F485210

General Info

Members Datasets Scaffolds Average Seq Length
902 494 774 433

Family's Representative Sequence

Representative Sequence 3300025735|Ga0207713_1013296|Ga0207713_10132963
Length 505
Sequence MNYSTFFKRSHYINNWLNRFYRKQYNLAVKKDLLVNYLLLHVTGEPTLNTQRKEGSLMAHTSEAANNRRVTSNIFKGSVGNLIEWYDWYVYSAFAVYFSSQFFPEGDPTSQLLNTAAIFAVGFLMRPIGSLLMGRYADRYGRRAALTLSITIMASGSLIIACTPSYSTIGLLSPIILVLARLLQGISLGGEYGTSATYLSEMASSGRRGFYSSFQYVTLVAGQLVALGVQIILQNVLSEADMISWGWRIPFVIGAIGALSVLWLRRTMDESEQFSKMDSESRENAGTIKALMKHPKAVLTVIGLTLGGTVAFYTYTTYLQKFMVNSVGLDKGVVSWINFCALLVFVVIQPIAGMLSDKIGRRPLLMSFGILGTLLTVPLFLFMKQAHNPVMAFLLMTVGLIIVTGYTSINAIVKAELFPTEIRALGVGLPYGLTVAIFGGTAEFIALWLKSIGHESIFFFYVAGCIAISFLVYWRMGESSKDSYIESELKTDDKGDNVPPNNISF

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
3 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
4 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
5 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
6 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
7 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
8 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
9 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
10 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
11 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
12 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
13 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
14 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
15 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
16 2643221559 Lysobacter sp. Root559 Isolate Unclassified
17 2643221573 Lysobacter sp. Root604 Isolate Unclassified
18 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
19 2643221582 Rhizobium sp. Root651 Isolate Unclassified
20 2643221586 Lysobacter sp. Root667 Isolate Unclassified
21 2643221593 Lysobacter sp. Root690 Isolate Unclassified
22 2643221612 Lysobacter sp. Root76 Isolate Unclassified
23 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
24 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
25 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
26 2643221692 Nocardia sp. Root136 Isolate Unclassified
27 2643221693 Rhizobium sp. Root491 Isolate Unclassified
28 2643221695 Lysobacter sp. Root494 Isolate Unclassified
29 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
30 2643221720 Lysobacter sp. Root916 Isolate Unclassified
31 2643221727 Lysobacter sp. Root96 Isolate Unclassified
32 2643221728 Lysobacter sp. Root983 Isolate Unclassified
33 2643221729 Bacillus sp. Root11 Isolate Unclassified
34 2643221730 Bacillus sp. Root131 Isolate Unclassified
35 2643221731 Bacillus sp. Root147 Isolate Unclassified
36 2643221732 Bacillus sp. Root239 Isolate Unclassified
37 2684622632 Bacillus cereus 905 Isolate Unclassified
38 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
39 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
40 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
41 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
42 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
43 2738541283 Pedobacter sp. OK701 Isolate Unclassified
44 2738541284 Pedobacter sp. YR016 Isolate Unclassified
45 2738541358 Bacillus sp. OV752 Isolate Unclassified
46 2738543006 Bacillus sp. OK077 Isolate Unclassified
47 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
48 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
49 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
50 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
51 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
52 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
53 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
54 2842882022 Bacillus sp. R-71893 Isolate Unclassified
55 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
56 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
57 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
58 2858438669 Leuconostoc mesenteroides YL48 Isolate Unclassified
59 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
60 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
61 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
62 2867475112 Streptomyces sp. TM32 Isolate Unclassified
63 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
64 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
65 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
66 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
67 2885266251 Ralstonia sp. SET104 Isolate Nodule
68 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
69 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
70 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
71 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
72 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
73 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
74 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
75 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
76 2914759650 Rhizosphaericola mali Isolate Rhizosphere
77 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
78 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
79 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
80 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
81 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
82 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
83 2919720352 Priestia megaterium 4340 Isolate Unclassified
84 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
85 2928058823 Ralstonia sp. 1138 Isolate Unclassified
86 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
87 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere
88 2929004312 Priestia megaterium 1104 Isolate Unclassified
89 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
90 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
91 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
92 2938917290 Bacillus sp. CR71 Isolate Unclassified
93 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
94 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
95 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
96 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
97 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
98 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
99 2965761152 Bacillus sp. COPE52 Isolate Unclassified
100 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
101 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
102 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
103 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
104 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
105 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
106 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
107 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
108 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
109 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
110 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
111 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
112 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
113 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
114 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
115 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
116 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
117 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
118 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
119 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
120 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
121 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
122 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
123 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
124 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
125 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
126 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
127 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
128 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
129 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
130 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
131 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
132 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
133 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
134 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
135 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
136 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
137 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
138 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
139 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
140 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
141 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
142 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
143 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
144 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
145 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
146 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
147 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
148 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
149 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
150 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
151 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
152 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
153 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
154 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
155 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
156 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
157 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
158 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
159 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
160 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
161 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
162 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
163 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
164 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
165 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
166 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
167 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
168 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
169 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
170 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
171 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
172 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
173 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
174 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
175 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
176 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
177 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
178 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
179 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
180 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
181 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
182 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
183 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
184 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
185 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
186 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
187 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
188 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
189 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
190 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
191 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
192 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
193 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
194 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
195 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
196 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
197 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
198 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
199 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
200 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
201 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
202 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
203 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
204 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
205 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
206 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
207 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
208 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
209 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
210 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
211 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
212 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
213 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
214 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
215 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
216 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
217 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
218 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
219 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
220 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
221 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
222 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
223 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
224 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
225 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
226 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
227 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
228 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
229 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
230 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
231 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
232 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
233 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
234 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
235 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
236 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
237 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
238 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
239 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
240 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
241 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
242 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
243 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
244 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
252 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
253 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
254 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
257 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
258 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
259 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
261 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
262 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
263 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
265 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
266 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
267 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
268 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
269 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
325 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
326 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
330 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
331 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
332 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
333 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
334 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
335 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
336 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
337 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
338 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
339 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
340 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
341 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
342 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
343 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
344 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
345 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
346 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
347 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
348 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
349 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
350 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
351 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
352 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
353 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
354 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
355 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
356 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
357 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
358 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
359 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
360 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
361 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
362 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
363 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
364 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
365 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
366 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
367 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
368 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
369 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
370 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
371 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
372 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
373 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
374 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
375 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
376 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
377 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
378 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
379 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
380 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
381 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
382 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
383 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
384 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
385 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
386 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
387 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
388 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
389 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
390 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
391 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
392 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
393 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
394 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
395 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
396 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
397 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
398 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
399 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
400 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
401 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
402 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
403 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
404 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
405 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
406 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
407 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
408 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
409 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
410 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
411 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
412 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
413 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
414 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
415 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
416 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
417 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
418 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
419 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
420 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
421 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
422 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
423 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
424 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
425 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
426 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
427 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
428 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
438 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
439 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
440 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
441 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
442 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
443 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
444 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
445 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
446 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
447 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
448 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
449 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
450 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
452 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
453 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
454 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
455 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
456 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
457 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
458 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
459 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
460 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
461 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
462 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
463 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
464 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
465 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
466 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
467 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
468 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
469 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
470 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
471 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
472 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
473 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
474 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
475 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
476 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
477 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
479 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
480 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
481 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
482 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
483 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
484 8022792930 Bacillus sp. Xin Isolate Rhizosphere
485 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
486 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
487 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
488 8023438354 Bacillus sp. BH2 Isolate Unclassified
489 8023444577 Bacillus sp. BH32 Isolate Unclassified
490 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
491 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
492 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
493 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere
494 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.37
Metatranscriptomes 0.44
Isolates 14.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.97
Nodule 0.33
Rhizoplane 2.55
Rhizosphere 67.52
Stem 0
Stem Tuber 0
Unclassified 14.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000571 3300001904 Bacteria 6744
2 JGI24741J21665_1000087 3300001915 Bacteria 23638
3 JGI24740J21852_10000056 3300001979 Bacteria 35577
4 JGI24740J21852_10000604 3300001979 Bacteria 15524
5 JGI24740J21852_10001793 3300001979 Bacteria 9848
6 JGI24740J21852_10005576 3300001979 Bacteria 5303
7 JGI24740J21852_10006495 3300001979 Bacteria 4835
8 JGI24740J21852_10009240 3300001979 Bacteria 3870
9 JGI24739J22299_10002030 3300001989 Bacteria 7747
10 JGI24739J22299_10024202 3300001989 Bacteria 2142
11 JGI24737J22298_10007765 3300001990 Bacteria 3616
12 JGI24738J21930_10001279 3300002075 Bacteria 7053
13 JGI24034J26672_10003921 3300002239 Bacteria 2093
14 JGI25156J39149_1002100 3300002705 Bacteria 7538
15 JGI25156J39149_1006039 3300002705 Bacteria 3374
16 JGI25154J39366_1000129 3300002738 Bacteria 59399
17 JGI25152J39213_1000016 3300002773 Bacteria 110433
18 JGI25150J39212_1000003 3300002774 Bacteria 508651
19 JGI25150J39212_1000004 3300002774 Bacteria 417320
20 JGI25159J45721_1002626 3300002987 Bacteria 6720
21 JGI25151J46595_10000002 3300003187 Bacteria 731381
22 JGI25151J46595_10001821 3300003187 Bacteria 13757
23 JGI25151J46595_10014371 3300003187 Bacteria 3528
24 JGI25151J46595_10016138 3300003187 Bacteria 3272
25 JGI25151J46595_10017907 3300003187 Bacteria 3057
26 JGI25151J46595_10027517 3300003187 Bacteria 2277
27 JGI25151J46595_10033087 3300003187 Bacteria 1996
28 JGI25151J46595_10039002 3300003187 Bacteria 1760
29 JGI25153J46596_10000015 3300003215 Bacteria 289820
30 rootH1_10014435 3300003316 Bacteria 15863
31 rootH2_10001801 3300003320 Bacteria 92828
32 rootL2_10034836 3300003322 Bacteria 25479
33 rootL2_10141361 3300003322 Bacteria 10596
34 rootH1_10012599 3300003323 Bacteria 111210
35 JGI25160J50197_1003101 3300003354 Bacteria 7581
36 Ga0006562J51391_1012222 3300003578 Bacteria 1613
37 Ga0006562J51391_1016016 3300003578 Bacteria 6536
38 Ga0006562J51391_1016017 3300003578 Bacteria 5770
39 Ga0055539_1000081 3300003752 Bacteria 122891
40 Ga0055533_1000421 3300003756 Bacteria 16356
41 Ga0055532_1000048 3300003758 Bacteria 175560
42 Ga0055532_1001906 3300003758 Bacteria 5005
43 Ga0055525_1000273 3300003759 Bacteria 48163
44 Ga0055527_1000387 3300003760 Bacteria 19111
45 Ga0055535_1000035 3300003761 Bacteria 175560
46 Ga0055542_1001297 3300003762 Bacteria 13337
47 Ga0055529_1000101 3300003763 Bacteria 130709
48 Ga0055526_1000449 3300003771 Bacteria 32775
49 Ga0055537_1000708 3300003773 Bacteria 17301
50 Ga0055524_1000947 3300003775 Bacteria 18419
51 Ga0055536_1000601 3300003781 Bacteria 24524
52 Ga0055534_1000613 3300003784 Bacteria 18419
53 Ga0055528_1000337 3300003790 Bacteria 39377
54 Ga0055540_1000003 3300003792 Bacteria 428375
55 Ga0055531_10001471 3300003794 Bacteria 17334
56 Ga0055541_1000361 3300003841 Bacteria 14113
57 JGI25405J52794_10004542 3300003911 Bacteria 2478
58 Ga0065165_1002643 3300005262 Bacteria 14514
59 Ga0065165_1010558 3300005262 Bacteria 3970
60 Ga0065704_10073281 3300005289 Bacteria 7350
61 Ga0065704_10074342 3300005289 Bacteria 6344
62 Ga0065715_10137322 3300005293 Bacteria 1909
63 Ga0070658_10022682 3300005327 Bacteria 5038
64 Ga0070658_10126130 3300005327 Bacteria 2131
65 Ga0070658_10200008 3300005327 Bacteria 1685
66 Ga0070658_10284790 3300005327 Bacteria 1407
67 Ga0070676_10001841 3300005328 Bacteria 10804
68 Ga0070683_100010869 3300005329 Bacteria 7838
69 Ga0070670_100000027 3300005331 Bacteria 186072
70 Ga0070670_100052714 3300005331 Bacteria 3493
71 Ga0070670_100055135 3300005331 Bacteria 3412
72 Ga0070670_100119540 3300005331 Bacteria 2273
73 Ga0070666_10008338 3300005335 Bacteria 6428
74 Ga0070682_100137867 3300005337 Bacteria 1659
75 Ga0068868_100000063 3300005338 Bacteria 61783
76 Ga0068868_100043366 3300005338 Bacteria 3514
77 Ga0068868_100088472 3300005338 Bacteria 2493
78 Ga0070660_100128661 3300005339 Bacteria 2025
79 Ga0070660_100152744 3300005339 Bacteria 1857
80 Ga0070691_10054800 3300005341 Bacteria 1909
81 Ga0070661_100006605 3300005344 Bacteria 8000
82 Ga0070661_100169282 3300005344 Bacteria 1658
83 Ga0070668_100000021 3300005347 Bacteria 96397
84 Ga0070668_100000190 3300005347 Bacteria 40176
85 Ga0070668_100001427 3300005347 Bacteria 17249
86 Ga0070668_100002649 3300005347 Bacteria 13148
87 Ga0070668_100128748 3300005347 Bacteria 2030
88 Ga0070668_100174026 3300005347 Bacteria 1754
89 Ga0070669_100044684 3300005353 Bacteria 3227
90 Ga0070669_100103876 3300005353 Bacteria 2148
91 Ga0070671_100001059 3300005355 Bacteria 20287
92 Ga0070671_100001896 3300005355 Bacteria 15990
93 Ga0070671_100050167 3300005355 Bacteria 3471
94 Ga0070673_100042809 3300005364 Bacteria 3494
95 Ga0070673_100048531 3300005364 Bacteria 3310
96 Ga0070673_100063713 3300005364 Bacteria 2934
97 Ga0070659_100009872 3300005366 Bacteria 7020
98 Ga0070667_100000135 3300005367 Bacteria 93968
99 Ga0070667_100000638 3300005367 Bacteria 34017
100 Ga0070667_100008061 3300005367 Bacteria 8739
101 Ga0070667_100009598 3300005367 Bacteria 8025
102 Ga0070713_100067249 3300005436 Bacteria 3016
103 Ga0070710_10000514 3300005437 Bacteria 18217
104 Ga0070694_100006716 3300005444 Bacteria 6990
105 Ga0070708_100149719 3300005445 Bacteria 2170
106 Ga0070663_100000024 3300005455 Bacteria 108544
107 Ga0070663_100055920 3300005455 Bacteria 2826
108 Ga0070678_100018605 3300005456 Bacteria 4506
109 Ga0070678_100027141 3300005456 Bacteria 3883
110 Ga0070678_100237540 3300005456 Bacteria 1522
111 Ga0070681_10002788 3300005458 Bacteria 16141
112 Ga0070698_100007890 3300005471 Bacteria 11521
113 Ga0070699_100019463 3300005518 Bacteria 5845
114 Ga0070679_100085544 3300005530 Bacteria 3140
115 Ga0070679_100101575 3300005530 Bacteria 2863
116 Ga0070684_100022411 3300005535 Bacteria 5268
117 Ga0068853_100153787 3300005539 Bacteria 2072
118 Ga0070672_100014855 3300005543 Bacteria 5528
119 Ga0070672_100184809 3300005543 Bacteria 1738
120 Ga0070672_100190098 3300005543 Bacteria 1714
121 Ga0070686_100000553 3300005544 Bacteria 22346
122 Ga0070696_100018171 3300005546 Bacteria 4750
123 Ga0070665_100000605 3300005548 Bacteria 49400
124 Ga0070665_100001611 3300005548 Bacteria 25963
125 Ga0070665_100002698 3300005548 Bacteria 19270
126 Ga0070665_100015939 3300005548 Bacteria 7543
127 Ga0070665_100088738 3300005548 Bacteria 3098
128 Ga0070665_100119808 3300005548 Bacteria 2634
129 Ga0070665_100187375 3300005548 Bacteria 2070
130 Ga0070704_100003498 3300005549 Bacteria 9016
131 Ga0070704_100176648 3300005549 Bacteria 1704
132 Ga0068855_100020165 3300005563 Bacteria 8006
133 Ga0068855_100349061 3300005563 Unclassified 1630
134 Ga0070664_100000022 3300005564 Bacteria 108544
135 Ga0070664_100000247 3300005564 Bacteria 38997
136 Ga0070664_100012258 3300005564 Bacteria 6967
137 Ga0070664_100025219 3300005564 Bacteria 4926
138 Ga0068857_100000513 3300005577 Bacteria 27847
139 Ga0068857_100049989 3300005577 Bacteria 3709
140 Ga0068854_100000336 3300005578 Bacteria 30476
141 Ga0068854_100000612 3300005578 Bacteria 21143
142 Ga0068854_100011735 3300005578 Bacteria 5717
143 Ga0068854_100035972 3300005578 Bacteria 3469
144 Ga0068856_100000049 3300005614 Bacteria 108544
145 Ga0068856_100000194 3300005614 Bacteria 64170
146 Ga0068856_100021956 3300005614 Bacteria 6205
147 Ga0068852_100033802 3300005616 Bacteria 4250
148 Ga0068852_100040812 3300005616 Bacteria 3918
149 Ga0068852_100052820 3300005616 Bacteria 3495
150 Ga0068859_100045965 3300005617 Bacteria 4386
151 Ga0068859_100048570 3300005617 Bacteria 4263
152 Ga0068859_100177419 3300005617 Bacteria 2212
153 Ga0068859_100188297 3300005617 Bacteria 2148
154 Ga0068859_100205476 3300005617 Bacteria 2055
155 Ga0068864_100000083 3300005618 Bacteria 100972
156 Ga0068864_100004493 3300005618 Bacteria 11474
157 Ga0068864_100044774 3300005618 Bacteria 3795
158 Ga0068861_100147690 3300005719 Bacteria 1926
159 Ga0068863_100000025 3300005841 Bacteria 186072
160 Ga0068863_100000043 3300005841 Bacteria 153935
161 Ga0068863_100000198 3300005841 Bacteria 63987
162 Ga0068863_100014397 3300005841 Bacteria 7617
163 Ga0068858_100007771 3300005842 Bacteria 10351
164 Ga0068858_100038243 3300005842 Bacteria 4451
165 Ga0068858_100064195 3300005842 Bacteria 3398
166 Ga0068858_100089625 3300005842 Bacteria 2862
167 Ga0068860_100001354 3300005843 Bacteria 26623
168 Ga0068860_100003820 3300005843 Bacteria 15493
169 Ga0068862_100000027 3300005844 Bacteria 186072
170 Ga0068862_100000125 3300005844 Bacteria 89536
171 Ga0068862_100002747 3300005844 Bacteria 15447
172 Ga0068862_100005128 3300005844 Bacteria 11013
173 Ga0068862_100012533 3300005844 Bacteria 7018
174 Ga0068862_100053143 3300005844 Bacteria 3467
175 Ga0068862_100108709 3300005844 Bacteria 2432
176 Ga0081455_10000021 3300005937 Bacteria 160055
177 Ga0081455_10000066 3300005937 Bacteria 115221
178 Ga0081455_10063949 3300005937 Bacteria 3084
179 Ga0081539_10002432 3300005985 Bacteria 26284
180 Ga0075363_100000051 3300006048 Bacteria 22810
181 Ga0075363_100060203 3300006048 Bacteria 2043
182 Ga0070712_100043499 3300006175 Bacteria 3092
183 Ga0075369_10001593 3300006186 Bacteria 7799
184 Ga0075366_10008428 3300006195 Bacteria 5732
185 Ga0068871_100039365 3300006358 Bacteria 3782
186 Ga0068871_100059716 3300006358 Bacteria 3108
187 Ga0075428_100095951 3300006844 Bacteria 3232
188 Ga0075428_100122559 3300006844 Bacteria 2830
189 Ga0075428_100128370 3300006844 Bacteria 2758
190 Ga0075433_10013939 3300006852 Bacteria 6553
191 Ga0075434_100019256 3300006871 Bacteria 6603
192 Ga0097620_100045965 3300006931 Bacteria 4386
193 Ga0097620_100048565 3300006931 Bacteria 4263
194 Ga0097620_100177419 3300006931 Bacteria 2212
195 Ga0097620_100188301 3300006931 Bacteria 2148
196 Ga0097620_100205475 3300006931 Bacteria 2055
197 Ga0075435_100003419 3300007076 Bacteria 10764
198 Ga0105251_10000138 3300009011 Bacteria 74430
199 Ga0105244_10011682 3300009036 Bacteria 5242
200 Ga0105250_10000793 3300009092 Bacteria 19040
201 Ga0105240_10011125 3300009093 Bacteria 12574
202 Ga0105240_10012181 3300009093 Bacteria 11904
203 Ga0105240_10018898 3300009093 Bacteria 9228
204 Ga0105240_10079491 3300009093 Bacteria 4035
205 Ga0105240_10119764 3300009093 Bacteria 3170
206 Ga0105240_10164625 3300009093 Bacteria 2631
207 Ga0105240_10181760 3300009093 Bacteria 2481
208 Ga0111539_10030317 3300009094 Bacteria 6576
209 Ga0111539_10131569 3300009094 Bacteria 2930
210 Ga0105245_10225045 3300009098 Bacteria 1812
211 Ga0105245_10468875 3300009098 Bacteria 1271
212 Ga0105247_10002888 3300009101 Bacteria 11441
213 Ga0105247_10100907 3300009101 Bacteria 1845
214 Ga0114129_10091845 3300009147 Bacteria 4205
215 Ga0114129_10171564 3300009147 Bacteria 2957
216 Ga0105243_10014444 3300009148 Bacteria 5979
217 Ga0105241_10005021 3300009174 Bacteria 9771
218 Ga0105241_10255484 3300009174 Bacteria 1487
219 Ga0105242_10020912 3300009176 Bacteria 5132
220 Ga0105248_10000026 3300009177 Bacteria 257155
221 Ga0105248_10001586 3300009177 Bacteria 25332
222 Ga0105248_10025719 3300009177 Bacteria 6547
223 Ga0105248_10064630 3300009177 Bacteria 4108
224 Ga0105248_10119095 3300009177 Bacteria 2978
225 Ga0105248_10363368 3300009177 Bacteria 1630
226 Ga0105237_10000026 3300009545 Bacteria 212619
227 Ga0105238_10018672 3300009551 Bacteria 7062
228 Ga0105238_10022601 3300009551 Bacteria 6410
229 Ga0105249_10000015 3300009553 Bacteria 282138
230 Ga0105249_10000123 3300009553 Bacteria 104747
231 Ga0105249_10008042 3300009553 Bacteria 9192
232 Ga0105249_10010730 3300009553 Bacteria 8048
233 Ga0105249_10023672 3300009553 Bacteria 5513
234 Ga0105249_10024158 3300009553 Bacteria 5461
235 Ga0105249_10267942 3300009553 Bacteria 1700
236 Ga0099796_10002492 3300010159 Bacteria 4051
237 Ga0105239_10008875 3300010375 Bacteria 11378
238 Ga0105239_10025788 3300010375 Bacteria 6474
239 Ga0105239_10040042 3300010375 Bacteria 5133
240 Ga0105246_10005371 3300011119 Bacteria 7800
241 Ga0157314_1000397 3300012500 Bacteria 4389
242 Ga0157373_10004557 3300013100 Bacteria 10420
243 Ga0157373_10016049 3300013100 Bacteria 5466
244 Ga0157371_10000089 3300013102 Bacteria 145483
245 Ga0157371_10005522 3300013102 Bacteria 10642
246 Ga0157370_10000002 3300013104 Bacteria 431400
247 Ga0157370_10011309 3300013104 Bacteria 9351
248 Ga0157370_10048771 3300013104 Bacteria 4057
249 Ga0157370_10056458 3300013104 Bacteria 3737
250 Ga0157369_10006987 3300013105 Bacteria 13022
251 Ga0157369_10104723 3300013105 Bacteria 3012
252 Ga0157369_10224587 3300013105 Bacteria 1965
253 Ga0157374_10043528 3300013296 Bacteria 4149
254 Ga0157374_10160140 3300013296 Bacteria 2192
255 Ga0163162_10003740 3300013306 Bacteria 14573
256 Ga0163162_10042644 3300013306 Bacteria 4542
257 Ga0163162_10203926 3300013306 Bacteria 2107
258 Ga0163162_10239912 3300013306 Bacteria 1943
259 Ga0157372_10000149 3300013307 Bacteria 76796
260 Ga0157372_10245387 3300013307 Bacteria 2078
261 Ga0157372_10438725 3300013307 Bacteria 1522
262 Ga0157375_10010613 3300013308 Bacteria 8111
263 Ga0157375_10142766 3300013308 Bacteria 2523
264 Ga0157380_10031110 3300014326 Bacteria 4095
265 Ga0157380_10046066 3300014326 Bacteria 3424
266 Ga0157380_10120027 3300014326 Bacteria 2225
267 Ga0182008_10057668 3300014497 Bacteria 1918
268 Ga0157379_10021758 3300014968 Bacteria 5680
269 Ga0157379_10121279 3300014968 Bacteria 2352
270 Ga0182006_1001276 3300015261 Bacteria 15513
271 Ga0182007_10007444 3300015262 Bacteria 4590
272 Ga0183360_10001 3300015689 Bacteria 3943671
273 Ga0163161_10017243 3300017792 Bacteria 5051
274 Ga0213872_10006956 3300021361 Bacteria 5619
275 Ga0213875_10000415 3300021388 Bacteria 37517
276 Ga0209784_100024 3300025224 Bacteria 394613
277 Ga0209566_100018 3300025225 Bacteria 448638
278 Ga0209566_100251 3300025225 Bacteria 51274
279 Ga0209674_100046 3300025226 Bacteria 357920
280 Ga0209674_100135 3300025226 Bacteria 113826
281 Ga0209672_100240 3300025228 Bacteria 41226
282 Ga0209147_100008 3300025229 Bacteria 777096
283 Ga0209147_100115 3300025229 Bacteria 143934
284 Ga0209563_100039 3300025230 Bacteria 409717
285 Ga0209563_101432 3300025230 Bacteria 6329
286 Ga0209258_100013 3300025242 Bacteria 777096
287 Ga0207425_1000003 3300025245 Bacteria 1145342
288 Ga0207425_1002895 3300025245 Bacteria 5756
289 Ga0209646_1000027 3300025246 Bacteria 395141
290 Ga0209026_1000416 3300025250 Bacteria 36810
291 Ga0209026_1005274 3300025250 Bacteria 3519
292 Ga0209026_1013129 3300025250 Unclassified 1419
293 Ga0209677_100024 3300025253 Bacteria 406035
294 Ga0209148_1000019 3300025254 Bacteria 748518
295 Ga0209759_1007543 3300025256 Bacteria 3486
296 Ga0209759_1009583 3300025256 Bacteria 2916
297 Ga0209129_1000014 3300025258 Bacteria 509018
298 Ga0209129_1001768 3300025258 Bacteria 11551
299 Ga0209565_1000001 3300025263 Bacteria 2950419
300 Ga0209455_1000042 3300025272 Bacteria 419638
301 Ga0209673_1000001 3300025273 Bacteria 3176258
302 Ga0209130_1001011 3300025284 Bacteria 21808
303 Ga0209675_1000001 3300025291 Bacteria 2950293
304 Ga0209676_1000046 3300025292 Bacteria 409173
305 Ga0209676_1008056 3300025292 Bacteria 4789
306 Ga0209025_1000007 3300025294 Bacteria 1145109
307 Ga0209025_1000036 3300025294 Bacteria 404113
308 Ga0209025_1000724 3300025294 Bacteria 56016
309 Ga0209025_1001437 3300025294 Bacteria 31330
310 Ga0209025_1002332 3300025294 Bacteria 20505
311 Ga0209025_1005432 3300025294 Bacteria 10399
312 Ga0209025_1008485 3300025294 Bacteria 7388
313 Ga0209025_1009574 3300025294 Bacteria 6723
314 Ga0209025_1010749 3300025294 Bacteria 6155
315 Ga0209025_1011402 3300025294 Bacteria 5863
316 Ga0209025_1016889 3300025294 Bacteria 4259
317 Ga0209025_1017894 3300025294 Bacteria 4059
318 Ga0209025_1024984 3300025294 Bacteria 3060
319 Ga0209025_1027121 3300025294 Bacteria 2851
320 Ga0209025_1036044 3300025294 Bacteria 2223
321 Ga0209025_1046600 3300025294 Bacteria 1781
322 Ga0209564_1000001 3300025295 Bacteria 3176258
323 Ga0209758_1000012 3300025297 Bacteria 949866
324 Ga0209758_1000269 3300025297 Bacteria 103013
325 Ga0209758_1000309 3300025297 Bacteria 94619
326 Ga0209758_1026024 3300025297 Bacteria 2547
327 Ga0209256_1000002 3300025299 Bacteria 1906740
328 Ga0207426_1000313 3300025302 Bacteria 94934
329 Ga0207426_1004156 3300025302 Bacteria 7241
330 Ga0209051_1000011 3300025303 Bacteria 610828
331 Ga0209257_1001575 3300025304 Bacteria 26306
332 Ga0209257_1001711 3300025304 Bacteria 24581
333 Ga0207697_10014484 3300025315 Bacteria 3269
334 Ga0207656_10004664 3300025321 Bacteria 4802
335 Ga0207696_1002900 3300025711 Bacteria 8072
336 Ga0207655_1017390 3300025728 Bacteria 3881
337 Ga0207713_1013296 3300025735 Bacteria 4346
338 Ga0207713_1023169 3300025735 Bacteria 2930
339 Ga0207713_1033299 3300025735 Bacteria 2253
340 Ga0207713_1049139 3300025735 Bacteria 1693
341 Ga0207713_1049818 3300025735 Bacteria 1676
342 Ga0207692_10008674 3300025898 Bacteria 4218
343 Ga0207710_10020090 3300025900 Bacteria 2853
344 Ga0207710_10057943 3300025900 Bacteria 1750
345 Ga0207688_10007026 3300025901 Bacteria 6121
346 Ga0207688_10052808 3300025901 Bacteria 2278
347 Ga0207680_10001069 3300025903 Bacteria 12923
348 Ga0207647_10027823 3300025904 Bacteria 3682
349 Ga0207645_10006422 3300025907 Bacteria 8439
350 Ga0207645_10156823 3300025907 Bacteria 1487
351 Ga0207705_10022095 3300025909 Bacteria 4539
352 Ga0207705_10051621 3300025909 Bacteria 2960
353 Ga0207654_10052585 3300025911 Bacteria 2348
354 Ga0207707_10066580 3300025912 Bacteria 3138
355 Ga0207695_10004273 3300025913 Bacteria 19616
356 Ga0207695_10005571 3300025913 Bacteria 16629
357 Ga0207695_10034300 3300025913 Bacteria 5522
358 Ga0207695_10057496 3300025913 Bacteria 4040
359 Ga0207695_10115979 3300025913 Bacteria 2652
360 Ga0207671_10000041 3300025914 Bacteria 216095
361 Ga0207693_10269951 3300025915 Bacteria 1333
362 Ga0207657_10014188 3300025919 Bacteria 7790
363 Ga0207657_10088710 3300025919 Bacteria 2584
364 Ga0207649_10000075 3300025920 Bacteria 83915
365 Ga0207649_10006407 3300025920 Bacteria 6395
366 Ga0207649_10022312 3300025920 Bacteria 3656
367 Ga0207652_10004883 3300025921 Bacteria 10849
368 Ga0207652_10057707 3300025921 Bacteria 3344
369 Ga0207652_10121023 3300025921 Bacteria 2328
370 Ga0207681_10016295 3300025923 Bacteria 4647
371 Ga0207681_10041246 3300025923 Bacteria 3076
372 Ga0207694_10162935 3300025924 Bacteria 1802
373 Ga0207650_10000056 3300025925 Bacteria 157972
374 Ga0207650_10001645 3300025925 Bacteria 15921
375 Ga0207650_10015096 3300025925 Bacteria 5374
376 Ga0207687_10074223 3300025927 Bacteria 2437
377 Ga0207644_10002127 3300025931 Bacteria 12857
378 Ga0207644_10003552 3300025931 Bacteria 10090
379 Ga0207644_10057746 3300025931 Bacteria 2802
380 Ga0207644_10072288 3300025931 Bacteria 2526
381 Ga0207690_10039031 3300025932 Bacteria 3096
382 Ga0207706_10048379 3300025933 Bacteria 3761
383 Ga0207706_10049700 3300025933 Bacteria 3705
384 Ga0207706_10201075 3300025933 Bacteria 1747
385 Ga0207706_10235738 3300025933 Bacteria 1600
386 Ga0207709_10000305 3300025935 Bacteria 53275
387 Ga0207704_10056850 3300025938 Bacteria 2399
388 Ga0207691_10007560 3300025940 Bacteria 10461
389 Ga0207691_10056940 3300025940 Bacteria 3560
390 Ga0207691_10057571 3300025940 Bacteria 3536
391 Ga0207711_10000004 3300025941 Bacteria 870636
392 Ga0207711_10004220 3300025941 Bacteria 12307
393 Ga0207711_10028891 3300025941 Bacteria 4671
394 Ga0207711_10041090 3300025941 Bacteria 3937
395 Ga0207689_10084499 3300025942 Bacteria 2609
396 Ga0207689_10111859 3300025942 Bacteria 2245
397 Ga0207661_10007992 3300025944 Bacteria 7543
398 Ga0207661_10066150 3300025944 Bacteria 2936
399 Ga0207661_10199067 3300025944 Bacteria 1760
400 Ga0207679_10000004 3300025945 Bacteria 589021
401 Ga0207679_10009846 3300025945 Bacteria 6136
402 Ga0207679_10028387 3300025945 Bacteria 3882
403 Ga0207667_10000428 3300025949 Bacteria 56508
404 Ga0207667_10004100 3300025949 Bacteria 17907
405 Ga0207667_10276870 3300025949 Unclassified 1715
406 Ga0207651_10060067 3300025960 Bacteria 2637
407 Ga0207651_10112554 3300025960 Bacteria 2046
408 Ga0207651_10138127 3300025960 Bacteria 1878
409 Ga0207651_10153111 3300025960 Bacteria 1798
410 Ga0207712_10000023 3300025961 Bacteria 282081
411 Ga0207712_10000102 3300025961 Bacteria 96444
412 Ga0207712_10006888 3300025961 Bacteria 7175
413 Ga0207712_10012601 3300025961 Bacteria 5403
414 Ga0207668_10000070 3300025972 Bacteria 78666
415 Ga0207668_10000491 3300025972 Bacteria 24767
416 Ga0207668_10001557 3300025972 Bacteria 13418
417 Ga0207640_10000084 3300025981 Bacteria 74504
418 Ga0207640_10000185 3300025981 Bacteria 44459
419 Ga0207640_10007204 3300025981 Bacteria 6132
420 Ga0207640_10008681 3300025981 Bacteria 5651
421 Ga0207658_10000101 3300025986 Bacteria 95144
422 Ga0207658_10000251 3300025986 Bacteria 56192
423 Ga0207658_10007909 3300025986 Bacteria 7242
424 Ga0207658_10010752 3300025986 Bacteria 6224
425 Ga0207677_10000044 3300026023 Bacteria 107614
426 Ga0207677_10217630 3300026023 Bacteria 1529
427 Ga0207703_10014421 3300026035 Bacteria 6163
428 Ga0207703_10022204 3300026035 Bacteria 4976
429 Ga0207703_10112069 3300026035 Bacteria 2330
430 Ga0207639_10120297 3300026041 Bacteria 2156
431 Ga0207678_10000012 3300026067 Bacteria 145324
432 Ga0207678_10002629 3300026067 Bacteria 16358
433 Ga0207678_10012155 3300026067 Bacteria 7562
434 Ga0207678_10013054 3300026067 Bacteria 7288
435 Ga0207678_10033439 3300026067 Bacteria 4479
436 Ga0207678_10073669 3300026067 Bacteria 2926
437 Ga0207708_10079598 3300026075 Bacteria 2517
438 Ga0207702_10000020 3300026078 Bacteria 203299
439 Ga0207702_10002214 3300026078 Bacteria 18628
440 Ga0207702_10023308 3300026078 Bacteria 5133
441 Ga0207641_10000018 3300026088 Bacteria 298209
442 Ga0207641_10000031 3300026088 Bacteria 224320
443 Ga0207641_10000046 3300026088 Bacteria 180836
444 Ga0207641_10011350 3300026088 Bacteria 7312
445 Ga0207641_10143612 3300026088 Bacteria 2156
446 Ga0207641_10274672 3300026088 Bacteria 1583
447 Ga0207676_10000027 3300026095 Bacteria 245868
448 Ga0207676_10002924 3300026095 Bacteria 12175
449 Ga0207676_10038759 3300026095 Bacteria 3640
450 Ga0207674_10000209 3300026116 Bacteria 72184
451 Ga0207674_10006196 3300026116 Bacteria 14099
452 Ga0207674_10051941 3300026116 Bacteria 4182
453 Ga0207674_10178300 3300026116 Bacteria 2077
454 Ga0207675_100087142 3300026118 Bacteria 2932
455 Ga0207675_100090177 3300026118 Bacteria 2882
456 Ga0207675_100095286 3300026118 Bacteria 2800
457 Ga0207683_10028424 3300026121 Bacteria 4835
458 Ga0207683_10071144 3300026121 Bacteria 3074
459 Ga0207698_10072327 3300026142 Bacteria 2741
460 Ga0209179_1002620 3300027512 Bacteria 2464
461 Ga0209813_10000397 3300027866 Bacteria 10778
462 Ga0207428_10002905 3300027907 Bacteria 16985
463 Ga0268266_10000394 3300028379 Bacteria 66190
464 Ga0268266_10003975 3300028379 Bacteria 14338
465 Ga0268266_10005881 3300028379 Bacteria 11353
466 Ga0268266_10083270 3300028379 Bacteria 2792
467 Ga0268266_10224302 3300028379 Bacteria 1729
468 Ga0268265_10000042 3300028380 Bacteria 186086
469 Ga0268265_10000049 3300028380 Bacteria 177242
470 Ga0268265_10000770 3300028380 Bacteria 30967
471 Ga0268265_10005055 3300028380 Bacteria 9055
472 Ga0268265_10046537 3300028380 Bacteria 3244
473 Ga0268265_10081278 3300028380 Bacteria 2558
474 Ga0268264_10001904 3300028381 Bacteria 18903
475 Ga0268264_10005865 3300028381 Bacteria 10396
476 Ga0268264_10007684 3300028381 Bacteria 8985
477 Ga0237817_10088 3300030083 Bacteria 28251
478 Ga0237817_10199 3300030083 Bacteria 15991
479 Ga0237817_10571 3300030083 Bacteria 4119
480 Ga0265328_10001466 3300031239 Bacteria 10894
481 Ga0265327_10001610 3300031251 Bacteria 27353
482 Ga0265327_10002591 3300031251 Bacteria 18713
483 Ga0265316_10144748 3300031344 Bacteria 1783
484 Ga0307513_10106202 3300031456 Bacteria 2815
485 Ga0307513_10181155 3300031456 Bacteria 1970
486 Ga0307509_10006676 3300031507 Bacteria 15395
487 Ga0307509_10015731 3300031507 Bacteria 8807
488 Ga0307509_10020068 3300031507 Bacteria 7597
489 Ga0307509_10059371 3300031507 Bacteria 4047
490 Ga0307509_10069425 3300031507 Bacteria 3683
491 Ga0307408_100029226 3300031548 Bacteria 3816
492 Ga0307408_100041473 3300031548 Bacteria 3263
493 Ga0307408_100153986 3300031548 Bacteria 1818
494 Ga0307408_100232652 3300031548 Bacteria 1510
495 Ga0307508_10000921 3300031616 Bacteria 34235
496 Ga0307508_10032102 3300031616 Bacteria 4744
497 Ga0307405_10032740 3300031731 Bacteria 3075
498 Ga0307405_10105375 3300031731 Bacteria 1899
499 Ga0307405_10110755 3300031731 Bacteria 1859
500 Ga0307413_10061078 3300031824 Bacteria 2323
501 Ga0307410_10003115 3300031852 Bacteria 8231
502 Ga0307410_10047646 3300031852 Bacteria 2865
503 Ga0307410_10090384 3300031852 Bacteria 2171
504 Ga0307410_10166443 3300031852 Bacteria 1657
505 Ga0307406_10001562 3300031901 Bacteria 12620
506 Ga0307406_10011507 3300031901 Bacteria 5026
507 Ga0307406_10024964 3300031901 Bacteria 3574
508 Ga0307406_10058812 3300031901 Bacteria 2471
509 Ga0307407_10003631 3300031903 Bacteria 6380
510 Ga0307407_10119100 3300031903 Bacteria 1670
511 Ga0307412_10001834 3300031911 Bacteria 11779
512 Ga0307412_10041379 3300031911 Bacteria 2986
513 Ga0307412_10050390 3300031911 Bacteria 2747
514 Ga0307409_100004024 3300031995 Bacteria 8161
515 Ga0307409_100005574 3300031995 Bacteria 7274
516 Ga0307409_100048247 3300031995 Bacteria 3238
517 Ga0307409_100069989 3300031995 Bacteria 2783
518 Ga0307409_100112456 3300031995 Bacteria 2286
519 Ga0307416_100041203 3300032002 Bacteria 3594
520 Ga0307416_100109541 3300032002 Bacteria 2429
521 Ga0307414_10003418 3300032004 Bacteria 8470
522 Ga0307414_10016685 3300032004 Bacteria 4472
523 Ga0307414_10058882 3300032004 Bacteria 2709
524 Ga0307414_10075548 3300032004 Bacteria 2445
525 Ga0307411_10005783 3300032005 Bacteria 6120
526 Ga0307411_10024840 3300032005 Bacteria 3579
527 Ga0307411_10039330 3300032005 Bacteria 2991
528 Ga0307411_10051340 3300032005 Bacteria 2690
529 Ga0307411_10074757 3300032005 Bacteria 2310
530 Ga0307415_100091882 3300032126 Bacteria 2200
531 Ga0307415_100140151 3300032126 Bacteria 1846
532 Ga0395899_0000610 3300037312 Bacteria 37302
533 Ga0395899_0002435 3300037312 Bacteria 15139
534 Ga0395899_0064489 3300037312 Bacteria 2693
535 Ga0395899_0095812 3300037312 Bacteria 2146
536 Ga0395900_0000301 3300037418 Bacteria 73924
537 Ga0395900_0010269 3300037418 Bacteria 9574
538 Ga0395900_0032913 3300037418 Bacteria 5333
539 Ga0395900_0132975 3300037418 Bacteria 2549
540 Ga0395898_0000049 3300037466 Bacteria 284792
541 Ga0395898_0000504 3300037466 Bacteria 75910
542 Ga0395898_0020197 3300037466 Bacteria 6766
543 Ga0395898_0058759 3300037466 Bacteria 3743
544 Ga0395905_0004579 3300037471 Bacteria 14305
545 Ga0395905_0019542 3300037471 Bacteria 6421
546 Ga0395905_0132498 3300037471 Bacteria 2344
547 Ga0395905_0156248 3300037471 Bacteria 2145
548 Ga0436364_1487636 3300037853 Bacteria 30336
549 Ga0395901_0000197 3300038443 Bacteria 76617
550 Ga0237819_00121 3300038705 Bacteria 29067
551 Ga0237819_00430 3300038705 Bacteria 14382
552 Ga0237819_02219 3300038705 Bacteria 4091
553 Ga0237816_00660 3300039145 Bacteria 2907
554 Ga0436361_0587792 3300039447 Bacteria 4315
555 Ga0436361_0637365 3300039447 Bacteria 14224
556 Ga0439436_0001800 3300041404 Bacteria 6315
557 Ga0439447_001376 3300041407 Bacteria 8895
558 Ga0451797_0154013 3300041453 Bacteria 1471
559 Ga0451853_1495030 3300041512 Bacteria 13527
560 Ga0439445_0000005 3300042004 Bacteria 28900
561 Ga0439449_0002747 3300042007 Bacteria 6846
562 Ga0439449_0011729 3300042007 Bacteria 3293
563 Ga0439449_0020874 3300042007 Bacteria 2454
564 Ga0466969_0002062 3300044656 Bacteria 10728
565 Ga0466969_0064503 3300044656 Bacteria 1773
566 Ga0466972_0003988 3300044658 Bacteria 7352
567 Ga0466972_0005704 3300044658 Bacteria 6240
568 Ga0466972_0034292 3300044658 Bacteria 2487
569 Ga0466978_0002079 3300044671 Bacteria 8369
570 Ga0466982_0000003 3300044672 Bacteria 417243
571 Ga0466965_0001591 3300044683 Bacteria 9263
572 Ga0466965_0038543 3300044683 Bacteria 2348
573 Ga0466965_0116846 3300044683 Bacteria 1375
574 Ga0466966_0007047 3300044684 Bacteria 7444
575 Ga0466966_0028158 3300044684 Bacteria 3661
576 Ga0466961_0000354 3300044693 Bacteria 29866
577 Ga0466961_0007493 3300044693 Bacteria 6941
578 Ga0466961_0033128 3300044693 Bacteria 3321
579 Ga0466964_0005625 3300044706 Bacteria 4657
580 Ga0466964_0008119 3300044706 Bacteria 3938
581 Ga0466971_0001735 3300044719 Bacteria 9235
582 Ga0466971_0011695 3300044719 Bacteria 3843
583 Ga0466968_0017456 3300044735 Bacteria 2868
584 Ga0466968_0031750 3300044735 Bacteria 2192
585 Ga0466970_0000585 3300044765 Bacteria 17842
586 Ga0466970_0023508 3300044765 Bacteria 3219
587 Ga0466957_0108315 3300044842 Bacteria 1759
588 Ga0466960_0000132 3300044901 Bacteria 25196
589 Ga0466960_0005384 3300044901 Bacteria 5069
590 Ga0466960_0167635 3300044901 Bacteria 1183
591 Ga0466959_0051225 3300045049 Bacteria 3029
592 Ga0466959_0118008 3300045049 Bacteria 1888
593 Ga0451576_0009411 3300045051 Bacteria 11329
594 Ga0466958_0047382 3300045836 Bacteria 2595
595 Ga0466967_0000281 3300045976 Bacteria 22593
596 Ga0495638_0000204 3300046460 Bacteria 84182
597 Ga0495653_0000527 3300046463 Bacteria 29318
598 Ga0495650_0002326 3300046471 Bacteria 15721
599 Ga0495585_0000330 3300046492 Bacteria 46311
600 Ga0495607_0009844 3300046501 Bacteria 6448
601 Ga0495607_0130359 3300046501 Bacteria 1309
602 Ga0495583_0000349 3300046506 Bacteria 73032
603 Ga0495606_0001152 3300046507 Bacteria 37502
604 Ga0495632_0001269 3300046519 Bacteria 21412
605 Ga0495637_0011991 3300046520 Bacteria 4156
606 Ga0495648_0000212 3300046524 Bacteria 67727
607 Ga0495648_0007599 3300046524 Bacteria 8655
608 Ga0495648_0007985 3300046524 Bacteria 8395
609 Ga0495663_0016250 3300046525 Bacteria 2104
610 Ga0495652_0027948 3300046529 Bacteria 4968
611 Ga0495654_0025510 3300046530 Bacteria 3044
612 Ga0495587_0103598 3300046536 Bacteria 1638
613 Ga0495609_0010947 3300046538 Bacteria 4333
614 Ga0495622_0125213 3300046557 Bacteria 1172
615 Ga0495633_0000759 3300046558 Bacteria 29007
616 Ga0495633_0033078 3300046558 Bacteria 2495
617 Ga0495668_0000044 3300046616 Bacteria 227585
618 Ga0495668_0002177 3300046616 Bacteria 16775
619 Ga0495668_0002195 3300046616 Bacteria 16650
620 Ga0495668_0061652 3300046616 Bacteria 2068
621 Ga0495668_0101824 3300046616 Bacteria 1571
622 Ga0495668_0141008 3300046616 Bacteria 1319
623 Ga0495611_0007828 3300046648 Bacteria 4536
624 Ga0495625_0002196 3300046660 Bacteria 21608
625 Ga0495625_0006917 3300046660 Bacteria 10010
626 Ga0495661_0000055 3300046665 Bacteria 138787
627 Ga0495588_0034047 3300046674 Bacteria 2577
628 Ga0495669_0000104 3300046684 Bacteria 53714
629 Ga0495669_0003427 3300046684 Bacteria 6531
630 Ga0495669_0005899 3300046684 Bacteria 5105
631 Ga0495669_0046662 3300046684 Bacteria 1934
632 Ga0495671_0000060 3300046692 Bacteria 107734
633 Ga0495671_0011594 3300046692 Bacteria 4844
634 Ga0495671_0036177 3300046692 Bacteria 2502
635 Ga0495649_0006051 3300046694 Bacteria 7567
636 Ga0495581_0018902 3300047315 Bacteria 4000
637 Ga0495672_0010100 3300047320 Bacteria 6754
638 Ga0495672_0012840 3300047320 Bacteria 5815
639 Ga0495673_0000088 3300047469 Bacteria 189812
640 Ga0495673_0001871 3300047469 Bacteria 15797
641 Ga0495686_0000273 3300047472 Bacteria 91936
642 Ga0495686_0001176 3300047472 Bacteria 30528
643 Ga0495686_0001454 3300047472 Bacteria 25799
644 Ga0495686_0002443 3300047472 Bacteria 17543
645 Ga0495626_0025948 3300048091 Bacteria 2860
646 Ga0496102_0019806 3300048905 Bacteria 5931
647 Ga0496102_0146479 3300048905 Bacteria 2217
648 Ga0496104_0040214 3300048907 Bacteria 4382
649 Ga0496106_0001233 3300048909 Bacteria 19151
650 Ga0496107_0019708 3300048910 Bacteria 4760
651 Ga0496107_0030713 3300048910 Bacteria 3830
652 Ga0496107_0047994 3300048910 Bacteria 3075
653 Ga0496108_0001640 3300048911 Bacteria 17743
654 Ga0496108_0011078 3300048911 Bacteria 7323
655 Ga0496109_0005013 3300048912 Bacteria 11058
656 Ga0496109_0016098 3300048912 Bacteria 6534
657 Ga0496109_0094770 3300048912 Bacteria 2763
658 Ga0496112_0006823 3300048915 Bacteria 10064
659 Ga0496112_0008439 3300048915 Bacteria 9227
660 Ga0496112_0368312 3300048915 Bacteria 1378
661 Ga0496113_0004212 3300048916 Bacteria 8795
662 Ga0496113_0088079 3300048916 Bacteria 2388
663 Ga0496114_0022635 3300048917 Bacteria 5122
664 Ga0496115_0206191 3300048918 Bacteria 1624
665 Ga0496117_0005187 3300048920 Bacteria 13879
666 Ga0496118_0000262 3300048921 Bacteria 92154
667 Ga0496121_0005989 3300048924 Bacteria 15361
668 Ga0496121_0015828 3300048924 Bacteria 7846
669 Ga0496121_0031186 3300048924 Bacteria 4875
670 Ga0496122_0001014 3300048925 Bacteria 49714
671 Ga0496122_0010437 3300048925 Bacteria 9572
672 Ga0496122_0039799 3300048925 Bacteria 3744
673 Ga0496123_0000212 3300048926 Bacteria 118628
674 Ga0496123_0002266 3300048926 Bacteria 24245
675 Ga0496123_0006380 3300048926 Bacteria 11447
676 Ga0496123_0020071 3300048926 Bacteria 5242
677 Ga0496124_0000191 3300048927 Bacteria 121192
678 Ga0496124_0005682 3300048927 Bacteria 13907
679 Ga0496124_0151122 3300048927 Bacteria 1821
680 Ga0496125_0001371 3300048928 Bacteria 35830
681 Ga0496125_0016025 3300048928 Bacteria 7216
682 Ga0496125_0025101 3300048928 Bacteria 5466
683 Ga0496125_0068929 3300048928 Bacteria 2779
684 Ga0496126_0070584 3300048929 Bacteria 3112
685 Ga0496126_0191073 3300048929 Bacteria 1734
686 Ga0501034_0006142 3300049571 Bacteria 12951
687 Ga0501036_0053029 3300049572 Bacteria 3435
688 Ga0501036_0199548 3300049572 Bacteria 1683
689 Ga0501037_0006585 3300049573 Bacteria 8497
690 Ga0501037_0020025 3300049573 Bacteria 4939
691 Ga0501038_0018653 3300049574 Bacteria 6266
692 Ga0501040_0008279 3300049576 Bacteria 6764
693 Ga0501043_0001562 3300049579 Bacteria 19946
694 Ga0501043_0051406 3300049579 Bacteria 3238
695 Ga0501043_0079939 3300049579 Bacteria 2569
696 Ga0501046_0000033 3300049580 Bacteria 174675
697 Ga0501046_0016647 3300049580 Bacteria 6152
698 Ga0501046_0021415 3300049580 Bacteria 5334
699 Ga0501046_0077105 3300049580 Bacteria 2581
700 Ga0501047_0006704 3300049581 Bacteria 10826
701 Ga0501047_0011301 3300049581 Bacteria 8452
702 Ga0501047_0020030 3300049581 Bacteria 6423
703 Ga0501047_0069738 3300049581 Bacteria 3385
704 Ga0501048_0019298 3300049582 Bacteria 5005
705 Ga0501067_0008656 3300049583 Bacteria 5640
706 Ga0501070_0052359 3300049586 Bacteria 3388
707 Ga0501072_0004575 3300049588 Bacteria 10529
708 Ga0501075_0094614 3300049591 Bacteria 2268
709 Ga0501076_0007578 3300049592 Bacteria 7902
710 Ga0501202_017065 3300049652 Bacteria 1414
711 Ga0501235_005002 3300049669 Bacteria 2876
712 Ga0501235_012406 3300049669 Bacteria 1874
713 Ga0501239_003632 3300049672 Bacteria 1478
714 Ga0501249_015084 3300049679 Bacteria 1651
715 Ga0501225_0017211 3300049705 Bacteria 2006
716 Ga0501079_0024540 3300049741 Bacteria 4627
717 Ga0501241_004656 3300049758 Bacteria 2560
718 Ga0501268_002017 3300049765 Bacteria 2618
719 Ga0501044_0012022 3300049823 Bacteria 9378
720 Ga0501044_0053391 3300049823 Bacteria 4158
721 Ga0501044_0361121 3300049823 Bacteria 1370
722 Ga0501045_0021883 3300049824 Bacteria 4575
723 nmdc:mga0yw44_5052_c1 3300050492 Bacteria 6164
724 nmdc:mga0k408_7155_c1 3300050493 Bacteria 5962
725 nmdc:mga08y16_199748_c1 3300050511 Bacteria 2072
726 nmdc:mga0a205_306844_c1 3300050515 Bacteria 1459
727 nmdc:mga0a205_39985_c1 3300050515 Bacteria 4515
728 Ga0500610_0000215 3300053079 Bacteria 17712
729 Ga0500610_0012721 3300053079 Bacteria 3888
730 Ga0495619_0067857 3300053085 Bacteria 2382
731 Ga0500643_000233 3300053087 Bacteria 51480
732 Ga0500643_002379 3300053087 Bacteria 9800
733 Ga0500643_003227 3300053087 Bacteria 7939
734 Ga0500643_005019 3300053087 Bacteria 5798
735 Ga0500644_0005175 3300053088 Bacteria 3285
736 Ga0500641_0000769 3300053096 Bacteria 11636
737 Ga0500641_0001800 3300053096 Bacteria 7597
738 Ga0500556_0000049 3300053104 Bacteria 122572
739 Ga0500556_0005972 3300053104 Bacteria 3449
740 Ga0500562_000025 3300053108 Bacteria 105616
741 Ga0500562_001325 3300053108 Bacteria 6108
742 Ga0500562_018163 3300053108 Bacteria 1815
743 Ga0500594_0000406 3300053118 Bacteria 9542
744 Ga0500595_002777 3300053119 Bacteria 8434
745 Ga0500608_061213 3300053122 Bacteria 1799
746 Ga0500642_0000002 3300053130 Bacteria 795093
747 Ga0500642_0017740 3300053130 Bacteria 2736
748 Ga0500652_049004 3300053131 Bacteria 1720
749 Ga0500658_0050263 3300053134 Bacteria 1701
750 Ga0500573_0000002 3300053140 Bacteria 407088
751 Ga0500573_0000029 3300053140 Bacteria 135595
752 Ga0500604_0000275 3300053151 Bacteria 14285
753 Ga0500616_0000042 3300053153 Bacteria 351293
754 Ga0500616_0000293 3300053153 Bacteria 72597
755 Ga0500616_0000626 3300053153 Bacteria 42914
756 Ga0500616_0009558 3300053153 Bacteria 5891
757 Ga0500616_0026195 3300053153 Bacteria 3230
758 Ga0500616_0030689 3300053153 Bacteria 2949
759 Ga0500616_0054945 3300053153 Bacteria 2084
760 Ga0500622_0001865 3300053156 Bacteria 15924
761 Ga0500622_0002056 3300053156 Bacteria 14993
762 Ga0500622_0020235 3300053156 Bacteria 3534
763 Ga0500622_0023574 3300053156 Bacteria 3259
764 Ga0500638_002144 3300053162 Bacteria 6706
765 Ga0500637_0000954 3300053178 Bacteria 11760
766 Ga0500645_000002 3300053730 Bacteria 388892
767 Ga0500645_000517 3300053730 Bacteria 25761
768 Ga0500645_001489 3300053730 Bacteria 11754
769 Ga0500645_005247 3300053730 Bacteria 4810
770 Ga0500645_021801 3300053730 Bacteria 1975
771 Ga0500587_000307 3300053739 Bacteria 5491
772 Ga0587072_005443 3300059643 Bacteria 1900
773 Ga0466962_0001864 3300061719 Bacteria 9909
774 Ga0466962_0003379 3300061719 Bacteria 7595

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025915 Ga0207693_10269951 Ga0207693_102699511 316
2 3300046557 Ga0495622_0125213 Ga0495622_0125213_42_1061 323
3 3300009098 Ga0105245_10468875 Ga0105245_104688752 324
4 3300013307 Ga0157372_10000149 Ga0157372_1000014959 332
5 3300005327 Ga0070658_10284790 Ga0070658_102847902 334
6 3300046616 Ga0495668_0141008 Ga0495668_0141008_10_1080 342
7 3300048915 Ga0496112_0368312 Ga0496112_0368312_43_1116 345
8 3300046501 Ga0495607_0130359 Ga0495607_0130359_191_1267 347
9 3300044901 Ga0466960_0167635 Ga0466960_0167635_15_1103 348
10 3300025901 Ga0207688_10052808 Ga0207688_100528081 360
11 3300025944 Ga0207661_10199067 Ga0207661_101990672 360
12 3300048912 Ga0496109_0094770 Ga0496109_0094770_12_1145 365
13 3300006844 Ga0075428_100122559 Ga0075428_1001225592 366
14 3300048926 Ga0496123_0002266 Ga0496123_0002266_9999_11294 379
15 3300048928 Ga0496125_0068929 Ga0496125_0068929_17_1309 381
16 3300003792 Ga0055540_1000003 Ga0055540_1000003278 382
17 3300025303 Ga0209051_1000011 Ga0209051_1000011318 382
18 3300031616 Ga0307508_10032102 Ga0307508_100321022 382
19 3300005564 Ga0070664_100025219 Ga0070664_1000252192 383
20 3300005618 Ga0068864_100044774 Ga0068864_1000447742 383
21 3300014326 Ga0157380_10031110 Ga0157380_100311103 383
22 3300025945 Ga0207679_10009846 Ga0207679_100098464 383
23 3300026088 Ga0207641_10274672 Ga0207641_102746721 383
24 3300031239 Ga0265328_10001466 Ga0265328_100014665 383
25 3300031344 Ga0265316_10144748 Ga0265316_101447481 383
26 3300031995 Ga0307409_100069989 Ga0307409_1000699892 383
27 3300009093 Ga0105240_10164625 Ga0105240_101646253 384
28 3300025913 Ga0207695_10115979 Ga0207695_101159793 384
29 3300053153 Ga0500616_0009558 Ga0500616_0009558_4582_5868 384
30 3300009098 Ga0105245_10225045 Ga0105245_102250452 386
31 3300031507 Ga0307509_10059371 Ga0307509_100593713 386
32 3300046616 Ga0495668_0002195 Ga0495668_0002195_60_1466 387
33 3300049580 Ga0501046_0077105 Ga0501046_0077105_15_1253 387
34 3300053079 Ga0500610_0012721 Ga0500610_0012721_233_1564 387
35 3300053134 Ga0500658_0050263 Ga0500658_0050263_15_1376 387
36 3300053730 Ga0500645_021801 Ga0500645_021801_576_1919 387
37 3300005985 Ga0081539_10002432 Ga0081539_100024328 388
38 3300009094 Ga0111539_10131569 Ga0111539_101315692 388
39 3300050511 nmdc:mga08y16_199748_c1 nmdc:mga08y16_199748_c1_237_1541 388
40 3300005455 Ga0070663_100055920 Ga0070663_1000559203 389
41 3300005578 Ga0068854_100035972 Ga0068854_1000359723 389
42 3300005616 Ga0068852_100052820 Ga0068852_1000528202 389
43 3300006048 Ga0075363_100000051 Ga0075363_10000005123 389
44 3300010375 Ga0105239_10025788 Ga0105239_100257885 389
45 3300025981 Ga0207640_10007204 Ga0207640_100072045 389
46 3300026067 Ga0207678_10002629 Ga0207678_1000262913 389
47 3300026118 Ga0207675_100087142 Ga0207675_1000871423 389
48 3300026142 Ga0207698_10072327 Ga0207698_100723272 389
49 3300028379 Ga0268266_10224302 Ga0268266_102243021 389
50 3300048912 Ga0496109_0005013 Ga0496109_0005013_1902_3233 389
51 3300048915 Ga0496112_0006823 Ga0496112_0006823_4454_5785 389
52 3300048916 Ga0496113_0088079 Ga0496113_0088079_924_2255 389
53 3300009551 Ga0105238_10022601 Ga0105238_100226015 390
54 3300025924 Ga0207694_10162935 Ga0207694_101629352 390
55 3300031852 Ga0307410_10003115 Ga0307410_100031154 390
56 3300031903 Ga0307407_10003631 Ga0307407_100036313 390
57 3300031995 Ga0307409_100004024 Ga0307409_1000040245 390
58 3300032004 Ga0307414_10003418 Ga0307414_100034188 390
59 3300032005 Ga0307411_10074757 Ga0307411_100747572 390
60 3300046665 Ga0495661_0000055 Ga0495661_0000055_72508_73821 390
61 3300053131 Ga0500652_049004 Ga0500652_049004_186_1481 391
62 3300001989 JGI24739J22299_10024202 JGI24739J22299_100242022 392
63 3300003354 JGI25160J50197_1003101 JGI25160J50197_10031014 392
64 3300005262 Ga0065165_1010558 Ga0065165_10105583 392
65 3300006048 Ga0075363_100060203 Ga0075363_1000602032 392
66 3300006186 Ga0075369_10001593 Ga0075369_100015935 392
67 3300025297 Ga0209758_1026024 Ga0209758_10260242 392
68 3300025302 Ga0207426_1000313 Ga0207426_100031344 392
69 3300046674 Ga0495588_0034047 Ga0495588_0034047_243_1559 392
70 3300048905 Ga0496102_0019806 Ga0496102_0019806_1538_2896 392
71 3300009093 Ga0105240_10018898 Ga0105240_100188984 393
72 3300028380 Ga0268265_10046537 Ga0268265_100465372 393
73 3300038705 Ga0237819_00121 Ga0237819_00121_24756_26033 393
74 3300039145 Ga0237816_00660 Ga0237816_00660_1229_2506 393
75 3300046524 Ga0495648_0007599 Ga0495648_0007599_6231_7553 393
76 3300046616 Ga0495668_0061652 Ga0495668_0061652_613_1935 393
77 3300046692 Ga0495671_0011594 Ga0495671_0011594_882_2204 393
78 3300047320 Ga0495672_0012840 Ga0495672_0012840_2705_4027 393
79 3300047469 Ga0495673_0001871 Ga0495673_0001871_8117_9439 393
80 3300048929 Ga0496126_0070584 Ga0496126_0070584_486_1808 393
81 3300049579 Ga0501043_0051406 Ga0501043_0051406_751_2070 393
82 3300049581 Ga0501047_0006704 Ga0501047_0006704_54_1355 393
83 3300053087 Ga0500643_002379 Ga0500643_002379_2499_3821 393
84 3300005327 Ga0070658_10126130 Ga0070658_101261302 394
85 3300005347 Ga0070668_100002649 Ga0070668_1000026496 394
86 3300025909 Ga0207705_10022095 Ga0207705_100220952 394
87 3300025909 Ga0207705_10051621 Ga0207705_100516212 394
88 3300025972 Ga0207668_10000491 Ga0207668_1000049114 394
89 3300031507 Ga0307509_10006676 Ga0307509_100066764 394
90 3300044656 Ga0466969_0064503 Ga0466969_0064503_253_1560 394
91 3300044693 Ga0466961_0033128 Ga0466961_0033128_1458_2834 394
92 3300044735 Ga0466968_0017456 Ga0466968_0017456_1107_2483 394
93 iso_pu_bacteria 2858438669 2858439593 394
94 iso_pu_bacteria 2928519762 2928520345 394
95 3300002773 JGI25152J39213_1000016 JGI25152J39213_100001645 395
96 3300002774 JGI25150J39212_1000003 JGI25150J39212_1000003350 395
97 3300002774 JGI25150J39212_1000004 JGI25150J39212_1000004274 395
98 3300003187 JGI25151J46595_10000002 JGI25151J46595_10000002350 395
99 3300003215 JGI25153J46596_10000015 JGI25153J46596_10000015161 395
100 3300003320 rootH2_10001801 rootH2_1000180179 395
101 3300005339 Ga0070660_100128661 Ga0070660_1001286611 395
102 3300009093 Ga0105240_10079491 Ga0105240_100794915 395
103 3300009093 Ga0105240_10119764 Ga0105240_101197644 395
104 3300009174 Ga0105241_10255484 Ga0105241_102554841 395
105 3300013307 Ga0157372_10245387 Ga0157372_102453872 395
106 3300021361 Ga0213872_10006956 Ga0213872_100069562 395
107 3300025245 Ga0207425_1000003 Ga0207425_1000003494 395
108 3300025258 Ga0209129_1000014 Ga0209129_1000014339 395
109 3300025294 Ga0209025_1000007 Ga0209025_1000007493 395
110 3300025297 Ga0209758_1000012 Ga0209758_1000012494 395
111 3300025302 Ga0207426_1004156 Ga0207426_10041565 395
112 3300025911 Ga0207654_10052585 Ga0207654_100525851 395
113 3300025913 Ga0207695_10057496 Ga0207695_100574965 395
114 3300037312 Ga0395899_0002435 Ga0395899_0002435_3242_4618 395
115 3300037312 Ga0395899_0064489 Ga0395899_0064489_1370_2635 395
116 3300039447 Ga0436361_0637365 Ga0436361_0637365_285_1568 395
117 3300046684 Ga0495669_0003427 Ga0495669_0003427_1529_2827 395
118 3300049572 Ga0501036_0199548 Ga0501036_0199548_64_1368 395
119 3300049758 Ga0501241_004656 Ga0501241_004656_873_2150 395
120 3300049823 Ga0501044_0361121 Ga0501044_0361121_46_1314 395
121 3300053140 Ga0500573_0000002 Ga0500573_0000002_122973_124256 395
122 3300053156 Ga0500622_0002056 Ga0500622_0002056_2043_3323 395
123 iso_pu_bacteria 2862178590 2862186584 395
124 iso_pu_bacteria 8056447290 8056449402 395
125 3300003322 rootL2_10034836 rootL2_1003483616 396
126 3300005327 Ga0070658_10022682 Ga0070658_100226824 396
127 3300005937 Ga0081455_10063949 Ga0081455_100639492 396
128 3300010375 Ga0105239_10040042 Ga0105239_100400424 396
129 3300013104 Ga0157370_10011309 Ga0157370_100113093 396
130 3300025250 Ga0209026_1000416 Ga0209026_100041613 396
131 3300025938 Ga0207704_10056850 Ga0207704_100568502 396
132 3300025942 Ga0207689_10084499 Ga0207689_100844991 396
133 3300048918 Ga0496115_0206191 Ga0496115_0206191_326_1594 396
134 3300048925 Ga0496122_0001014 Ga0496122_0001014_46184_47467 396
135 3300048926 Ga0496123_0000212 Ga0496123_0000212_44581_45864 396
136 3300053730 Ga0500645_001489 Ga0500645_001489_3429_4733 396
137 iso_pu_bacteria 2738541274 2738703369 396
138 iso_pu_bacteria 2895427314 2895432235 396
139 3300005289 Ga0065704_10074342 Ga0065704_100743423 397
140 3300005331 Ga0070670_100000027 Ga0070670_100000027130 397
141 3300005367 Ga0070667_100000638 Ga0070667_10000063813 397
142 3300005618 Ga0068864_100000083 Ga0068864_10000008379 397
143 3300005841 Ga0068863_100000025 Ga0068863_10000002579 397
144 3300005842 Ga0068858_100089625 Ga0068858_1000896252 397
145 3300005844 Ga0068862_100000027 Ga0068862_100000027136 397
146 3300006195 Ga0075366_10008428 Ga0075366_100084283 397
147 3300009011 Ga0105251_10000138 Ga0105251_1000013878 397
148 3300009101 Ga0105247_10002888 Ga0105247_100028883 397
149 3300009177 Ga0105248_10000026 Ga0105248_10000026106 397
150 3300009177 Ga0105248_10025719 Ga0105248_100257194 397
151 3300009553 Ga0105249_10000123 Ga0105249_1000012386 397
152 3300009553 Ga0105249_10023672 Ga0105249_100236723 397
153 3300014968 Ga0157379_10021758 Ga0157379_100217582 397
154 3300025250 Ga0209026_1005274 Ga0209026_10052742 397
155 3300025735 Ga0207713_1049818 Ga0207713_10498181 397
156 3300025900 Ga0207710_10020090 Ga0207710_100200902 397
157 3300025925 Ga0207650_10000056 Ga0207650_1000005694 397
158 3300025941 Ga0207711_10000004 Ga0207711_10000004121 397
159 3300025961 Ga0207712_10000102 Ga0207712_1000010287 397
160 3300025961 Ga0207712_10012601 Ga0207712_100126012 397
161 3300025986 Ga0207658_10000251 Ga0207658_1000025139 397
162 3300026075 Ga0207708_10079598 Ga0207708_100795982 397
163 3300026088 Ga0207641_10000018 Ga0207641_10000018236 397
164 3300026095 Ga0207676_10000027 Ga0207676_10000027181 397
165 3300028380 Ga0268265_10000042 Ga0268265_10000042123 397
166 3300032004 Ga0307414_10016685 Ga0307414_100166854 397
167 3300037466 Ga0395898_0058759 Ga0395898_0058759_1329_2705 397
168 3300046463 Ga0495653_0000527 Ga0495653_0000527_7732_9045 397
169 3300046507 Ga0495606_0001152 Ga0495606_0001152_15974_17287 397
170 3300048091 Ga0495626_0025948 Ga0495626_0025948_528_1940 397
171 3300048920 Ga0496117_0005187 Ga0496117_0005187_8355_9629 397
172 3300048921 Ga0496118_0000262 Ga0496118_0000262_18857_20131 397
173 3300049581 Ga0501047_0069738 Ga0501047_0069738_529_1899 397
174 3300050493 nmdc:mga0k408_7155_c1 nmdc:mga0k408_7155_c1_3322_4599 397
175 iso_pu_bacteria 2914759650 2914762916 397
176 3300005329 Ga0070683_100010869 Ga0070683_10001086910 398
177 3300005331 Ga0070670_100055135 Ga0070670_1000551351 398
178 3300005331 Ga0070670_100119540 Ga0070670_1001195402 398
179 3300005338 Ga0068868_100043366 Ga0068868_1000433665 398
180 3300005341 Ga0070691_10054800 Ga0070691_100548002 398
181 3300005364 Ga0070673_100063713 Ga0070673_1000637134 398
182 3300005535 Ga0070684_100022411 Ga0070684_1000224115 398
183 3300005564 Ga0070664_100012258 Ga0070664_1000122586 398
184 3300005616 Ga0068852_100033802 Ga0068852_1000338022 398
185 3300013296 Ga0157374_10043528 Ga0157374_100435283 398
186 3300013296 Ga0157374_10160140 Ga0157374_101601402 398
187 3300025920 Ga0207649_10022312 Ga0207649_100223122 398
188 3300025925 Ga0207650_10001645 Ga0207650_100016451 398
189 3300025925 Ga0207650_10015096 Ga0207650_100150962 398
190 3300025940 Ga0207691_10007560 Ga0207691_100075605 398
191 3300025944 Ga0207661_10007992 Ga0207661_100079923 398
192 3300025945 Ga0207679_10028387 Ga0207679_100283872 398
193 3300025960 Ga0207651_10060067 Ga0207651_100600673 398
194 3300026023 Ga0207677_10217630 Ga0207677_102176301 398
195 3300026118 Ga0207675_100090177 Ga0207675_1000901774 398
196 3300046520 Ga0495637_0011991 Ga0495637_0011991_968_2284 398
197 3300046616 Ga0495668_0101824 Ga0495668_0101824_176_1465 398
198 3300046648 Ga0495611_0007828 Ga0495611_0007828_122_1438 398
199 3300046660 Ga0495625_0002196 Ga0495625_0002196_8900_10216 398
200 3300046684 Ga0495669_0000104 Ga0495669_0000104_8892_10208 398
201 3300048911 Ga0496108_0001640 Ga0496108_0001640_11102_12361 398
202 3300048927 Ga0496124_0005682 Ga0496124_0005682_2053_3384 398
203 3300053079 Ga0500610_0000215 Ga0500610_0000215_15271_16587 398
204 3300053087 Ga0500643_003227 Ga0500643_003227_2188_3477 398
205 3300053153 Ga0500616_0000626 Ga0500616_0000626_27227_28591 398
206 3300053730 Ga0500645_000002 Ga0500645_000002_107772_109088 398
207 3300009553 Ga0105249_10024158 Ga0105249_100241585 399
208 3300011119 Ga0105246_10005371 Ga0105246_100053715 399
209 3300013102 Ga0157371_10005522 Ga0157371_100055225 399
210 3300013306 Ga0163162_10003740 Ga0163162_1000374011 399
211 3300025901 Ga0207688_10007026 Ga0207688_100070265 399
212 3300025933 Ga0207706_10048379 Ga0207706_100483792 399
213 3300031548 Ga0307408_100153986 Ga0307408_1001539862 399
214 3300037471 Ga0395905_0132498 Ga0395905_0132498_861_2129 399
215 3300046660 Ga0495625_0006917 Ga0495625_0006917_2983_4272 399
216 3300046684 Ga0495669_0046662 Ga0495669_0046662_400_1668 399
217 3300053087 Ga0500643_005019 Ga0500643_005019_2365_3654 399
218 3300053104 Ga0500556_0000049 Ga0500556_0000049_14538_15842 399
219 3300053130 Ga0500642_0000002 Ga0500642_0000002_115810_117099 399
220 iso_pu_bacteria 2551306519 2553391355 399
221 iso_pu_bacteria 2585428060 2587747360 399
222 iso_pu_bacteria 2599185359 2600225334 399
223 iso_pu_bacteria 2643221729 2644703472 399
224 iso_pu_bacteria 2643221730 2644712402 399
225 iso_pu_bacteria 2684622632 2685148823 399
226 iso_pu_bacteria 2695420987 2698324341 399
227 iso_pu_bacteria 2703719227 2705992796 399
228 iso_pu_bacteria 2718218445 2721504209 399
229 iso_pu_bacteria 2738541284 2738763599 399
230 iso_pu_bacteria 2738541358 2739159747 399
231 iso_pu_bacteria 2738543006 2739212312 399
232 iso_pu_bacteria 2772190705 2772606597 399
233 iso_pu_bacteria 2818991443 2819584570 399
234 iso_pu_bacteria 2879163058 2879166282 399
235 iso_pu_bacteria 2929233124 2929234122 399
236 iso_pu_bacteria 2938917290 2938918286 399
237 iso_pu_bacteria 2947426588 2947427609 399
238 iso_pu_bacteria 2965761152 2965762161 399
239 iso_pu_bacteria 2979083700 2979084591 399
240 iso_pu_bacteria 8022621104 8022622063 399
241 iso_pu_bacteria 8023438354 8023443542 399
242 iso_pu_bacteria 8023444577 8023449139 399
243 3300003911 JGI25405J52794_10004542 JGI25405J52794_100045422 400
244 3300005444 Ga0070694_100006716 Ga0070694_1000067165 400
245 3300005471 Ga0070698_100007890 Ga0070698_1000078909 400
246 3300005518 Ga0070699_100019463 Ga0070699_1000194632 400
247 3300005546 Ga0070696_100018171 Ga0070696_1000181711 400
248 3300005548 Ga0070665_100088738 Ga0070665_1000887382 400
249 3300005549 Ga0070704_100003498 Ga0070704_1000034987 400
250 3300005617 Ga0068859_100048570 Ga0068859_1000485702 400
251 3300005937 Ga0081455_10000021 Ga0081455_10000021131 400
252 3300006931 Ga0097620_100048565 Ga0097620_1000485652 400
253 3300009176 Ga0105242_10020912 Ga0105242_100209122 400
254 3300025942 Ga0207689_10111859 Ga0207689_101118592 400
255 3300028379 Ga0268266_10003975 Ga0268266_100039751 400
256 3300031548 Ga0307408_100041473 Ga0307408_1000414732 400
257 3300031616 Ga0307508_10000921 Ga0307508_1000092111 400
258 3300031731 Ga0307405_10032740 Ga0307405_100327403 400
259 3300041453 Ga0451797_0154013 Ga0451797_0154013_136_1455 400
260 3300042007 Ga0439449_0002747 Ga0439449_0002747_5346_6686 400
261 3300044684 Ga0466966_0007047 Ga0466966_0007047_3646_4956 400
262 3300044719 Ga0466971_0011695 Ga0466971_0011695_2392_3702 400
263 3300045049 Ga0466959_0118008 Ga0466959_0118008_133_1443 400
264 3300045836 Ga0466958_0047382 Ga0466958_0047382_471_1781 400
265 3300046692 Ga0495671_0036177 Ga0495671_0036177_1050_2354 400
266 3300047320 Ga0495672_0010100 Ga0495672_0010100_3999_5345 400
267 3300049652 Ga0501202_017065 Ga0501202_017065_29_1351 400
268 3300049672 Ga0501239_003632 Ga0501239_003632_101_1423 400
269 3300053118 Ga0500594_0000406 Ga0500594_0000406_7609_8913 400
270 3300061719 Ga0466962_0001864 Ga0466962_0001864_6010_7320 400
271 iso_pu_bacteria 2643221634 2644196391 400
272 iso_pu_bacteria 2643221663 2644354055 400
273 iso_pu_bacteria 2643221695 2644528052 400
274 iso_pu_bacteria 2902792274 2902797894 400
275 iso_pu_bacteria 2929154850 2929155203 400
276 iso_pu_bacteria 2946024296 2946024581 400
277 iso_pu_bacteria 2977232053 2977233685 400
278 iso_pu_bacteria 8056207758 8056214538 400
279 3300003323 rootH1_10012599 rootH1_1001259956 401
280 3300005262 Ga0065165_1002643 Ga0065165_10026437 401
281 3300005437 Ga0070710_10000514 Ga0070710_1000051410 401
282 3300007076 Ga0075435_100003419 Ga0075435_1000034195 401
283 3300009553 Ga0105249_10010730 Ga0105249_100107302 401
284 3300025898 Ga0207692_10008674 Ga0207692_100086745 401
285 3300025961 Ga0207712_10006888 Ga0207712_100068887 401
286 3300031456 Ga0307513_10181155 Ga0307513_101811552 401
287 3300031507 Ga0307509_10015731 Ga0307509_100157318 401
288 3300031507 Ga0307509_10069425 Ga0307509_100694253 401
289 3300037466 Ga0395898_0000049 Ga0395898_0000049_86446_87753 401
290 3300044656 Ga0466969_0002062 Ga0466969_0002062_3556_4878 401
291 3300044658 Ga0466972_0005704 Ga0466972_0005704_2261_3562 401
292 3300044658 Ga0466972_0034292 Ga0466972_0034292_1047_2354 401
293 3300044672 Ga0466982_0000003 Ga0466982_0000003_393346_394653 401
294 3300044683 Ga0466965_0001591 Ga0466965_0001591_2088_3389 401
295 3300044683 Ga0466965_0038543 Ga0466965_0038543_771_2093 401
296 3300044684 Ga0466966_0028158 Ga0466966_0028158_1504_2811 401
297 3300044693 Ga0466961_0007493 Ga0466961_0007493_2193_3515 401
298 3300044706 Ga0466964_0005625 Ga0466964_0005625_2876_4183 401
299 3300044719 Ga0466971_0001735 Ga0466971_0001735_6371_7678 401
300 3300044765 Ga0466970_0023508 Ga0466970_0023508_1720_3027 401
301 3300044901 Ga0466960_0000132 Ga0466960_0000132_7597_8898 401
302 3300044901 Ga0466960_0005384 Ga0466960_0005384_2853_4160 401
303 3300045049 Ga0466959_0051225 Ga0466959_0051225_140_1462 401
304 3300047472 Ga0495686_0001176 Ga0495686_0001176_25868_27154 401
305 3300061719 Ga0466962_0003379 Ga0466962_0003379_3065_4372 401
306 iso_pu_bacteria 2588254257 2590613401 401
307 iso_pu_bacteria 2596583598 2597027985 401
308 iso_pu_bacteria 2599185178 2599444658 401
309 iso_pu_bacteria 2852623160 2852624687 401
310 iso_pu_bacteria 2881955468 2881956350 401
311 iso_pu_bacteria 2885266251 2885266419 401
312 iso_pu_bacteria 2900577576 2900580041 401
313 iso_pu_bacteria 2928058823 2928059796 401
314 iso_pu_bacteria 2997600082 2997600696 401
315 3300001979 JGI24740J21852_10001793 JGI24740J21852_100017934 402
316 3300001979 JGI24740J21852_10005576 JGI24740J21852_100055762 402
317 3300001979 JGI24740J21852_10006495 JGI24740J21852_100064953 402
318 3300001989 JGI24739J22299_10002030 JGI24739J22299_100020304 402
319 3300002987 JGI25159J45721_1002626 JGI25159J45721_10026264 402
320 3300003187 JGI25151J46595_10014371 JGI25151J46595_100143712 402
321 3300003187 JGI25151J46595_10016138 JGI25151J46595_100161383 402
322 3300003187 JGI25151J46595_10017907 JGI25151J46595_100179072 402
323 3300003187 JGI25151J46595_10027517 JGI25151J46595_100275172 402
324 3300003187 JGI25151J46595_10033087 JGI25151J46595_100330871 402
325 3300003187 JGI25151J46595_10039002 JGI25151J46595_100390022 402
326 3300003316 rootH1_10014435 rootH1_100144357 402
327 3300003322 rootL2_10141361 rootL2_101413617 402
328 3300003578 Ga0006562J51391_1012222 Ga0006562J51391_10122221 402
329 3300003578 Ga0006562J51391_1016016 Ga0006562J51391_10160163 402
330 3300003578 Ga0006562J51391_1016017 Ga0006562J51391_10160172 402
331 3300003758 Ga0055532_1001906 Ga0055532_10019064 402
332 3300005344 Ga0070661_100169282 Ga0070661_1001692822 402
333 3300005530 Ga0070679_100085544 Ga0070679_1000855442 402
334 3300005544 Ga0070686_100000553 Ga0070686_10000055321 402
335 3300005563 Ga0068855_100020165 Ga0068855_1000201656 402
336 3300005563 Ga0068855_100349061 Ga0068855_1003490612 402
337 3300005577 Ga0068857_100000513 Ga0068857_1000005136 402
338 3300005614 Ga0068856_100021956 Ga0068856_1000219567 402
339 3300005616 Ga0068852_100040812 Ga0068852_1000408122 402
340 3300005842 Ga0068858_100007771 Ga0068858_1000077716 402
341 3300009036 Ga0105244_10011682 Ga0105244_100116828 402
342 3300009092 Ga0105250_10000793 Ga0105250_100007933 402
343 3300009093 Ga0105240_10011125 Ga0105240_100111253 402
344 3300009148 Ga0105243_10014444 Ga0105243_100144444 402
345 3300009545 Ga0105237_10000026 Ga0105237_1000002612 402
346 3300009551 Ga0105238_10018672 Ga0105238_100186724 402
347 3300010159 Ga0099796_10002492 Ga0099796_100024923 402
348 3300010375 Ga0105239_10008875 Ga0105239_100088752 402
349 3300012500 Ga0157314_1000397 Ga0157314_10003972 402
350 3300013104 Ga0157370_10048771 Ga0157370_100487713 402
351 3300013104 Ga0157370_10056458 Ga0157370_100564584 402
352 3300013105 Ga0157369_10224587 Ga0157369_102245872 402
353 3300014326 Ga0157380_10120027 Ga0157380_101200272 402
354 3300025229 Ga0209147_100115 Ga0209147_100115106 402
355 3300025258 Ga0209129_1001768 Ga0209129_10017683 402
356 3300025284 Ga0209130_1001011 Ga0209130_10010119 402
357 3300025294 Ga0209025_1000724 Ga0209025_100072417 402
358 3300025294 Ga0209025_1001437 Ga0209025_10014379 402
359 3300025294 Ga0209025_1002332 Ga0209025_10023329 402
360 3300025294 Ga0209025_1005432 Ga0209025_100543210 402
361 3300025294 Ga0209025_1008485 Ga0209025_10084852 402
362 3300025294 Ga0209025_1009574 Ga0209025_10095744 402
363 3300025294 Ga0209025_1010749 Ga0209025_10107493 402
364 3300025294 Ga0209025_1011402 Ga0209025_10114024 402
365 3300025294 Ga0209025_1016889 Ga0209025_10168892 402
366 3300025294 Ga0209025_1017894 Ga0209025_10178942 402
367 3300025294 Ga0209025_1024984 Ga0209025_10249845 402
368 3300025294 Ga0209025_1027121 Ga0209025_10271212 402
369 3300025294 Ga0209025_1036044 Ga0209025_10360442 402
370 3300025294 Ga0209025_1046600 Ga0209025_10466001 402
371 3300025297 Ga0209758_1000269 Ga0209758_100026944 402
372 3300025297 Ga0209758_1000309 Ga0209758_100030935 402
373 3300025711 Ga0207696_1002900 Ga0207696_10029002 402
374 3300025728 Ga0207655_1017390 Ga0207655_10173902 402
375 3300025735 Ga0207713_1023169 Ga0207713_10231692 402
376 3300025735 Ga0207713_1033299 Ga0207713_10332991 402
377 3300025735 Ga0207713_1049139 Ga0207713_10491392 402
378 3300025904 Ga0207647_10027823 Ga0207647_100278232 402
379 3300025913 Ga0207695_10005571 Ga0207695_100055717 402
380 3300025914 Ga0207671_10000041 Ga0207671_10000041176 402
381 3300025921 Ga0207652_10004883 Ga0207652_100048837 402
382 3300025935 Ga0207709_10000305 Ga0207709_1000030531 402
383 3300025949 Ga0207667_10000428 Ga0207667_1000042839 402
384 3300025949 Ga0207667_10276870 Ga0207667_102768702 402
385 3300026035 Ga0207703_10022204 Ga0207703_100222042 402
386 3300026078 Ga0207702_10023308 Ga0207702_100233083 402
387 3300026116 Ga0207674_10000209 Ga0207674_1000020910 402
388 3300027512 Ga0209179_1002620 Ga0209179_10026202 402
389 3300030083 Ga0237817_10088 Ga0237817_100883 402
390 3300030083 Ga0237817_10199 Ga0237817_101992 402
391 3300030083 Ga0237817_10571 Ga0237817_105713 402
392 3300031548 Ga0307408_100232652 Ga0307408_1002326522 402
393 3300031731 Ga0307405_10105375 Ga0307405_101053752 402
394 3300031852 Ga0307410_10166443 Ga0307410_101664431 402
395 3300031995 Ga0307409_100005574 Ga0307409_1000055747 402
396 3300032005 Ga0307411_10005783 Ga0307411_100057832 402
397 3300038705 Ga0237819_00430 Ga0237819_00430_1313_2635 402
398 3300038705 Ga0237819_02219 Ga0237819_02219_1294_2616 402
399 3300042007 Ga0439449_0011729 Ga0439449_0011729_508_1809 402
400 3300042007 Ga0439449_0020874 Ga0439449_0020874_1017_2399 402
401 3300045976 Ga0466967_0000281 Ga0466967_0000281_6049_7371 402
402 3300046492 Ga0495585_0000330 Ga0495585_0000330_6984_8318 402
403 3300046524 Ga0495648_0007985 Ga0495648_0007985_3977_5275 402
404 3300046538 Ga0495609_0010947 Ga0495609_0010947_2551_3849 402
405 3300046558 Ga0495633_0000759 Ga0495633_0000759_16014_17282 402
406 3300046616 Ga0495668_0000044 Ga0495668_0000044_128246_129544 402
407 3300047315 Ga0495581_0018902 Ga0495581_0018902_170_1528 402
408 3300048907 Ga0496104_0040214 Ga0496104_0040214_2596_3942 402
409 3300048909 Ga0496106_0001233 Ga0496106_0001233_15388_16734 402
410 3300048910 Ga0496107_0030713 Ga0496107_0030713_2091_3437 402
411 3300048924 Ga0496121_0005989 Ga0496121_0005989_665_1972 402
412 3300048928 Ga0496125_0001371 Ga0496125_0001371_23829_25136 402
413 3300048928 Ga0496125_0025101 Ga0496125_0025101_2517_3863 402
414 3300048929 Ga0496126_0191073 Ga0496126_0191073_269_1615 402
415 3300049581 Ga0501047_0011301 Ga0501047_0011301_6806_8089 402
416 3300049823 Ga0501044_0012022 Ga0501044_0012022_7459_8742 402
417 iso_pu_bacteria 2510917027 2511178903 402
418 iso_pu_bacteria 2512564013 2512636140 402
419 iso_pu_bacteria 2512564039 2512734027 402
420 iso_pu_bacteria 2585428059 2587741624 402
421 iso_pu_bacteria 2643221676 2644428394 402
422 iso_pu_bacteria 2643221731 2644718451 402
423 iso_pu_bacteria 2643221732 2644725353 402
424 iso_pu_bacteria 2711768088 2712199411 402
425 iso_pu_bacteria 2738543011 2739236906 402
426 iso_pu_bacteria 2808606982 2811842546 402
427 iso_pu_bacteria 2818991465 2819707604 402
428 iso_pu_bacteria 2842882022 2842882072 402
429 iso_pu_bacteria 2857465823 2857466600 402
430 iso_pu_bacteria 2857465823 2857470997 402
431 iso_pu_bacteria 2857591370 2857592625 402
432 iso_pu_bacteria 2857591370 2857596562 402
433 iso_pu_bacteria 2863404153 2863409802 402
434 iso_pu_bacteria 2864997549 2864998437 402
435 iso_pu_bacteria 2864997549 2865001830 402
436 iso_pu_bacteria 2867475112 2867479496 402
437 iso_pu_bacteria 2884933994 2884936426 402
438 iso_pu_bacteria 2889300758 2889305799 402
439 iso_pu_bacteria 2904524088 2904527273 402
440 iso_pu_bacteria 2915597211 2915599962 402
441 iso_pu_bacteria 2915606848 2915609673 402
442 iso_pu_bacteria 2919143609 2919144136 402
443 iso_pu_bacteria 2919425241 2919426379 402
444 iso_pu_bacteria 2919517244 2919519332 402
445 iso_pu_bacteria 2919720352 2919720467 402
446 iso_pu_bacteria 2928093941 2928095762 402
447 iso_pu_bacteria 2929004312 2929007960 402
448 iso_pu_bacteria 2929183550 2929185144 402
449 iso_pu_bacteria 2939743619 2939743935 402
450 iso_pu_bacteria 2960319331 2960322947 402
451 iso_pu_bacteria 2960375949 2960381722 402
452 iso_pu_bacteria 2980125574 2980130510 402
453 iso_pu_bacteria 2997451912 2997455636 402
454 iso_pu_bacteria 3006393351 3006399732 402
455 iso_pu_bacteria 8004021418 8004021736 402
456 iso_pu_bacteria 8004021418 8004025231 402
457 iso_pu_bacteria 8004025490 8004026803 402
458 iso_pu_bacteria 8022792930 8022794952 402
459 iso_pu_bacteria 8022893055 8022894130 402
460 iso_pu_bacteria 8022914991 8022915579 402
461 iso_pu_bacteria 8053945823 8053952940 402
462 iso_pu_bacteria 8057582654 8057583671 402
463 3300001990 JGI24737J22298_10007765 JGI24737J22298_100077653 403
464 3300003794 Ga0055531_10001471 Ga0055531_100014712 403
465 3300005338 Ga0068868_100000063 Ga0068868_1000000639 403
466 3300005578 Ga0068854_100000612 Ga0068854_1000006128 403
467 3300013307 Ga0157372_10438725 Ga0157372_104387251 403
468 3300025304 Ga0209257_1001575 Ga0209257_10015759 403
469 3300025321 Ga0207656_10004664 Ga0207656_100046643 403
470 3300025933 Ga0207706_10049700 Ga0207706_100497003 403
471 3300025949 Ga0207667_10004100 Ga0207667_1000410018 403
472 3300025981 Ga0207640_10000185 Ga0207640_100001858 403
473 3300026023 Ga0207677_10000044 Ga0207677_10000044110 403
474 3300031824 Ga0307413_10061078 Ga0307413_100610782 403
475 3300031852 Ga0307410_10047646 Ga0307410_100476462 403
476 3300031852 Ga0307410_10090384 Ga0307410_100903842 403
477 3300031901 Ga0307406_10058812 Ga0307406_100588122 403
478 3300031911 Ga0307412_10041379 Ga0307412_100413792 403
479 3300037418 Ga0395900_0132975 Ga0395900_0132975_988_2286 403
480 3300048925 Ga0496122_0039799 Ga0496122_0039799_2237_3553 403
481 3300048926 Ga0496123_0020071 Ga0496123_0020071_2089_3405 403
482 3300048927 Ga0496124_0151122 Ga0496124_0151122_111_1427 403
483 3300049573 Ga0501037_0006585 Ga0501037_0006585_2847_4241 403
484 3300049581 Ga0501047_0020030 Ga0501047_0020030_199_1593 403
485 3300053088 Ga0500644_0005175 Ga0500644_0005175_814_2160 403
486 3300053104 Ga0500556_0005972 Ga0500556_0005972_1937_3265 403
487 3300053108 Ga0500562_000025 Ga0500562_000025_18013_19359 403
488 3300053108 Ga0500562_001325 Ga0500562_001325_896_2224 403
489 3300053140 Ga0500573_0000029 Ga0500573_0000029_1410_2681 403
490 3300053153 Ga0500616_0026195 Ga0500616_0026195_1570_2880 403
491 iso_pu_bacteria 2738541283 2738758739 403
492 iso_pu_bacteria 2784132109 2784473446 403
493 iso_pu_bacteria 2870782633 2870784970 403
494 iso_pu_bacteria 2899359706 2899360524 403
495 iso_pu_bacteria 2919391150 2919392574 403
496 3300005293 Ga0065715_10137322 Ga0065715_101373222 404
497 3300005347 Ga0070668_100174026 Ga0070668_1001740262 404
498 3300005458 Ga0070681_10002788 Ga0070681_1000278812 404
499 3300005543 Ga0070672_100184809 Ga0070672_1001848091 404
500 3300005548 Ga0070665_100000605 Ga0070665_10000060522 404
501 3300005614 Ga0068856_100000194 Ga0068856_1000001944 404
502 3300009177 Ga0105248_10064630 Ga0105248_100646302 404
503 3300013105 Ga0157369_10104723 Ga0157369_101047232 404
504 3300013306 Ga0163162_10042644 Ga0163162_100426443 404
505 3300013308 Ga0157375_10010613 Ga0157375_100106132 404
506 3300014497 Ga0182008_10057668 Ga0182008_100576682 404
507 3300017792 Ga0163161_10017243 Ga0163161_100172434 404
508 3300025250 Ga0209026_1013129 Ga0209026_10131292 404
509 3300025315 Ga0207697_10014484 Ga0207697_100144842 404
510 3300025912 Ga0207707_10066580 Ga0207707_100665802 404
511 3300025921 Ga0207652_10057707 Ga0207652_100577072 404
512 3300025940 Ga0207691_10056940 Ga0207691_100569402 404
513 3300025941 Ga0207711_10041090 Ga0207711_100410902 404
514 3300026035 Ga0207703_10112069 Ga0207703_101120692 404
515 3300026041 Ga0207639_10120297 Ga0207639_101202972 404
516 3300026067 Ga0207678_10012155 Ga0207678_100121558 404
517 3300026078 Ga0207702_10002214 Ga0207702_1000221414 404
518 3300026095 Ga0207676_10038759 Ga0207676_100387593 404
519 3300027907 Ga0207428_10002905 Ga0207428_100029053 404
520 3300028379 Ga0268266_10000394 Ga0268266_100003942 404
521 3300031507 Ga0307509_10020068 Ga0307509_100200685 404
522 3300032002 Ga0307416_100109541 Ga0307416_1001095411 404
523 3300041512 Ga0451853_1495030 Ga0451853_1495030_7393_8757 404
524 3300048910 Ga0496107_0019708 Ga0496107_0019708_1609_2886 404
525 3300048910 Ga0496107_0047994 Ga0496107_0047994_1515_2804 404
526 3300048917 Ga0496114_0022635 Ga0496114_0022635_2073_3350 404
527 3300049571 Ga0501034_0006142 Ga0501034_0006142_3132_4517 404
528 3300049574 Ga0501038_0018653 Ga0501038_0018653_1791_3176 404
529 3300049579 Ga0501043_0001562 Ga0501043_0001562_9246_10631 404
530 3300049580 Ga0501046_0016647 Ga0501046_0016647_3445_4830 404
531 3300049823 Ga0501044_0053391 Ga0501044_0053391_1824_3179 404
532 iso_pu_bacteria 2643221559 2643816168 404
533 iso_pu_bacteria 2643221573 2643877973 404
534 iso_pu_bacteria 2643221586 2643938196 404
535 iso_pu_bacteria 2643221612 2644077768 404
536 iso_pu_bacteria 2643221692 2644516408 404
537 iso_pu_bacteria 2643221720 2644659283 404
538 iso_pu_bacteria 2643221727 2644695939 404
539 iso_pu_bacteria 2643221728 2644698621 404
540 iso_pu_bacteria 2902048731 2902049401 404
541 iso_pu_bacteria 8022948649 8022952939 404
542 3300001915 JGI24741J21665_1000087 JGI24741J21665_100008722 405
543 3300001979 JGI24740J21852_10000056 JGI24740J21852_100000562 405
544 3300001979 JGI24740J21852_10009240 JGI24740J21852_100092402 405
545 3300002239 JGI24034J26672_10003921 JGI24034J26672_100039212 405
546 3300002705 JGI25156J39149_1002100 JGI25156J39149_10021003 405
547 3300002705 JGI25156J39149_1006039 JGI25156J39149_10060391 405
548 3300002738 JGI25154J39366_1000129 JGI25154J39366_100012923 405
549 3300003752 Ga0055539_1000081 Ga0055539_100008170 405
550 3300003756 Ga0055533_1000421 Ga0055533_10004212 405
551 3300003758 Ga0055532_1000048 Ga0055532_100004867 405
552 3300003759 Ga0055525_1000273 Ga0055525_100027343 405
553 3300003760 Ga0055527_1000387 Ga0055527_10003872 405
554 3300003761 Ga0055535_1000035 Ga0055535_100003567 405
555 3300003762 Ga0055542_1001297 Ga0055542_10012972 405
556 3300003763 Ga0055529_1000101 Ga0055529_1000101104 405
557 3300003841 Ga0055541_1000361 Ga0055541_10003614 405
558 3300005327 Ga0070658_10200008 Ga0070658_102000081 405
559 3300005337 Ga0070682_100137867 Ga0070682_1001378672 405
560 3300005347 Ga0070668_100000021 Ga0070668_10000002185 405
561 3300005347 Ga0070668_100128748 Ga0070668_1001287482 405
562 3300005355 Ga0070671_100001059 Ga0070671_1000010596 405
563 3300005366 Ga0070659_100009872 Ga0070659_1000098726 405
564 3300005455 Ga0070663_100000024 Ga0070663_10000002475 405
565 3300005548 Ga0070665_100002698 Ga0070665_10000269813 405
566 3300005548 Ga0070665_100187375 Ga0070665_1001873752 405
567 3300005564 Ga0070664_100000022 Ga0070664_10000002275 405
568 3300005577 Ga0068857_100049989 Ga0068857_1000499893 405
569 3300005578 Ga0068854_100000336 Ga0068854_10000033625 405
570 3300005614 Ga0068856_100000049 Ga0068856_10000004975 405
571 3300005617 Ga0068859_100045965 Ga0068859_1000459652 405
572 3300005617 Ga0068859_100177419 Ga0068859_1001774192 405
573 3300005719 Ga0068861_100147690 Ga0068861_1001476903 405
574 3300005841 Ga0068863_100000043 Ga0068863_10000004388 405
575 3300005843 Ga0068860_100003820 Ga0068860_1000038202 405
576 3300005844 Ga0068862_100000125 Ga0068862_10000012563 405
577 3300005844 Ga0068862_100012533 Ga0068862_1000125333 405
578 3300006931 Ga0097620_100045965 Ga0097620_1000459652 405
579 3300006931 Ga0097620_100177419 Ga0097620_1001774192 405
580 3300009093 Ga0105240_10181760 Ga0105240_101817602 405
581 3300009147 Ga0114129_10091845 Ga0114129_100918452 405
582 3300009553 Ga0105249_10008042 Ga0105249_100080428 405
583 3300013100 Ga0157373_10004557 Ga0157373_100045572 405
584 3300013100 Ga0157373_10016049 Ga0157373_100160495 405
585 3300013102 Ga0157371_10000089 Ga0157371_1000008973 405
586 3300013104 Ga0157370_10000002 Ga0157370_10000002316 405
587 3300013105 Ga0157369_10006987 Ga0157369_100069873 405
588 3300014326 Ga0157380_10046066 Ga0157380_100460663 405
589 3300015261 Ga0182006_1001276 Ga0182006_100127610 405
590 3300015262 Ga0182007_10007444 Ga0182007_100074443 405
591 3300025224 Ga0209784_100024 Ga0209784_100024291 405
592 3300025225 Ga0209566_100018 Ga0209566_100018291 405
593 3300025225 Ga0209566_100251 Ga0209566_10025139 405
594 3300025226 Ga0209674_100046 Ga0209674_10004672 405
595 3300025226 Ga0209674_100135 Ga0209674_10013565 405
596 3300025228 Ga0209672_100240 Ga0209672_10024023 405
597 3300025229 Ga0209147_100008 Ga0209147_10000886 405
598 3300025230 Ga0209563_100039 Ga0209563_10003972 405
599 3300025230 Ga0209563_101432 Ga0209563_1014325 405
600 3300025242 Ga0209258_100013 Ga0209258_10001386 405
601 3300025246 Ga0209646_1000027 Ga0209646_1000027279 405
602 3300025253 Ga0209677_100024 Ga0209677_10002470 405
603 3300025254 Ga0209148_1000019 Ga0209148_1000019373 405
604 3300025256 Ga0209759_1007543 Ga0209759_10075433 405
605 3300025256 Ga0209759_1009583 Ga0209759_10095832 405
606 3300025272 Ga0209455_1000042 Ga0209455_100004286 405
607 3300025907 Ga0207645_10156823 Ga0207645_101568231 405
608 3300025913 Ga0207695_10004273 Ga0207695_100042738 405
609 3300025913 Ga0207695_10034300 Ga0207695_100343003 405
610 3300025920 Ga0207649_10000075 Ga0207649_100000751 405
611 3300025927 Ga0207687_10074223 Ga0207687_100742232 405
612 3300025931 Ga0207644_10003552 Ga0207644_100035523 405
613 3300025932 Ga0207690_10039031 Ga0207690_100390312 405
614 3300025945 Ga0207679_10000004 Ga0207679_10000004483 405
615 3300025961 Ga0207712_10000023 Ga0207712_10000023107 405
616 3300025972 Ga0207668_10001557 Ga0207668_100015575 405
617 3300025981 Ga0207640_10000084 Ga0207640_1000008465 405
618 3300026067 Ga0207678_10000012 Ga0207678_1000001273 405
619 3300026078 Ga0207702_10000020 Ga0207702_10000020126 405
620 3300026088 Ga0207641_10000031 Ga0207641_1000003191 405
621 3300026116 Ga0207674_10006196 Ga0207674_100061969 405
622 3300028379 Ga0268266_10005881 Ga0268266_100058816 405
623 3300028380 Ga0268265_10000049 Ga0268265_10000049158 405
624 3300028380 Ga0268265_10081278 Ga0268265_100812781 405
625 3300028381 Ga0268264_10001904 Ga0268264_1000190422 405
626 3300028381 Ga0268264_10005865 Ga0268264_100058652 405
627 3300031456 Ga0307513_10106202 Ga0307513_101062022 405
628 3300031548 Ga0307408_100029226 Ga0307408_1000292262 405
629 3300031731 Ga0307405_10110755 Ga0307405_101107552 405
630 3300031903 Ga0307407_10119100 Ga0307407_101191002 405
631 3300031911 Ga0307412_10050390 Ga0307412_100503901 405
632 3300031995 Ga0307409_100112456 Ga0307409_1001124562 405
633 3300032002 Ga0307416_100041203 Ga0307416_1000412032 405
634 3300032004 Ga0307414_10058882 Ga0307414_100588822 405
635 3300032005 Ga0307411_10024840 Ga0307411_100248402 405
636 3300037418 Ga0395900_0032913 Ga0395900_0032913_3854_5194 405
637 3300041404 Ga0439436_0001800 Ga0439436_0001800_4580_5911 405
638 3300042004 Ga0439445_0000005 Ga0439445_0000005_1918_3204 405
639 3300044658 Ga0466972_0003988 Ga0466972_0003988_2519_3859 405
640 3300044671 Ga0466978_0002079 Ga0466978_0002079_3891_5231 405
641 3300044693 Ga0466961_0000354 Ga0466961_0000354_8157_9497 405
642 3300044706 Ga0466964_0008119 Ga0466964_0008119_1342_2682 405
643 3300044735 Ga0466968_0031750 Ga0466968_0031750_713_2053 405
644 3300044765 Ga0466970_0000585 Ga0466970_0000585_8142_9482 405
645 3300044842 Ga0466957_0108315 Ga0466957_0108315_314_1654 405
646 3300048928 Ga0496125_0016025 Ga0496125_0016025_3679_5019 405
647 3300053151 Ga0500604_0000275 Ga0500604_0000275_11759_13048 405
648 3300053739 Ga0500587_000307 Ga0500587_000307_1024_2310 405
649 3300059643 Ga0587072_005443 Ga0587072_005443_27_1367 405
650 iso_pu_bacteria 2508501114 2509074900 405
651 iso_pu_bacteria 2643221574 2643883838 405
652 iso_pu_bacteria 2643221593 2643975409 405
653 iso_pu_bacteria 2643221699 2644548118 405
654 iso_pu_bacteria 2941489479 2941490033 405
655 iso_pu_bacteria 2995948881 2995950410 405
656 iso_pu_bacteria 650716007 650843651 405
657 3300003187 JGI25151J46595_10001821 JGI25151J46595_100018212 406
658 3300003771 Ga0055526_1000449 Ga0055526_100044912 406
659 3300003773 Ga0055537_1000708 Ga0055537_100070812 406
660 3300003775 Ga0055524_1000947 Ga0055524_100094713 406
661 3300003784 Ga0055534_1000613 Ga0055534_100061313 406
662 3300003790 Ga0055528_1000337 Ga0055528_100033741 406
663 3300005335 Ga0070666_10008338 Ga0070666_100083386 406
664 3300005347 Ga0070668_100000190 Ga0070668_10000019030 406
665 3300005367 Ga0070667_100000135 Ga0070667_10000013512 406
666 3300005841 Ga0068863_100000198 Ga0068863_10000019833 406
667 3300005843 Ga0068860_100001354 Ga0068860_1000013547 406
668 3300005844 Ga0068862_100053143 Ga0068862_1000531432 406
669 3300006175 Ga0070712_100043499 Ga0070712_1000434994 406
670 3300013306 Ga0163162_10203926 Ga0163162_102039261 406
671 3300015689 Ga0183360_10001 Ga0183360_100012684 406
672 3300025245 Ga0207425_1002895 Ga0207425_10028952 406
673 3300025263 Ga0209565_1000001 Ga0209565_10000011193 406
674 3300025273 Ga0209673_1000001 Ga0209673_10000011193 406
675 3300025291 Ga0209675_1000001 Ga0209675_10000011340 406
676 3300025294 Ga0209025_1000036 Ga0209025_100003628 406
677 3300025295 Ga0209564_1000001 Ga0209564_10000011502 406
678 3300025299 Ga0209256_1000002 Ga0209256_100000251 406
679 3300025903 Ga0207680_10001069 Ga0207680_100010696 406
680 3300025986 Ga0207658_10000101 Ga0207658_1000010112 406
681 3300026088 Ga0207641_10000046 Ga0207641_1000004630 406
682 3300026118 Ga0207675_100095286 Ga0207675_1000952862 406
683 3300028381 Ga0268264_10007684 Ga0268264_100076846 406
684 3300031901 Ga0307406_10011507 Ga0307406_100115072 406
685 3300031901 Ga0307406_10024964 Ga0307406_100249642 406
686 3300039447 Ga0436361_0587792 Ga0436361_0587792_896_2224 406
687 3300041407 Ga0439447_001376 Ga0439447_001376_1676_3004 406
688 3300046471 Ga0495650_0002326 Ga0495650_0002326_7744_9048 406
689 3300046501 Ga0495607_0009844 Ga0495607_0009844_2569_3861 406
690 3300046525 Ga0495663_0016250 Ga0495663_0016250_292_1620 406
691 3300046529 Ga0495652_0027948 Ga0495652_0027948_247_1575 406
692 3300046536 Ga0495587_0103598 Ga0495587_0103598_244_1572 406
693 3300046616 Ga0495668_0002177 Ga0495668_0002177_7638_9038 406
694 3300048924 Ga0496121_0031186 Ga0496121_0031186_658_1986 406
695 3300049573 Ga0501037_0020025 Ga0501037_0020025_929_2287 406
696 3300049580 Ga0501046_0000033 Ga0501046_0000033_21639_22970 406
697 3300050515 nmdc:mga0a205_306844_c1 nmdc:mga0a205_306844_c1_13_1323 406
698 3300053085 Ga0495619_0067857 Ga0495619_0067857_950_2278 406
699 3300053096 Ga0500641_0000769 Ga0500641_0000769_4791_6077 406
700 3300005937 Ga0081455_10000066 Ga0081455_1000006651 407
701 3300006844 Ga0075428_100095951 Ga0075428_1000959512 407
702 3300006844 Ga0075428_100128370 Ga0075428_1001283702 407
703 3300009094 Ga0111539_10030317 Ga0111539_100303178 407
704 3300031251 Ga0265327_10001610 Ga0265327_1000161016 407
705 3300046694 Ga0495649_0006051 Ga0495649_0006051_4719_6008 407
706 3300049572 Ga0501036_0053029 Ga0501036_0053029_926_2254 407
707 3300049576 Ga0501040_0008279 Ga0501040_0008279_480_1808 407
708 3300049579 Ga0501043_0079939 Ga0501043_0079939_908_2236 407
709 3300049580 Ga0501046_0021415 Ga0501046_0021415_1000_2328 407
710 3300049582 Ga0501048_0019298 Ga0501048_0019298_1384_2712 407
711 3300049588 Ga0501072_0004575 Ga0501072_0004575_4913_6241 407
712 3300049591 Ga0501075_0094614 Ga0501075_0094614_382_1710 407
713 3300049592 Ga0501076_0007578 Ga0501076_0007578_5331_6659 407
714 3300049741 Ga0501079_0024540 Ga0501079_0024540_1291_2619 407
715 3300049824 Ga0501045_0021883 Ga0501045_0021883_1045_2373 407
716 3300053087 Ga0500643_000233 Ga0500643_000233_42107_43447 407
717 3300053096 Ga0500641_0001800 Ga0500641_0001800_5966_7306 407
718 3300053108 Ga0500562_018163 Ga0500562_018163_137_1477 407
719 3300053153 Ga0500616_0054945 Ga0500616_0054945_250_1590 407
720 3300053156 Ga0500622_0020235 Ga0500622_0020235_246_1586 407
721 3300053156 Ga0500622_0023574 Ga0500622_0023574_221_1561 407
722 3300053730 Ga0500645_000517 Ga0500645_000517_20213_21553 407
723 iso_pu_bacteria 2554235003 2554244944 407
724 iso_pu_bacteria 2558860242 2559297222 407
725 iso_pu_bacteria 2558860983 2561466452 407
726 iso_pu_bacteria 2643221582 2643921764 407
727 iso_pu_bacteria 2643221693 2644519733 407
728 iso_pu_bacteria 2808606387 2808988820 407
729 iso_pu_bacteria 2899845264 2899850500 407
730 iso_pu_bacteria 2926760298 2926764190 407
731 iso_pu_bacteria 2979089926 2979090711 407
732 iso_pu_bacteria 2979095461 2979096234 407
733 iso_pu_bacteria 8003570095 8003574086 407
734 iso_pu_bacteria 8057101203 8057103875 407
735 3300005328 Ga0070676_10001841 Ga0070676_100018414 408
736 3300005347 Ga0070668_100001427 Ga0070668_10000142713 408
737 3300005353 Ga0070669_100044684 Ga0070669_1000446842 408
738 3300005353 Ga0070669_100103876 Ga0070669_1001038762 408
739 3300005364 Ga0070673_100048531 Ga0070673_1000485312 408
740 3300005367 Ga0070667_100008061 Ga0070667_1000080614 408
741 3300005530 Ga0070679_100101575 Ga0070679_1001015752 408
742 3300005543 Ga0070672_100014855 Ga0070672_1000148552 408
743 3300005548 Ga0070665_100001611 Ga0070665_10000161123 408
744 3300005548 Ga0070665_100119808 Ga0070665_1001198082 408
745 3300005549 Ga0070704_100176648 Ga0070704_1001766482 408
746 3300005617 Ga0068859_100188297 Ga0068859_1001882972 408
747 3300005617 Ga0068859_100205476 Ga0068859_1002054761 408
748 3300005842 Ga0068858_100038243 Ga0068858_1000382432 408
749 3300005844 Ga0068862_100002747 Ga0068862_10000274713 408
750 3300006358 Ga0068871_100039365 Ga0068871_1000393652 408
751 3300006852 Ga0075433_10013939 Ga0075433_100139397 408
752 3300006931 Ga0097620_100188301 Ga0097620_1001883012 408
753 3300006931 Ga0097620_100205475 Ga0097620_1002054752 408
754 3300009093 Ga0105240_10012181 Ga0105240_100121816 408
755 3300009147 Ga0114129_10171564 Ga0114129_101715643 408
756 3300009177 Ga0105248_10119095 Ga0105248_101190952 408
757 3300013306 Ga0163162_10239912 Ga0163162_102399121 408
758 3300013308 Ga0157375_10142766 Ga0157375_101427662 408
759 3300025735 Ga0207713_1013296 Ga0207713_10132963 408
760 3300025907 Ga0207645_10006422 Ga0207645_100064224 408
761 3300025919 Ga0207657_10088710 Ga0207657_100887102 408
762 3300025921 Ga0207652_10121023 Ga0207652_101210232 408
763 3300025923 Ga0207681_10016295 Ga0207681_100162952 408
764 3300025923 Ga0207681_10041246 Ga0207681_100412462 408
765 3300025933 Ga0207706_10235738 Ga0207706_102357382 408
766 3300025940 Ga0207691_10057571 Ga0207691_100575713 408
767 3300025941 Ga0207711_10028891 Ga0207711_100288913 408
768 3300025944 Ga0207661_10066150 Ga0207661_100661502 408
769 3300025960 Ga0207651_10112554 Ga0207651_101125542 408
770 3300025972 Ga0207668_10000070 Ga0207668_100000707 408
771 3300025986 Ga0207658_10007909 Ga0207658_100079093 408
772 3300026067 Ga0207678_10073669 Ga0207678_100736692 408
773 3300026088 Ga0207641_10143612 Ga0207641_101436122 408
774 3300026116 Ga0207674_10051941 Ga0207674_100519412 408
775 3300028379 Ga0268266_10083270 Ga0268266_100832702 408
776 3300028380 Ga0268265_10000770 Ga0268265_100007708 408
777 3300031251 Ga0265327_10002591 Ga0265327_1000259119 408
778 3300046460 Ga0495638_0000204 Ga0495638_0000204_27945_29321 408
779 3300046506 Ga0495583_0000349 Ga0495583_0000349_15088_16455 408
780 3300046519 Ga0495632_0001269 Ga0495632_0001269_7919_9301 408
781 3300046524 Ga0495648_0000212 Ga0495648_0000212_10322_11698 408
782 3300046530 Ga0495654_0025510 Ga0495654_0025510_514_1932 408
783 3300046558 Ga0495633_0033078 Ga0495633_0033078_121_1488 408
784 3300046692 Ga0495671_0000060 Ga0495671_0000060_54937_56304 408
785 3300047469 Ga0495673_0000088 Ga0495673_0000088_54937_56304 408
786 3300047472 Ga0495686_0000273 Ga0495686_0000273_88184_89491 408
787 3300047472 Ga0495686_0001454 Ga0495686_0001454_16094_17428 408
788 3300048905 Ga0496102_0146479 Ga0496102_0146479_137_1543 408
789 3300048925 Ga0496122_0010437 Ga0496122_0010437_1478_2764 408
790 3300048926 Ga0496123_0006380 Ga0496123_0006380_5281_6567 408
791 3300049583 Ga0501067_0008656 Ga0501067_0008656_4326_5618 408
792 3300049586 Ga0501070_0052359 Ga0501070_0052359_1067_2365 408
793 3300050492 nmdc:mga0yw44_5052_c1 nmdc:mga0yw44_5052_c1_4607_6055 408
794 3300050515 nmdc:mga0a205_39985_c1 nmdc:mga0a205_39985_c1_2143_3471 408
795 3300053122 Ga0500608_061213 Ga0500608_061213_371_1699 408
796 3300053130 Ga0500642_0017740 Ga0500642_0017740_1333_2655 408
797 3300053153 Ga0500616_0000042 Ga0500616_0000042_140932_142326 408
798 3300053153 Ga0500616_0030689 Ga0500616_0030689_255_1613 408
799 3300053730 Ga0500645_005247 Ga0500645_005247_2209_3543 408
800 iso_pu_bacteria 2554235469 2556065743 408
801 3300003781 Ga0055536_1000601 Ga0055536_100060111 409
802 3300005331 Ga0070670_100052714 Ga0070670_1000527143 409
803 3300005338 Ga0068868_100088472 Ga0068868_1000884722 409
804 3300005339 Ga0070660_100152744 Ga0070660_1001527442 409
805 3300005344 Ga0070661_100006605 Ga0070661_1000066056 409
806 3300005355 Ga0070671_100001896 Ga0070671_10000189614 409
807 3300005355 Ga0070671_100050167 Ga0070671_1000501673 409
808 3300005364 Ga0070673_100042809 Ga0070673_1000428092 409
809 3300005367 Ga0070667_100009598 Ga0070667_1000095984 409
810 3300005436 Ga0070713_100067249 Ga0070713_1000672493 409
811 3300005445 Ga0070708_100149719 Ga0070708_1001497192 409
812 3300005456 Ga0070678_100018605 Ga0070678_1000186052 409
813 3300005456 Ga0070678_100027141 Ga0070678_1000271412 409
814 3300005456 Ga0070678_100237540 Ga0070678_1002375402 409
815 3300005539 Ga0068853_100153787 Ga0068853_1001537872 409
816 3300005543 Ga0070672_100190098 Ga0070672_1001900982 409
817 3300005548 Ga0070665_100015939 Ga0070665_1000159394 409
818 3300005564 Ga0070664_100000247 Ga0070664_10000024713 409
819 3300005578 Ga0068854_100011735 Ga0068854_1000117352 409
820 3300005618 Ga0068864_100004493 Ga0068864_10000449312 409
821 3300005841 Ga0068863_100014397 Ga0068863_1000143973 409
822 3300005842 Ga0068858_100064195 Ga0068858_1000641952 409
823 3300005844 Ga0068862_100005128 Ga0068862_1000051283 409
824 3300005844 Ga0068862_100108709 Ga0068862_1001087092 409
825 3300006358 Ga0068871_100059716 Ga0068871_1000597163 409
826 3300006871 Ga0075434_100019256 Ga0075434_1000192564 409
827 3300009177 Ga0105248_10001586 Ga0105248_100015863 409
828 3300009177 Ga0105248_10363368 Ga0105248_103633681 409
829 3300009553 Ga0105249_10267942 Ga0105249_102679422 409
830 3300014968 Ga0157379_10121279 Ga0157379_101212792 409
831 3300021388 Ga0213875_10000415 Ga0213875_1000041514 409
832 3300025292 Ga0209676_1000046 Ga0209676_100004647 409
833 3300025292 Ga0209676_1008056 Ga0209676_10080561 409
834 3300025304 Ga0209257_1001711 Ga0209257_10017115 409
835 3300025920 Ga0207649_10006407 Ga0207649_100064072 409
836 3300025931 Ga0207644_10002127 Ga0207644_100021272 409
837 3300025931 Ga0207644_10057746 Ga0207644_100577462 409
838 3300025931 Ga0207644_10072288 Ga0207644_100722881 409
839 3300025933 Ga0207706_10201075 Ga0207706_102010752 409
840 3300025941 Ga0207711_10004220 Ga0207711_100042204 409
841 3300025960 Ga0207651_10138127 Ga0207651_101381272 409
842 3300025960 Ga0207651_10153111 Ga0207651_101531112 409
843 3300025981 Ga0207640_10008681 Ga0207640_100086813 409
844 3300025986 Ga0207658_10010752 Ga0207658_100107523 409
845 3300026035 Ga0207703_10014421 Ga0207703_100144212 409
846 3300026067 Ga0207678_10013054 Ga0207678_100130547 409
847 3300026067 Ga0207678_10033439 Ga0207678_100334393 409
848 3300026088 Ga0207641_10011350 Ga0207641_100113502 409
849 3300026095 Ga0207676_10002924 Ga0207676_100029244 409
850 3300026116 Ga0207674_10178300 Ga0207674_101783002 409
851 3300026121 Ga0207683_10028424 Ga0207683_100284242 409
852 3300026121 Ga0207683_10071144 Ga0207683_100711442 409
853 3300028380 Ga0268265_10005055 Ga0268265_100050555 409
854 3300031995 Ga0307409_100048247 Ga0307409_1000482472 409
855 3300032004 Ga0307414_10075548 Ga0307414_100755482 409
856 3300032005 Ga0307411_10051340 Ga0307411_100513402 409
857 3300032126 Ga0307415_100091882 Ga0307415_1000918822 409
858 3300032126 Ga0307415_100140151 Ga0307415_1001401512 409
859 3300037312 Ga0395899_0095812 Ga0395899_0095812_23_1318 409
860 3300037418 Ga0395900_0010269 Ga0395900_0010269_2847_4142 409
861 3300037466 Ga0395898_0020197 Ga0395898_0020197_212_1507 409
862 3300037471 Ga0395905_0019542 Ga0395905_0019542_645_1940 409
863 3300037471 Ga0395905_0156248 Ga0395905_0156248_765_2060 409
864 3300037853 Ga0436364_1487636 Ga0436364_1487636_15676_17028 409
865 3300044683 Ga0466965_0116846 Ga0466965_0116846_47_1342 409
866 3300045051 Ga0451576_0009411 Ga0451576_0009411_5166_6506 409
867 3300046684 Ga0495669_0005899 Ga0495669_0005899_2310_3605 409
868 3300048911 Ga0496108_0011078 Ga0496108_0011078_3443_4759 409
869 3300048912 Ga0496109_0016098 Ga0496109_0016098_2791_4107 409
870 3300048915 Ga0496112_0008439 Ga0496112_0008439_4572_5888 409
871 3300048916 Ga0496113_0004212 Ga0496113_0004212_6437_7753 409
872 3300048924 Ga0496121_0015828 Ga0496121_0015828_5573_6979 409
873 3300049669 Ga0501235_005002 Ga0501235_005002_1075_2370 409
874 3300049669 Ga0501235_012406 Ga0501235_012406_286_1581 409
875 3300049679 Ga0501249_015084 Ga0501249_015084_331_1626 409
876 3300049705 Ga0501225_0017211 Ga0501225_0017211_364_1659 409
877 3300049765 Ga0501268_002017 Ga0501268_002017_838_2133 409
878 3300053119 Ga0500595_002777 Ga0500595_002777_2914_4236 409
879 3300053156 Ga0500622_0001865 Ga0500622_0001865_2077_3423 409
880 3300053162 Ga0500638_002144 Ga0500638_002144_3914_5236 409
881 3300053178 Ga0500637_0000954 Ga0500637_0000954_5714_7036 409
882 3300005289 Ga0065704_10073281 Ga0065704_100732816 410
883 3300025919 Ga0207657_10014188 Ga0207657_100141882 410
884 3300031901 Ga0307406_10001562 Ga0307406_100015626 410
885 3300032005 Ga0307411_10039330 Ga0307411_100393302 410
886 3300001904 JGI24736J21556_1000571 JGI24736J21556_10005712 411
887 3300001979 JGI24740J21852_10000604 JGI24740J21852_100006045 411
888 3300002075 JGI24738J21930_10001279 JGI24738J21930_100012793 411
889 3300009101 Ga0105247_10100907 Ga0105247_101009071 411
890 3300009174 Ga0105241_10005021 Ga0105241_1000502111 411
891 3300009553 Ga0105249_10000015 Ga0105249_10000015178 411
892 3300025900 Ga0207710_10057943 Ga0207710_100579432 411
893 3300027866 Ga0209813_10000397 Ga0209813_100003978 411
894 3300031911 Ga0307412_10001834 Ga0307412_100018346 411
895 3300037312 Ga0395899_0000610 Ga0395899_0000610_31491_32846 411
896 3300037418 Ga0395900_0000301 Ga0395900_0000301_4479_5834 411
897 3300037466 Ga0395898_0000504 Ga0395898_0000504_4465_5820 411
898 3300037471 Ga0395905_0004579 Ga0395905_0004579_8472_9827 411
899 3300038443 Ga0395901_0000197 Ga0395901_0000197_5172_6527 411
900 3300047472 Ga0495686_0002443 Ga0495686_0002443_8458_9819 411
901 3300048927 Ga0496124_0000191 Ga0496124_0000191_78144_79493 411
902 3300053153 Ga0500616_0000293 Ga0500616_0000293_59330_60646 411

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

74

285

0.92

PF00083

Sugar_tr

Sugar (and other) transporter

265

489

0.87

PF13347

MFS_2

MFS/sugar transport protein

304

413

0.79

PF07690

MFS_1

Major Facilitator Superfamily

78

330

0.74

PF07690

MFS_1

Major Facilitator Superfamily

310

496

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h7d-assembly1.cif.gz_A crystal structure of a. thaliana sugar transport protein 10 in complex with glucose in the outward occluded state 0.7978 9 403
6h7d-assembly1.cif.gz_A crystal structure of a. thaliana sugar transport protein 10 in complex with glucose in the outward occluded state 0.7678 9 403
6rw3-assembly3.cif.gz_C the molecular basis for sugar import in malaria parasites. 0.7618 11 403
8hpj-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in a ligand-free outward-facing form 0.7601 11 396
7spt-assembly1.cif.gz_A crystal structure of exofacial state human glucose transporter glut3 0.7504 12 403
ID Description Score Start End Superfamily
af_Q2G0K4_17_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.96 15 214 1.20.1250.20
af_P0AEX3_19_432_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9392 13 400 1.20.1250.20
af_I6XHB8_22_443_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9387 17 401 1.20.1250.20
af_A0A1D6LG74_1_148_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9385 56 216 1.20.1250.20
af_P37643_22_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9291 12 215 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A556C2H5-F1-model_v4 Putative proline/betaine transporter 0.9562 11 408 GO:0005886
GO:0015293
AF-A0A6I5J5R6-F1-model_v4 deleted 0.9559 11 408
AF-A0A6N6S6W7-F1-model_v4 MHS family MFS transporter 0.9551 11 407 GO:0005886
GO:0015293
AF-A0A1H6BNI7-F1-model_v4 deleted 0.9547 11 408
AF-A0A7W7X4H8-F1-model_v4 deleted 0.9546 11 408

Feature Viewer

pLDDT pTM Quality
76.82 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map