v4 | deleted | 0.9747 | 290 | 423 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar