F485210
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 902 | 494 | 774 | 433 |
Family's Representative Sequence
| Representative Sequence | 3300025735|Ga0207713_1013296|Ga0207713_10132963 |
| Length | 505 |
| Sequence | MNYSTFFKRSHYINNWLNRFYRKQYNLAVKKDLLVNYLLLHVTGEPTLNTQRKEGSLMAHTSEAANNRRVTSNIFKGSVGNLIEWYDWYVYSAFAVYFSSQFFPEGDPTSQLLNTAAIFAVGFLMRPIGSLLMGRYADRYGRRAALTLSITIMASGSLIIACTPSYSTIGLLSPIILVLARLLQGISLGGEYGTSATYLSEMASSGRRGFYSSFQYVTLVAGQLVALGVQIILQNVLSEADMISWGWRIPFVIGAIGALSVLWLRRTMDESEQFSKMDSESRENAGTIKALMKHPKAVLTVIGLTLGGTVAFYTYTTYLQKFMVNSVGLDKGVVSWINFCALLVFVVIQPIAGMLSDKIGRRPLLMSFGILGTLLTVPLFLFMKQAHNPVMAFLLMTVGLIIVTGYTSINAIVKAELFPTEIRALGVGLPYGLTVAIFGGTAEFIALWLKSIGHESIFFFYVAGCIAISFLVYWRMGESSKDSYIESELKTDDKGDNVPPNNISF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 2 | 2510917027 | Brevibacillus sp. CF112 | Isolate | Rhizosphere |
| 3 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 4 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 5 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 6 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 7 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 8 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 9 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 10 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 11 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 12 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 13 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 14 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 15 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 16 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 17 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 18 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 19 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 20 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 21 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 22 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 23 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 24 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 25 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 26 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 27 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 28 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 29 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 30 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 31 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 32 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 33 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 34 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 35 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 36 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 37 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 38 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 39 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 40 | 2711768088 | Sporolactobacillus terrae DSM 11697 | Isolate | Rhizosphere |
| 41 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 42 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 43 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 44 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 45 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 46 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 47 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 48 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 49 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 50 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 51 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 52 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 53 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 54 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 55 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 56 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 57 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 58 | 2858438669 | Leuconostoc mesenteroides YL48 | Isolate | Unclassified |
| 59 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 60 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 61 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 62 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 63 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 64 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 65 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 66 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 67 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 68 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 69 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 70 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 71 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 72 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 73 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 74 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 75 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 76 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 77 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 78 | 2915606848 | Brevibacillus sp. HD1.4A | Isolate | Rhizosphere |
| 79 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 80 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 81 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 82 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 83 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 84 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 85 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 86 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 87 | 2928519762 | Leuconostoc citreum 1377 | Isolate | Rhizosphere |
| 88 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 89 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 90 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 91 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 92 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 93 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 94 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 95 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 96 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 97 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 98 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 99 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 100 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 101 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 102 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 103 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 104 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 105 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 106 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 107 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 108 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 109 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 110 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 111 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 112 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 113 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 114 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 115 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 116 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 117 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 118 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 119 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 120 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 121 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 122 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 123 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 124 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 125 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 126 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 127 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 128 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 129 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 130 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 131 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 132 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 133 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 134 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 135 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 136 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 137 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 138 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 139 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 140 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 141 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 142 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 143 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 144 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 145 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 146 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 147 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 148 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 149 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 150 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 153 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 156 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 157 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 159 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 167 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 168 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 169 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 173 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 174 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 176 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 177 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 178 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 180 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 183 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 184 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 186 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 187 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 188 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 189 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 190 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 191 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 192 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 193 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 194 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 195 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 196 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 197 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 198 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 199 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 200 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 201 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 202 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 203 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 204 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 205 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 206 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 208 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 221 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 222 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 224 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 225 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 227 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 229 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 230 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 231 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 232 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 233 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 234 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 235 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 236 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 237 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 239 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 240 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 241 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 243 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 244 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 246 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 252 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 253 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 254 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 257 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 258 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 259 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 261 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 263 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 266 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 268 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 325 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 326 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 330 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 331 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 332 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 333 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 334 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 335 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 336 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 337 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 338 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 339 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 340 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 341 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 342 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 343 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 344 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 345 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 346 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 347 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 348 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 349 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 350 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 351 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 352 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 353 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 354 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 355 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 356 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 357 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 358 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 359 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 360 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 361 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 362 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 363 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 364 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 365 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 366 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 367 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 368 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 369 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 370 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 371 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 372 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 373 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 374 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 375 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 376 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 377 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 378 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 379 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 380 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 411 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 412 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 413 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 414 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 416 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 417 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 418 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 419 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 420 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 421 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 422 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 423 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 424 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 425 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 426 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 427 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 428 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 443 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 444 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 445 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 446 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 447 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 449 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 450 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 453 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 454 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 457 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 459 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 460 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 461 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 462 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 463 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 464 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 465 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 466 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 467 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 468 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 469 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 470 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 471 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 472 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 473 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 474 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 475 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 476 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 477 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 479 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 480 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 481 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 482 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 483 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 484 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 485 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 486 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 487 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 488 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 489 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 490 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 491 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 492 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 493 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
| 494 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.37 |
| Metatranscriptomes | 0.44 |
| Isolates | 14.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.97 |
| Nodule | 0.33 |
| Rhizoplane | 2.55 |
| Rhizosphere | 67.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000571 | 3300001904 | Bacteria | 6744 |
| 2 | JGI24741J21665_1000087 | 3300001915 | Bacteria | 23638 |
| 3 | JGI24740J21852_10000056 | 3300001979 | Bacteria | 35577 |
| 4 | JGI24740J21852_10000604 | 3300001979 | Bacteria | 15524 |
| 5 | JGI24740J21852_10001793 | 3300001979 | Bacteria | 9848 |
| 6 | JGI24740J21852_10005576 | 3300001979 | Bacteria | 5303 |
| 7 | JGI24740J21852_10006495 | 3300001979 | Bacteria | 4835 |
| 8 | JGI24740J21852_10009240 | 3300001979 | Bacteria | 3870 |
| 9 | JGI24739J22299_10002030 | 3300001989 | Bacteria | 7747 |
| 10 | JGI24739J22299_10024202 | 3300001989 | Bacteria | 2142 |
| 11 | JGI24737J22298_10007765 | 3300001990 | Bacteria | 3616 |
| 12 | JGI24738J21930_10001279 | 3300002075 | Bacteria | 7053 |
| 13 | JGI24034J26672_10003921 | 3300002239 | Bacteria | 2093 |
| 14 | JGI25156J39149_1002100 | 3300002705 | Bacteria | 7538 |
| 15 | JGI25156J39149_1006039 | 3300002705 | Bacteria | 3374 |
| 16 | JGI25154J39366_1000129 | 3300002738 | Bacteria | 59399 |
| 17 | JGI25152J39213_1000016 | 3300002773 | Bacteria | 110433 |
| 18 | JGI25150J39212_1000003 | 3300002774 | Bacteria | 508651 |
| 19 | JGI25150J39212_1000004 | 3300002774 | Bacteria | 417320 |
| 20 | JGI25159J45721_1002626 | 3300002987 | Bacteria | 6720 |
| 21 | JGI25151J46595_10000002 | 3300003187 | Bacteria | 731381 |
| 22 | JGI25151J46595_10001821 | 3300003187 | Bacteria | 13757 |
| 23 | JGI25151J46595_10014371 | 3300003187 | Bacteria | 3528 |
| 24 | JGI25151J46595_10016138 | 3300003187 | Bacteria | 3272 |
| 25 | JGI25151J46595_10017907 | 3300003187 | Bacteria | 3057 |
| 26 | JGI25151J46595_10027517 | 3300003187 | Bacteria | 2277 |
| 27 | JGI25151J46595_10033087 | 3300003187 | Bacteria | 1996 |
| 28 | JGI25151J46595_10039002 | 3300003187 | Bacteria | 1760 |
| 29 | JGI25153J46596_10000015 | 3300003215 | Bacteria | 289820 |
| 30 | rootH1_10014435 | 3300003316 | Bacteria | 15863 |
| 31 | rootH2_10001801 | 3300003320 | Bacteria | 92828 |
| 32 | rootL2_10034836 | 3300003322 | Bacteria | 25479 |
| 33 | rootL2_10141361 | 3300003322 | Bacteria | 10596 |
| 34 | rootH1_10012599 | 3300003323 | Bacteria | 111210 |
| 35 | JGI25160J50197_1003101 | 3300003354 | Bacteria | 7581 |
| 36 | Ga0006562J51391_1012222 | 3300003578 | Bacteria | 1613 |
| 37 | Ga0006562J51391_1016016 | 3300003578 | Bacteria | 6536 |
| 38 | Ga0006562J51391_1016017 | 3300003578 | Bacteria | 5770 |
| 39 | Ga0055539_1000081 | 3300003752 | Bacteria | 122891 |
| 40 | Ga0055533_1000421 | 3300003756 | Bacteria | 16356 |
| 41 | Ga0055532_1000048 | 3300003758 | Bacteria | 175560 |
| 42 | Ga0055532_1001906 | 3300003758 | Bacteria | 5005 |
| 43 | Ga0055525_1000273 | 3300003759 | Bacteria | 48163 |
| 44 | Ga0055527_1000387 | 3300003760 | Bacteria | 19111 |
| 45 | Ga0055535_1000035 | 3300003761 | Bacteria | 175560 |
| 46 | Ga0055542_1001297 | 3300003762 | Bacteria | 13337 |
| 47 | Ga0055529_1000101 | 3300003763 | Bacteria | 130709 |
| 48 | Ga0055526_1000449 | 3300003771 | Bacteria | 32775 |
| 49 | Ga0055537_1000708 | 3300003773 | Bacteria | 17301 |
| 50 | Ga0055524_1000947 | 3300003775 | Bacteria | 18419 |
| 51 | Ga0055536_1000601 | 3300003781 | Bacteria | 24524 |
| 52 | Ga0055534_1000613 | 3300003784 | Bacteria | 18419 |
| 53 | Ga0055528_1000337 | 3300003790 | Bacteria | 39377 |
| 54 | Ga0055540_1000003 | 3300003792 | Bacteria | 428375 |
| 55 | Ga0055531_10001471 | 3300003794 | Bacteria | 17334 |
| 56 | Ga0055541_1000361 | 3300003841 | Bacteria | 14113 |
| 57 | JGI25405J52794_10004542 | 3300003911 | Bacteria | 2478 |
| 58 | Ga0065165_1002643 | 3300005262 | Bacteria | 14514 |
| 59 | Ga0065165_1010558 | 3300005262 | Bacteria | 3970 |
| 60 | Ga0065704_10073281 | 3300005289 | Bacteria | 7350 |
| 61 | Ga0065704_10074342 | 3300005289 | Bacteria | 6344 |
| 62 | Ga0065715_10137322 | 3300005293 | Bacteria | 1909 |
| 63 | Ga0070658_10022682 | 3300005327 | Bacteria | 5038 |
| 64 | Ga0070658_10126130 | 3300005327 | Bacteria | 2131 |
| 65 | Ga0070658_10200008 | 3300005327 | Bacteria | 1685 |
| 66 | Ga0070658_10284790 | 3300005327 | Bacteria | 1407 |
| 67 | Ga0070676_10001841 | 3300005328 | Bacteria | 10804 |
| 68 | Ga0070683_100010869 | 3300005329 | Bacteria | 7838 |
| 69 | Ga0070670_100000027 | 3300005331 | Bacteria | 186072 |
| 70 | Ga0070670_100052714 | 3300005331 | Bacteria | 3493 |
| 71 | Ga0070670_100055135 | 3300005331 | Bacteria | 3412 |
| 72 | Ga0070670_100119540 | 3300005331 | Bacteria | 2273 |
| 73 | Ga0070666_10008338 | 3300005335 | Bacteria | 6428 |
| 74 | Ga0070682_100137867 | 3300005337 | Bacteria | 1659 |
| 75 | Ga0068868_100000063 | 3300005338 | Bacteria | 61783 |
| 76 | Ga0068868_100043366 | 3300005338 | Bacteria | 3514 |
| 77 | Ga0068868_100088472 | 3300005338 | Bacteria | 2493 |
| 78 | Ga0070660_100128661 | 3300005339 | Bacteria | 2025 |
| 79 | Ga0070660_100152744 | 3300005339 | Bacteria | 1857 |
| 80 | Ga0070691_10054800 | 3300005341 | Bacteria | 1909 |
| 81 | Ga0070661_100006605 | 3300005344 | Bacteria | 8000 |
| 82 | Ga0070661_100169282 | 3300005344 | Bacteria | 1658 |
| 83 | Ga0070668_100000021 | 3300005347 | Bacteria | 96397 |
| 84 | Ga0070668_100000190 | 3300005347 | Bacteria | 40176 |
| 85 | Ga0070668_100001427 | 3300005347 | Bacteria | 17249 |
| 86 | Ga0070668_100002649 | 3300005347 | Bacteria | 13148 |
| 87 | Ga0070668_100128748 | 3300005347 | Bacteria | 2030 |
| 88 | Ga0070668_100174026 | 3300005347 | Bacteria | 1754 |
| 89 | Ga0070669_100044684 | 3300005353 | Bacteria | 3227 |
| 90 | Ga0070669_100103876 | 3300005353 | Bacteria | 2148 |
| 91 | Ga0070671_100001059 | 3300005355 | Bacteria | 20287 |
| 92 | Ga0070671_100001896 | 3300005355 | Bacteria | 15990 |
| 93 | Ga0070671_100050167 | 3300005355 | Bacteria | 3471 |
| 94 | Ga0070673_100042809 | 3300005364 | Bacteria | 3494 |
| 95 | Ga0070673_100048531 | 3300005364 | Bacteria | 3310 |
| 96 | Ga0070673_100063713 | 3300005364 | Bacteria | 2934 |
| 97 | Ga0070659_100009872 | 3300005366 | Bacteria | 7020 |
| 98 | Ga0070667_100000135 | 3300005367 | Bacteria | 93968 |
| 99 | Ga0070667_100000638 | 3300005367 | Bacteria | 34017 |
| 100 | Ga0070667_100008061 | 3300005367 | Bacteria | 8739 |
| 101 | Ga0070667_100009598 | 3300005367 | Bacteria | 8025 |
| 102 | Ga0070713_100067249 | 3300005436 | Bacteria | 3016 |
| 103 | Ga0070710_10000514 | 3300005437 | Bacteria | 18217 |
| 104 | Ga0070694_100006716 | 3300005444 | Bacteria | 6990 |
| 105 | Ga0070708_100149719 | 3300005445 | Bacteria | 2170 |
| 106 | Ga0070663_100000024 | 3300005455 | Bacteria | 108544 |
| 107 | Ga0070663_100055920 | 3300005455 | Bacteria | 2826 |
| 108 | Ga0070678_100018605 | 3300005456 | Bacteria | 4506 |
| 109 | Ga0070678_100027141 | 3300005456 | Bacteria | 3883 |
| 110 | Ga0070678_100237540 | 3300005456 | Bacteria | 1522 |
| 111 | Ga0070681_10002788 | 3300005458 | Bacteria | 16141 |
| 112 | Ga0070698_100007890 | 3300005471 | Bacteria | 11521 |
| 113 | Ga0070699_100019463 | 3300005518 | Bacteria | 5845 |
| 114 | Ga0070679_100085544 | 3300005530 | Bacteria | 3140 |
| 115 | Ga0070679_100101575 | 3300005530 | Bacteria | 2863 |
| 116 | Ga0070684_100022411 | 3300005535 | Bacteria | 5268 |
| 117 | Ga0068853_100153787 | 3300005539 | Bacteria | 2072 |
| 118 | Ga0070672_100014855 | 3300005543 | Bacteria | 5528 |
| 119 | Ga0070672_100184809 | 3300005543 | Bacteria | 1738 |
| 120 | Ga0070672_100190098 | 3300005543 | Bacteria | 1714 |
| 121 | Ga0070686_100000553 | 3300005544 | Bacteria | 22346 |
| 122 | Ga0070696_100018171 | 3300005546 | Bacteria | 4750 |
| 123 | Ga0070665_100000605 | 3300005548 | Bacteria | 49400 |
| 124 | Ga0070665_100001611 | 3300005548 | Bacteria | 25963 |
| 125 | Ga0070665_100002698 | 3300005548 | Bacteria | 19270 |
| 126 | Ga0070665_100015939 | 3300005548 | Bacteria | 7543 |
| 127 | Ga0070665_100088738 | 3300005548 | Bacteria | 3098 |
| 128 | Ga0070665_100119808 | 3300005548 | Bacteria | 2634 |
| 129 | Ga0070665_100187375 | 3300005548 | Bacteria | 2070 |
| 130 | Ga0070704_100003498 | 3300005549 | Bacteria | 9016 |
| 131 | Ga0070704_100176648 | 3300005549 | Bacteria | 1704 |
| 132 | Ga0068855_100020165 | 3300005563 | Bacteria | 8006 |
| 133 | Ga0068855_100349061 | 3300005563 | Unclassified | 1630 |
| 134 | Ga0070664_100000022 | 3300005564 | Bacteria | 108544 |
| 135 | Ga0070664_100000247 | 3300005564 | Bacteria | 38997 |
| 136 | Ga0070664_100012258 | 3300005564 | Bacteria | 6967 |
| 137 | Ga0070664_100025219 | 3300005564 | Bacteria | 4926 |
| 138 | Ga0068857_100000513 | 3300005577 | Bacteria | 27847 |
| 139 | Ga0068857_100049989 | 3300005577 | Bacteria | 3709 |
| 140 | Ga0068854_100000336 | 3300005578 | Bacteria | 30476 |
| 141 | Ga0068854_100000612 | 3300005578 | Bacteria | 21143 |
| 142 | Ga0068854_100011735 | 3300005578 | Bacteria | 5717 |
| 143 | Ga0068854_100035972 | 3300005578 | Bacteria | 3469 |
| 144 | Ga0068856_100000049 | 3300005614 | Bacteria | 108544 |
| 145 | Ga0068856_100000194 | 3300005614 | Bacteria | 64170 |
| 146 | Ga0068856_100021956 | 3300005614 | Bacteria | 6205 |
| 147 | Ga0068852_100033802 | 3300005616 | Bacteria | 4250 |
| 148 | Ga0068852_100040812 | 3300005616 | Bacteria | 3918 |
| 149 | Ga0068852_100052820 | 3300005616 | Bacteria | 3495 |
| 150 | Ga0068859_100045965 | 3300005617 | Bacteria | 4386 |
| 151 | Ga0068859_100048570 | 3300005617 | Bacteria | 4263 |
| 152 | Ga0068859_100177419 | 3300005617 | Bacteria | 2212 |
| 153 | Ga0068859_100188297 | 3300005617 | Bacteria | 2148 |
| 154 | Ga0068859_100205476 | 3300005617 | Bacteria | 2055 |
| 155 | Ga0068864_100000083 | 3300005618 | Bacteria | 100972 |
| 156 | Ga0068864_100004493 | 3300005618 | Bacteria | 11474 |
| 157 | Ga0068864_100044774 | 3300005618 | Bacteria | 3795 |
| 158 | Ga0068861_100147690 | 3300005719 | Bacteria | 1926 |
| 159 | Ga0068863_100000025 | 3300005841 | Bacteria | 186072 |
| 160 | Ga0068863_100000043 | 3300005841 | Bacteria | 153935 |
| 161 | Ga0068863_100000198 | 3300005841 | Bacteria | 63987 |
| 162 | Ga0068863_100014397 | 3300005841 | Bacteria | 7617 |
| 163 | Ga0068858_100007771 | 3300005842 | Bacteria | 10351 |
| 164 | Ga0068858_100038243 | 3300005842 | Bacteria | 4451 |
| 165 | Ga0068858_100064195 | 3300005842 | Bacteria | 3398 |
| 166 | Ga0068858_100089625 | 3300005842 | Bacteria | 2862 |
| 167 | Ga0068860_100001354 | 3300005843 | Bacteria | 26623 |
| 168 | Ga0068860_100003820 | 3300005843 | Bacteria | 15493 |
| 169 | Ga0068862_100000027 | 3300005844 | Bacteria | 186072 |
| 170 | Ga0068862_100000125 | 3300005844 | Bacteria | 89536 |
| 171 | Ga0068862_100002747 | 3300005844 | Bacteria | 15447 |
| 172 | Ga0068862_100005128 | 3300005844 | Bacteria | 11013 |
| 173 | Ga0068862_100012533 | 3300005844 | Bacteria | 7018 |
| 174 | Ga0068862_100053143 | 3300005844 | Bacteria | 3467 |
| 175 | Ga0068862_100108709 | 3300005844 | Bacteria | 2432 |
| 176 | Ga0081455_10000021 | 3300005937 | Bacteria | 160055 |
| 177 | Ga0081455_10000066 | 3300005937 | Bacteria | 115221 |
| 178 | Ga0081455_10063949 | 3300005937 | Bacteria | 3084 |
| 179 | Ga0081539_10002432 | 3300005985 | Bacteria | 26284 |
| 180 | Ga0075363_100000051 | 3300006048 | Bacteria | 22810 |
| 181 | Ga0075363_100060203 | 3300006048 | Bacteria | 2043 |
| 182 | Ga0070712_100043499 | 3300006175 | Bacteria | 3092 |
| 183 | Ga0075369_10001593 | 3300006186 | Bacteria | 7799 |
| 184 | Ga0075366_10008428 | 3300006195 | Bacteria | 5732 |
| 185 | Ga0068871_100039365 | 3300006358 | Bacteria | 3782 |
| 186 | Ga0068871_100059716 | 3300006358 | Bacteria | 3108 |
| 187 | Ga0075428_100095951 | 3300006844 | Bacteria | 3232 |
| 188 | Ga0075428_100122559 | 3300006844 | Bacteria | 2830 |
| 189 | Ga0075428_100128370 | 3300006844 | Bacteria | 2758 |
| 190 | Ga0075433_10013939 | 3300006852 | Bacteria | 6553 |
| 191 | Ga0075434_100019256 | 3300006871 | Bacteria | 6603 |
| 192 | Ga0097620_100045965 | 3300006931 | Bacteria | 4386 |
| 193 | Ga0097620_100048565 | 3300006931 | Bacteria | 4263 |
| 194 | Ga0097620_100177419 | 3300006931 | Bacteria | 2212 |
| 195 | Ga0097620_100188301 | 3300006931 | Bacteria | 2148 |
| 196 | Ga0097620_100205475 | 3300006931 | Bacteria | 2055 |
| 197 | Ga0075435_100003419 | 3300007076 | Bacteria | 10764 |
| 198 | Ga0105251_10000138 | 3300009011 | Bacteria | 74430 |
| 199 | Ga0105244_10011682 | 3300009036 | Bacteria | 5242 |
| 200 | Ga0105250_10000793 | 3300009092 | Bacteria | 19040 |
| 201 | Ga0105240_10011125 | 3300009093 | Bacteria | 12574 |
| 202 | Ga0105240_10012181 | 3300009093 | Bacteria | 11904 |
| 203 | Ga0105240_10018898 | 3300009093 | Bacteria | 9228 |
| 204 | Ga0105240_10079491 | 3300009093 | Bacteria | 4035 |
| 205 | Ga0105240_10119764 | 3300009093 | Bacteria | 3170 |
| 206 | Ga0105240_10164625 | 3300009093 | Bacteria | 2631 |
| 207 | Ga0105240_10181760 | 3300009093 | Bacteria | 2481 |
| 208 | Ga0111539_10030317 | 3300009094 | Bacteria | 6576 |
| 209 | Ga0111539_10131569 | 3300009094 | Bacteria | 2930 |
| 210 | Ga0105245_10225045 | 3300009098 | Bacteria | 1812 |
| 211 | Ga0105245_10468875 | 3300009098 | Bacteria | 1271 |
| 212 | Ga0105247_10002888 | 3300009101 | Bacteria | 11441 |
| 213 | Ga0105247_10100907 | 3300009101 | Bacteria | 1845 |
| 214 | Ga0114129_10091845 | 3300009147 | Bacteria | 4205 |
| 215 | Ga0114129_10171564 | 3300009147 | Bacteria | 2957 |
| 216 | Ga0105243_10014444 | 3300009148 | Bacteria | 5979 |
| 217 | Ga0105241_10005021 | 3300009174 | Bacteria | 9771 |
| 218 | Ga0105241_10255484 | 3300009174 | Bacteria | 1487 |
| 219 | Ga0105242_10020912 | 3300009176 | Bacteria | 5132 |
| 220 | Ga0105248_10000026 | 3300009177 | Bacteria | 257155 |
| 221 | Ga0105248_10001586 | 3300009177 | Bacteria | 25332 |
| 222 | Ga0105248_10025719 | 3300009177 | Bacteria | 6547 |
| 223 | Ga0105248_10064630 | 3300009177 | Bacteria | 4108 |
| 224 | Ga0105248_10119095 | 3300009177 | Bacteria | 2978 |
| 225 | Ga0105248_10363368 | 3300009177 | Bacteria | 1630 |
| 226 | Ga0105237_10000026 | 3300009545 | Bacteria | 212619 |
| 227 | Ga0105238_10018672 | 3300009551 | Bacteria | 7062 |
| 228 | Ga0105238_10022601 | 3300009551 | Bacteria | 6410 |
| 229 | Ga0105249_10000015 | 3300009553 | Bacteria | 282138 |
| 230 | Ga0105249_10000123 | 3300009553 | Bacteria | 104747 |
| 231 | Ga0105249_10008042 | 3300009553 | Bacteria | 9192 |
| 232 | Ga0105249_10010730 | 3300009553 | Bacteria | 8048 |
| 233 | Ga0105249_10023672 | 3300009553 | Bacteria | 5513 |
| 234 | Ga0105249_10024158 | 3300009553 | Bacteria | 5461 |
| 235 | Ga0105249_10267942 | 3300009553 | Bacteria | 1700 |
| 236 | Ga0099796_10002492 | 3300010159 | Bacteria | 4051 |
| 237 | Ga0105239_10008875 | 3300010375 | Bacteria | 11378 |
| 238 | Ga0105239_10025788 | 3300010375 | Bacteria | 6474 |
| 239 | Ga0105239_10040042 | 3300010375 | Bacteria | 5133 |
| 240 | Ga0105246_10005371 | 3300011119 | Bacteria | 7800 |
| 241 | Ga0157314_1000397 | 3300012500 | Bacteria | 4389 |
| 242 | Ga0157373_10004557 | 3300013100 | Bacteria | 10420 |
| 243 | Ga0157373_10016049 | 3300013100 | Bacteria | 5466 |
| 244 | Ga0157371_10000089 | 3300013102 | Bacteria | 145483 |
| 245 | Ga0157371_10005522 | 3300013102 | Bacteria | 10642 |
| 246 | Ga0157370_10000002 | 3300013104 | Bacteria | 431400 |
| 247 | Ga0157370_10011309 | 3300013104 | Bacteria | 9351 |
| 248 | Ga0157370_10048771 | 3300013104 | Bacteria | 4057 |
| 249 | Ga0157370_10056458 | 3300013104 | Bacteria | 3737 |
| 250 | Ga0157369_10006987 | 3300013105 | Bacteria | 13022 |
| 251 | Ga0157369_10104723 | 3300013105 | Bacteria | 3012 |
| 252 | Ga0157369_10224587 | 3300013105 | Bacteria | 1965 |
| 253 | Ga0157374_10043528 | 3300013296 | Bacteria | 4149 |
| 254 | Ga0157374_10160140 | 3300013296 | Bacteria | 2192 |
| 255 | Ga0163162_10003740 | 3300013306 | Bacteria | 14573 |
| 256 | Ga0163162_10042644 | 3300013306 | Bacteria | 4542 |
| 257 | Ga0163162_10203926 | 3300013306 | Bacteria | 2107 |
| 258 | Ga0163162_10239912 | 3300013306 | Bacteria | 1943 |
| 259 | Ga0157372_10000149 | 3300013307 | Bacteria | 76796 |
| 260 | Ga0157372_10245387 | 3300013307 | Bacteria | 2078 |
| 261 | Ga0157372_10438725 | 3300013307 | Bacteria | 1522 |
| 262 | Ga0157375_10010613 | 3300013308 | Bacteria | 8111 |
| 263 | Ga0157375_10142766 | 3300013308 | Bacteria | 2523 |
| 264 | Ga0157380_10031110 | 3300014326 | Bacteria | 4095 |
| 265 | Ga0157380_10046066 | 3300014326 | Bacteria | 3424 |
| 266 | Ga0157380_10120027 | 3300014326 | Bacteria | 2225 |
| 267 | Ga0182008_10057668 | 3300014497 | Bacteria | 1918 |
| 268 | Ga0157379_10021758 | 3300014968 | Bacteria | 5680 |
| 269 | Ga0157379_10121279 | 3300014968 | Bacteria | 2352 |
| 270 | Ga0182006_1001276 | 3300015261 | Bacteria | 15513 |
| 271 | Ga0182007_10007444 | 3300015262 | Bacteria | 4590 |
| 272 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 273 | Ga0163161_10017243 | 3300017792 | Bacteria | 5051 |
| 274 | Ga0213872_10006956 | 3300021361 | Bacteria | 5619 |
| 275 | Ga0213875_10000415 | 3300021388 | Bacteria | 37517 |
| 276 | Ga0209784_100024 | 3300025224 | Bacteria | 394613 |
| 277 | Ga0209566_100018 | 3300025225 | Bacteria | 448638 |
| 278 | Ga0209566_100251 | 3300025225 | Bacteria | 51274 |
| 279 | Ga0209674_100046 | 3300025226 | Bacteria | 357920 |
| 280 | Ga0209674_100135 | 3300025226 | Bacteria | 113826 |
| 281 | Ga0209672_100240 | 3300025228 | Bacteria | 41226 |
| 282 | Ga0209147_100008 | 3300025229 | Bacteria | 777096 |
| 283 | Ga0209147_100115 | 3300025229 | Bacteria | 143934 |
| 284 | Ga0209563_100039 | 3300025230 | Bacteria | 409717 |
| 285 | Ga0209563_101432 | 3300025230 | Bacteria | 6329 |
| 286 | Ga0209258_100013 | 3300025242 | Bacteria | 777096 |
| 287 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 288 | Ga0207425_1002895 | 3300025245 | Bacteria | 5756 |
| 289 | Ga0209646_1000027 | 3300025246 | Bacteria | 395141 |
| 290 | Ga0209026_1000416 | 3300025250 | Bacteria | 36810 |
| 291 | Ga0209026_1005274 | 3300025250 | Bacteria | 3519 |
| 292 | Ga0209026_1013129 | 3300025250 | Unclassified | 1419 |
| 293 | Ga0209677_100024 | 3300025253 | Bacteria | 406035 |
| 294 | Ga0209148_1000019 | 3300025254 | Bacteria | 748518 |
| 295 | Ga0209759_1007543 | 3300025256 | Bacteria | 3486 |
| 296 | Ga0209759_1009583 | 3300025256 | Bacteria | 2916 |
| 297 | Ga0209129_1000014 | 3300025258 | Bacteria | 509018 |
| 298 | Ga0209129_1001768 | 3300025258 | Bacteria | 11551 |
| 299 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 300 | Ga0209455_1000042 | 3300025272 | Bacteria | 419638 |
| 301 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 302 | Ga0209130_1001011 | 3300025284 | Bacteria | 21808 |
| 303 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 304 | Ga0209676_1000046 | 3300025292 | Bacteria | 409173 |
| 305 | Ga0209676_1008056 | 3300025292 | Bacteria | 4789 |
| 306 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 307 | Ga0209025_1000036 | 3300025294 | Bacteria | 404113 |
| 308 | Ga0209025_1000724 | 3300025294 | Bacteria | 56016 |
| 309 | Ga0209025_1001437 | 3300025294 | Bacteria | 31330 |
| 310 | Ga0209025_1002332 | 3300025294 | Bacteria | 20505 |
| 311 | Ga0209025_1005432 | 3300025294 | Bacteria | 10399 |
| 312 | Ga0209025_1008485 | 3300025294 | Bacteria | 7388 |
| 313 | Ga0209025_1009574 | 3300025294 | Bacteria | 6723 |
| 314 | Ga0209025_1010749 | 3300025294 | Bacteria | 6155 |
| 315 | Ga0209025_1011402 | 3300025294 | Bacteria | 5863 |
| 316 | Ga0209025_1016889 | 3300025294 | Bacteria | 4259 |
| 317 | Ga0209025_1017894 | 3300025294 | Bacteria | 4059 |
| 318 | Ga0209025_1024984 | 3300025294 | Bacteria | 3060 |
| 319 | Ga0209025_1027121 | 3300025294 | Bacteria | 2851 |
| 320 | Ga0209025_1036044 | 3300025294 | Bacteria | 2223 |
| 321 | Ga0209025_1046600 | 3300025294 | Bacteria | 1781 |
| 322 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 323 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 324 | Ga0209758_1000269 | 3300025297 | Bacteria | 103013 |
| 325 | Ga0209758_1000309 | 3300025297 | Bacteria | 94619 |
| 326 | Ga0209758_1026024 | 3300025297 | Bacteria | 2547 |
| 327 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 328 | Ga0207426_1000313 | 3300025302 | Bacteria | 94934 |
| 329 | Ga0207426_1004156 | 3300025302 | Bacteria | 7241 |
| 330 | Ga0209051_1000011 | 3300025303 | Bacteria | 610828 |
| 331 | Ga0209257_1001575 | 3300025304 | Bacteria | 26306 |
| 332 | Ga0209257_1001711 | 3300025304 | Bacteria | 24581 |
| 333 | Ga0207697_10014484 | 3300025315 | Bacteria | 3269 |
| 334 | Ga0207656_10004664 | 3300025321 | Bacteria | 4802 |
| 335 | Ga0207696_1002900 | 3300025711 | Bacteria | 8072 |
| 336 | Ga0207655_1017390 | 3300025728 | Bacteria | 3881 |
| 337 | Ga0207713_1013296 | 3300025735 | Bacteria | 4346 |
| 338 | Ga0207713_1023169 | 3300025735 | Bacteria | 2930 |
| 339 | Ga0207713_1033299 | 3300025735 | Bacteria | 2253 |
| 340 | Ga0207713_1049139 | 3300025735 | Bacteria | 1693 |
| 341 | Ga0207713_1049818 | 3300025735 | Bacteria | 1676 |
| 342 | Ga0207692_10008674 | 3300025898 | Bacteria | 4218 |
| 343 | Ga0207710_10020090 | 3300025900 | Bacteria | 2853 |
| 344 | Ga0207710_10057943 | 3300025900 | Bacteria | 1750 |
| 345 | Ga0207688_10007026 | 3300025901 | Bacteria | 6121 |
| 346 | Ga0207688_10052808 | 3300025901 | Bacteria | 2278 |
| 347 | Ga0207680_10001069 | 3300025903 | Bacteria | 12923 |
| 348 | Ga0207647_10027823 | 3300025904 | Bacteria | 3682 |
| 349 | Ga0207645_10006422 | 3300025907 | Bacteria | 8439 |
| 350 | Ga0207645_10156823 | 3300025907 | Bacteria | 1487 |
| 351 | Ga0207705_10022095 | 3300025909 | Bacteria | 4539 |
| 352 | Ga0207705_10051621 | 3300025909 | Bacteria | 2960 |
| 353 | Ga0207654_10052585 | 3300025911 | Bacteria | 2348 |
| 354 | Ga0207707_10066580 | 3300025912 | Bacteria | 3138 |
| 355 | Ga0207695_10004273 | 3300025913 | Bacteria | 19616 |
| 356 | Ga0207695_10005571 | 3300025913 | Bacteria | 16629 |
| 357 | Ga0207695_10034300 | 3300025913 | Bacteria | 5522 |
| 358 | Ga0207695_10057496 | 3300025913 | Bacteria | 4040 |
| 359 | Ga0207695_10115979 | 3300025913 | Bacteria | 2652 |
| 360 | Ga0207671_10000041 | 3300025914 | Bacteria | 216095 |
| 361 | Ga0207693_10269951 | 3300025915 | Bacteria | 1333 |
| 362 | Ga0207657_10014188 | 3300025919 | Bacteria | 7790 |
| 363 | Ga0207657_10088710 | 3300025919 | Bacteria | 2584 |
| 364 | Ga0207649_10000075 | 3300025920 | Bacteria | 83915 |
| 365 | Ga0207649_10006407 | 3300025920 | Bacteria | 6395 |
| 366 | Ga0207649_10022312 | 3300025920 | Bacteria | 3656 |
| 367 | Ga0207652_10004883 | 3300025921 | Bacteria | 10849 |
| 368 | Ga0207652_10057707 | 3300025921 | Bacteria | 3344 |
| 369 | Ga0207652_10121023 | 3300025921 | Bacteria | 2328 |
| 370 | Ga0207681_10016295 | 3300025923 | Bacteria | 4647 |
| 371 | Ga0207681_10041246 | 3300025923 | Bacteria | 3076 |
| 372 | Ga0207694_10162935 | 3300025924 | Bacteria | 1802 |
| 373 | Ga0207650_10000056 | 3300025925 | Bacteria | 157972 |
| 374 | Ga0207650_10001645 | 3300025925 | Bacteria | 15921 |
| 375 | Ga0207650_10015096 | 3300025925 | Bacteria | 5374 |
| 376 | Ga0207687_10074223 | 3300025927 | Bacteria | 2437 |
| 377 | Ga0207644_10002127 | 3300025931 | Bacteria | 12857 |
| 378 | Ga0207644_10003552 | 3300025931 | Bacteria | 10090 |
| 379 | Ga0207644_10057746 | 3300025931 | Bacteria | 2802 |
| 380 | Ga0207644_10072288 | 3300025931 | Bacteria | 2526 |
| 381 | Ga0207690_10039031 | 3300025932 | Bacteria | 3096 |
| 382 | Ga0207706_10048379 | 3300025933 | Bacteria | 3761 |
| 383 | Ga0207706_10049700 | 3300025933 | Bacteria | 3705 |
| 384 | Ga0207706_10201075 | 3300025933 | Bacteria | 1747 |
| 385 | Ga0207706_10235738 | 3300025933 | Bacteria | 1600 |
| 386 | Ga0207709_10000305 | 3300025935 | Bacteria | 53275 |
| 387 | Ga0207704_10056850 | 3300025938 | Bacteria | 2399 |
| 388 | Ga0207691_10007560 | 3300025940 | Bacteria | 10461 |
| 389 | Ga0207691_10056940 | 3300025940 | Bacteria | 3560 |
| 390 | Ga0207691_10057571 | 3300025940 | Bacteria | 3536 |
| 391 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 392 | Ga0207711_10004220 | 3300025941 | Bacteria | 12307 |
| 393 | Ga0207711_10028891 | 3300025941 | Bacteria | 4671 |
| 394 | Ga0207711_10041090 | 3300025941 | Bacteria | 3937 |
| 395 | Ga0207689_10084499 | 3300025942 | Bacteria | 2609 |
| 396 | Ga0207689_10111859 | 3300025942 | Bacteria | 2245 |
| 397 | Ga0207661_10007992 | 3300025944 | Bacteria | 7543 |
| 398 | Ga0207661_10066150 | 3300025944 | Bacteria | 2936 |
| 399 | Ga0207661_10199067 | 3300025944 | Bacteria | 1760 |
| 400 | Ga0207679_10000004 | 3300025945 | Bacteria | 589021 |
| 401 | Ga0207679_10009846 | 3300025945 | Bacteria | 6136 |
| 402 | Ga0207679_10028387 | 3300025945 | Bacteria | 3882 |
| 403 | Ga0207667_10000428 | 3300025949 | Bacteria | 56508 |
| 404 | Ga0207667_10004100 | 3300025949 | Bacteria | 17907 |
| 405 | Ga0207667_10276870 | 3300025949 | Unclassified | 1715 |
| 406 | Ga0207651_10060067 | 3300025960 | Bacteria | 2637 |
| 407 | Ga0207651_10112554 | 3300025960 | Bacteria | 2046 |
| 408 | Ga0207651_10138127 | 3300025960 | Bacteria | 1878 |
| 409 | Ga0207651_10153111 | 3300025960 | Bacteria | 1798 |
| 410 | Ga0207712_10000023 | 3300025961 | Bacteria | 282081 |
| 411 | Ga0207712_10000102 | 3300025961 | Bacteria | 96444 |
| 412 | Ga0207712_10006888 | 3300025961 | Bacteria | 7175 |
| 413 | Ga0207712_10012601 | 3300025961 | Bacteria | 5403 |
| 414 | Ga0207668_10000070 | 3300025972 | Bacteria | 78666 |
| 415 | Ga0207668_10000491 | 3300025972 | Bacteria | 24767 |
| 416 | Ga0207668_10001557 | 3300025972 | Bacteria | 13418 |
| 417 | Ga0207640_10000084 | 3300025981 | Bacteria | 74504 |
| 418 | Ga0207640_10000185 | 3300025981 | Bacteria | 44459 |
| 419 | Ga0207640_10007204 | 3300025981 | Bacteria | 6132 |
| 420 | Ga0207640_10008681 | 3300025981 | Bacteria | 5651 |
| 421 | Ga0207658_10000101 | 3300025986 | Bacteria | 95144 |
| 422 | Ga0207658_10000251 | 3300025986 | Bacteria | 56192 |
| 423 | Ga0207658_10007909 | 3300025986 | Bacteria | 7242 |
| 424 | Ga0207658_10010752 | 3300025986 | Bacteria | 6224 |
| 425 | Ga0207677_10000044 | 3300026023 | Bacteria | 107614 |
| 426 | Ga0207677_10217630 | 3300026023 | Bacteria | 1529 |
| 427 | Ga0207703_10014421 | 3300026035 | Bacteria | 6163 |
| 428 | Ga0207703_10022204 | 3300026035 | Bacteria | 4976 |
| 429 | Ga0207703_10112069 | 3300026035 | Bacteria | 2330 |
| 430 | Ga0207639_10120297 | 3300026041 | Bacteria | 2156 |
| 431 | Ga0207678_10000012 | 3300026067 | Bacteria | 145324 |
| 432 | Ga0207678_10002629 | 3300026067 | Bacteria | 16358 |
| 433 | Ga0207678_10012155 | 3300026067 | Bacteria | 7562 |
| 434 | Ga0207678_10013054 | 3300026067 | Bacteria | 7288 |
| 435 | Ga0207678_10033439 | 3300026067 | Bacteria | 4479 |
| 436 | Ga0207678_10073669 | 3300026067 | Bacteria | 2926 |
| 437 | Ga0207708_10079598 | 3300026075 | Bacteria | 2517 |
| 438 | Ga0207702_10000020 | 3300026078 | Bacteria | 203299 |
| 439 | Ga0207702_10002214 | 3300026078 | Bacteria | 18628 |
| 440 | Ga0207702_10023308 | 3300026078 | Bacteria | 5133 |
| 441 | Ga0207641_10000018 | 3300026088 | Bacteria | 298209 |
| 442 | Ga0207641_10000031 | 3300026088 | Bacteria | 224320 |
| 443 | Ga0207641_10000046 | 3300026088 | Bacteria | 180836 |
| 444 | Ga0207641_10011350 | 3300026088 | Bacteria | 7312 |
| 445 | Ga0207641_10143612 | 3300026088 | Bacteria | 2156 |
| 446 | Ga0207641_10274672 | 3300026088 | Bacteria | 1583 |
| 447 | Ga0207676_10000027 | 3300026095 | Bacteria | 245868 |
| 448 | Ga0207676_10002924 | 3300026095 | Bacteria | 12175 |
| 449 | Ga0207676_10038759 | 3300026095 | Bacteria | 3640 |
| 450 | Ga0207674_10000209 | 3300026116 | Bacteria | 72184 |
| 451 | Ga0207674_10006196 | 3300026116 | Bacteria | 14099 |
| 452 | Ga0207674_10051941 | 3300026116 | Bacteria | 4182 |
| 453 | Ga0207674_10178300 | 3300026116 | Bacteria | 2077 |
| 454 | Ga0207675_100087142 | 3300026118 | Bacteria | 2932 |
| 455 | Ga0207675_100090177 | 3300026118 | Bacteria | 2882 |
| 456 | Ga0207675_100095286 | 3300026118 | Bacteria | 2800 |
| 457 | Ga0207683_10028424 | 3300026121 | Bacteria | 4835 |
| 458 | Ga0207683_10071144 | 3300026121 | Bacteria | 3074 |
| 459 | Ga0207698_10072327 | 3300026142 | Bacteria | 2741 |
| 460 | Ga0209179_1002620 | 3300027512 | Bacteria | 2464 |
| 461 | Ga0209813_10000397 | 3300027866 | Bacteria | 10778 |
| 462 | Ga0207428_10002905 | 3300027907 | Bacteria | 16985 |
| 463 | Ga0268266_10000394 | 3300028379 | Bacteria | 66190 |
| 464 | Ga0268266_10003975 | 3300028379 | Bacteria | 14338 |
| 465 | Ga0268266_10005881 | 3300028379 | Bacteria | 11353 |
| 466 | Ga0268266_10083270 | 3300028379 | Bacteria | 2792 |
| 467 | Ga0268266_10224302 | 3300028379 | Bacteria | 1729 |
| 468 | Ga0268265_10000042 | 3300028380 | Bacteria | 186086 |
| 469 | Ga0268265_10000049 | 3300028380 | Bacteria | 177242 |
| 470 | Ga0268265_10000770 | 3300028380 | Bacteria | 30967 |
| 471 | Ga0268265_10005055 | 3300028380 | Bacteria | 9055 |
| 472 | Ga0268265_10046537 | 3300028380 | Bacteria | 3244 |
| 473 | Ga0268265_10081278 | 3300028380 | Bacteria | 2558 |
| 474 | Ga0268264_10001904 | 3300028381 | Bacteria | 18903 |
| 475 | Ga0268264_10005865 | 3300028381 | Bacteria | 10396 |
| 476 | Ga0268264_10007684 | 3300028381 | Bacteria | 8985 |
| 477 | Ga0237817_10088 | 3300030083 | Bacteria | 28251 |
| 478 | Ga0237817_10199 | 3300030083 | Bacteria | 15991 |
| 479 | Ga0237817_10571 | 3300030083 | Bacteria | 4119 |
| 480 | Ga0265328_10001466 | 3300031239 | Bacteria | 10894 |
| 481 | Ga0265327_10001610 | 3300031251 | Bacteria | 27353 |
| 482 | Ga0265327_10002591 | 3300031251 | Bacteria | 18713 |
| 483 | Ga0265316_10144748 | 3300031344 | Bacteria | 1783 |
| 484 | Ga0307513_10106202 | 3300031456 | Bacteria | 2815 |
| 485 | Ga0307513_10181155 | 3300031456 | Bacteria | 1970 |
| 486 | Ga0307509_10006676 | 3300031507 | Bacteria | 15395 |
| 487 | Ga0307509_10015731 | 3300031507 | Bacteria | 8807 |
| 488 | Ga0307509_10020068 | 3300031507 | Bacteria | 7597 |
| 489 | Ga0307509_10059371 | 3300031507 | Bacteria | 4047 |
| 490 | Ga0307509_10069425 | 3300031507 | Bacteria | 3683 |
| 491 | Ga0307408_100029226 | 3300031548 | Bacteria | 3816 |
| 492 | Ga0307408_100041473 | 3300031548 | Bacteria | 3263 |
| 493 | Ga0307408_100153986 | 3300031548 | Bacteria | 1818 |
| 494 | Ga0307408_100232652 | 3300031548 | Bacteria | 1510 |
| 495 | Ga0307508_10000921 | 3300031616 | Bacteria | 34235 |
| 496 | Ga0307508_10032102 | 3300031616 | Bacteria | 4744 |
| 497 | Ga0307405_10032740 | 3300031731 | Bacteria | 3075 |
| 498 | Ga0307405_10105375 | 3300031731 | Bacteria | 1899 |
| 499 | Ga0307405_10110755 | 3300031731 | Bacteria | 1859 |
| 500 | Ga0307413_10061078 | 3300031824 | Bacteria | 2323 |
| 501 | Ga0307410_10003115 | 3300031852 | Bacteria | 8231 |
| 502 | Ga0307410_10047646 | 3300031852 | Bacteria | 2865 |
| 503 | Ga0307410_10090384 | 3300031852 | Bacteria | 2171 |
| 504 | Ga0307410_10166443 | 3300031852 | Bacteria | 1657 |
| 505 | Ga0307406_10001562 | 3300031901 | Bacteria | 12620 |
| 506 | Ga0307406_10011507 | 3300031901 | Bacteria | 5026 |
| 507 | Ga0307406_10024964 | 3300031901 | Bacteria | 3574 |
| 508 | Ga0307406_10058812 | 3300031901 | Bacteria | 2471 |
| 509 | Ga0307407_10003631 | 3300031903 | Bacteria | 6380 |
| 510 | Ga0307407_10119100 | 3300031903 | Bacteria | 1670 |
| 511 | Ga0307412_10001834 | 3300031911 | Bacteria | 11779 |
| 512 | Ga0307412_10041379 | 3300031911 | Bacteria | 2986 |
| 513 | Ga0307412_10050390 | 3300031911 | Bacteria | 2747 |
| 514 | Ga0307409_100004024 | 3300031995 | Bacteria | 8161 |
| 515 | Ga0307409_100005574 | 3300031995 | Bacteria | 7274 |
| 516 | Ga0307409_100048247 | 3300031995 | Bacteria | 3238 |
| 517 | Ga0307409_100069989 | 3300031995 | Bacteria | 2783 |
| 518 | Ga0307409_100112456 | 3300031995 | Bacteria | 2286 |
| 519 | Ga0307416_100041203 | 3300032002 | Bacteria | 3594 |
| 520 | Ga0307416_100109541 | 3300032002 | Bacteria | 2429 |
| 521 | Ga0307414_10003418 | 3300032004 | Bacteria | 8470 |
| 522 | Ga0307414_10016685 | 3300032004 | Bacteria | 4472 |
| 523 | Ga0307414_10058882 | 3300032004 | Bacteria | 2709 |
| 524 | Ga0307414_10075548 | 3300032004 | Bacteria | 2445 |
| 525 | Ga0307411_10005783 | 3300032005 | Bacteria | 6120 |
| 526 | Ga0307411_10024840 | 3300032005 | Bacteria | 3579 |
| 527 | Ga0307411_10039330 | 3300032005 | Bacteria | 2991 |
| 528 | Ga0307411_10051340 | 3300032005 | Bacteria | 2690 |
| 529 | Ga0307411_10074757 | 3300032005 | Bacteria | 2310 |
| 530 | Ga0307415_100091882 | 3300032126 | Bacteria | 2200 |
| 531 | Ga0307415_100140151 | 3300032126 | Bacteria | 1846 |
| 532 | Ga0395899_0000610 | 3300037312 | Bacteria | 37302 |
| 533 | Ga0395899_0002435 | 3300037312 | Bacteria | 15139 |
| 534 | Ga0395899_0064489 | 3300037312 | Bacteria | 2693 |
| 535 | Ga0395899_0095812 | 3300037312 | Bacteria | 2146 |
| 536 | Ga0395900_0000301 | 3300037418 | Bacteria | 73924 |
| 537 | Ga0395900_0010269 | 3300037418 | Bacteria | 9574 |
| 538 | Ga0395900_0032913 | 3300037418 | Bacteria | 5333 |
| 539 | Ga0395900_0132975 | 3300037418 | Bacteria | 2549 |
| 540 | Ga0395898_0000049 | 3300037466 | Bacteria | 284792 |
| 541 | Ga0395898_0000504 | 3300037466 | Bacteria | 75910 |
| 542 | Ga0395898_0020197 | 3300037466 | Bacteria | 6766 |
| 543 | Ga0395898_0058759 | 3300037466 | Bacteria | 3743 |
| 544 | Ga0395905_0004579 | 3300037471 | Bacteria | 14305 |
| 545 | Ga0395905_0019542 | 3300037471 | Bacteria | 6421 |
| 546 | Ga0395905_0132498 | 3300037471 | Bacteria | 2344 |
| 547 | Ga0395905_0156248 | 3300037471 | Bacteria | 2145 |
| 548 | Ga0436364_1487636 | 3300037853 | Bacteria | 30336 |
| 549 | Ga0395901_0000197 | 3300038443 | Bacteria | 76617 |
| 550 | Ga0237819_00121 | 3300038705 | Bacteria | 29067 |
| 551 | Ga0237819_00430 | 3300038705 | Bacteria | 14382 |
| 552 | Ga0237819_02219 | 3300038705 | Bacteria | 4091 |
| 553 | Ga0237816_00660 | 3300039145 | Bacteria | 2907 |
| 554 | Ga0436361_0587792 | 3300039447 | Bacteria | 4315 |
| 555 | Ga0436361_0637365 | 3300039447 | Bacteria | 14224 |
| 556 | Ga0439436_0001800 | 3300041404 | Bacteria | 6315 |
| 557 | Ga0439447_001376 | 3300041407 | Bacteria | 8895 |
| 558 | Ga0451797_0154013 | 3300041453 | Bacteria | 1471 |
| 559 | Ga0451853_1495030 | 3300041512 | Bacteria | 13527 |
| 560 | Ga0439445_0000005 | 3300042004 | Bacteria | 28900 |
| 561 | Ga0439449_0002747 | 3300042007 | Bacteria | 6846 |
| 562 | Ga0439449_0011729 | 3300042007 | Bacteria | 3293 |
| 563 | Ga0439449_0020874 | 3300042007 | Bacteria | 2454 |
| 564 | Ga0466969_0002062 | 3300044656 | Bacteria | 10728 |
| 565 | Ga0466969_0064503 | 3300044656 | Bacteria | 1773 |
| 566 | Ga0466972_0003988 | 3300044658 | Bacteria | 7352 |
| 567 | Ga0466972_0005704 | 3300044658 | Bacteria | 6240 |
| 568 | Ga0466972_0034292 | 3300044658 | Bacteria | 2487 |
| 569 | Ga0466978_0002079 | 3300044671 | Bacteria | 8369 |
| 570 | Ga0466982_0000003 | 3300044672 | Bacteria | 417243 |
| 571 | Ga0466965_0001591 | 3300044683 | Bacteria | 9263 |
| 572 | Ga0466965_0038543 | 3300044683 | Bacteria | 2348 |
| 573 | Ga0466965_0116846 | 3300044683 | Bacteria | 1375 |
| 574 | Ga0466966_0007047 | 3300044684 | Bacteria | 7444 |
| 575 | Ga0466966_0028158 | 3300044684 | Bacteria | 3661 |
| 576 | Ga0466961_0000354 | 3300044693 | Bacteria | 29866 |
| 577 | Ga0466961_0007493 | 3300044693 | Bacteria | 6941 |
| 578 | Ga0466961_0033128 | 3300044693 | Bacteria | 3321 |
| 579 | Ga0466964_0005625 | 3300044706 | Bacteria | 4657 |
| 580 | Ga0466964_0008119 | 3300044706 | Bacteria | 3938 |
| 581 | Ga0466971_0001735 | 3300044719 | Bacteria | 9235 |
| 582 | Ga0466971_0011695 | 3300044719 | Bacteria | 3843 |
| 583 | Ga0466968_0017456 | 3300044735 | Bacteria | 2868 |
| 584 | Ga0466968_0031750 | 3300044735 | Bacteria | 2192 |
| 585 | Ga0466970_0000585 | 3300044765 | Bacteria | 17842 |
| 586 | Ga0466970_0023508 | 3300044765 | Bacteria | 3219 |
| 587 | Ga0466957_0108315 | 3300044842 | Bacteria | 1759 |
| 588 | Ga0466960_0000132 | 3300044901 | Bacteria | 25196 |
| 589 | Ga0466960_0005384 | 3300044901 | Bacteria | 5069 |
| 590 | Ga0466960_0167635 | 3300044901 | Bacteria | 1183 |
| 591 | Ga0466959_0051225 | 3300045049 | Bacteria | 3029 |
| 592 | Ga0466959_0118008 | 3300045049 | Bacteria | 1888 |
| 593 | Ga0451576_0009411 | 3300045051 | Bacteria | 11329 |
| 594 | Ga0466958_0047382 | 3300045836 | Bacteria | 2595 |
| 595 | Ga0466967_0000281 | 3300045976 | Bacteria | 22593 |
| 596 | Ga0495638_0000204 | 3300046460 | Bacteria | 84182 |
| 597 | Ga0495653_0000527 | 3300046463 | Bacteria | 29318 |
| 598 | Ga0495650_0002326 | 3300046471 | Bacteria | 15721 |
| 599 | Ga0495585_0000330 | 3300046492 | Bacteria | 46311 |
| 600 | Ga0495607_0009844 | 3300046501 | Bacteria | 6448 |
| 601 | Ga0495607_0130359 | 3300046501 | Bacteria | 1309 |
| 602 | Ga0495583_0000349 | 3300046506 | Bacteria | 73032 |
| 603 | Ga0495606_0001152 | 3300046507 | Bacteria | 37502 |
| 604 | Ga0495632_0001269 | 3300046519 | Bacteria | 21412 |
| 605 | Ga0495637_0011991 | 3300046520 | Bacteria | 4156 |
| 606 | Ga0495648_0000212 | 3300046524 | Bacteria | 67727 |
| 607 | Ga0495648_0007599 | 3300046524 | Bacteria | 8655 |
| 608 | Ga0495648_0007985 | 3300046524 | Bacteria | 8395 |
| 609 | Ga0495663_0016250 | 3300046525 | Bacteria | 2104 |
| 610 | Ga0495652_0027948 | 3300046529 | Bacteria | 4968 |
| 611 | Ga0495654_0025510 | 3300046530 | Bacteria | 3044 |
| 612 | Ga0495587_0103598 | 3300046536 | Bacteria | 1638 |
| 613 | Ga0495609_0010947 | 3300046538 | Bacteria | 4333 |
| 614 | Ga0495622_0125213 | 3300046557 | Bacteria | 1172 |
| 615 | Ga0495633_0000759 | 3300046558 | Bacteria | 29007 |
| 616 | Ga0495633_0033078 | 3300046558 | Bacteria | 2495 |
| 617 | Ga0495668_0000044 | 3300046616 | Bacteria | 227585 |
| 618 | Ga0495668_0002177 | 3300046616 | Bacteria | 16775 |
| 619 | Ga0495668_0002195 | 3300046616 | Bacteria | 16650 |
| 620 | Ga0495668_0061652 | 3300046616 | Bacteria | 2068 |
| 621 | Ga0495668_0101824 | 3300046616 | Bacteria | 1571 |
| 622 | Ga0495668_0141008 | 3300046616 | Bacteria | 1319 |
| 623 | Ga0495611_0007828 | 3300046648 | Bacteria | 4536 |
| 624 | Ga0495625_0002196 | 3300046660 | Bacteria | 21608 |
| 625 | Ga0495625_0006917 | 3300046660 | Bacteria | 10010 |
| 626 | Ga0495661_0000055 | 3300046665 | Bacteria | 138787 |
| 627 | Ga0495588_0034047 | 3300046674 | Bacteria | 2577 |
| 628 | Ga0495669_0000104 | 3300046684 | Bacteria | 53714 |
| 629 | Ga0495669_0003427 | 3300046684 | Bacteria | 6531 |
| 630 | Ga0495669_0005899 | 3300046684 | Bacteria | 5105 |
| 631 | Ga0495669_0046662 | 3300046684 | Bacteria | 1934 |
| 632 | Ga0495671_0000060 | 3300046692 | Bacteria | 107734 |
| 633 | Ga0495671_0011594 | 3300046692 | Bacteria | 4844 |
| 634 | Ga0495671_0036177 | 3300046692 | Bacteria | 2502 |
| 635 | Ga0495649_0006051 | 3300046694 | Bacteria | 7567 |
| 636 | Ga0495581_0018902 | 3300047315 | Bacteria | 4000 |
| 637 | Ga0495672_0010100 | 3300047320 | Bacteria | 6754 |
| 638 | Ga0495672_0012840 | 3300047320 | Bacteria | 5815 |
| 639 | Ga0495673_0000088 | 3300047469 | Bacteria | 189812 |
| 640 | Ga0495673_0001871 | 3300047469 | Bacteria | 15797 |
| 641 | Ga0495686_0000273 | 3300047472 | Bacteria | 91936 |
| 642 | Ga0495686_0001176 | 3300047472 | Bacteria | 30528 |
| 643 | Ga0495686_0001454 | 3300047472 | Bacteria | 25799 |
| 644 | Ga0495686_0002443 | 3300047472 | Bacteria | 17543 |
| 645 | Ga0495626_0025948 | 3300048091 | Bacteria | 2860 |
| 646 | Ga0496102_0019806 | 3300048905 | Bacteria | 5931 |
| 647 | Ga0496102_0146479 | 3300048905 | Bacteria | 2217 |
| 648 | Ga0496104_0040214 | 3300048907 | Bacteria | 4382 |
| 649 | Ga0496106_0001233 | 3300048909 | Bacteria | 19151 |
| 650 | Ga0496107_0019708 | 3300048910 | Bacteria | 4760 |
| 651 | Ga0496107_0030713 | 3300048910 | Bacteria | 3830 |
| 652 | Ga0496107_0047994 | 3300048910 | Bacteria | 3075 |
| 653 | Ga0496108_0001640 | 3300048911 | Bacteria | 17743 |
| 654 | Ga0496108_0011078 | 3300048911 | Bacteria | 7323 |
| 655 | Ga0496109_0005013 | 3300048912 | Bacteria | 11058 |
| 656 | Ga0496109_0016098 | 3300048912 | Bacteria | 6534 |
| 657 | Ga0496109_0094770 | 3300048912 | Bacteria | 2763 |
| 658 | Ga0496112_0006823 | 3300048915 | Bacteria | 10064 |
| 659 | Ga0496112_0008439 | 3300048915 | Bacteria | 9227 |
| 660 | Ga0496112_0368312 | 3300048915 | Bacteria | 1378 |
| 661 | Ga0496113_0004212 | 3300048916 | Bacteria | 8795 |
| 662 | Ga0496113_0088079 | 3300048916 | Bacteria | 2388 |
| 663 | Ga0496114_0022635 | 3300048917 | Bacteria | 5122 |
| 664 | Ga0496115_0206191 | 3300048918 | Bacteria | 1624 |
| 665 | Ga0496117_0005187 | 3300048920 | Bacteria | 13879 |
| 666 | Ga0496118_0000262 | 3300048921 | Bacteria | 92154 |
| 667 | Ga0496121_0005989 | 3300048924 | Bacteria | 15361 |
| 668 | Ga0496121_0015828 | 3300048924 | Bacteria | 7846 |
| 669 | Ga0496121_0031186 | 3300048924 | Bacteria | 4875 |
| 670 | Ga0496122_0001014 | 3300048925 | Bacteria | 49714 |
| 671 | Ga0496122_0010437 | 3300048925 | Bacteria | 9572 |
| 672 | Ga0496122_0039799 | 3300048925 | Bacteria | 3744 |
| 673 | Ga0496123_0000212 | 3300048926 | Bacteria | 118628 |
| 674 | Ga0496123_0002266 | 3300048926 | Bacteria | 24245 |
| 675 | Ga0496123_0006380 | 3300048926 | Bacteria | 11447 |
| 676 | Ga0496123_0020071 | 3300048926 | Bacteria | 5242 |
| 677 | Ga0496124_0000191 | 3300048927 | Bacteria | 121192 |
| 678 | Ga0496124_0005682 | 3300048927 | Bacteria | 13907 |
| 679 | Ga0496124_0151122 | 3300048927 | Bacteria | 1821 |
| 680 | Ga0496125_0001371 | 3300048928 | Bacteria | 35830 |
| 681 | Ga0496125_0016025 | 3300048928 | Bacteria | 7216 |
| 682 | Ga0496125_0025101 | 3300048928 | Bacteria | 5466 |
| 683 | Ga0496125_0068929 | 3300048928 | Bacteria | 2779 |
| 684 | Ga0496126_0070584 | 3300048929 | Bacteria | 3112 |
| 685 | Ga0496126_0191073 | 3300048929 | Bacteria | 1734 |
| 686 | Ga0501034_0006142 | 3300049571 | Bacteria | 12951 |
| 687 | Ga0501036_0053029 | 3300049572 | Bacteria | 3435 |
| 688 | Ga0501036_0199548 | 3300049572 | Bacteria | 1683 |
| 689 | Ga0501037_0006585 | 3300049573 | Bacteria | 8497 |
| 690 | Ga0501037_0020025 | 3300049573 | Bacteria | 4939 |
| 691 | Ga0501038_0018653 | 3300049574 | Bacteria | 6266 |
| 692 | Ga0501040_0008279 | 3300049576 | Bacteria | 6764 |
| 693 | Ga0501043_0001562 | 3300049579 | Bacteria | 19946 |
| 694 | Ga0501043_0051406 | 3300049579 | Bacteria | 3238 |
| 695 | Ga0501043_0079939 | 3300049579 | Bacteria | 2569 |
| 696 | Ga0501046_0000033 | 3300049580 | Bacteria | 174675 |
| 697 | Ga0501046_0016647 | 3300049580 | Bacteria | 6152 |
| 698 | Ga0501046_0021415 | 3300049580 | Bacteria | 5334 |
| 699 | Ga0501046_0077105 | 3300049580 | Bacteria | 2581 |
| 700 | Ga0501047_0006704 | 3300049581 | Bacteria | 10826 |
| 701 | Ga0501047_0011301 | 3300049581 | Bacteria | 8452 |
| 702 | Ga0501047_0020030 | 3300049581 | Bacteria | 6423 |
| 703 | Ga0501047_0069738 | 3300049581 | Bacteria | 3385 |
| 704 | Ga0501048_0019298 | 3300049582 | Bacteria | 5005 |
| 705 | Ga0501067_0008656 | 3300049583 | Bacteria | 5640 |
| 706 | Ga0501070_0052359 | 3300049586 | Bacteria | 3388 |
| 707 | Ga0501072_0004575 | 3300049588 | Bacteria | 10529 |
| 708 | Ga0501075_0094614 | 3300049591 | Bacteria | 2268 |
| 709 | Ga0501076_0007578 | 3300049592 | Bacteria | 7902 |
| 710 | Ga0501202_017065 | 3300049652 | Bacteria | 1414 |
| 711 | Ga0501235_005002 | 3300049669 | Bacteria | 2876 |
| 712 | Ga0501235_012406 | 3300049669 | Bacteria | 1874 |
| 713 | Ga0501239_003632 | 3300049672 | Bacteria | 1478 |
| 714 | Ga0501249_015084 | 3300049679 | Bacteria | 1651 |
| 715 | Ga0501225_0017211 | 3300049705 | Bacteria | 2006 |
| 716 | Ga0501079_0024540 | 3300049741 | Bacteria | 4627 |
| 717 | Ga0501241_004656 | 3300049758 | Bacteria | 2560 |
| 718 | Ga0501268_002017 | 3300049765 | Bacteria | 2618 |
| 719 | Ga0501044_0012022 | 3300049823 | Bacteria | 9378 |
| 720 | Ga0501044_0053391 | 3300049823 | Bacteria | 4158 |
| 721 | Ga0501044_0361121 | 3300049823 | Bacteria | 1370 |
| 722 | Ga0501045_0021883 | 3300049824 | Bacteria | 4575 |
| 723 | nmdc:mga0yw44_5052_c1 | 3300050492 | Bacteria | 6164 |
| 724 | nmdc:mga0k408_7155_c1 | 3300050493 | Bacteria | 5962 |
| 725 | nmdc:mga08y16_199748_c1 | 3300050511 | Bacteria | 2072 |
| 726 | nmdc:mga0a205_306844_c1 | 3300050515 | Bacteria | 1459 |
| 727 | nmdc:mga0a205_39985_c1 | 3300050515 | Bacteria | 4515 |
| 728 | Ga0500610_0000215 | 3300053079 | Bacteria | 17712 |
| 729 | Ga0500610_0012721 | 3300053079 | Bacteria | 3888 |
| 730 | Ga0495619_0067857 | 3300053085 | Bacteria | 2382 |
| 731 | Ga0500643_000233 | 3300053087 | Bacteria | 51480 |
| 732 | Ga0500643_002379 | 3300053087 | Bacteria | 9800 |
| 733 | Ga0500643_003227 | 3300053087 | Bacteria | 7939 |
| 734 | Ga0500643_005019 | 3300053087 | Bacteria | 5798 |
| 735 | Ga0500644_0005175 | 3300053088 | Bacteria | 3285 |
| 736 | Ga0500641_0000769 | 3300053096 | Bacteria | 11636 |
| 737 | Ga0500641_0001800 | 3300053096 | Bacteria | 7597 |
| 738 | Ga0500556_0000049 | 3300053104 | Bacteria | 122572 |
| 739 | Ga0500556_0005972 | 3300053104 | Bacteria | 3449 |
| 740 | Ga0500562_000025 | 3300053108 | Bacteria | 105616 |
| 741 | Ga0500562_001325 | 3300053108 | Bacteria | 6108 |
| 742 | Ga0500562_018163 | 3300053108 | Bacteria | 1815 |
| 743 | Ga0500594_0000406 | 3300053118 | Bacteria | 9542 |
| 744 | Ga0500595_002777 | 3300053119 | Bacteria | 8434 |
| 745 | Ga0500608_061213 | 3300053122 | Bacteria | 1799 |
| 746 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 747 | Ga0500642_0017740 | 3300053130 | Bacteria | 2736 |
| 748 | Ga0500652_049004 | 3300053131 | Bacteria | 1720 |
| 749 | Ga0500658_0050263 | 3300053134 | Bacteria | 1701 |
| 750 | Ga0500573_0000002 | 3300053140 | Bacteria | 407088 |
| 751 | Ga0500573_0000029 | 3300053140 | Bacteria | 135595 |
| 752 | Ga0500604_0000275 | 3300053151 | Bacteria | 14285 |
| 753 | Ga0500616_0000042 | 3300053153 | Bacteria | 351293 |
| 754 | Ga0500616_0000293 | 3300053153 | Bacteria | 72597 |
| 755 | Ga0500616_0000626 | 3300053153 | Bacteria | 42914 |
| 756 | Ga0500616_0009558 | 3300053153 | Bacteria | 5891 |
| 757 | Ga0500616_0026195 | 3300053153 | Bacteria | 3230 |
| 758 | Ga0500616_0030689 | 3300053153 | Bacteria | 2949 |
| 759 | Ga0500616_0054945 | 3300053153 | Bacteria | 2084 |
| 760 | Ga0500622_0001865 | 3300053156 | Bacteria | 15924 |
| 761 | Ga0500622_0002056 | 3300053156 | Bacteria | 14993 |
| 762 | Ga0500622_0020235 | 3300053156 | Bacteria | 3534 |
| 763 | Ga0500622_0023574 | 3300053156 | Bacteria | 3259 |
| 764 | Ga0500638_002144 | 3300053162 | Bacteria | 6706 |
| 765 | Ga0500637_0000954 | 3300053178 | Bacteria | 11760 |
| 766 | Ga0500645_000002 | 3300053730 | Bacteria | 388892 |
| 767 | Ga0500645_000517 | 3300053730 | Bacteria | 25761 |
| 768 | Ga0500645_001489 | 3300053730 | Bacteria | 11754 |
| 769 | Ga0500645_005247 | 3300053730 | Bacteria | 4810 |
| 770 | Ga0500645_021801 | 3300053730 | Bacteria | 1975 |
| 771 | Ga0500587_000307 | 3300053739 | Bacteria | 5491 |
| 772 | Ga0587072_005443 | 3300059643 | Bacteria | 1900 |
| 773 | Ga0466962_0001864 | 3300061719 | Bacteria | 9909 |
| 774 | Ga0466962_0003379 | 3300061719 | Bacteria | 7595 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025915 | Ga0207693_10269951 | Ga0207693_102699511 | 316 |
| 2 | 3300046557 | Ga0495622_0125213 | Ga0495622_0125213_42_1061 | 323 |
| 3 | 3300009098 | Ga0105245_10468875 | Ga0105245_104688752 | 324 |
| 4 | 3300013307 | Ga0157372_10000149 | Ga0157372_1000014959 | 332 |
| 5 | 3300005327 | Ga0070658_10284790 | Ga0070658_102847902 | 334 |
| 6 | 3300046616 | Ga0495668_0141008 | Ga0495668_0141008_10_1080 | 342 |
| 7 | 3300048915 | Ga0496112_0368312 | Ga0496112_0368312_43_1116 | 345 |
| 8 | 3300046501 | Ga0495607_0130359 | Ga0495607_0130359_191_1267 | 347 |
| 9 | 3300044901 | Ga0466960_0167635 | Ga0466960_0167635_15_1103 | 348 |
| 10 | 3300025901 | Ga0207688_10052808 | Ga0207688_100528081 | 360 |
| 11 | 3300025944 | Ga0207661_10199067 | Ga0207661_101990672 | 360 |
| 12 | 3300048912 | Ga0496109_0094770 | Ga0496109_0094770_12_1145 | 365 |
| 13 | 3300006844 | Ga0075428_100122559 | Ga0075428_1001225592 | 366 |
| 14 | 3300048926 | Ga0496123_0002266 | Ga0496123_0002266_9999_11294 | 379 |
| 15 | 3300048928 | Ga0496125_0068929 | Ga0496125_0068929_17_1309 | 381 |
| 16 | 3300003792 | Ga0055540_1000003 | Ga0055540_1000003278 | 382 |
| 17 | 3300025303 | Ga0209051_1000011 | Ga0209051_1000011318 | 382 |
| 18 | 3300031616 | Ga0307508_10032102 | Ga0307508_100321022 | 382 |
| 19 | 3300005564 | Ga0070664_100025219 | Ga0070664_1000252192 | 383 |
| 20 | 3300005618 | Ga0068864_100044774 | Ga0068864_1000447742 | 383 |
| 21 | 3300014326 | Ga0157380_10031110 | Ga0157380_100311103 | 383 |
| 22 | 3300025945 | Ga0207679_10009846 | Ga0207679_100098464 | 383 |
| 23 | 3300026088 | Ga0207641_10274672 | Ga0207641_102746721 | 383 |
| 24 | 3300031239 | Ga0265328_10001466 | Ga0265328_100014665 | 383 |
| 25 | 3300031344 | Ga0265316_10144748 | Ga0265316_101447481 | 383 |
| 26 | 3300031995 | Ga0307409_100069989 | Ga0307409_1000699892 | 383 |
| 27 | 3300009093 | Ga0105240_10164625 | Ga0105240_101646253 | 384 |
| 28 | 3300025913 | Ga0207695_10115979 | Ga0207695_101159793 | 384 |
| 29 | 3300053153 | Ga0500616_0009558 | Ga0500616_0009558_4582_5868 | 384 |
| 30 | 3300009098 | Ga0105245_10225045 | Ga0105245_102250452 | 386 |
| 31 | 3300031507 | Ga0307509_10059371 | Ga0307509_100593713 | 386 |
| 32 | 3300046616 | Ga0495668_0002195 | Ga0495668_0002195_60_1466 | 387 |
| 33 | 3300049580 | Ga0501046_0077105 | Ga0501046_0077105_15_1253 | 387 |
| 34 | 3300053079 | Ga0500610_0012721 | Ga0500610_0012721_233_1564 | 387 |
| 35 | 3300053134 | Ga0500658_0050263 | Ga0500658_0050263_15_1376 | 387 |
| 36 | 3300053730 | Ga0500645_021801 | Ga0500645_021801_576_1919 | 387 |
| 37 | 3300005985 | Ga0081539_10002432 | Ga0081539_100024328 | 388 |
| 38 | 3300009094 | Ga0111539_10131569 | Ga0111539_101315692 | 388 |
| 39 | 3300050511 | nmdc:mga08y16_199748_c1 | nmdc:mga08y16_199748_c1_237_1541 | 388 |
| 40 | 3300005455 | Ga0070663_100055920 | Ga0070663_1000559203 | 389 |
| 41 | 3300005578 | Ga0068854_100035972 | Ga0068854_1000359723 | 389 |
| 42 | 3300005616 | Ga0068852_100052820 | Ga0068852_1000528202 | 389 |
| 43 | 3300006048 | Ga0075363_100000051 | Ga0075363_10000005123 | 389 |
| 44 | 3300010375 | Ga0105239_10025788 | Ga0105239_100257885 | 389 |
| 45 | 3300025981 | Ga0207640_10007204 | Ga0207640_100072045 | 389 |
| 46 | 3300026067 | Ga0207678_10002629 | Ga0207678_1000262913 | 389 |
| 47 | 3300026118 | Ga0207675_100087142 | Ga0207675_1000871423 | 389 |
| 48 | 3300026142 | Ga0207698_10072327 | Ga0207698_100723272 | 389 |
| 49 | 3300028379 | Ga0268266_10224302 | Ga0268266_102243021 | 389 |
| 50 | 3300048912 | Ga0496109_0005013 | Ga0496109_0005013_1902_3233 | 389 |
| 51 | 3300048915 | Ga0496112_0006823 | Ga0496112_0006823_4454_5785 | 389 |
| 52 | 3300048916 | Ga0496113_0088079 | Ga0496113_0088079_924_2255 | 389 |
| 53 | 3300009551 | Ga0105238_10022601 | Ga0105238_100226015 | 390 |
| 54 | 3300025924 | Ga0207694_10162935 | Ga0207694_101629352 | 390 |
| 55 | 3300031852 | Ga0307410_10003115 | Ga0307410_100031154 | 390 |
| 56 | 3300031903 | Ga0307407_10003631 | Ga0307407_100036313 | 390 |
| 57 | 3300031995 | Ga0307409_100004024 | Ga0307409_1000040245 | 390 |
| 58 | 3300032004 | Ga0307414_10003418 | Ga0307414_100034188 | 390 |
| 59 | 3300032005 | Ga0307411_10074757 | Ga0307411_100747572 | 390 |
| 60 | 3300046665 | Ga0495661_0000055 | Ga0495661_0000055_72508_73821 | 390 |
| 61 | 3300053131 | Ga0500652_049004 | Ga0500652_049004_186_1481 | 391 |
| 62 | 3300001989 | JGI24739J22299_10024202 | JGI24739J22299_100242022 | 392 |
| 63 | 3300003354 | JGI25160J50197_1003101 | JGI25160J50197_10031014 | 392 |
| 64 | 3300005262 | Ga0065165_1010558 | Ga0065165_10105583 | 392 |
| 65 | 3300006048 | Ga0075363_100060203 | Ga0075363_1000602032 | 392 |
| 66 | 3300006186 | Ga0075369_10001593 | Ga0075369_100015935 | 392 |
| 67 | 3300025297 | Ga0209758_1026024 | Ga0209758_10260242 | 392 |
| 68 | 3300025302 | Ga0207426_1000313 | Ga0207426_100031344 | 392 |
| 69 | 3300046674 | Ga0495588_0034047 | Ga0495588_0034047_243_1559 | 392 |
| 70 | 3300048905 | Ga0496102_0019806 | Ga0496102_0019806_1538_2896 | 392 |
| 71 | 3300009093 | Ga0105240_10018898 | Ga0105240_100188984 | 393 |
| 72 | 3300028380 | Ga0268265_10046537 | Ga0268265_100465372 | 393 |
| 73 | 3300038705 | Ga0237819_00121 | Ga0237819_00121_24756_26033 | 393 |
| 74 | 3300039145 | Ga0237816_00660 | Ga0237816_00660_1229_2506 | 393 |
| 75 | 3300046524 | Ga0495648_0007599 | Ga0495648_0007599_6231_7553 | 393 |
| 76 | 3300046616 | Ga0495668_0061652 | Ga0495668_0061652_613_1935 | 393 |
| 77 | 3300046692 | Ga0495671_0011594 | Ga0495671_0011594_882_2204 | 393 |
| 78 | 3300047320 | Ga0495672_0012840 | Ga0495672_0012840_2705_4027 | 393 |
| 79 | 3300047469 | Ga0495673_0001871 | Ga0495673_0001871_8117_9439 | 393 |
| 80 | 3300048929 | Ga0496126_0070584 | Ga0496126_0070584_486_1808 | 393 |
| 81 | 3300049579 | Ga0501043_0051406 | Ga0501043_0051406_751_2070 | 393 |
| 82 | 3300049581 | Ga0501047_0006704 | Ga0501047_0006704_54_1355 | 393 |
| 83 | 3300053087 | Ga0500643_002379 | Ga0500643_002379_2499_3821 | 393 |
| 84 | 3300005327 | Ga0070658_10126130 | Ga0070658_101261302 | 394 |
| 85 | 3300005347 | Ga0070668_100002649 | Ga0070668_1000026496 | 394 |
| 86 | 3300025909 | Ga0207705_10022095 | Ga0207705_100220952 | 394 |
| 87 | 3300025909 | Ga0207705_10051621 | Ga0207705_100516212 | 394 |
| 88 | 3300025972 | Ga0207668_10000491 | Ga0207668_1000049114 | 394 |
| 89 | 3300031507 | Ga0307509_10006676 | Ga0307509_100066764 | 394 |
| 90 | 3300044656 | Ga0466969_0064503 | Ga0466969_0064503_253_1560 | 394 |
| 91 | 3300044693 | Ga0466961_0033128 | Ga0466961_0033128_1458_2834 | 394 |
| 92 | 3300044735 | Ga0466968_0017456 | Ga0466968_0017456_1107_2483 | 394 |
| 93 | iso_pu_bacteria | 2858438669 | 2858439593 | 394 |
| 94 | iso_pu_bacteria | 2928519762 | 2928520345 | 394 |
| 95 | 3300002773 | JGI25152J39213_1000016 | JGI25152J39213_100001645 | 395 |
| 96 | 3300002774 | JGI25150J39212_1000003 | JGI25150J39212_1000003350 | 395 |
| 97 | 3300002774 | JGI25150J39212_1000004 | JGI25150J39212_1000004274 | 395 |
| 98 | 3300003187 | JGI25151J46595_10000002 | JGI25151J46595_10000002350 | 395 |
| 99 | 3300003215 | JGI25153J46596_10000015 | JGI25153J46596_10000015161 | 395 |
| 100 | 3300003320 | rootH2_10001801 | rootH2_1000180179 | 395 |
| 101 | 3300005339 | Ga0070660_100128661 | Ga0070660_1001286611 | 395 |
| 102 | 3300009093 | Ga0105240_10079491 | Ga0105240_100794915 | 395 |
| 103 | 3300009093 | Ga0105240_10119764 | Ga0105240_101197644 | 395 |
| 104 | 3300009174 | Ga0105241_10255484 | Ga0105241_102554841 | 395 |
| 105 | 3300013307 | Ga0157372_10245387 | Ga0157372_102453872 | 395 |
| 106 | 3300021361 | Ga0213872_10006956 | Ga0213872_100069562 | 395 |
| 107 | 3300025245 | Ga0207425_1000003 | Ga0207425_1000003494 | 395 |
| 108 | 3300025258 | Ga0209129_1000014 | Ga0209129_1000014339 | 395 |
| 109 | 3300025294 | Ga0209025_1000007 | Ga0209025_1000007493 | 395 |
| 110 | 3300025297 | Ga0209758_1000012 | Ga0209758_1000012494 | 395 |
| 111 | 3300025302 | Ga0207426_1004156 | Ga0207426_10041565 | 395 |
| 112 | 3300025911 | Ga0207654_10052585 | Ga0207654_100525851 | 395 |
| 113 | 3300025913 | Ga0207695_10057496 | Ga0207695_100574965 | 395 |
| 114 | 3300037312 | Ga0395899_0002435 | Ga0395899_0002435_3242_4618 | 395 |
| 115 | 3300037312 | Ga0395899_0064489 | Ga0395899_0064489_1370_2635 | 395 |
| 116 | 3300039447 | Ga0436361_0637365 | Ga0436361_0637365_285_1568 | 395 |
| 117 | 3300046684 | Ga0495669_0003427 | Ga0495669_0003427_1529_2827 | 395 |
| 118 | 3300049572 | Ga0501036_0199548 | Ga0501036_0199548_64_1368 | 395 |
| 119 | 3300049758 | Ga0501241_004656 | Ga0501241_004656_873_2150 | 395 |
| 120 | 3300049823 | Ga0501044_0361121 | Ga0501044_0361121_46_1314 | 395 |
| 121 | 3300053140 | Ga0500573_0000002 | Ga0500573_0000002_122973_124256 | 395 |
| 122 | 3300053156 | Ga0500622_0002056 | Ga0500622_0002056_2043_3323 | 395 |
| 123 | iso_pu_bacteria | 2862178590 | 2862186584 | 395 |
| 124 | iso_pu_bacteria | 8056447290 | 8056449402 | 395 |
| 125 | 3300003322 | rootL2_10034836 | rootL2_1003483616 | 396 |
| 126 | 3300005327 | Ga0070658_10022682 | Ga0070658_100226824 | 396 |
| 127 | 3300005937 | Ga0081455_10063949 | Ga0081455_100639492 | 396 |
| 128 | 3300010375 | Ga0105239_10040042 | Ga0105239_100400424 | 396 |
| 129 | 3300013104 | Ga0157370_10011309 | Ga0157370_100113093 | 396 |
| 130 | 3300025250 | Ga0209026_1000416 | Ga0209026_100041613 | 396 |
| 131 | 3300025938 | Ga0207704_10056850 | Ga0207704_100568502 | 396 |
| 132 | 3300025942 | Ga0207689_10084499 | Ga0207689_100844991 | 396 |
| 133 | 3300048918 | Ga0496115_0206191 | Ga0496115_0206191_326_1594 | 396 |
| 134 | 3300048925 | Ga0496122_0001014 | Ga0496122_0001014_46184_47467 | 396 |
| 135 | 3300048926 | Ga0496123_0000212 | Ga0496123_0000212_44581_45864 | 396 |
| 136 | 3300053730 | Ga0500645_001489 | Ga0500645_001489_3429_4733 | 396 |
| 137 | iso_pu_bacteria | 2738541274 | 2738703369 | 396 |
| 138 | iso_pu_bacteria | 2895427314 | 2895432235 | 396 |
| 139 | 3300005289 | Ga0065704_10074342 | Ga0065704_100743423 | 397 |
| 140 | 3300005331 | Ga0070670_100000027 | Ga0070670_100000027130 | 397 |
| 141 | 3300005367 | Ga0070667_100000638 | Ga0070667_10000063813 | 397 |
| 142 | 3300005618 | Ga0068864_100000083 | Ga0068864_10000008379 | 397 |
| 143 | 3300005841 | Ga0068863_100000025 | Ga0068863_10000002579 | 397 |
| 144 | 3300005842 | Ga0068858_100089625 | Ga0068858_1000896252 | 397 |
| 145 | 3300005844 | Ga0068862_100000027 | Ga0068862_100000027136 | 397 |
| 146 | 3300006195 | Ga0075366_10008428 | Ga0075366_100084283 | 397 |
| 147 | 3300009011 | Ga0105251_10000138 | Ga0105251_1000013878 | 397 |
| 148 | 3300009101 | Ga0105247_10002888 | Ga0105247_100028883 | 397 |
| 149 | 3300009177 | Ga0105248_10000026 | Ga0105248_10000026106 | 397 |
| 150 | 3300009177 | Ga0105248_10025719 | Ga0105248_100257194 | 397 |
| 151 | 3300009553 | Ga0105249_10000123 | Ga0105249_1000012386 | 397 |
| 152 | 3300009553 | Ga0105249_10023672 | Ga0105249_100236723 | 397 |
| 153 | 3300014968 | Ga0157379_10021758 | Ga0157379_100217582 | 397 |
| 154 | 3300025250 | Ga0209026_1005274 | Ga0209026_10052742 | 397 |
| 155 | 3300025735 | Ga0207713_1049818 | Ga0207713_10498181 | 397 |
| 156 | 3300025900 | Ga0207710_10020090 | Ga0207710_100200902 | 397 |
| 157 | 3300025925 | Ga0207650_10000056 | Ga0207650_1000005694 | 397 |
| 158 | 3300025941 | Ga0207711_10000004 | Ga0207711_10000004121 | 397 |
| 159 | 3300025961 | Ga0207712_10000102 | Ga0207712_1000010287 | 397 |
| 160 | 3300025961 | Ga0207712_10012601 | Ga0207712_100126012 | 397 |
| 161 | 3300025986 | Ga0207658_10000251 | Ga0207658_1000025139 | 397 |
| 162 | 3300026075 | Ga0207708_10079598 | Ga0207708_100795982 | 397 |
| 163 | 3300026088 | Ga0207641_10000018 | Ga0207641_10000018236 | 397 |
| 164 | 3300026095 | Ga0207676_10000027 | Ga0207676_10000027181 | 397 |
| 165 | 3300028380 | Ga0268265_10000042 | Ga0268265_10000042123 | 397 |
| 166 | 3300032004 | Ga0307414_10016685 | Ga0307414_100166854 | 397 |
| 167 | 3300037466 | Ga0395898_0058759 | Ga0395898_0058759_1329_2705 | 397 |
| 168 | 3300046463 | Ga0495653_0000527 | Ga0495653_0000527_7732_9045 | 397 |
| 169 | 3300046507 | Ga0495606_0001152 | Ga0495606_0001152_15974_17287 | 397 |
| 170 | 3300048091 | Ga0495626_0025948 | Ga0495626_0025948_528_1940 | 397 |
| 171 | 3300048920 | Ga0496117_0005187 | Ga0496117_0005187_8355_9629 | 397 |
| 172 | 3300048921 | Ga0496118_0000262 | Ga0496118_0000262_18857_20131 | 397 |
| 173 | 3300049581 | Ga0501047_0069738 | Ga0501047_0069738_529_1899 | 397 |
| 174 | 3300050493 | nmdc:mga0k408_7155_c1 | nmdc:mga0k408_7155_c1_3322_4599 | 397 |
| 175 | iso_pu_bacteria | 2914759650 | 2914762916 | 397 |
| 176 | 3300005329 | Ga0070683_100010869 | Ga0070683_10001086910 | 398 |
| 177 | 3300005331 | Ga0070670_100055135 | Ga0070670_1000551351 | 398 |
| 178 | 3300005331 | Ga0070670_100119540 | Ga0070670_1001195402 | 398 |
| 179 | 3300005338 | Ga0068868_100043366 | Ga0068868_1000433665 | 398 |
| 180 | 3300005341 | Ga0070691_10054800 | Ga0070691_100548002 | 398 |
| 181 | 3300005364 | Ga0070673_100063713 | Ga0070673_1000637134 | 398 |
| 182 | 3300005535 | Ga0070684_100022411 | Ga0070684_1000224115 | 398 |
| 183 | 3300005564 | Ga0070664_100012258 | Ga0070664_1000122586 | 398 |
| 184 | 3300005616 | Ga0068852_100033802 | Ga0068852_1000338022 | 398 |
| 185 | 3300013296 | Ga0157374_10043528 | Ga0157374_100435283 | 398 |
| 186 | 3300013296 | Ga0157374_10160140 | Ga0157374_101601402 | 398 |
| 187 | 3300025920 | Ga0207649_10022312 | Ga0207649_100223122 | 398 |
| 188 | 3300025925 | Ga0207650_10001645 | Ga0207650_100016451 | 398 |
| 189 | 3300025925 | Ga0207650_10015096 | Ga0207650_100150962 | 398 |
| 190 | 3300025940 | Ga0207691_10007560 | Ga0207691_100075605 | 398 |
| 191 | 3300025944 | Ga0207661_10007992 | Ga0207661_100079923 | 398 |
| 192 | 3300025945 | Ga0207679_10028387 | Ga0207679_100283872 | 398 |
| 193 | 3300025960 | Ga0207651_10060067 | Ga0207651_100600673 | 398 |
| 194 | 3300026023 | Ga0207677_10217630 | Ga0207677_102176301 | 398 |
| 195 | 3300026118 | Ga0207675_100090177 | Ga0207675_1000901774 | 398 |
| 196 | 3300046520 | Ga0495637_0011991 | Ga0495637_0011991_968_2284 | 398 |
| 197 | 3300046616 | Ga0495668_0101824 | Ga0495668_0101824_176_1465 | 398 |
| 198 | 3300046648 | Ga0495611_0007828 | Ga0495611_0007828_122_1438 | 398 |
| 199 | 3300046660 | Ga0495625_0002196 | Ga0495625_0002196_8900_10216 | 398 |
| 200 | 3300046684 | Ga0495669_0000104 | Ga0495669_0000104_8892_10208 | 398 |
| 201 | 3300048911 | Ga0496108_0001640 | Ga0496108_0001640_11102_12361 | 398 |
| 202 | 3300048927 | Ga0496124_0005682 | Ga0496124_0005682_2053_3384 | 398 |
| 203 | 3300053079 | Ga0500610_0000215 | Ga0500610_0000215_15271_16587 | 398 |
| 204 | 3300053087 | Ga0500643_003227 | Ga0500643_003227_2188_3477 | 398 |
| 205 | 3300053153 | Ga0500616_0000626 | Ga0500616_0000626_27227_28591 | 398 |
| 206 | 3300053730 | Ga0500645_000002 | Ga0500645_000002_107772_109088 | 398 |
| 207 | 3300009553 | Ga0105249_10024158 | Ga0105249_100241585 | 399 |
| 208 | 3300011119 | Ga0105246_10005371 | Ga0105246_100053715 | 399 |
| 209 | 3300013102 | Ga0157371_10005522 | Ga0157371_100055225 | 399 |
| 210 | 3300013306 | Ga0163162_10003740 | Ga0163162_1000374011 | 399 |
| 211 | 3300025901 | Ga0207688_10007026 | Ga0207688_100070265 | 399 |
| 212 | 3300025933 | Ga0207706_10048379 | Ga0207706_100483792 | 399 |
| 213 | 3300031548 | Ga0307408_100153986 | Ga0307408_1001539862 | 399 |
| 214 | 3300037471 | Ga0395905_0132498 | Ga0395905_0132498_861_2129 | 399 |
| 215 | 3300046660 | Ga0495625_0006917 | Ga0495625_0006917_2983_4272 | 399 |
| 216 | 3300046684 | Ga0495669_0046662 | Ga0495669_0046662_400_1668 | 399 |
| 217 | 3300053087 | Ga0500643_005019 | Ga0500643_005019_2365_3654 | 399 |
| 218 | 3300053104 | Ga0500556_0000049 | Ga0500556_0000049_14538_15842 | 399 |
| 219 | 3300053130 | Ga0500642_0000002 | Ga0500642_0000002_115810_117099 | 399 |
| 220 | iso_pu_bacteria | 2551306519 | 2553391355 | 399 |
| 221 | iso_pu_bacteria | 2585428060 | 2587747360 | 399 |
| 222 | iso_pu_bacteria | 2599185359 | 2600225334 | 399 |
| 223 | iso_pu_bacteria | 2643221729 | 2644703472 | 399 |
| 224 | iso_pu_bacteria | 2643221730 | 2644712402 | 399 |
| 225 | iso_pu_bacteria | 2684622632 | 2685148823 | 399 |
| 226 | iso_pu_bacteria | 2695420987 | 2698324341 | 399 |
| 227 | iso_pu_bacteria | 2703719227 | 2705992796 | 399 |
| 228 | iso_pu_bacteria | 2718218445 | 2721504209 | 399 |
| 229 | iso_pu_bacteria | 2738541284 | 2738763599 | 399 |
| 230 | iso_pu_bacteria | 2738541358 | 2739159747 | 399 |
| 231 | iso_pu_bacteria | 2738543006 | 2739212312 | 399 |
| 232 | iso_pu_bacteria | 2772190705 | 2772606597 | 399 |
| 233 | iso_pu_bacteria | 2818991443 | 2819584570 | 399 |
| 234 | iso_pu_bacteria | 2879163058 | 2879166282 | 399 |
| 235 | iso_pu_bacteria | 2929233124 | 2929234122 | 399 |
| 236 | iso_pu_bacteria | 2938917290 | 2938918286 | 399 |
| 237 | iso_pu_bacteria | 2947426588 | 2947427609 | 399 |
| 238 | iso_pu_bacteria | 2965761152 | 2965762161 | 399 |
| 239 | iso_pu_bacteria | 2979083700 | 2979084591 | 399 |
| 240 | iso_pu_bacteria | 8022621104 | 8022622063 | 399 |
| 241 | iso_pu_bacteria | 8023438354 | 8023443542 | 399 |
| 242 | iso_pu_bacteria | 8023444577 | 8023449139 | 399 |
| 243 | 3300003911 | JGI25405J52794_10004542 | JGI25405J52794_100045422 | 400 |
| 244 | 3300005444 | Ga0070694_100006716 | Ga0070694_1000067165 | 400 |
| 245 | 3300005471 | Ga0070698_100007890 | Ga0070698_1000078909 | 400 |
| 246 | 3300005518 | Ga0070699_100019463 | Ga0070699_1000194632 | 400 |
| 247 | 3300005546 | Ga0070696_100018171 | Ga0070696_1000181711 | 400 |
| 248 | 3300005548 | Ga0070665_100088738 | Ga0070665_1000887382 | 400 |
| 249 | 3300005549 | Ga0070704_100003498 | Ga0070704_1000034987 | 400 |
| 250 | 3300005617 | Ga0068859_100048570 | Ga0068859_1000485702 | 400 |
| 251 | 3300005937 | Ga0081455_10000021 | Ga0081455_10000021131 | 400 |
| 252 | 3300006931 | Ga0097620_100048565 | Ga0097620_1000485652 | 400 |
| 253 | 3300009176 | Ga0105242_10020912 | Ga0105242_100209122 | 400 |
| 254 | 3300025942 | Ga0207689_10111859 | Ga0207689_101118592 | 400 |
| 255 | 3300028379 | Ga0268266_10003975 | Ga0268266_100039751 | 400 |
| 256 | 3300031548 | Ga0307408_100041473 | Ga0307408_1000414732 | 400 |
| 257 | 3300031616 | Ga0307508_10000921 | Ga0307508_1000092111 | 400 |
| 258 | 3300031731 | Ga0307405_10032740 | Ga0307405_100327403 | 400 |
| 259 | 3300041453 | Ga0451797_0154013 | Ga0451797_0154013_136_1455 | 400 |
| 260 | 3300042007 | Ga0439449_0002747 | Ga0439449_0002747_5346_6686 | 400 |
| 261 | 3300044684 | Ga0466966_0007047 | Ga0466966_0007047_3646_4956 | 400 |
| 262 | 3300044719 | Ga0466971_0011695 | Ga0466971_0011695_2392_3702 | 400 |
| 263 | 3300045049 | Ga0466959_0118008 | Ga0466959_0118008_133_1443 | 400 |
| 264 | 3300045836 | Ga0466958_0047382 | Ga0466958_0047382_471_1781 | 400 |
| 265 | 3300046692 | Ga0495671_0036177 | Ga0495671_0036177_1050_2354 | 400 |
| 266 | 3300047320 | Ga0495672_0010100 | Ga0495672_0010100_3999_5345 | 400 |
| 267 | 3300049652 | Ga0501202_017065 | Ga0501202_017065_29_1351 | 400 |
| 268 | 3300049672 | Ga0501239_003632 | Ga0501239_003632_101_1423 | 400 |
| 269 | 3300053118 | Ga0500594_0000406 | Ga0500594_0000406_7609_8913 | 400 |
| 270 | 3300061719 | Ga0466962_0001864 | Ga0466962_0001864_6010_7320 | 400 |
| 271 | iso_pu_bacteria | 2643221634 | 2644196391 | 400 |
| 272 | iso_pu_bacteria | 2643221663 | 2644354055 | 400 |
| 273 | iso_pu_bacteria | 2643221695 | 2644528052 | 400 |
| 274 | iso_pu_bacteria | 2902792274 | 2902797894 | 400 |
| 275 | iso_pu_bacteria | 2929154850 | 2929155203 | 400 |
| 276 | iso_pu_bacteria | 2946024296 | 2946024581 | 400 |
| 277 | iso_pu_bacteria | 2977232053 | 2977233685 | 400 |
| 278 | iso_pu_bacteria | 8056207758 | 8056214538 | 400 |
| 279 | 3300003323 | rootH1_10012599 | rootH1_1001259956 | 401 |
| 280 | 3300005262 | Ga0065165_1002643 | Ga0065165_10026437 | 401 |
| 281 | 3300005437 | Ga0070710_10000514 | Ga0070710_1000051410 | 401 |
| 282 | 3300007076 | Ga0075435_100003419 | Ga0075435_1000034195 | 401 |
| 283 | 3300009553 | Ga0105249_10010730 | Ga0105249_100107302 | 401 |
| 284 | 3300025898 | Ga0207692_10008674 | Ga0207692_100086745 | 401 |
| 285 | 3300025961 | Ga0207712_10006888 | Ga0207712_100068887 | 401 |
| 286 | 3300031456 | Ga0307513_10181155 | Ga0307513_101811552 | 401 |
| 287 | 3300031507 | Ga0307509_10015731 | Ga0307509_100157318 | 401 |
| 288 | 3300031507 | Ga0307509_10069425 | Ga0307509_100694253 | 401 |
| 289 | 3300037466 | Ga0395898_0000049 | Ga0395898_0000049_86446_87753 | 401 |
| 290 | 3300044656 | Ga0466969_0002062 | Ga0466969_0002062_3556_4878 | 401 |
| 291 | 3300044658 | Ga0466972_0005704 | Ga0466972_0005704_2261_3562 | 401 |
| 292 | 3300044658 | Ga0466972_0034292 | Ga0466972_0034292_1047_2354 | 401 |
| 293 | 3300044672 | Ga0466982_0000003 | Ga0466982_0000003_393346_394653 | 401 |
| 294 | 3300044683 | Ga0466965_0001591 | Ga0466965_0001591_2088_3389 | 401 |
| 295 | 3300044683 | Ga0466965_0038543 | Ga0466965_0038543_771_2093 | 401 |
| 296 | 3300044684 | Ga0466966_0028158 | Ga0466966_0028158_1504_2811 | 401 |
| 297 | 3300044693 | Ga0466961_0007493 | Ga0466961_0007493_2193_3515 | 401 |
| 298 | 3300044706 | Ga0466964_0005625 | Ga0466964_0005625_2876_4183 | 401 |
| 299 | 3300044719 | Ga0466971_0001735 | Ga0466971_0001735_6371_7678 | 401 |
| 300 | 3300044765 | Ga0466970_0023508 | Ga0466970_0023508_1720_3027 | 401 |
| 301 | 3300044901 | Ga0466960_0000132 | Ga0466960_0000132_7597_8898 | 401 |
| 302 | 3300044901 | Ga0466960_0005384 | Ga0466960_0005384_2853_4160 | 401 |
| 303 | 3300045049 | Ga0466959_0051225 | Ga0466959_0051225_140_1462 | 401 |
| 304 | 3300047472 | Ga0495686_0001176 | Ga0495686_0001176_25868_27154 | 401 |
| 305 | 3300061719 | Ga0466962_0003379 | Ga0466962_0003379_3065_4372 | 401 |
| 306 | iso_pu_bacteria | 2588254257 | 2590613401 | 401 |
| 307 | iso_pu_bacteria | 2596583598 | 2597027985 | 401 |
| 308 | iso_pu_bacteria | 2599185178 | 2599444658 | 401 |
| 309 | iso_pu_bacteria | 2852623160 | 2852624687 | 401 |
| 310 | iso_pu_bacteria | 2881955468 | 2881956350 | 401 |
| 311 | iso_pu_bacteria | 2885266251 | 2885266419 | 401 |
| 312 | iso_pu_bacteria | 2900577576 | 2900580041 | 401 |
| 313 | iso_pu_bacteria | 2928058823 | 2928059796 | 401 |
| 314 | iso_pu_bacteria | 2997600082 | 2997600696 | 401 |
| 315 | 3300001979 | JGI24740J21852_10001793 | JGI24740J21852_100017934 | 402 |
| 316 | 3300001979 | JGI24740J21852_10005576 | JGI24740J21852_100055762 | 402 |
| 317 | 3300001979 | JGI24740J21852_10006495 | JGI24740J21852_100064953 | 402 |
| 318 | 3300001989 | JGI24739J22299_10002030 | JGI24739J22299_100020304 | 402 |
| 319 | 3300002987 | JGI25159J45721_1002626 | JGI25159J45721_10026264 | 402 |
| 320 | 3300003187 | JGI25151J46595_10014371 | JGI25151J46595_100143712 | 402 |
| 321 | 3300003187 | JGI25151J46595_10016138 | JGI25151J46595_100161383 | 402 |
| 322 | 3300003187 | JGI25151J46595_10017907 | JGI25151J46595_100179072 | 402 |
| 323 | 3300003187 | JGI25151J46595_10027517 | JGI25151J46595_100275172 | 402 |
| 324 | 3300003187 | JGI25151J46595_10033087 | JGI25151J46595_100330871 | 402 |
| 325 | 3300003187 | JGI25151J46595_10039002 | JGI25151J46595_100390022 | 402 |
| 326 | 3300003316 | rootH1_10014435 | rootH1_100144357 | 402 |
| 327 | 3300003322 | rootL2_10141361 | rootL2_101413617 | 402 |
| 328 | 3300003578 | Ga0006562J51391_1012222 | Ga0006562J51391_10122221 | 402 |
| 329 | 3300003578 | Ga0006562J51391_1016016 | Ga0006562J51391_10160163 | 402 |
| 330 | 3300003578 | Ga0006562J51391_1016017 | Ga0006562J51391_10160172 | 402 |
| 331 | 3300003758 | Ga0055532_1001906 | Ga0055532_10019064 | 402 |
| 332 | 3300005344 | Ga0070661_100169282 | Ga0070661_1001692822 | 402 |
| 333 | 3300005530 | Ga0070679_100085544 | Ga0070679_1000855442 | 402 |
| 334 | 3300005544 | Ga0070686_100000553 | Ga0070686_10000055321 | 402 |
| 335 | 3300005563 | Ga0068855_100020165 | Ga0068855_1000201656 | 402 |
| 336 | 3300005563 | Ga0068855_100349061 | Ga0068855_1003490612 | 402 |
| 337 | 3300005577 | Ga0068857_100000513 | Ga0068857_1000005136 | 402 |
| 338 | 3300005614 | Ga0068856_100021956 | Ga0068856_1000219567 | 402 |
| 339 | 3300005616 | Ga0068852_100040812 | Ga0068852_1000408122 | 402 |
| 340 | 3300005842 | Ga0068858_100007771 | Ga0068858_1000077716 | 402 |
| 341 | 3300009036 | Ga0105244_10011682 | Ga0105244_100116828 | 402 |
| 342 | 3300009092 | Ga0105250_10000793 | Ga0105250_100007933 | 402 |
| 343 | 3300009093 | Ga0105240_10011125 | Ga0105240_100111253 | 402 |
| 344 | 3300009148 | Ga0105243_10014444 | Ga0105243_100144444 | 402 |
| 345 | 3300009545 | Ga0105237_10000026 | Ga0105237_1000002612 | 402 |
| 346 | 3300009551 | Ga0105238_10018672 | Ga0105238_100186724 | 402 |
| 347 | 3300010159 | Ga0099796_10002492 | Ga0099796_100024923 | 402 |
| 348 | 3300010375 | Ga0105239_10008875 | Ga0105239_100088752 | 402 |
| 349 | 3300012500 | Ga0157314_1000397 | Ga0157314_10003972 | 402 |
| 350 | 3300013104 | Ga0157370_10048771 | Ga0157370_100487713 | 402 |
| 351 | 3300013104 | Ga0157370_10056458 | Ga0157370_100564584 | 402 |
| 352 | 3300013105 | Ga0157369_10224587 | Ga0157369_102245872 | 402 |
| 353 | 3300014326 | Ga0157380_10120027 | Ga0157380_101200272 | 402 |
| 354 | 3300025229 | Ga0209147_100115 | Ga0209147_100115106 | 402 |
| 355 | 3300025258 | Ga0209129_1001768 | Ga0209129_10017683 | 402 |
| 356 | 3300025284 | Ga0209130_1001011 | Ga0209130_10010119 | 402 |
| 357 | 3300025294 | Ga0209025_1000724 | Ga0209025_100072417 | 402 |
| 358 | 3300025294 | Ga0209025_1001437 | Ga0209025_10014379 | 402 |
| 359 | 3300025294 | Ga0209025_1002332 | Ga0209025_10023329 | 402 |
| 360 | 3300025294 | Ga0209025_1005432 | Ga0209025_100543210 | 402 |
| 361 | 3300025294 | Ga0209025_1008485 | Ga0209025_10084852 | 402 |
| 362 | 3300025294 | Ga0209025_1009574 | Ga0209025_10095744 | 402 |
| 363 | 3300025294 | Ga0209025_1010749 | Ga0209025_10107493 | 402 |
| 364 | 3300025294 | Ga0209025_1011402 | Ga0209025_10114024 | 402 |
| 365 | 3300025294 | Ga0209025_1016889 | Ga0209025_10168892 | 402 |
| 366 | 3300025294 | Ga0209025_1017894 | Ga0209025_10178942 | 402 |
| 367 | 3300025294 | Ga0209025_1024984 | Ga0209025_10249845 | 402 |
| 368 | 3300025294 | Ga0209025_1027121 | Ga0209025_10271212 | 402 |
| 369 | 3300025294 | Ga0209025_1036044 | Ga0209025_10360442 | 402 |
| 370 | 3300025294 | Ga0209025_1046600 | Ga0209025_10466001 | 402 |
| 371 | 3300025297 | Ga0209758_1000269 | Ga0209758_100026944 | 402 |
| 372 | 3300025297 | Ga0209758_1000309 | Ga0209758_100030935 | 402 |
| 373 | 3300025711 | Ga0207696_1002900 | Ga0207696_10029002 | 402 |
| 374 | 3300025728 | Ga0207655_1017390 | Ga0207655_10173902 | 402 |
| 375 | 3300025735 | Ga0207713_1023169 | Ga0207713_10231692 | 402 |
| 376 | 3300025735 | Ga0207713_1033299 | Ga0207713_10332991 | 402 |
| 377 | 3300025735 | Ga0207713_1049139 | Ga0207713_10491392 | 402 |
| 378 | 3300025904 | Ga0207647_10027823 | Ga0207647_100278232 | 402 |
| 379 | 3300025913 | Ga0207695_10005571 | Ga0207695_100055717 | 402 |
| 380 | 3300025914 | Ga0207671_10000041 | Ga0207671_10000041176 | 402 |
| 381 | 3300025921 | Ga0207652_10004883 | Ga0207652_100048837 | 402 |
| 382 | 3300025935 | Ga0207709_10000305 | Ga0207709_1000030531 | 402 |
| 383 | 3300025949 | Ga0207667_10000428 | Ga0207667_1000042839 | 402 |
| 384 | 3300025949 | Ga0207667_10276870 | Ga0207667_102768702 | 402 |
| 385 | 3300026035 | Ga0207703_10022204 | Ga0207703_100222042 | 402 |
| 386 | 3300026078 | Ga0207702_10023308 | Ga0207702_100233083 | 402 |
| 387 | 3300026116 | Ga0207674_10000209 | Ga0207674_1000020910 | 402 |
| 388 | 3300027512 | Ga0209179_1002620 | Ga0209179_10026202 | 402 |
| 389 | 3300030083 | Ga0237817_10088 | Ga0237817_100883 | 402 |
| 390 | 3300030083 | Ga0237817_10199 | Ga0237817_101992 | 402 |
| 391 | 3300030083 | Ga0237817_10571 | Ga0237817_105713 | 402 |
| 392 | 3300031548 | Ga0307408_100232652 | Ga0307408_1002326522 | 402 |
| 393 | 3300031731 | Ga0307405_10105375 | Ga0307405_101053752 | 402 |
| 394 | 3300031852 | Ga0307410_10166443 | Ga0307410_101664431 | 402 |
| 395 | 3300031995 | Ga0307409_100005574 | Ga0307409_1000055747 | 402 |
| 396 | 3300032005 | Ga0307411_10005783 | Ga0307411_100057832 | 402 |
| 397 | 3300038705 | Ga0237819_00430 | Ga0237819_00430_1313_2635 | 402 |
| 398 | 3300038705 | Ga0237819_02219 | Ga0237819_02219_1294_2616 | 402 |
| 399 | 3300042007 | Ga0439449_0011729 | Ga0439449_0011729_508_1809 | 402 |
| 400 | 3300042007 | Ga0439449_0020874 | Ga0439449_0020874_1017_2399 | 402 |
| 401 | 3300045976 | Ga0466967_0000281 | Ga0466967_0000281_6049_7371 | 402 |
| 402 | 3300046492 | Ga0495585_0000330 | Ga0495585_0000330_6984_8318 | 402 |
| 403 | 3300046524 | Ga0495648_0007985 | Ga0495648_0007985_3977_5275 | 402 |
| 404 | 3300046538 | Ga0495609_0010947 | Ga0495609_0010947_2551_3849 | 402 |
| 405 | 3300046558 | Ga0495633_0000759 | Ga0495633_0000759_16014_17282 | 402 |
| 406 | 3300046616 | Ga0495668_0000044 | Ga0495668_0000044_128246_129544 | 402 |
| 407 | 3300047315 | Ga0495581_0018902 | Ga0495581_0018902_170_1528 | 402 |
| 408 | 3300048907 | Ga0496104_0040214 | Ga0496104_0040214_2596_3942 | 402 |
| 409 | 3300048909 | Ga0496106_0001233 | Ga0496106_0001233_15388_16734 | 402 |
| 410 | 3300048910 | Ga0496107_0030713 | Ga0496107_0030713_2091_3437 | 402 |
| 411 | 3300048924 | Ga0496121_0005989 | Ga0496121_0005989_665_1972 | 402 |
| 412 | 3300048928 | Ga0496125_0001371 | Ga0496125_0001371_23829_25136 | 402 |
| 413 | 3300048928 | Ga0496125_0025101 | Ga0496125_0025101_2517_3863 | 402 |
| 414 | 3300048929 | Ga0496126_0191073 | Ga0496126_0191073_269_1615 | 402 |
| 415 | 3300049581 | Ga0501047_0011301 | Ga0501047_0011301_6806_8089 | 402 |
| 416 | 3300049823 | Ga0501044_0012022 | Ga0501044_0012022_7459_8742 | 402 |
| 417 | iso_pu_bacteria | 2510917027 | 2511178903 | 402 |
| 418 | iso_pu_bacteria | 2512564013 | 2512636140 | 402 |
| 419 | iso_pu_bacteria | 2512564039 | 2512734027 | 402 |
| 420 | iso_pu_bacteria | 2585428059 | 2587741624 | 402 |
| 421 | iso_pu_bacteria | 2643221676 | 2644428394 | 402 |
| 422 | iso_pu_bacteria | 2643221731 | 2644718451 | 402 |
| 423 | iso_pu_bacteria | 2643221732 | 2644725353 | 402 |
| 424 | iso_pu_bacteria | 2711768088 | 2712199411 | 402 |
| 425 | iso_pu_bacteria | 2738543011 | 2739236906 | 402 |
| 426 | iso_pu_bacteria | 2808606982 | 2811842546 | 402 |
| 427 | iso_pu_bacteria | 2818991465 | 2819707604 | 402 |
| 428 | iso_pu_bacteria | 2842882022 | 2842882072 | 402 |
| 429 | iso_pu_bacteria | 2857465823 | 2857466600 | 402 |
| 430 | iso_pu_bacteria | 2857465823 | 2857470997 | 402 |
| 431 | iso_pu_bacteria | 2857591370 | 2857592625 | 402 |
| 432 | iso_pu_bacteria | 2857591370 | 2857596562 | 402 |
| 433 | iso_pu_bacteria | 2863404153 | 2863409802 | 402 |
| 434 | iso_pu_bacteria | 2864997549 | 2864998437 | 402 |
| 435 | iso_pu_bacteria | 2864997549 | 2865001830 | 402 |
| 436 | iso_pu_bacteria | 2867475112 | 2867479496 | 402 |
| 437 | iso_pu_bacteria | 2884933994 | 2884936426 | 402 |
| 438 | iso_pu_bacteria | 2889300758 | 2889305799 | 402 |
| 439 | iso_pu_bacteria | 2904524088 | 2904527273 | 402 |
| 440 | iso_pu_bacteria | 2915597211 | 2915599962 | 402 |
| 441 | iso_pu_bacteria | 2915606848 | 2915609673 | 402 |
| 442 | iso_pu_bacteria | 2919143609 | 2919144136 | 402 |
| 443 | iso_pu_bacteria | 2919425241 | 2919426379 | 402 |
| 444 | iso_pu_bacteria | 2919517244 | 2919519332 | 402 |
| 445 | iso_pu_bacteria | 2919720352 | 2919720467 | 402 |
| 446 | iso_pu_bacteria | 2928093941 | 2928095762 | 402 |
| 447 | iso_pu_bacteria | 2929004312 | 2929007960 | 402 |
| 448 | iso_pu_bacteria | 2929183550 | 2929185144 | 402 |
| 449 | iso_pu_bacteria | 2939743619 | 2939743935 | 402 |
| 450 | iso_pu_bacteria | 2960319331 | 2960322947 | 402 |
| 451 | iso_pu_bacteria | 2960375949 | 2960381722 | 402 |
| 452 | iso_pu_bacteria | 2980125574 | 2980130510 | 402 |
| 453 | iso_pu_bacteria | 2997451912 | 2997455636 | 402 |
| 454 | iso_pu_bacteria | 3006393351 | 3006399732 | 402 |
| 455 | iso_pu_bacteria | 8004021418 | 8004021736 | 402 |
| 456 | iso_pu_bacteria | 8004021418 | 8004025231 | 402 |
| 457 | iso_pu_bacteria | 8004025490 | 8004026803 | 402 |
| 458 | iso_pu_bacteria | 8022792930 | 8022794952 | 402 |
| 459 | iso_pu_bacteria | 8022893055 | 8022894130 | 402 |
| 460 | iso_pu_bacteria | 8022914991 | 8022915579 | 402 |
| 461 | iso_pu_bacteria | 8053945823 | 8053952940 | 402 |
| 462 | iso_pu_bacteria | 8057582654 | 8057583671 | 402 |
| 463 | 3300001990 | JGI24737J22298_10007765 | JGI24737J22298_100077653 | 403 |
| 464 | 3300003794 | Ga0055531_10001471 | Ga0055531_100014712 | 403 |
| 465 | 3300005338 | Ga0068868_100000063 | Ga0068868_1000000639 | 403 |
| 466 | 3300005578 | Ga0068854_100000612 | Ga0068854_1000006128 | 403 |
| 467 | 3300013307 | Ga0157372_10438725 | Ga0157372_104387251 | 403 |
| 468 | 3300025304 | Ga0209257_1001575 | Ga0209257_10015759 | 403 |
| 469 | 3300025321 | Ga0207656_10004664 | Ga0207656_100046643 | 403 |
| 470 | 3300025933 | Ga0207706_10049700 | Ga0207706_100497003 | 403 |
| 471 | 3300025949 | Ga0207667_10004100 | Ga0207667_1000410018 | 403 |
| 472 | 3300025981 | Ga0207640_10000185 | Ga0207640_100001858 | 403 |
| 473 | 3300026023 | Ga0207677_10000044 | Ga0207677_10000044110 | 403 |
| 474 | 3300031824 | Ga0307413_10061078 | Ga0307413_100610782 | 403 |
| 475 | 3300031852 | Ga0307410_10047646 | Ga0307410_100476462 | 403 |
| 476 | 3300031852 | Ga0307410_10090384 | Ga0307410_100903842 | 403 |
| 477 | 3300031901 | Ga0307406_10058812 | Ga0307406_100588122 | 403 |
| 478 | 3300031911 | Ga0307412_10041379 | Ga0307412_100413792 | 403 |
| 479 | 3300037418 | Ga0395900_0132975 | Ga0395900_0132975_988_2286 | 403 |
| 480 | 3300048925 | Ga0496122_0039799 | Ga0496122_0039799_2237_3553 | 403 |
| 481 | 3300048926 | Ga0496123_0020071 | Ga0496123_0020071_2089_3405 | 403 |
| 482 | 3300048927 | Ga0496124_0151122 | Ga0496124_0151122_111_1427 | 403 |
| 483 | 3300049573 | Ga0501037_0006585 | Ga0501037_0006585_2847_4241 | 403 |
| 484 | 3300049581 | Ga0501047_0020030 | Ga0501047_0020030_199_1593 | 403 |
| 485 | 3300053088 | Ga0500644_0005175 | Ga0500644_0005175_814_2160 | 403 |
| 486 | 3300053104 | Ga0500556_0005972 | Ga0500556_0005972_1937_3265 | 403 |
| 487 | 3300053108 | Ga0500562_000025 | Ga0500562_000025_18013_19359 | 403 |
| 488 | 3300053108 | Ga0500562_001325 | Ga0500562_001325_896_2224 | 403 |
| 489 | 3300053140 | Ga0500573_0000029 | Ga0500573_0000029_1410_2681 | 403 |
| 490 | 3300053153 | Ga0500616_0026195 | Ga0500616_0026195_1570_2880 | 403 |
| 491 | iso_pu_bacteria | 2738541283 | 2738758739 | 403 |
| 492 | iso_pu_bacteria | 2784132109 | 2784473446 | 403 |
| 493 | iso_pu_bacteria | 2870782633 | 2870784970 | 403 |
| 494 | iso_pu_bacteria | 2899359706 | 2899360524 | 403 |
| 495 | iso_pu_bacteria | 2919391150 | 2919392574 | 403 |
| 496 | 3300005293 | Ga0065715_10137322 | Ga0065715_101373222 | 404 |
| 497 | 3300005347 | Ga0070668_100174026 | Ga0070668_1001740262 | 404 |
| 498 | 3300005458 | Ga0070681_10002788 | Ga0070681_1000278812 | 404 |
| 499 | 3300005543 | Ga0070672_100184809 | Ga0070672_1001848091 | 404 |
| 500 | 3300005548 | Ga0070665_100000605 | Ga0070665_10000060522 | 404 |
| 501 | 3300005614 | Ga0068856_100000194 | Ga0068856_1000001944 | 404 |
| 502 | 3300009177 | Ga0105248_10064630 | Ga0105248_100646302 | 404 |
| 503 | 3300013105 | Ga0157369_10104723 | Ga0157369_101047232 | 404 |
| 504 | 3300013306 | Ga0163162_10042644 | Ga0163162_100426443 | 404 |
| 505 | 3300013308 | Ga0157375_10010613 | Ga0157375_100106132 | 404 |
| 506 | 3300014497 | Ga0182008_10057668 | Ga0182008_100576682 | 404 |
| 507 | 3300017792 | Ga0163161_10017243 | Ga0163161_100172434 | 404 |
| 508 | 3300025250 | Ga0209026_1013129 | Ga0209026_10131292 | 404 |
| 509 | 3300025315 | Ga0207697_10014484 | Ga0207697_100144842 | 404 |
| 510 | 3300025912 | Ga0207707_10066580 | Ga0207707_100665802 | 404 |
| 511 | 3300025921 | Ga0207652_10057707 | Ga0207652_100577072 | 404 |
| 512 | 3300025940 | Ga0207691_10056940 | Ga0207691_100569402 | 404 |
| 513 | 3300025941 | Ga0207711_10041090 | Ga0207711_100410902 | 404 |
| 514 | 3300026035 | Ga0207703_10112069 | Ga0207703_101120692 | 404 |
| 515 | 3300026041 | Ga0207639_10120297 | Ga0207639_101202972 | 404 |
| 516 | 3300026067 | Ga0207678_10012155 | Ga0207678_100121558 | 404 |
| 517 | 3300026078 | Ga0207702_10002214 | Ga0207702_1000221414 | 404 |
| 518 | 3300026095 | Ga0207676_10038759 | Ga0207676_100387593 | 404 |
| 519 | 3300027907 | Ga0207428_10002905 | Ga0207428_100029053 | 404 |
| 520 | 3300028379 | Ga0268266_10000394 | Ga0268266_100003942 | 404 |
| 521 | 3300031507 | Ga0307509_10020068 | Ga0307509_100200685 | 404 |
| 522 | 3300032002 | Ga0307416_100109541 | Ga0307416_1001095411 | 404 |
| 523 | 3300041512 | Ga0451853_1495030 | Ga0451853_1495030_7393_8757 | 404 |
| 524 | 3300048910 | Ga0496107_0019708 | Ga0496107_0019708_1609_2886 | 404 |
| 525 | 3300048910 | Ga0496107_0047994 | Ga0496107_0047994_1515_2804 | 404 |
| 526 | 3300048917 | Ga0496114_0022635 | Ga0496114_0022635_2073_3350 | 404 |
| 527 | 3300049571 | Ga0501034_0006142 | Ga0501034_0006142_3132_4517 | 404 |
| 528 | 3300049574 | Ga0501038_0018653 | Ga0501038_0018653_1791_3176 | 404 |
| 529 | 3300049579 | Ga0501043_0001562 | Ga0501043_0001562_9246_10631 | 404 |
| 530 | 3300049580 | Ga0501046_0016647 | Ga0501046_0016647_3445_4830 | 404 |
| 531 | 3300049823 | Ga0501044_0053391 | Ga0501044_0053391_1824_3179 | 404 |
| 532 | iso_pu_bacteria | 2643221559 | 2643816168 | 404 |
| 533 | iso_pu_bacteria | 2643221573 | 2643877973 | 404 |
| 534 | iso_pu_bacteria | 2643221586 | 2643938196 | 404 |
| 535 | iso_pu_bacteria | 2643221612 | 2644077768 | 404 |
| 536 | iso_pu_bacteria | 2643221692 | 2644516408 | 404 |
| 537 | iso_pu_bacteria | 2643221720 | 2644659283 | 404 |
| 538 | iso_pu_bacteria | 2643221727 | 2644695939 | 404 |
| 539 | iso_pu_bacteria | 2643221728 | 2644698621 | 404 |
| 540 | iso_pu_bacteria | 2902048731 | 2902049401 | 404 |
| 541 | iso_pu_bacteria | 8022948649 | 8022952939 | 404 |
| 542 | 3300001915 | JGI24741J21665_1000087 | JGI24741J21665_100008722 | 405 |
| 543 | 3300001979 | JGI24740J21852_10000056 | JGI24740J21852_100000562 | 405 |
| 544 | 3300001979 | JGI24740J21852_10009240 | JGI24740J21852_100092402 | 405 |
| 545 | 3300002239 | JGI24034J26672_10003921 | JGI24034J26672_100039212 | 405 |
| 546 | 3300002705 | JGI25156J39149_1002100 | JGI25156J39149_10021003 | 405 |
| 547 | 3300002705 | JGI25156J39149_1006039 | JGI25156J39149_10060391 | 405 |
| 548 | 3300002738 | JGI25154J39366_1000129 | JGI25154J39366_100012923 | 405 |
| 549 | 3300003752 | Ga0055539_1000081 | Ga0055539_100008170 | 405 |
| 550 | 3300003756 | Ga0055533_1000421 | Ga0055533_10004212 | 405 |
| 551 | 3300003758 | Ga0055532_1000048 | Ga0055532_100004867 | 405 |
| 552 | 3300003759 | Ga0055525_1000273 | Ga0055525_100027343 | 405 |
| 553 | 3300003760 | Ga0055527_1000387 | Ga0055527_10003872 | 405 |
| 554 | 3300003761 | Ga0055535_1000035 | Ga0055535_100003567 | 405 |
| 555 | 3300003762 | Ga0055542_1001297 | Ga0055542_10012972 | 405 |
| 556 | 3300003763 | Ga0055529_1000101 | Ga0055529_1000101104 | 405 |
| 557 | 3300003841 | Ga0055541_1000361 | Ga0055541_10003614 | 405 |
| 558 | 3300005327 | Ga0070658_10200008 | Ga0070658_102000081 | 405 |
| 559 | 3300005337 | Ga0070682_100137867 | Ga0070682_1001378672 | 405 |
| 560 | 3300005347 | Ga0070668_100000021 | Ga0070668_10000002185 | 405 |
| 561 | 3300005347 | Ga0070668_100128748 | Ga0070668_1001287482 | 405 |
| 562 | 3300005355 | Ga0070671_100001059 | Ga0070671_1000010596 | 405 |
| 563 | 3300005366 | Ga0070659_100009872 | Ga0070659_1000098726 | 405 |
| 564 | 3300005455 | Ga0070663_100000024 | Ga0070663_10000002475 | 405 |
| 565 | 3300005548 | Ga0070665_100002698 | Ga0070665_10000269813 | 405 |
| 566 | 3300005548 | Ga0070665_100187375 | Ga0070665_1001873752 | 405 |
| 567 | 3300005564 | Ga0070664_100000022 | Ga0070664_10000002275 | 405 |
| 568 | 3300005577 | Ga0068857_100049989 | Ga0068857_1000499893 | 405 |
| 569 | 3300005578 | Ga0068854_100000336 | Ga0068854_10000033625 | 405 |
| 570 | 3300005614 | Ga0068856_100000049 | Ga0068856_10000004975 | 405 |
| 571 | 3300005617 | Ga0068859_100045965 | Ga0068859_1000459652 | 405 |
| 572 | 3300005617 | Ga0068859_100177419 | Ga0068859_1001774192 | 405 |
| 573 | 3300005719 | Ga0068861_100147690 | Ga0068861_1001476903 | 405 |
| 574 | 3300005841 | Ga0068863_100000043 | Ga0068863_10000004388 | 405 |
| 575 | 3300005843 | Ga0068860_100003820 | Ga0068860_1000038202 | 405 |
| 576 | 3300005844 | Ga0068862_100000125 | Ga0068862_10000012563 | 405 |
| 577 | 3300005844 | Ga0068862_100012533 | Ga0068862_1000125333 | 405 |
| 578 | 3300006931 | Ga0097620_100045965 | Ga0097620_1000459652 | 405 |
| 579 | 3300006931 | Ga0097620_100177419 | Ga0097620_1001774192 | 405 |
| 580 | 3300009093 | Ga0105240_10181760 | Ga0105240_101817602 | 405 |
| 581 | 3300009147 | Ga0114129_10091845 | Ga0114129_100918452 | 405 |
| 582 | 3300009553 | Ga0105249_10008042 | Ga0105249_100080428 | 405 |
| 583 | 3300013100 | Ga0157373_10004557 | Ga0157373_100045572 | 405 |
| 584 | 3300013100 | Ga0157373_10016049 | Ga0157373_100160495 | 405 |
| 585 | 3300013102 | Ga0157371_10000089 | Ga0157371_1000008973 | 405 |
| 586 | 3300013104 | Ga0157370_10000002 | Ga0157370_10000002316 | 405 |
| 587 | 3300013105 | Ga0157369_10006987 | Ga0157369_100069873 | 405 |
| 588 | 3300014326 | Ga0157380_10046066 | Ga0157380_100460663 | 405 |
| 589 | 3300015261 | Ga0182006_1001276 | Ga0182006_100127610 | 405 |
| 590 | 3300015262 | Ga0182007_10007444 | Ga0182007_100074443 | 405 |
| 591 | 3300025224 | Ga0209784_100024 | Ga0209784_100024291 | 405 |
| 592 | 3300025225 | Ga0209566_100018 | Ga0209566_100018291 | 405 |
| 593 | 3300025225 | Ga0209566_100251 | Ga0209566_10025139 | 405 |
| 594 | 3300025226 | Ga0209674_100046 | Ga0209674_10004672 | 405 |
| 595 | 3300025226 | Ga0209674_100135 | Ga0209674_10013565 | 405 |
| 596 | 3300025228 | Ga0209672_100240 | Ga0209672_10024023 | 405 |
| 597 | 3300025229 | Ga0209147_100008 | Ga0209147_10000886 | 405 |
| 598 | 3300025230 | Ga0209563_100039 | Ga0209563_10003972 | 405 |
| 599 | 3300025230 | Ga0209563_101432 | Ga0209563_1014325 | 405 |
| 600 | 3300025242 | Ga0209258_100013 | Ga0209258_10001386 | 405 |
| 601 | 3300025246 | Ga0209646_1000027 | Ga0209646_1000027279 | 405 |
| 602 | 3300025253 | Ga0209677_100024 | Ga0209677_10002470 | 405 |
| 603 | 3300025254 | Ga0209148_1000019 | Ga0209148_1000019373 | 405 |
| 604 | 3300025256 | Ga0209759_1007543 | Ga0209759_10075433 | 405 |
| 605 | 3300025256 | Ga0209759_1009583 | Ga0209759_10095832 | 405 |
| 606 | 3300025272 | Ga0209455_1000042 | Ga0209455_100004286 | 405 |
| 607 | 3300025907 | Ga0207645_10156823 | Ga0207645_101568231 | 405 |
| 608 | 3300025913 | Ga0207695_10004273 | Ga0207695_100042738 | 405 |
| 609 | 3300025913 | Ga0207695_10034300 | Ga0207695_100343003 | 405 |
| 610 | 3300025920 | Ga0207649_10000075 | Ga0207649_100000751 | 405 |
| 611 | 3300025927 | Ga0207687_10074223 | Ga0207687_100742232 | 405 |
| 612 | 3300025931 | Ga0207644_10003552 | Ga0207644_100035523 | 405 |
| 613 | 3300025932 | Ga0207690_10039031 | Ga0207690_100390312 | 405 |
| 614 | 3300025945 | Ga0207679_10000004 | Ga0207679_10000004483 | 405 |
| 615 | 3300025961 | Ga0207712_10000023 | Ga0207712_10000023107 | 405 |
| 616 | 3300025972 | Ga0207668_10001557 | Ga0207668_100015575 | 405 |
| 617 | 3300025981 | Ga0207640_10000084 | Ga0207640_1000008465 | 405 |
| 618 | 3300026067 | Ga0207678_10000012 | Ga0207678_1000001273 | 405 |
| 619 | 3300026078 | Ga0207702_10000020 | Ga0207702_10000020126 | 405 |
| 620 | 3300026088 | Ga0207641_10000031 | Ga0207641_1000003191 | 405 |
| 621 | 3300026116 | Ga0207674_10006196 | Ga0207674_100061969 | 405 |
| 622 | 3300028379 | Ga0268266_10005881 | Ga0268266_100058816 | 405 |
| 623 | 3300028380 | Ga0268265_10000049 | Ga0268265_10000049158 | 405 |
| 624 | 3300028380 | Ga0268265_10081278 | Ga0268265_100812781 | 405 |
| 625 | 3300028381 | Ga0268264_10001904 | Ga0268264_1000190422 | 405 |
| 626 | 3300028381 | Ga0268264_10005865 | Ga0268264_100058652 | 405 |
| 627 | 3300031456 | Ga0307513_10106202 | Ga0307513_101062022 | 405 |
| 628 | 3300031548 | Ga0307408_100029226 | Ga0307408_1000292262 | 405 |
| 629 | 3300031731 | Ga0307405_10110755 | Ga0307405_101107552 | 405 |
| 630 | 3300031903 | Ga0307407_10119100 | Ga0307407_101191002 | 405 |
| 631 | 3300031911 | Ga0307412_10050390 | Ga0307412_100503901 | 405 |
| 632 | 3300031995 | Ga0307409_100112456 | Ga0307409_1001124562 | 405 |
| 633 | 3300032002 | Ga0307416_100041203 | Ga0307416_1000412032 | 405 |
| 634 | 3300032004 | Ga0307414_10058882 | Ga0307414_100588822 | 405 |
| 635 | 3300032005 | Ga0307411_10024840 | Ga0307411_100248402 | 405 |
| 636 | 3300037418 | Ga0395900_0032913 | Ga0395900_0032913_3854_5194 | 405 |
| 637 | 3300041404 | Ga0439436_0001800 | Ga0439436_0001800_4580_5911 | 405 |
| 638 | 3300042004 | Ga0439445_0000005 | Ga0439445_0000005_1918_3204 | 405 |
| 639 | 3300044658 | Ga0466972_0003988 | Ga0466972_0003988_2519_3859 | 405 |
| 640 | 3300044671 | Ga0466978_0002079 | Ga0466978_0002079_3891_5231 | 405 |
| 641 | 3300044693 | Ga0466961_0000354 | Ga0466961_0000354_8157_9497 | 405 |
| 642 | 3300044706 | Ga0466964_0008119 | Ga0466964_0008119_1342_2682 | 405 |
| 643 | 3300044735 | Ga0466968_0031750 | Ga0466968_0031750_713_2053 | 405 |
| 644 | 3300044765 | Ga0466970_0000585 | Ga0466970_0000585_8142_9482 | 405 |
| 645 | 3300044842 | Ga0466957_0108315 | Ga0466957_0108315_314_1654 | 405 |
| 646 | 3300048928 | Ga0496125_0016025 | Ga0496125_0016025_3679_5019 | 405 |
| 647 | 3300053151 | Ga0500604_0000275 | Ga0500604_0000275_11759_13048 | 405 |
| 648 | 3300053739 | Ga0500587_000307 | Ga0500587_000307_1024_2310 | 405 |
| 649 | 3300059643 | Ga0587072_005443 | Ga0587072_005443_27_1367 | 405 |
| 650 | iso_pu_bacteria | 2508501114 | 2509074900 | 405 |
| 651 | iso_pu_bacteria | 2643221574 | 2643883838 | 405 |
| 652 | iso_pu_bacteria | 2643221593 | 2643975409 | 405 |
| 653 | iso_pu_bacteria | 2643221699 | 2644548118 | 405 |
| 654 | iso_pu_bacteria | 2941489479 | 2941490033 | 405 |
| 655 | iso_pu_bacteria | 2995948881 | 2995950410 | 405 |
| 656 | iso_pu_bacteria | 650716007 | 650843651 | 405 |
| 657 | 3300003187 | JGI25151J46595_10001821 | JGI25151J46595_100018212 | 406 |
| 658 | 3300003771 | Ga0055526_1000449 | Ga0055526_100044912 | 406 |
| 659 | 3300003773 | Ga0055537_1000708 | Ga0055537_100070812 | 406 |
| 660 | 3300003775 | Ga0055524_1000947 | Ga0055524_100094713 | 406 |
| 661 | 3300003784 | Ga0055534_1000613 | Ga0055534_100061313 | 406 |
| 662 | 3300003790 | Ga0055528_1000337 | Ga0055528_100033741 | 406 |
| 663 | 3300005335 | Ga0070666_10008338 | Ga0070666_100083386 | 406 |
| 664 | 3300005347 | Ga0070668_100000190 | Ga0070668_10000019030 | 406 |
| 665 | 3300005367 | Ga0070667_100000135 | Ga0070667_10000013512 | 406 |
| 666 | 3300005841 | Ga0068863_100000198 | Ga0068863_10000019833 | 406 |
| 667 | 3300005843 | Ga0068860_100001354 | Ga0068860_1000013547 | 406 |
| 668 | 3300005844 | Ga0068862_100053143 | Ga0068862_1000531432 | 406 |
| 669 | 3300006175 | Ga0070712_100043499 | Ga0070712_1000434994 | 406 |
| 670 | 3300013306 | Ga0163162_10203926 | Ga0163162_102039261 | 406 |
| 671 | 3300015689 | Ga0183360_10001 | Ga0183360_100012684 | 406 |
| 672 | 3300025245 | Ga0207425_1002895 | Ga0207425_10028952 | 406 |
| 673 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000011193 | 406 |
| 674 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000011193 | 406 |
| 675 | 3300025291 | Ga0209675_1000001 | Ga0209675_10000011340 | 406 |
| 676 | 3300025294 | Ga0209025_1000036 | Ga0209025_100003628 | 406 |
| 677 | 3300025295 | Ga0209564_1000001 | Ga0209564_10000011502 | 406 |
| 678 | 3300025299 | Ga0209256_1000002 | Ga0209256_100000251 | 406 |
| 679 | 3300025903 | Ga0207680_10001069 | Ga0207680_100010696 | 406 |
| 680 | 3300025986 | Ga0207658_10000101 | Ga0207658_1000010112 | 406 |
| 681 | 3300026088 | Ga0207641_10000046 | Ga0207641_1000004630 | 406 |
| 682 | 3300026118 | Ga0207675_100095286 | Ga0207675_1000952862 | 406 |
| 683 | 3300028381 | Ga0268264_10007684 | Ga0268264_100076846 | 406 |
| 684 | 3300031901 | Ga0307406_10011507 | Ga0307406_100115072 | 406 |
| 685 | 3300031901 | Ga0307406_10024964 | Ga0307406_100249642 | 406 |
| 686 | 3300039447 | Ga0436361_0587792 | Ga0436361_0587792_896_2224 | 406 |
| 687 | 3300041407 | Ga0439447_001376 | Ga0439447_001376_1676_3004 | 406 |
| 688 | 3300046471 | Ga0495650_0002326 | Ga0495650_0002326_7744_9048 | 406 |
| 689 | 3300046501 | Ga0495607_0009844 | Ga0495607_0009844_2569_3861 | 406 |
| 690 | 3300046525 | Ga0495663_0016250 | Ga0495663_0016250_292_1620 | 406 |
| 691 | 3300046529 | Ga0495652_0027948 | Ga0495652_0027948_247_1575 | 406 |
| 692 | 3300046536 | Ga0495587_0103598 | Ga0495587_0103598_244_1572 | 406 |
| 693 | 3300046616 | Ga0495668_0002177 | Ga0495668_0002177_7638_9038 | 406 |
| 694 | 3300048924 | Ga0496121_0031186 | Ga0496121_0031186_658_1986 | 406 |
| 695 | 3300049573 | Ga0501037_0020025 | Ga0501037_0020025_929_2287 | 406 |
| 696 | 3300049580 | Ga0501046_0000033 | Ga0501046_0000033_21639_22970 | 406 |
| 697 | 3300050515 | nmdc:mga0a205_306844_c1 | nmdc:mga0a205_306844_c1_13_1323 | 406 |
| 698 | 3300053085 | Ga0495619_0067857 | Ga0495619_0067857_950_2278 | 406 |
| 699 | 3300053096 | Ga0500641_0000769 | Ga0500641_0000769_4791_6077 | 406 |
| 700 | 3300005937 | Ga0081455_10000066 | Ga0081455_1000006651 | 407 |
| 701 | 3300006844 | Ga0075428_100095951 | Ga0075428_1000959512 | 407 |
| 702 | 3300006844 | Ga0075428_100128370 | Ga0075428_1001283702 | 407 |
| 703 | 3300009094 | Ga0111539_10030317 | Ga0111539_100303178 | 407 |
| 704 | 3300031251 | Ga0265327_10001610 | Ga0265327_1000161016 | 407 |
| 705 | 3300046694 | Ga0495649_0006051 | Ga0495649_0006051_4719_6008 | 407 |
| 706 | 3300049572 | Ga0501036_0053029 | Ga0501036_0053029_926_2254 | 407 |
| 707 | 3300049576 | Ga0501040_0008279 | Ga0501040_0008279_480_1808 | 407 |
| 708 | 3300049579 | Ga0501043_0079939 | Ga0501043_0079939_908_2236 | 407 |
| 709 | 3300049580 | Ga0501046_0021415 | Ga0501046_0021415_1000_2328 | 407 |
| 710 | 3300049582 | Ga0501048_0019298 | Ga0501048_0019298_1384_2712 | 407 |
| 711 | 3300049588 | Ga0501072_0004575 | Ga0501072_0004575_4913_6241 | 407 |
| 712 | 3300049591 | Ga0501075_0094614 | Ga0501075_0094614_382_1710 | 407 |
| 713 | 3300049592 | Ga0501076_0007578 | Ga0501076_0007578_5331_6659 | 407 |
| 714 | 3300049741 | Ga0501079_0024540 | Ga0501079_0024540_1291_2619 | 407 |
| 715 | 3300049824 | Ga0501045_0021883 | Ga0501045_0021883_1045_2373 | 407 |
| 716 | 3300053087 | Ga0500643_000233 | Ga0500643_000233_42107_43447 | 407 |
| 717 | 3300053096 | Ga0500641_0001800 | Ga0500641_0001800_5966_7306 | 407 |
| 718 | 3300053108 | Ga0500562_018163 | Ga0500562_018163_137_1477 | 407 |
| 719 | 3300053153 | Ga0500616_0054945 | Ga0500616_0054945_250_1590 | 407 |
| 720 | 3300053156 | Ga0500622_0020235 | Ga0500622_0020235_246_1586 | 407 |
| 721 | 3300053156 | Ga0500622_0023574 | Ga0500622_0023574_221_1561 | 407 |
| 722 | 3300053730 | Ga0500645_000517 | Ga0500645_000517_20213_21553 | 407 |
| 723 | iso_pu_bacteria | 2554235003 | 2554244944 | 407 |
| 724 | iso_pu_bacteria | 2558860242 | 2559297222 | 407 |
| 725 | iso_pu_bacteria | 2558860983 | 2561466452 | 407 |
| 726 | iso_pu_bacteria | 2643221582 | 2643921764 | 407 |
| 727 | iso_pu_bacteria | 2643221693 | 2644519733 | 407 |
| 728 | iso_pu_bacteria | 2808606387 | 2808988820 | 407 |
| 729 | iso_pu_bacteria | 2899845264 | 2899850500 | 407 |
| 730 | iso_pu_bacteria | 2926760298 | 2926764190 | 407 |
| 731 | iso_pu_bacteria | 2979089926 | 2979090711 | 407 |
| 732 | iso_pu_bacteria | 2979095461 | 2979096234 | 407 |
| 733 | iso_pu_bacteria | 8003570095 | 8003574086 | 407 |
| 734 | iso_pu_bacteria | 8057101203 | 8057103875 | 407 |
| 735 | 3300005328 | Ga0070676_10001841 | Ga0070676_100018414 | 408 |
| 736 | 3300005347 | Ga0070668_100001427 | Ga0070668_10000142713 | 408 |
| 737 | 3300005353 | Ga0070669_100044684 | Ga0070669_1000446842 | 408 |
| 738 | 3300005353 | Ga0070669_100103876 | Ga0070669_1001038762 | 408 |
| 739 | 3300005364 | Ga0070673_100048531 | Ga0070673_1000485312 | 408 |
| 740 | 3300005367 | Ga0070667_100008061 | Ga0070667_1000080614 | 408 |
| 741 | 3300005530 | Ga0070679_100101575 | Ga0070679_1001015752 | 408 |
| 742 | 3300005543 | Ga0070672_100014855 | Ga0070672_1000148552 | 408 |
| 743 | 3300005548 | Ga0070665_100001611 | Ga0070665_10000161123 | 408 |
| 744 | 3300005548 | Ga0070665_100119808 | Ga0070665_1001198082 | 408 |
| 745 | 3300005549 | Ga0070704_100176648 | Ga0070704_1001766482 | 408 |
| 746 | 3300005617 | Ga0068859_100188297 | Ga0068859_1001882972 | 408 |
| 747 | 3300005617 | Ga0068859_100205476 | Ga0068859_1002054761 | 408 |
| 748 | 3300005842 | Ga0068858_100038243 | Ga0068858_1000382432 | 408 |
| 749 | 3300005844 | Ga0068862_100002747 | Ga0068862_10000274713 | 408 |
| 750 | 3300006358 | Ga0068871_100039365 | Ga0068871_1000393652 | 408 |
| 751 | 3300006852 | Ga0075433_10013939 | Ga0075433_100139397 | 408 |
| 752 | 3300006931 | Ga0097620_100188301 | Ga0097620_1001883012 | 408 |
| 753 | 3300006931 | Ga0097620_100205475 | Ga0097620_1002054752 | 408 |
| 754 | 3300009093 | Ga0105240_10012181 | Ga0105240_100121816 | 408 |
| 755 | 3300009147 | Ga0114129_10171564 | Ga0114129_101715643 | 408 |
| 756 | 3300009177 | Ga0105248_10119095 | Ga0105248_101190952 | 408 |
| 757 | 3300013306 | Ga0163162_10239912 | Ga0163162_102399121 | 408 |
| 758 | 3300013308 | Ga0157375_10142766 | Ga0157375_101427662 | 408 |
| 759 | 3300025735 | Ga0207713_1013296 | Ga0207713_10132963 | 408 |
| 760 | 3300025907 | Ga0207645_10006422 | Ga0207645_100064224 | 408 |
| 761 | 3300025919 | Ga0207657_10088710 | Ga0207657_100887102 | 408 |
| 762 | 3300025921 | Ga0207652_10121023 | Ga0207652_101210232 | 408 |
| 763 | 3300025923 | Ga0207681_10016295 | Ga0207681_100162952 | 408 |
| 764 | 3300025923 | Ga0207681_10041246 | Ga0207681_100412462 | 408 |
| 765 | 3300025933 | Ga0207706_10235738 | Ga0207706_102357382 | 408 |
| 766 | 3300025940 | Ga0207691_10057571 | Ga0207691_100575713 | 408 |
| 767 | 3300025941 | Ga0207711_10028891 | Ga0207711_100288913 | 408 |
| 768 | 3300025944 | Ga0207661_10066150 | Ga0207661_100661502 | 408 |
| 769 | 3300025960 | Ga0207651_10112554 | Ga0207651_101125542 | 408 |
| 770 | 3300025972 | Ga0207668_10000070 | Ga0207668_100000707 | 408 |
| 771 | 3300025986 | Ga0207658_10007909 | Ga0207658_100079093 | 408 |
| 772 | 3300026067 | Ga0207678_10073669 | Ga0207678_100736692 | 408 |
| 773 | 3300026088 | Ga0207641_10143612 | Ga0207641_101436122 | 408 |
| 774 | 3300026116 | Ga0207674_10051941 | Ga0207674_100519412 | 408 |
| 775 | 3300028379 | Ga0268266_10083270 | Ga0268266_100832702 | 408 |
| 776 | 3300028380 | Ga0268265_10000770 | Ga0268265_100007708 | 408 |
| 777 | 3300031251 | Ga0265327_10002591 | Ga0265327_1000259119 | 408 |
| 778 | 3300046460 | Ga0495638_0000204 | Ga0495638_0000204_27945_29321 | 408 |
| 779 | 3300046506 | Ga0495583_0000349 | Ga0495583_0000349_15088_16455 | 408 |
| 780 | 3300046519 | Ga0495632_0001269 | Ga0495632_0001269_7919_9301 | 408 |
| 781 | 3300046524 | Ga0495648_0000212 | Ga0495648_0000212_10322_11698 | 408 |
| 782 | 3300046530 | Ga0495654_0025510 | Ga0495654_0025510_514_1932 | 408 |
| 783 | 3300046558 | Ga0495633_0033078 | Ga0495633_0033078_121_1488 | 408 |
| 784 | 3300046692 | Ga0495671_0000060 | Ga0495671_0000060_54937_56304 | 408 |
| 785 | 3300047469 | Ga0495673_0000088 | Ga0495673_0000088_54937_56304 | 408 |
| 786 | 3300047472 | Ga0495686_0000273 | Ga0495686_0000273_88184_89491 | 408 |
| 787 | 3300047472 | Ga0495686_0001454 | Ga0495686_0001454_16094_17428 | 408 |
| 788 | 3300048905 | Ga0496102_0146479 | Ga0496102_0146479_137_1543 | 408 |
| 789 | 3300048925 | Ga0496122_0010437 | Ga0496122_0010437_1478_2764 | 408 |
| 790 | 3300048926 | Ga0496123_0006380 | Ga0496123_0006380_5281_6567 | 408 |
| 791 | 3300049583 | Ga0501067_0008656 | Ga0501067_0008656_4326_5618 | 408 |
| 792 | 3300049586 | Ga0501070_0052359 | Ga0501070_0052359_1067_2365 | 408 |
| 793 | 3300050492 | nmdc:mga0yw44_5052_c1 | nmdc:mga0yw44_5052_c1_4607_6055 | 408 |
| 794 | 3300050515 | nmdc:mga0a205_39985_c1 | nmdc:mga0a205_39985_c1_2143_3471 | 408 |
| 795 | 3300053122 | Ga0500608_061213 | Ga0500608_061213_371_1699 | 408 |
| 796 | 3300053130 | Ga0500642_0017740 | Ga0500642_0017740_1333_2655 | 408 |
| 797 | 3300053153 | Ga0500616_0000042 | Ga0500616_0000042_140932_142326 | 408 |
| 798 | 3300053153 | Ga0500616_0030689 | Ga0500616_0030689_255_1613 | 408 |
| 799 | 3300053730 | Ga0500645_005247 | Ga0500645_005247_2209_3543 | 408 |
| 800 | iso_pu_bacteria | 2554235469 | 2556065743 | 408 |
| 801 | 3300003781 | Ga0055536_1000601 | Ga0055536_100060111 | 409 |
| 802 | 3300005331 | Ga0070670_100052714 | Ga0070670_1000527143 | 409 |
| 803 | 3300005338 | Ga0068868_100088472 | Ga0068868_1000884722 | 409 |
| 804 | 3300005339 | Ga0070660_100152744 | Ga0070660_1001527442 | 409 |
| 805 | 3300005344 | Ga0070661_100006605 | Ga0070661_1000066056 | 409 |
| 806 | 3300005355 | Ga0070671_100001896 | Ga0070671_10000189614 | 409 |
| 807 | 3300005355 | Ga0070671_100050167 | Ga0070671_1000501673 | 409 |
| 808 | 3300005364 | Ga0070673_100042809 | Ga0070673_1000428092 | 409 |
| 809 | 3300005367 | Ga0070667_100009598 | Ga0070667_1000095984 | 409 |
| 810 | 3300005436 | Ga0070713_100067249 | Ga0070713_1000672493 | 409 |
| 811 | 3300005445 | Ga0070708_100149719 | Ga0070708_1001497192 | 409 |
| 812 | 3300005456 | Ga0070678_100018605 | Ga0070678_1000186052 | 409 |
| 813 | 3300005456 | Ga0070678_100027141 | Ga0070678_1000271412 | 409 |
| 814 | 3300005456 | Ga0070678_100237540 | Ga0070678_1002375402 | 409 |
| 815 | 3300005539 | Ga0068853_100153787 | Ga0068853_1001537872 | 409 |
| 816 | 3300005543 | Ga0070672_100190098 | Ga0070672_1001900982 | 409 |
| 817 | 3300005548 | Ga0070665_100015939 | Ga0070665_1000159394 | 409 |
| 818 | 3300005564 | Ga0070664_100000247 | Ga0070664_10000024713 | 409 |
| 819 | 3300005578 | Ga0068854_100011735 | Ga0068854_1000117352 | 409 |
| 820 | 3300005618 | Ga0068864_100004493 | Ga0068864_10000449312 | 409 |
| 821 | 3300005841 | Ga0068863_100014397 | Ga0068863_1000143973 | 409 |
| 822 | 3300005842 | Ga0068858_100064195 | Ga0068858_1000641952 | 409 |
| 823 | 3300005844 | Ga0068862_100005128 | Ga0068862_1000051283 | 409 |
| 824 | 3300005844 | Ga0068862_100108709 | Ga0068862_1001087092 | 409 |
| 825 | 3300006358 | Ga0068871_100059716 | Ga0068871_1000597163 | 409 |
| 826 | 3300006871 | Ga0075434_100019256 | Ga0075434_1000192564 | 409 |
| 827 | 3300009177 | Ga0105248_10001586 | Ga0105248_100015863 | 409 |
| 828 | 3300009177 | Ga0105248_10363368 | Ga0105248_103633681 | 409 |
| 829 | 3300009553 | Ga0105249_10267942 | Ga0105249_102679422 | 409 |
| 830 | 3300014968 | Ga0157379_10121279 | Ga0157379_101212792 | 409 |
| 831 | 3300021388 | Ga0213875_10000415 | Ga0213875_1000041514 | 409 |
| 832 | 3300025292 | Ga0209676_1000046 | Ga0209676_100004647 | 409 |
| 833 | 3300025292 | Ga0209676_1008056 | Ga0209676_10080561 | 409 |
| 834 | 3300025304 | Ga0209257_1001711 | Ga0209257_10017115 | 409 |
| 835 | 3300025920 | Ga0207649_10006407 | Ga0207649_100064072 | 409 |
| 836 | 3300025931 | Ga0207644_10002127 | Ga0207644_100021272 | 409 |
| 837 | 3300025931 | Ga0207644_10057746 | Ga0207644_100577462 | 409 |
| 838 | 3300025931 | Ga0207644_10072288 | Ga0207644_100722881 | 409 |
| 839 | 3300025933 | Ga0207706_10201075 | Ga0207706_102010752 | 409 |
| 840 | 3300025941 | Ga0207711_10004220 | Ga0207711_100042204 | 409 |
| 841 | 3300025960 | Ga0207651_10138127 | Ga0207651_101381272 | 409 |
| 842 | 3300025960 | Ga0207651_10153111 | Ga0207651_101531112 | 409 |
| 843 | 3300025981 | Ga0207640_10008681 | Ga0207640_100086813 | 409 |
| 844 | 3300025986 | Ga0207658_10010752 | Ga0207658_100107523 | 409 |
| 845 | 3300026035 | Ga0207703_10014421 | Ga0207703_100144212 | 409 |
| 846 | 3300026067 | Ga0207678_10013054 | Ga0207678_100130547 | 409 |
| 847 | 3300026067 | Ga0207678_10033439 | Ga0207678_100334393 | 409 |
| 848 | 3300026088 | Ga0207641_10011350 | Ga0207641_100113502 | 409 |
| 849 | 3300026095 | Ga0207676_10002924 | Ga0207676_100029244 | 409 |
| 850 | 3300026116 | Ga0207674_10178300 | Ga0207674_101783002 | 409 |
| 851 | 3300026121 | Ga0207683_10028424 | Ga0207683_100284242 | 409 |
| 852 | 3300026121 | Ga0207683_10071144 | Ga0207683_100711442 | 409 |
| 853 | 3300028380 | Ga0268265_10005055 | Ga0268265_100050555 | 409 |
| 854 | 3300031995 | Ga0307409_100048247 | Ga0307409_1000482472 | 409 |
| 855 | 3300032004 | Ga0307414_10075548 | Ga0307414_100755482 | 409 |
| 856 | 3300032005 | Ga0307411_10051340 | Ga0307411_100513402 | 409 |
| 857 | 3300032126 | Ga0307415_100091882 | Ga0307415_1000918822 | 409 |
| 858 | 3300032126 | Ga0307415_100140151 | Ga0307415_1001401512 | 409 |
| 859 | 3300037312 | Ga0395899_0095812 | Ga0395899_0095812_23_1318 | 409 |
| 860 | 3300037418 | Ga0395900_0010269 | Ga0395900_0010269_2847_4142 | 409 |
| 861 | 3300037466 | Ga0395898_0020197 | Ga0395898_0020197_212_1507 | 409 |
| 862 | 3300037471 | Ga0395905_0019542 | Ga0395905_0019542_645_1940 | 409 |
| 863 | 3300037471 | Ga0395905_0156248 | Ga0395905_0156248_765_2060 | 409 |
| 864 | 3300037853 | Ga0436364_1487636 | Ga0436364_1487636_15676_17028 | 409 |
| 865 | 3300044683 | Ga0466965_0116846 | Ga0466965_0116846_47_1342 | 409 |
| 866 | 3300045051 | Ga0451576_0009411 | Ga0451576_0009411_5166_6506 | 409 |
| 867 | 3300046684 | Ga0495669_0005899 | Ga0495669_0005899_2310_3605 | 409 |
| 868 | 3300048911 | Ga0496108_0011078 | Ga0496108_0011078_3443_4759 | 409 |
| 869 | 3300048912 | Ga0496109_0016098 | Ga0496109_0016098_2791_4107 | 409 |
| 870 | 3300048915 | Ga0496112_0008439 | Ga0496112_0008439_4572_5888 | 409 |
| 871 | 3300048916 | Ga0496113_0004212 | Ga0496113_0004212_6437_7753 | 409 |
| 872 | 3300048924 | Ga0496121_0015828 | Ga0496121_0015828_5573_6979 | 409 |
| 873 | 3300049669 | Ga0501235_005002 | Ga0501235_005002_1075_2370 | 409 |
| 874 | 3300049669 | Ga0501235_012406 | Ga0501235_012406_286_1581 | 409 |
| 875 | 3300049679 | Ga0501249_015084 | Ga0501249_015084_331_1626 | 409 |
| 876 | 3300049705 | Ga0501225_0017211 | Ga0501225_0017211_364_1659 | 409 |
| 877 | 3300049765 | Ga0501268_002017 | Ga0501268_002017_838_2133 | 409 |
| 878 | 3300053119 | Ga0500595_002777 | Ga0500595_002777_2914_4236 | 409 |
| 879 | 3300053156 | Ga0500622_0001865 | Ga0500622_0001865_2077_3423 | 409 |
| 880 | 3300053162 | Ga0500638_002144 | Ga0500638_002144_3914_5236 | 409 |
| 881 | 3300053178 | Ga0500637_0000954 | Ga0500637_0000954_5714_7036 | 409 |
| 882 | 3300005289 | Ga0065704_10073281 | Ga0065704_100732816 | 410 |
| 883 | 3300025919 | Ga0207657_10014188 | Ga0207657_100141882 | 410 |
| 884 | 3300031901 | Ga0307406_10001562 | Ga0307406_100015626 | 410 |
| 885 | 3300032005 | Ga0307411_10039330 | Ga0307411_100393302 | 410 |
| 886 | 3300001904 | JGI24736J21556_1000571 | JGI24736J21556_10005712 | 411 |
| 887 | 3300001979 | JGI24740J21852_10000604 | JGI24740J21852_100006045 | 411 |
| 888 | 3300002075 | JGI24738J21930_10001279 | JGI24738J21930_100012793 | 411 |
| 889 | 3300009101 | Ga0105247_10100907 | Ga0105247_101009071 | 411 |
| 890 | 3300009174 | Ga0105241_10005021 | Ga0105241_1000502111 | 411 |
| 891 | 3300009553 | Ga0105249_10000015 | Ga0105249_10000015178 | 411 |
| 892 | 3300025900 | Ga0207710_10057943 | Ga0207710_100579432 | 411 |
| 893 | 3300027866 | Ga0209813_10000397 | Ga0209813_100003978 | 411 |
| 894 | 3300031911 | Ga0307412_10001834 | Ga0307412_100018346 | 411 |
| 895 | 3300037312 | Ga0395899_0000610 | Ga0395899_0000610_31491_32846 | 411 |
| 896 | 3300037418 | Ga0395900_0000301 | Ga0395900_0000301_4479_5834 | 411 |
| 897 | 3300037466 | Ga0395898_0000504 | Ga0395898_0000504_4465_5820 | 411 |
| 898 | 3300037471 | Ga0395905_0004579 | Ga0395905_0004579_8472_9827 | 411 |
| 899 | 3300038443 | Ga0395901_0000197 | Ga0395901_0000197_5172_6527 | 411 |
| 900 | 3300047472 | Ga0495686_0002443 | Ga0495686_0002443_8458_9819 | 411 |
| 901 | 3300048927 | Ga0496124_0000191 | Ga0496124_0000191_78144_79493 | 411 |
| 902 | 3300053153 | Ga0500616_0000293 | Ga0500616_0000293_59330_60646 | 411 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6h7d-assembly1.cif.gz_A | crystal structure of a. thaliana sugar transport protein 10 in complex with glucose in the outward occluded state | 0.7978 | 9 | 403 |
| 6h7d-assembly1.cif.gz_A | crystal structure of a. thaliana sugar transport protein 10 in complex with glucose in the outward occluded state | 0.7678 | 9 | 403 |
| 6rw3-assembly3.cif.gz_C | the molecular basis for sugar import in malaria parasites. | 0.7618 | 11 | 403 |
| 8hpj-assembly1.cif.gz_A | crystal structure of the bacterial oxalate transporter oxlt in a ligand-free outward-facing form | 0.7601 | 11 | 396 |
| 7spt-assembly1.cif.gz_A | crystal structure of exofacial state human glucose transporter glut3 | 0.7504 | 12 | 403 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0K4_17_228_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.96 | 15 | 214 | 1.20.1250.20 |
| af_P0AEX3_19_432_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9392 | 13 | 400 | 1.20.1250.20 |
| af_I6XHB8_22_443_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9387 | 17 | 401 | 1.20.1250.20 |
| af_A0A1D6LG74_1_148_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9385 | 56 | 216 | 1.20.1250.20 |
| af_P37643_22_237_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9291 | 12 | 215 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A556C2H5-F1-model_v4 | Putative proline/betaine transporter | 0.9562 | 11 | 408 |
GO:0005886
GO:0015293 |
| AF-A0A6I5J5R6-F1-model_v4 | deleted | 0.9559 | 11 | 408 |
|
| AF-A0A6N6S6W7-F1-model_v4 | MHS family MFS transporter | 0.9551 | 11 | 407 |
GO:0005886
GO:0015293 |
| AF-A0A1H6BNI7-F1-model_v4 | deleted | 0.9547 | 11 | 408 |
|
| AF-A0A7W7X4H8-F1-model_v4 | deleted | 0.9546 | 11 | 408 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar