F485173

General Info

Members Datasets Scaffolds Average Seq Length
901 548 1802 246

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10014356|Ga0105237_100143562
Length 284
Sequence VPAKEALLIAPDNNEVSTMSDFDRNYASPFGRAIGRADAAAVDAGLRAYMLRIYNYMTIGLAITGFAALGVFMGATTNDPSLAAFPQKIGSFYLTGFGYAMFVSPLKWLFIFAPLAMVFVISFGIQRLAPATAQLLFWVFSALMGVSLSSIFLVYTHSSIVQVFFITAAAFGALSLYGYTTRRDMTGMGSFLIMGLFGIVIASIVNLFLASSALQFVVSVGGVLVFAGLTAWDTQRLKNEYIYGYAGAGEAVAERSAILGALSLYLNFINLFTLLLQLLGQRDN

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
102 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
162 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
165 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
166 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
182 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
192 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
203 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
206 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
207 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
208 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
235 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
236 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
237 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
238 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
243 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
248 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
294 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
295 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
296 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
297 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
300 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
306 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
322 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
323 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
324 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
325 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
326 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
327 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
328 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
329 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
335 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
336 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
337 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
338 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
344 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
345 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
346 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
347 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
348 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
351 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
352 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
353 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
354 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
355 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
356 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
357 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
358 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
359 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
360 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
361 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
362 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
363 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
364 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
365 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
366 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
367 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
368 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
369 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
370 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
371 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
372 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
373 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
374 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
375 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
376 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
377 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
378 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
379 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
380 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
381 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
382 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
383 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
384 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
405 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
406 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
407 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
408 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
409 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
410 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
411 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
412 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
413 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
414 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
415 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
416 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
417 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
418 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
419 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
420 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
421 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
422 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
423 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
424 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
425 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
426 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
427 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
428 2643221651 Afipia sp. Root123D2 Isolate Unclassified
429 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
430 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
431 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
432 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
433 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
434 2791355199
435 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
436 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
437 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
438 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
439 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
440 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
441 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
442 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
443 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
444 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
445 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
446 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
447 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
448 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
449 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
450 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
451 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
452 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
453 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
454 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
455 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
456 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
457 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
458 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
459 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
460 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
461 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
462 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
463 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
464 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
465 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
466 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
467 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
468 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
469 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
470 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
471 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
472 2904699407
473 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
474 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
475 2906610324
476 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
477 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
478 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
479 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
480 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
481 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
482 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
483 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
484 2922425934
485 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
486 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
487 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
488 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
489 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
490 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
491 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
492 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
493 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
494 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
495 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
496 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
497 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
498 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
499 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
500 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
501 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
502 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
503 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
504 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
505 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
506 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
507 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
508 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
509 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
510 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
511 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
512 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
513 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
514 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
515 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
516 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
517 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
518 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
519 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
520 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
521 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
522 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
523 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
524 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
525 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
526 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
527 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
528 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
529 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
530 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
531 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
532 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
533 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
534 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
535 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
536 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
537 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
538 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
539 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
540 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
541 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
542 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
543 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
544 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
545 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
546 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
547 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
548 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.48
Metatranscriptomes 8.03
Isolates 15.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.32
Nodule 11.32
Rhizoplane 4
Rhizosphere 59.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10014356 3300009545 Bacteria 8288
2 JGI24740J21852_10019014 3300001979 Bacteria 2426
3 JGI24737J22298_10000979 3300001990 Bacteria 10150
4 JGI24738J21930_10031241 3300002075 Bacteria 1086
5 JGI25406J46586_10045046 3300003203 Bacteria 1522
6 JGI25165J46597_1009200 3300003214 Bacteria 1501
7 Ga0006777J48905_1044268 3300003308 Bacteria 921
8 Ga0007409J51694_1018315 3300003575 Bacteria 859
9 Ga0055526_1019675 3300003771 Bacteria 2447
10 JGI25405J52794_10031793 3300003911 Bacteria 1098
11 Ga0058859_10002637 3300004798 Bacteria 1022
12 Ga0058860_12101187 3300004801 Bacteria 1119
13 Ga0058862_12634862 3300004803 Bacteria 989
14 Ga0065165_1038109 3300005262 Bacteria 1452
15 Ga0070658_10018416 3300005327 Bacteria 5590
16 Ga0070683_100009865 3300005329 Bacteria 8181
17 Ga0070670_100359760 3300005331 Bacteria 1280
18 Ga0068869_100064257 3300005334 Bacteria 2699
19 Ga0070666_10143604 3300005335 Bacteria 1663
20 Ga0070680_100036908 3300005336 Bacteria 3948
21 Ga0070680_100574888 3300005336 Bacteria 967
22 Ga0070691_10048168 3300005341 Bacteria 2027
23 Ga0070668_100084817 3300005347 Bacteria 2489
24 Ga0070668_100260994 3300005347 Bacteria 1441
25 Ga0070668_100342991 3300005347 Bacteria 1262
26 Ga0070669_100023783 3300005353 Bacteria 4391
27 Ga0070669_100523000 3300005353 Bacteria 986
28 Ga0070675_100511647 3300005354 Bacteria 1083
29 Ga0070671_100000542 3300005355 Bacteria 26647
30 Ga0070673_100212996 3300005364 Bacteria 1669
31 Ga0070688_100342197 3300005365 Bacteria 1092
32 Ga0070659_100084996 3300005366 Bacteria 2530
33 Ga0070667_100035887 3300005367 Bacteria 4155
34 Ga0070667_100246357 3300005367 Bacteria 1597
35 Ga0070709_10014869 3300005434 Bacteria 4414
36 Ga0070709_10019171 3300005434 Bacteria 3950
37 Ga0070709_10044929 3300005434 Bacteria 2738
38 Ga0070714_100073568 3300005435 Bacteria 2961
39 Ga0070714_100191652 3300005435 Bacteria 1866
40 Ga0070713_100025592 3300005436 Bacteria 4617
41 Ga0070713_100045297 3300005436 Bacteria 3604
42 Ga0070713_100079741 3300005436 Bacteria 2790
43 Ga0070713_100119688 3300005436 Bacteria 2307
44 Ga0070713_100168405 3300005436 Bacteria 1961
45 Ga0070713_100348883 3300005436 Bacteria 1373
46 Ga0070710_10002858 3300005437 Bacteria 8225
47 Ga0070710_10020812 3300005437 Bacteria 3409
48 Ga0070710_10412975 3300005437 Bacteria 907
49 Ga0070663_100001941 3300005455 Bacteria 11542
50 Ga0070663_100060988 3300005455 Bacteria 2715
51 Ga0070681_10001077 3300005458 Bacteria 23275
52 Ga0070681_10132401 3300005458 Bacteria 2425
53 Ga0068867_100176355 3300005459 Bacteria 1696
54 Ga0070707_100142842 3300005468 Bacteria 2330
55 Ga0070699_100168805 3300005518 Bacteria 1938
56 Ga0070679_100005644 3300005530 Bacteria 11595
57 Ga0070679_100028700 3300005530 Bacteria 5488
58 Ga0070679_100097238 3300005530 Bacteria 2932
59 Ga0070679_100103273 3300005530 Bacteria 2836
60 Ga0070684_100008528 3300005535 Bacteria 8020
61 Ga0070684_100133161 3300005535 Bacteria 2243
62 Ga0068853_100015795 3300005539 Bacteria 6201
63 Ga0068853_100280674 3300005539 Bacteria 1536
64 Ga0070672_100256992 3300005543 Bacteria 1472
65 Ga0070686_100303674 3300005544 Bacteria 1184
66 Ga0070695_100045867 3300005545 Bacteria 2788
67 Ga0070693_100059830 3300005547 Bacteria 2209
68 Ga0070693_100089949 3300005547 Bacteria 1848
69 Ga0070665_100001356 3300005548 Bacteria 28943
70 Ga0070665_100182360 3300005548 Bacteria 2100
71 Ga0070665_100331908 3300005548 Bacteria 1525
72 Ga0068855_100024520 3300005563 Bacteria 7218
73 Ga0068855_100046913 3300005563 Bacteria 5106
74 Ga0068855_100188673 3300005563 Bacteria 2326
75 Ga0068855_100240999 3300005563 Bacteria 2021
76 Ga0068855_100415431 3300005563 Bacteria 1472
77 Ga0070664_100431467 3300005564 Bacteria 1208
78 Ga0068857_100005034 3300005577 Bacteria 11228
79 Ga0068857_100166962 3300005577 Bacteria 1999
80 Ga0068857_100223783 3300005577 Bacteria 1719
81 Ga0068854_100003979 3300005578 Bacteria 9266
82 Ga0068854_100342861 3300005578 Bacteria 1221
83 Ga0068856_100000883 3300005614 Bacteria 32112
84 Ga0068856_100004208 3300005614 Bacteria 14365
85 Ga0068856_100152442 3300005614 Bacteria 2321
86 Ga0068859_100093827 3300005617 Bacteria 3052
87 Ga0068864_100085987 3300005618 Bacteria 2766
88 Ga0068851_10006246 3300005834 Bacteria 5436
89 Ga0068870_10164917 3300005840 Bacteria 1317
90 Ga0068863_100074583 3300005841 Bacteria 3210
91 Ga0068863_100150925 3300005841 Bacteria 2223
92 Ga0068858_100039033 3300005842 Bacteria 4405
93 Ga0068858_100478227 3300005842 Bacteria 1202
94 Ga0068860_100261639 3300005843 Bacteria 1686
95 Ga0068862_100034179 3300005844 Bacteria 4300
96 Ga0068862_100238505 3300005844 Bacteria 1652
97 Ga0081455_10000738 3300005937 Bacteria 42457
98 Ga0081455_10011519 3300005937 Bacteria 8881
99 Ga0081455_10025851 3300005937 Bacteria 5412
100 Ga0081455_10029499 3300005937 Bacteria 5002
101 Ga0081538_10007441 3300005981 Bacteria 9477
102 Ga0081538_10032665 3300005981 Bacteria 3480
103 Ga0081540_1005811 3300005983 Bacteria 9130
104 Ga0081540_1007723 3300005983 Bacteria 7624
105 Ga0081540_1040622 3300005983 Bacteria 2422
106 Ga0081539_10000371 3300005985 Bacteria 98455
107 Ga0081539_10025876 3300005985 Bacteria 3761
108 Ga0081539_10075608 3300005985 Bacteria 1788
109 Ga0070717_10003277 3300006028 Bacteria 11581
110 Ga0070717_10018898 3300006028 Bacteria 5392
111 Ga0070717_10053768 3300006028 Bacteria 3319
112 Ga0070717_10208139 3300006028 Bacteria 1716
113 Ga0075365_10006761 3300006038 Bacteria 6346
114 Ga0075365_10087096 3300006038 Bacteria 2123
115 Ga0075365_10145024 3300006038 Bacteria 1649
116 Ga0075368_10028408 3300006042 Bacteria 2161
117 Ga0075363_100052946 3300006048 Bacteria 2167
118 Ga0075364_10110184 3300006051 Bacteria 1837
119 Ga0075364_10165743 3300006051 Bacteria 1493
120 Ga0075364_10289396 3300006051 Bacteria 1115
121 Ga0070716_100005454 3300006173 Bacteria 6164
122 Ga0070712_100051297 3300006175 Bacteria 2873
123 Ga0075362_10028375 3300006177 Bacteria 2403
124 Ga0075362_10068248 3300006177 Bacteria 1619
125 Ga0075367_10013523 3300006178 Bacteria 4390
126 Ga0075367_10022578 3300006178 Bacteria 3531
127 Ga0075369_10009920 3300006186 Bacteria 3715
128 Ga0075369_10049655 3300006186 Bacteria 1813
129 Ga0075366_10118823 3300006195 Bacteria 1592
130 Ga0075370_10031036 3300006353 Bacteria 2983
131 Ga0075370_10107073 3300006353 Bacteria 1621
132 Ga0075370_10136094 3300006353 Bacteria 1435
133 Ga0075370_10184506 3300006353 Bacteria 1228
134 Ga0075370_10212095 3300006353 Bacteria 1143
135 Ga0068865_100140332 3300006881 Bacteria 1821
136 Ga0075436_100045387 3300006914 Bacteria 3031
137 Ga0097620_100093827 3300006931 Bacteria 3052
138 Ga0079104_1041320 3300006946 Bacteria 1075
139 Ga0105251_10001526 3300009011 Bacteria 19872
140 Ga0105240_10002459 3300009093 Bacteria 29768
141 Ga0105240_10007949 3300009093 Bacteria 15306
142 Ga0105240_10056136 3300009093 Bacteria 4928
143 Ga0105240_10061018 3300009093 Bacteria 4700
144 Ga0105240_10093949 3300009093 Bacteria 3659
145 Ga0105240_10470262 3300009093 Bacteria 1403
146 Ga0111539_10089486 3300009094 Bacteria 3617
147 Ga0105247_10237703 3300009101 Bacteria 1240
148 Ga0105247_10362207 3300009101 Bacteria 1023
149 Ga0105241_10020741 3300009174 Bacteria 4856
150 Ga0105241_10223420 3300009174 Bacteria 1584
151 Ga0105248_10013528 3300009177 Bacteria 8982
152 Ga0105248_10089282 3300009177 Bacteria 3469
153 Ga0105237_10014927 3300009545 Bacteria 8100
154 Ga0105237_10151573 3300009545 Bacteria 2315
155 Ga0105237_10194513 3300009545 Bacteria 2028
156 Ga0105238_10001235 3300009551 Bacteria 25716
157 Ga0105238_10018660 3300009551 Bacteria 7063
158 Ga0105238_10021262 3300009551 Bacteria 6612
159 Ga0105238_10116101 3300009551 Bacteria 2656
160 Ga0105249_10379015 3300009553 Bacteria 1440
161 Ga0105249_10386249 3300009553 Bacteria 1427
162 Ga0099796_10016687 3300010159 Bacteria 2173
163 Ga0105239_10018536 3300010375 Bacteria 7687
164 Ga0105239_10053677 3300010375 Bacteria 4420
165 Ga0105239_10456862 3300010375 Bacteria 1449
166 Ga0105239_10710672 3300010375 Bacteria 1149
167 Ga0157314_1005405 3300012500 Bacteria 969
168 Ga0157369_10032756 3300013105 Bacteria 5711
169 Ga0157369_10223644 3300013105 Bacteria 1969
170 Ga0157374_10080278 3300013296 Bacteria 3093
171 Ga0157374_10154653 3300013296 Bacteria 2231
172 Ga0157374_10314643 3300013296 Bacteria 1551
173 Ga0163162_10055722 3300013306 Bacteria 3981
174 Ga0157375_10239363 3300013308 Bacteria 1974
175 Ga0163163_10026240 3300014325 Bacteria 5566
176 Ga0182008_10237463 3300014497 Bacteria 937
177 Ga0157379_10530911 3300014968 Bacteria 1093
178 Ga0197907_10122096 3300020069 Bacteria 1029
179 Ga0197907_11428149 3300020069 Bacteria 1014
180 Ga0206356_10841646 3300020070 Bacteria 915
181 Ga0206356_11019694 3300020070 Bacteria 1083
182 Ga0206356_11227967 3300020070 Bacteria 1316
183 Ga0206349_1112773 3300020075 Bacteria 1263
184 Ga0206349_1345775 3300020075 Bacteria 927
185 Ga0206349_1694165 3300020075 Bacteria 1023
186 Ga0206349_1878734 3300020075 Bacteria 1048
187 Ga0206355_1022003 3300020076 Bacteria 829
188 Ga0206355_1140956 3300020076 Bacteria 955
189 Ga0206351_10137541 3300020077 Bacteria 936
190 Ga0206351_10685837 3300020077 Bacteria 1022
191 Ga0206351_10853499 3300020077 Bacteria 927
192 Ga0206352_10853849 3300020078 Bacteria 943
193 Ga0206352_11018583 3300020078 Bacteria 924
194 Ga0206352_11297536 3300020078 Bacteria 969
195 Ga0206350_10047531 3300020080 Bacteria 970
196 Ga0206350_10124601 3300020080 Bacteria 947
197 Ga0206350_10258629 3300020080 Bacteria 935
198 Ga0206350_10783199 3300020080 Bacteria 917
199 Ga0206350_11138243 3300020080 Bacteria 953
200 Ga0206350_11301687 3300020080 Bacteria 925
201 Ga0206354_10001066 3300020081 Bacteria 968
202 Ga0206354_10892454 3300020081 Bacteria 919
203 Ga0206354_11650149 3300020081 Bacteria 971
204 Ga0206353_10006930 3300020082 Bacteria 923
205 Ga0206353_11260487 3300020082 Bacteria 935
206 Ga0206353_11903621 3300020082 Bacteria 2125
207 Ga0154015_1265539 3300020610 Bacteria 956
208 Ga0154015_1529450 3300020610 Bacteria 1040
209 Ga0213873_10001008 3300021358 Bacteria 4576
210 Ga0213876_10003470 3300021384 Bacteria 9015
211 Ga0213876_10023883 3300021384 Bacteria 3227
212 Ga0213876_10268756 3300021384 Bacteria 906
213 Ga0213875_10027840 3300021388 Bacteria 2689
214 Ga0224712_10119344 3300022467 Bacteria 1140
215 Ga0224712_10139243 3300022467 Bacteria 1066
216 Ga0224712_10186241 3300022467 Bacteria 938
217 Ga0224712_10187736 3300022467 Bacteria 934
218 Ga0224712_10190267 3300022467 Bacteria 928
219 Ga0209677_100170 3300025253 Bacteria 55896
220 Ga0209148_1006148 3300025254 Bacteria 2635
221 Ga0209233_1012365 3300025261 Bacteria 2478
222 Ga0209455_1002203 3300025272 Bacteria 7710
223 Ga0209455_1007613 3300025272 Bacteria 3035
224 Ga0209564_1000671 3300025295 Bacteria 50518
225 Ga0209564_1010723 3300025295 Bacteria 4182
226 Ga0209758_1001900 3300025297 Bacteria 22801
227 Ga0207656_10011551 3300025321 Bacteria 3339
228 Ga0207713_1002460 3300025735 Bacteria 13462
229 Ga0207692_10006838 3300025898 Bacteria 4643
230 Ga0207710_10105055 3300025900 Bacteria 1336
231 Ga0207688_10086352 3300025901 Bacteria 1797
232 Ga0207680_10126573 3300025903 Bacteria 1678
233 Ga0207647_10022531 3300025904 Bacteria 4181
234 Ga0207647_10027240 3300025904 Bacteria 3728
235 Ga0207699_10169105 3300025906 Bacteria 1461
236 Ga0207643_10070154 3300025908 Bacteria 2015
237 Ga0207707_10001830 3300025912 Bacteria 19505
238 Ga0207707_10028688 3300025912 Bacteria 4863
239 Ga0207707_10299982 3300025912 Bacteria 1389
240 Ga0207695_10051771 3300025913 Bacteria 4308
241 Ga0207695_10139657 3300025913 Bacteria 2373
242 Ga0207671_10062068 3300025914 Bacteria 2774
243 Ga0207671_10099663 3300025914 Bacteria 2199
244 Ga0207693_10003895 3300025915 Bacteria 12708
245 Ga0207693_10004610 3300025915 Bacteria 11630
246 Ga0207693_10107617 3300025915 Bacteria 2187
247 Ga0207693_10304145 3300025915 Bacteria 1249
248 Ga0207663_10054053 3300025916 Bacteria 2512
249 Ga0207663_10098371 3300025916 Bacteria 1959
250 Ga0207660_10413582 3300025917 Bacteria 1087
251 Ga0207660_10488399 3300025917 Bacteria 998
252 Ga0207657_10268499 3300025919 Bacteria 1356
253 Ga0207652_10005820 3300025921 Bacteria 9998
254 Ga0207652_10315488 3300025921 Bacteria 1411
255 Ga0207652_10394162 3300025921 Bacteria 1249
256 Ga0207681_10000503 3300025923 Bacteria 27243
257 Ga0207694_10018629 3300025924 Bacteria 5249
258 Ga0207694_10023665 3300025924 Bacteria 4664
259 Ga0207694_10185041 3300025924 Bacteria 1690
260 Ga0207687_10404930 3300025927 Bacteria 1123
261 Ga0207700_10070457 3300025928 Bacteria 2688
262 Ga0207700_10345410 3300025928 Bacteria 1295
263 Ga0207664_10023800 3300025929 Bacteria 4595
264 Ga0207664_10429104 3300025929 Bacteria 1178
265 Ga0207664_10501200 3300025929 Bacteria 1087
266 Ga0207644_10001520 3300025931 Bacteria 14966
267 Ga0207704_10433479 3300025938 Bacteria 1045
268 Ga0207665_10006607 3300025939 Bacteria 7691
269 Ga0207665_10113232 3300025939 Bacteria 1908
270 Ga0207711_10002363 3300025941 Bacteria 16902
271 Ga0207711_10048929 3300025941 Bacteria 3618
272 Ga0207711_10567891 3300025941 Bacteria 1058
273 Ga0207661_10000878 3300025944 Bacteria 19794
274 Ga0207661_10092182 3300025944 Bacteria 2525
275 Ga0207679_10214993 3300025945 Bacteria 1614
276 Ga0207679_10319399 3300025945 Bacteria 1344
277 Ga0207667_10037414 3300025949 Bacteria 5187
278 Ga0207667_10152080 3300025949 Bacteria 2381
279 Ga0207667_10482417 3300025949 Bacteria 1258
280 Ga0207668_10003815 3300025972 Bacteria 8882
281 Ga0207668_10846220 3300025972 Bacteria 812
282 Ga0207658_10197038 3300025986 Bacteria 1678
283 Ga0207703_10302433 3300026035 Bacteria 1459
284 Ga0207703_10339404 3300026035 Bacteria 1380
285 Ga0207639_10213299 3300026041 Bacteria 1663
286 Ga0207678_10043043 3300026067 Bacteria 3909
287 Ga0207678_10149983 3300026067 Bacteria 1990
288 Ga0207678_10237780 3300026067 Bacteria 1560
289 Ga0207708_10280685 3300026075 Bacteria 1350
290 Ga0207702_10000318 3300026078 Bacteria 55209
291 Ga0207702_10232747 3300026078 Bacteria 1723
292 Ga0207702_10567464 3300026078 Bacteria 1111
293 Ga0207674_10014753 3300026116 Bacteria 8619
294 Ga0207683_10088714 3300026121 Bacteria 2752
295 Ga0207698_10089767 3300026142 Bacteria 2511
296 Ga0207698_10627039 3300026142 Bacteria 1063
297 Ga0209179_1015611 3300027512 Bacteria 1413
298 Ga0268266_10000534 3300028379 Bacteria 53027
299 Ga0268266_10001906 3300028379 Bacteria 23472
300 Ga0268266_10009681 3300028379 Bacteria 8469
301 Ga0268266_10394682 3300028379 Bacteria 1307
302 Ga0268266_10465051 3300028379 Bacteria 1204
303 Ga0268265_10065886 3300028380 Bacteria 2797
304 Ga0268265_10125312 3300028380 Bacteria 2124
305 Ga0268265_10211107 3300028380 Bacteria 1691
306 Ga0268265_10853020 3300028380 Bacteria 891
307 Ga0268264_10000062 3300028381 Bacteria 302110
308 Ga0268264_10353623 3300028381 Bacteria 1399
309 Ga0265334_10006202 3300028573 Bacteria 5171
310 Ga0307517_10000232 3300028786 Bacteria 94332
311 Ga0307515_10354065 3300028794 Bacteria 1113
312 Ga0310981_1033463 3300029285 Bacteria 900
313 Ga0307511_10085070 3300030521 Bacteria 2189
314 Ga0307511_10114742 3300030521 Bacteria 1696
315 Ga0265763_1004318 3300030763 Bacteria 1161
316 Ga0265764_102331 3300030882 Bacteria 923
317 Ga0265332_10063996 3300031238 Bacteria 1571
318 Ga0265332_10079800 3300031238 Bacteria 1389
319 Ga0265325_10032360 3300031241 Bacteria 2792
320 Ga0265340_10012805 3300031247 Bacteria 4425
321 Ga0265340_10097790 3300031247 Bacteria 1366
322 Ga0265339_10001952 3300031249 Bacteria 15141
323 Ga0307513_10083845 3300031456 Bacteria 3276
324 Ga0307513_10299956 3300031456 Bacteria 1374
325 Ga0307509_10207829 3300031507 Bacteria 1786
326 Ga0307508_10105800 3300031616 Bacteria 2411
327 Ga0307508_10147504 3300031616 Bacteria 1957
328 Ga0265314_10087483 3300031711 Bacteria 2037
329 Ga0265314_10188651 3300031711 Bacteria 1229
330 Ga0307516_10029260 3300031730 Bacteria 5570
331 Ga0307516_10132990 3300031730 Bacteria 2265
332 Ga0307516_10181291 3300031730 Bacteria 1839
333 Ga0307409_100077156 3300031995 Bacteria 2675
334 Ga0307415_100039352 3300032126 Bacteria 3124
335 Ga0307507_10061770 3300033179 Bacteria 3486
336 Ga0307510_10024915 3300033180 Bacteria 6908
337 Ga0316215_1000881 3300033544 Bacteria 2943
338 Ga0373950_0017256 3300034818 Bacteria 1242
339 Ga0373936_0009753 3300035113 Bacteria 3623
340 Ga0373943_0035254 3300035170 Bacteria 2390
341 Ga0373943_0045855 3300035170 Bacteria 2132
342 Ga0373955_0148985 3300035172 Bacteria 1376
343 Ga0373935_0001267 3300035692 Bacteria 13929
344 Ga0373935_0036686 3300035692 Bacteria 3066
345 Ga0373935_0398511 3300035692 Bacteria 988
346 Ga0373927_0000766 3300035695 Bacteria 24573
347 Ga0373927_0005757 3300035695 Bacteria 8509
348 Ga0373927_0234532 3300035695 Bacteria 1206
349 Ga0373933_0000218 3300035724 Bacteria 37928
350 Ga0373933_0133166 3300035724 Bacteria 1564
351 Ga0373947_0000310 3300035725 Bacteria 27577
352 Ga0373937_0101471 3300036401 Bacteria 2671
353 Ga0310112_018378 3300036458 Bacteria 985
354 Ga0310109_018809 3300036534 Bacteria 934
355 Ga0373925_0002455 3300037068 Bacteria 14850
356 Ga0373925_0004991 3300037068 Bacteria 9964
357 Ga0373925_0130723 3300037068 Bacteria 1957
358 Ga0373925_0131430 3300037068 Bacteria 1952
359 Ga0373925_0137215 3300037068 Bacteria 1912
360 Ga0373925_0161821 3300037068 Bacteria 1763
361 Ga0373925_0375173 3300037068 Bacteria 1158
362 Ga0395899_0046650 3300037312 Bacteria 3227
363 Ga0395900_0005138 3300037418 Bacteria 13747
364 Ga0395900_0013190 3300037418 Bacteria 8447
365 Ga0395900_0187341 3300037418 Bacteria 2100
366 Ga0395900_0477755 3300037418 Bacteria 1199
367 Ga0395900_0757346 3300037418 Bacteria 901
368 Ga0395898_0033290 3300037466 Bacteria 5144
369 Ga0395898_0035036 3300037466 Bacteria 4996
370 Ga0395898_0041886 3300037466 Bacteria 4521
371 Ga0395898_0070416 3300037466 Bacteria 3381
372 Ga0395898_0105024 3300037466 Bacteria 2709
373 Ga0395898_0148501 3300037466 Bacteria 2243
374 Ga0395905_0259901 3300037471 Bacteria 1621
375 Ga0436364_0281278 3300037853 Bacteria 34090
376 Ga0436364_0904449 3300037853 Bacteria 2360
377 Ga0436364_0984338 3300037853 Bacteria 2695
378 Ga0436364_1231246 3300037853 Bacteria 4565
379 Ga0436364_1337275 3300037853 Bacteria 3761
380 Ga0395901_0154816 3300038443 Bacteria 2408
381 Ga0395901_0240173 3300038443 Bacteria 1890
382 Ga0395901_0810645 3300038443 Bacteria 924
383 Ga0395901_1012062 3300038443 Bacteria 806
384 Ga0400483_031226 3300039062 Bacteria 2670
385 Ga0436365_0261699 3300039437 Bacteria 8326
386 Ga0436365_0457696 3300039437 Bacteria 1037
387 Ga0436365_0829696 3300039437 Bacteria 36403
388 Ga0436365_1063208 3300039437 Bacteria 2154
389 Ga0436365_1359706 3300039437 Bacteria 2246
390 Ga0436365_1369925 3300039437 Bacteria 12666
391 Ga0436365_1436379 3300039437 Bacteria 1766
392 Ga0436365_1844499 3300039437 Bacteria 1279
393 Ga0436360_0832565 3300039438 Bacteria 8060
394 Ga0436360_0851954 3300039438 Bacteria 1380
395 Ga0436361_0379028 3300039447 Bacteria 3805
396 Ga0436361_0987636 3300039447 Bacteria 4376
397 Ga0436363_0292864 3300039450 Bacteria 3200
398 Ga0436363_0436908 3300039450 Bacteria 2420
399 Ga0436363_0451258 3300039450 Bacteria 2197
400 Ga0436363_0655475 3300039450 Bacteria 3427
401 Ga0436363_0775146 3300039450 Bacteria 11928
402 Ga0436363_0802555 3300039450 Bacteria 2593
403 Ga0436363_1571051 3300039450 Bacteria 883
404 Ga0436363_1571660 3300039450 Bacteria 2001
405 Ga0436362_0963821 3300039453 Bacteria 1543
406 Ga0436362_1185069 3300039453 Bacteria 11827
407 Ga0451797_0777937 3300041453 Bacteria 1279
408 Ga0466969_0044243 3300044656 Bacteria 2216
409 Ga0466972_0000299 3300044658 Bacteria 30012
410 Ga0466972_0052825 3300044658 Bacteria 1957
411 Ga0466966_0002843 3300044684 Bacteria 11392
412 Ga0466966_0081395 3300044684 Bacteria 2016
413 Ga0466961_0002447 3300044693 Bacteria 11519
414 Ga0466961_0141153 3300044693 Bacteria 1508
415 Ga0466963_0095903 3300044694 Bacteria 2025
416 Ga0466963_0237919 3300044694 Bacteria 1276
417 Ga0466963_0361743 3300044694 Bacteria 1022
418 Ga0466964_0092544 3300044706 Bacteria 1319
419 Ga0466968_0002351 3300044735 Bacteria 6916
420 Ga0466968_0081500 3300044735 Bacteria 1422
421 Ga0466970_0171981 3300044765 Bacteria 1201
422 Ga0466957_0059708 3300044842 Bacteria 2338
423 Ga0466960_0097824 3300044901 Bacteria 1506
424 Ga0466958_0145600 3300045836 Bacteria 1493
425 Ga0466967_0070195 3300045976 Bacteria 3133
426 Ga0466967_0115827 3300045976 Bacteria 2469
427 Ga0495592_0026073 3300046454 Bacteria 4434
428 Ga0495603_0000801 3300046455 Bacteria 18013
429 Ga0495603_0007385 3300046455 Bacteria 6608
430 Ga0495603_0298947 3300046455 Bacteria 924
431 Ga0495590_0075863 3300046457 Bacteria 1183
432 Ga0495629_0004806 3300046459 Bacteria 10133
433 Ga0495629_0007739 3300046459 Bacteria 7906
434 Ga0495638_0017844 3300046460 Bacteria 4723
435 Ga0495638_0034495 3300046460 Bacteria 3230
436 Ga0495638_0158860 3300046460 Bacteria 1306
437 Ga0495638_0199003 3300046460 Bacteria 1132
438 Ga0495641_0002198 3300046461 Bacteria 15577
439 Ga0495651_0111889 3300046462 Bacteria 2018
440 Ga0495651_0343390 3300046462 Bacteria 988
441 Ga0495653_0215187 3300046463 Bacteria 1295
442 Ga0495580_0038398 3300046472 Bacteria 3429
443 Ga0495582_0000855 3300046473 Bacteria 16906
444 Ga0495639_0000072 3300046475 Bacteria 46904
445 Ga0495639_0020710 3300046475 Bacteria 2874
446 Ga0495662_0000572 3300046476 Bacteria 16948
447 Ga0495662_0197010 3300046476 Bacteria 993
448 Ga0495664_0002994 3300046477 Bacteria 9132
449 Ga0495664_0011398 3300046477 Bacteria 5012
450 Ga0495584_0078381 3300046491 Bacteria 1662
451 Ga0495584_0115366 3300046491 Bacteria 1359
452 Ga0495594_0000046 3300046499 Bacteria 53822
453 Ga0495583_0081903 3300046506 Bacteria 1401
454 Ga0495606_0034430 3300046507 Bacteria 3477
455 Ga0495610_0027759 3300046512 Bacteria 3003
456 Ga0495616_0048814 3300046513 Bacteria 2124
457 Ga0495616_0056120 3300046513 Bacteria 1946
458 Ga0495620_0040172 3300046515 Bacteria 2061
459 Ga0495630_0011525 3300046517 Bacteria 6402
460 Ga0495643_0007651 3300046522 Bacteria 6931
461 Ga0495648_0052615 3300046524 Bacteria 2472
462 Ga0495663_0034611 3300046525 Bacteria 1513
463 Ga0495666_0003632 3300046526 Bacteria 7798
464 Ga0495666_0154266 3300046526 Bacteria 1067
465 Ga0495652_0031563 3300046529 Bacteria 4638
466 Ga0495665_0000128 3300046531 Bacteria 36043
467 Ga0495640_0012908 3300046533 Bacteria 6370
468 Ga0495621_0065406 3300046539 Bacteria 1328
469 Ga0495597_0042608 3300046542 Bacteria 2024
470 Ga0495597_0134503 3300046542 Bacteria 1023
471 Ga0495645_0015358 3300046543 Bacteria 5445
472 Ga0495645_0044984 3300046543 Bacteria 3220
473 Ga0495645_0162030 3300046543 Bacteria 1546
474 Ga0495622_0007496 3300046557 Bacteria 5062
475 Ga0495622_0022209 3300046557 Bacteria 2956
476 Ga0495667_0025221 3300046559 Bacteria 4008
477 Ga0495656_0028598 3300046615 Bacteria 2237
478 Ga0495656_0054370 3300046615 Bacteria 1722
479 Ga0495634_0003037 3300046642 Bacteria 13668
480 Ga0495634_0320167 3300046642 Bacteria 934
481 Ga0495625_0218111 3300046660 Bacteria 1251
482 Ga0495635_0002038 3300046663 Bacteria 13679
483 Ga0495635_0003646 3300046663 Bacteria 10680
484 Ga0495661_0033443 3300046665 Bacteria 3243
485 Ga0495588_0010612 3300046674 Bacteria 4291
486 Ga0495588_0044719 3300046674 Bacteria 2269
487 Ga0495657_0002636 3300046675 Bacteria 15017
488 Ga0495658_0004429 3300046683 Bacteria 6911
489 Ga0495669_0131590 3300046684 Bacteria 1177
490 Ga0495613_0003702 3300046689 Bacteria 11465
491 Ga0495624_0000795 3300046690 Bacteria 24919
492 Ga0495600_0126739 3300046809 Bacteria 1660
493 Ga0495581_0000030 3300047315 Bacteria 53487
494 Ga0495604_0020841 3300047317 Bacteria 5233
495 Ga0495636_0068370 3300047318 Bacteria 1512
496 Ga0495674_0001230 3300047319 Bacteria 24837
497 Ga0495672_0028262 3300047320 Bacteria 3550
498 Ga0495672_0219222 3300047320 Bacteria 940
499 Ga0495676_0017129 3300047321 Bacteria 6412
500 Ga0495676_0475670 3300047321 Bacteria 822
501 Ga0495680_0000836 3300047322 Bacteria 34084
502 Ga0495680_0094218 3300047322 Bacteria 2241
503 Ga0495675_0036875 3300047444 Bacteria 3116
504 Ga0495681_0038105 3300047470 Bacteria 2360
505 Ga0495684_0018978 3300047471 Bacteria 5294
506 Ga0495684_0089426 3300047471 Bacteria 2333
507 Ga0495593_0000470 3300047673 Bacteria 22684
508 Ga0495593_0013800 3300047673 Bacteria 4603
509 Ga0495602_0360503 3300048088 Bacteria 1047
510 Ga0495614_0022266 3300048089 Bacteria 2735
511 Ga0495614_0038654 3300048089 Bacteria 2048
512 Ga0495626_0013148 3300048091 Bacteria 4312
513 Ga0496100_0045464 3300048903 Bacteria 2818
514 Ga0496100_0427594 3300048903 Bacteria 1012
515 Ga0496101_0272312 3300048904 Bacteria 1322
516 Ga0496102_0457189 3300048905 Bacteria 1197
517 Ga0496103_0016321 3300048906 Bacteria 4431
518 Ga0496103_0387068 3300048906 Bacteria 898
519 Ga0496104_0004634 3300048907 Bacteria 11973
520 Ga0496104_0006887 3300048907 Bacteria 10025
521 Ga0496104_0058668 3300048907 Bacteria 3643
522 Ga0496105_0018687 3300048908 Bacteria 5579
523 Ga0496105_0043484 3300048908 Bacteria 3705
524 Ga0496105_0199333 3300048908 Bacteria 1634
525 Ga0496106_0003643 3300048909 Bacteria 11488
526 Ga0496107_0046717 3300048910 Bacteria 3116
527 Ga0496107_0181458 3300048910 Bacteria 1563
528 Ga0496108_0155438 3300048911 Bacteria 1975
529 Ga0496108_0238859 3300048911 Bacteria 1580
530 Ga0496108_0410894 3300048911 Bacteria 1182
531 Ga0496109_0095265 3300048912 Bacteria 2756
532 Ga0496109_0130510 3300048912 Bacteria 2345
533 Ga0496109_0151503 3300048912 Bacteria 2171
534 Ga0496110_0017143 3300048913 Bacteria 6055
535 Ga0496110_0127423 3300048913 Bacteria 2297
536 Ga0496110_0138630 3300048913 Bacteria 2199
537 Ga0496110_0411456 3300048913 Bacteria 1233
538 Ga0496111_0015674 3300048914 Bacteria 5209
539 Ga0496112_0004525 3300048915 Bacteria 11810
540 Ga0496112_0004583 3300048915 Bacteria 11751
541 Ga0496112_0146271 3300048915 Bacteria 2332
542 Ga0496112_0215534 3300048915 Bacteria 1876
543 Ga0496114_0109828 3300048917 Bacteria 2362
544 Ga0496115_0003360 3300048918 Bacteria 11473
545 Ga0496115_0044258 3300048918 Bacteria 3550
546 Ga0496116_0001930 3300048919 Bacteria 22336
547 Ga0496117_0012405 3300048920 Bacteria 7516
548 Ga0496117_0051814 3300048920 Bacteria 2897
549 Ga0496117_0219744 3300048920 Bacteria 1058
550 Ga0496118_0010865 3300048921 Bacteria 8960
551 Ga0496118_0020331 3300048921 Bacteria 5889
552 Ga0496118_0060316 3300048921 Bacteria 2817
553 Ga0496118_0135418 3300048921 Bacteria 1573
554 Ga0496118_0149541 3300048921 Bacteria 1464
555 Ga0496119_0140410 3300048922 Bacteria 1305
556 Ga0496120_0008022 3300048923 Bacteria 7770
557 Ga0496120_0021337 3300048923 Bacteria 4095
558 Ga0496121_0000811 3300048924 Bacteria 56962
559 Ga0496121_0000870 3300048924 Bacteria 54546
560 Ga0496121_0017520 3300048924 Bacteria 7309
561 Ga0496121_0024640 3300048924 Bacteria 5745
562 Ga0496121_0174913 3300048924 Bacteria 1555
563 Ga0496121_0230428 3300048924 Bacteria 1298
564 Ga0496123_0054650 3300048926 Bacteria 2627
565 Ga0496124_0002001 3300048927 Bacteria 27769
566 Ga0496124_0046080 3300048927 Bacteria 3736
567 Ga0496124_0051368 3300048927 Bacteria 3508
568 Ga0496124_0099848 3300048927 Bacteria 2353
569 Ga0496124_0355129 3300048927 Bacteria 1035
570 Ga0496125_0000869 3300048928 Bacteria 48286
571 Ga0496125_0006645 3300048928 Bacteria 12446
572 Ga0496125_0015348 3300048928 Bacteria 7416
573 Ga0496125_0018462 3300048928 Bacteria 6623
574 Ga0496125_0026599 3300048928 Bacteria 5267
575 Ga0496125_0066354 3300048928 Bacteria 2852
576 Ga0496125_0108616 3300048928 Bacteria 2017
577 Ga0496125_0212982 3300048928 Bacteria 1253
578 Ga0496125_0322812 3300048928 Bacteria 935
579 Ga0496125_0326778 3300048928 Bacteria 927
580 Ga0496126_0028135 3300048929 Bacteria 5360
581 Ga0496126_0036323 3300048929 Bacteria 4607
582 Ga0496126_0055197 3300048929 Bacteria 3595
583 Ga0496126_0064657 3300048929 Bacteria 3276
584 Ga0496126_0074215 3300048929 Bacteria 3021
585 Ga0496126_0145097 3300048929 Bacteria 2039
586 Ga0496126_0217168 3300048929 Bacteria 1608
587 Ga0496126_0260193 3300048929 Bacteria 1443
588 Ga0496126_0399814 3300048929 Bacteria 1114
589 Ga0501308_015165 3300049128 Bacteria 911
590 Ga0501344_01846 3300049133 Bacteria 1056
591 Ga0495678_066654 3300049459 Bacteria 1332
592 Ga0495678_080423 3300049459 Bacteria 1171
593 Ga0501317_023690 3300049533 Bacteria 849
594 Ga0501031_0002390 3300049568 Bacteria 11926
595 Ga0501032_0001465 3300049569 Bacteria 18782
596 Ga0501032_0009394 3300049569 Bacteria 7084
597 Ga0501032_0111245 3300049569 Bacteria 1812
598 Ga0501033_0000221 3300049570 Bacteria 54727
599 Ga0501033_0014226 3300049570 Bacteria 6048
600 Ga0501033_0161719 3300049570 Bacteria 1611
601 Ga0501034_0063989 3300049571 Bacteria 3692
602 Ga0501034_0387516 3300049571 Bacteria 1322
603 Ga0501036_0112469 3300049572 Bacteria 2301
604 Ga0501036_0116278 3300049572 Bacteria 2259
605 Ga0501036_0149151 3300049572 Bacteria 1972
606 Ga0501036_0185584 3300049572 Bacteria 1750
607 Ga0501037_0000211 3300049573 Bacteria 51924
608 Ga0501037_0199519 3300049573 Bacteria 1414
609 Ga0501038_0117785 3300049574 Bacteria 2193
610 Ga0501038_0214098 3300049574 Bacteria 1540
611 Ga0501039_0004618 3300049575 Bacteria 10417
612 Ga0501039_0073196 3300049575 Bacteria 2662
613 Ga0501039_0078518 3300049575 Bacteria 2568
614 Ga0501041_0022265 3300049577 Bacteria 3794
615 Ga0501041_0168583 3300049577 Bacteria 1370
616 Ga0501042_0102050 3300049578 Bacteria 2063
617 Ga0501042_0417913 3300049578 Bacteria 972
618 Ga0501043_0002234 3300049579 Bacteria 16494
619 Ga0501043_0097788 3300049579 Bacteria 2307
620 Ga0501043_0215386 3300049579 Bacteria 1487
621 Ga0501046_0097963 3300049580 Bacteria 2252
622 Ga0501046_0179534 3300049580 Bacteria 1584
623 Ga0501047_0036900 3300049581 Bacteria 4724
624 Ga0501047_0082949 3300049581 Bacteria 3081
625 Ga0501047_0170043 3300049581 Bacteria 2048
626 Ga0501048_0070529 3300049582 Bacteria 2468
627 Ga0501068_0097814 3300049584 Bacteria 1816
628 Ga0501070_0014987 3300049586 Bacteria 6522
629 Ga0501070_0067905 3300049586 Bacteria 2952
630 Ga0501070_0121560 3300049586 Bacteria 2158
631 Ga0501071_0012141 3300049587 Bacteria 5829
632 Ga0501071_0470326 3300049587 Bacteria 963
633 Ga0501072_0004379 3300049588 Bacteria 10721
634 Ga0501073_0024476 3300049589 Bacteria 4336
635 Ga0501074_0012908 3300049590 Bacteria 6073
636 Ga0501075_0027955 3300049591 Bacteria 4159
637 Ga0501076_0134528 3300049592 Bacteria 2006
638 Ga0501077_0037268 3300049593 Bacteria 3098
639 Ga0501080_0009730 3300049742 Bacteria 8780
640 Ga0501080_0113318 3300049742 Bacteria 2514
641 Ga0501081_0324216 3300049743 Bacteria 1132
642 Ga0501035_0003613 3300049822 Bacteria 14762
643 Ga0501035_0040812 3300049822 Bacteria 4192
644 Ga0501035_0144235 3300049822 Bacteria 2069
645 Ga0501035_0160333 3300049822 Bacteria 1947
646 Ga0501044_0006548 3300049823 Bacteria 12857
647 Ga0501044_0030992 3300049823 Bacteria 5631
648 Ga0501044_0038489 3300049823 Bacteria 4994
649 Ga0501044_0101594 3300049823 Bacteria 2893
650 Ga0501044_0119655 3300049823 Bacteria 2635
651 Ga0501044_0266664 3300049823 Bacteria 1649
652 Ga0501044_0504743 3300049823 Bacteria 1110
653 Ga0501044_0973984 3300049823 Bacteria 721
654 Ga0501045_0081117 3300049824 Bacteria 2392
655 nmdc:mga03683_58931_c1 3300050489 Bacteria 1619
656 nmdc:mga03n38_12117_c1 3300050490 Bacteria 3235
657 nmdc:mga03n38_7962_c1 3300050490 Bacteria 3776
658 nmdc:mga00v17_16675_c2 3300050491 Bacteria 1545
659 nmdc:mga00v17_84585_c1 3300050491 Bacteria 1986
660 nmdc:mga00v17_95829_c1 3300050491 Bacteria 1868
661 nmdc:mga0yw44_13126_c1 3300050492 Bacteria 4349
662 nmdc:mga0yw44_171654_c1 3300050492 Bacteria 1424
663 nmdc:mga0yw44_63003_c1 3300050492 Bacteria 2279
664 nmdc:mga0yw44_63079_c1 3300050492 Bacteria 2278
665 nmdc:mga0k408_153467_c1 3300050493 Bacteria 1372
666 nmdc:mga0k408_61581_c1 3300050493 Bacteria 935
667 nmdc:mga06z11_58021_c1 3300050494 Bacteria 2007
668 nmdc:mga06z11_85331_c1 3300050494 Bacteria 1703
669 nmdc:mga06z11_92058_c1 3300050494 Bacteria 1648
670 nmdc:mga07m45_135204_c1 3300050496 Bacteria 1427
671 nmdc:mga07m45_316726_c1 3300050496 Bacteria 907
672 nmdc:mga07m45_7843_c1 3300050496 Bacteria 5464
673 nmdc:mga07m45_97861_c1 3300050496 Bacteria 1684
674 nmdc:mga08y16_188038_c1 3300050511 Bacteria 2143
675 nmdc:mga08x19_91753_c1 3300050514 Bacteria 2005
676 nmdc:mga0a205_241895_c1 3300050515 Bacteria 1685
677 nmdc:mga0sz30_47631_c1 3300050516 Bacteria 1812
678 nmdc:mga0sz30_6347_c1 3300050516 Bacteria 4388
679 nmdc:mga0sz30_7031_c1 3300050516 Bacteria 4207
680 Ga0495612_0101059 3300053078 Bacteria 1228
681 Ga0500635_0011112 3300053080 Bacteria 2551
682 Ga0495595_0150542 3300053084 Bacteria 1145
683 Ga0495619_0006419 3300053085 Bacteria 7451
684 Ga0495619_0472753 3300053085 Bacteria 863
685 Ga0500643_032856 3300053087 Bacteria 1572
686 Ga0500581_049278 3300053089 Bacteria 2150
687 Ga0500581_172258 3300053089 Bacteria 992
688 Ga0500566_0000055 3300053094 Bacteria 54414
689 Ga0500566_0003437 3300053094 Bacteria 9442
690 Ga0500566_0038668 3300053094 Bacteria 2760
691 Ga0500641_0001366 3300053096 Bacteria 8686
692 Ga0500650_0000245 3300053098 Bacteria 13194
693 Ga0500554_006966 3300053102 Bacteria 2573
694 Ga0500556_0000006 3300053104 Bacteria 453982
695 Ga0500569_002880 3300053109 Bacteria 3446
696 Ga0500591_020057 3300053115 Bacteria 3241
697 Ga0500595_001016 3300053119 Bacteria 15748
698 Ga0500595_002547 3300053119 Bacteria 8931
699 Ga0500595_077621 3300053119 Bacteria 976
700 Ga0500608_000604 3300053122 Bacteria 13230
701 Ga0500608_027696 3300053122 Bacteria 2672
702 Ga0500642_0000004 3300053130 Bacteria 433122
703 Ga0500652_000294 3300053131 Bacteria 18164
704 Ga0500658_0028806 3300053134 Bacteria 2157
705 Ga0500559_0000362 3300053136 Bacteria 33750
706 Ga0500559_0019096 3300053136 Bacteria 2896
707 Ga0500568_0001522 3300053139 Bacteria 14778
708 Ga0500568_0050342 3300053139 Bacteria 1642
709 Ga0500586_017738 3300053145 Bacteria 2184
710 Ga0500590_025848 3300053148 Bacteria 3049
711 Ga0500590_125280 3300053148 Bacteria 1197
712 Ga0500603_000630 3300053150 Bacteria 8688
713 Ga0500604_0002744 3300053151 Bacteria 4784
714 Ga0500616_0000022 3300053153 Bacteria 460463
715 Ga0500616_0000244 3300053153 Bacteria 85079
716 Ga0500622_0000953 3300053156 Bacteria 24595
717 Ga0500630_152704 3300053159 Bacteria 976
718 Ga0500633_0061126 3300053160 Bacteria 1325
719 Ga0500634_0011130 3300053161 Bacteria 4627
720 Ga0500638_000160 3300053162 Bacteria 13163
721 Ga0500638_025570 3300053162 Bacteria 2823
722 Ga0500639_026342 3300053163 Bacteria 3072
723 Ga0500639_184390 3300053163 Bacteria 918
724 Ga0500636_0004749 3300053177 Bacteria 7704
725 Ga0500637_0000180 3300053178 Bacteria 23612
726 Ga0500637_0026584 3300053178 Bacteria 3189
727 Ga0500637_0117530 3300053178 Bacteria 1542
728 Ga0500637_0132267 3300053178 Bacteria 1446
729 Ga0500567_062807 3300053723 Bacteria 1657
730 Ga0500645_043501 3300053730 Bacteria 1323
731 Ga0500552_018595 3300053733 Bacteria 965
732 Ga0500596_001070 3300053735 Bacteria 5519
733 Ga0501084_0132762 3300054114 Bacteria 2096
734 Ga0587093_015825 3300059478 Bacteria 956
735 Ga0587066_033408 3300059490 Bacteria 930
736 Ga0587077_039774 3300059493 Bacteria 939
737 Ga0587080_027782 3300059503 Bacteria 968
738 Ga0587082_026592 3300059504 Bacteria 980
739 Ga0587083_0049948 3300059505 Bacteria 908
740 Ga0587083_0053841 3300059505 Bacteria 886
741 Ga0587085_024953 3300059506 Bacteria 942
742 Ga0587088_035480 3300059508 Bacteria 914
743 Ga0587091_038584 3300059511 Bacteria 932
744 Ga0587106_015136 3300059605 Bacteria 1073
745 Ga0587125_010223 3300059607 Bacteria 965
746 Ga0587101_022396 3300059623 Bacteria 921
747 Ga0587113_008368 3300059625 Bacteria 918
748 Ga0587115_019465 3300059626 Bacteria 934
749 Ga0587117_019089 3300059627 Bacteria 939
750 Ga0587130_008774 3300059631 Bacteria 964
751 Ga0587062_019188 3300059639 Bacteria 952
752 Ga0587062_020778 3300059639 Bacteria 929
753 Ga0587069_016120 3300059642 Bacteria 1064
754 Ga0587069_030050 3300059642 Bacteria 873
755 Ga0587079_034016 3300059647 Bacteria 995
756 Ga0587108_006445 3300059653 Bacteria 909
757 Ga0501082_0553466 3300060353 Bacteria 1006
758 Ga0530510_0031863 3300061734 Bacteria 3791
759 2507505442 2507262055 Bacteria 8048963
760 2508539327 2508501009 Bacteria 7784016
761 2508695654 2508501042 Bacteria 8719808
762 2511400450 2511231028 Bacteria 8046582
763 2513623934 2513237092 Bacteria 8341956
764 2513642181 2513237094 Bacteria 8789602
765 2513659501 2513237096 Bacteria 8722461
766 2513676307 2513237098 Bacteria 9902361
767 2513695279 2513237101 Bacteria 7952346
768 2513718232 2513237104 Bacteria 10034502
769 2513859392 2513237137 Bacteria 9558895
770 2513873358 2513237139 Bacteria 8737671
771 2513888588 2513237141 Bacteria 8496279
772 2513921566 2513237145 Bacteria 8979722
773 2515627637 2515154112 Bacteria 8294334
774 2517106288 2517093001 Bacteria 9002274
775 2517889042 2517572143 Bacteria 9484767
776 2524441433 2524023205 Bacteria 8918781
777 2524467235 2524023210 Bacteria 9029266
778 2524537477 2524023228 Bacteria 10118060
779 2603858633 2602042107 Bacteria 6226103
780 2617352069 2617270735 Bacteria 9163226
781 2644291085 2643221651 Bacteria 4798932
782 2671124031 2667528175 Bacteria 7532676
783 2723841813 2721755755 Bacteria 8322773
784 2728748440 2728368998 Bacteria 8720350
785 2745077567 2744054633 Bacteria 8678936
786 2793072719 2791355197 Bacteria 8420563
787 2793078313
788 2805920706 2802429603 Bacteria 8777136
789 2824608728 2824600985 Bacteria 8488197
790 2824617671 2824609381 Bacteria 8672835
791 2824660134 2824653114 Bacteria 8493680
792 2824687600 2824679649 Bacteria 8248951
793 2824702614 2824696289 Bacteria 8335049
794 2824710492 2824704595 Bacteria 9667483
795 2824761763 2824753945 Bacteria 9787441
796 2824772262 2824763712 Bacteria 9792355
797 2824780852 2824773399 Bacteria 8360218
798 2841965354 2841957949 Bacteria 8652217
799 2844315535 2844315083 Bacteria 8138177
800 2847942331 2847939898 Bacteria 8606328
801 2849083204 2849076700 Bacteria 7039503
802 2857526247 2857524615 Bacteria 6615449
803 2874592557 2874590934 Bacteria 8299676
804 2874607894 2874604998 Bacteria 7834745
805 2874617988 2874612657 Bacteria 8252029
806 2874647176 2874645413 Bacteria 8214782
807 2876772560 2876771140 Bacteria 8287509
808 2876814195 2876808645 Bacteria 8824342
809 2876819821 2876818435 Bacteria 8274608
810 2879076327 2879074833 Bacteria 8279565
811 2879113321 2879110137 Bacteria 8907982
812 2879128811 2879127579 Bacteria 8294491
813 2879143632 2879142872 Bacteria 8267021
814 2884298507 2884298095 Bacteria 3823049
815 2885377546 2885374607 Bacteria 8927485
816 2885386910 2885383462 Bacteria 9473874
817 2885415844 2885409591 Bacteria 9235467
818 2888420130 2888419890 Bacteria 7857137
819 2889035311 2889033259 Bacteria 9099371
820 2893067481 2893066018 Bacteria 6158120
821 2903733696 2903727486 Bacteria 8281579
822 2903758805 2903748898 Bacteria 9972761
823 2903774497 2903768456 Bacteria 9749579
824 2904691013 2904690495 Bacteria 9412302
825 2904708410
826 2904716338 2904711408 Bacteria 9771557
827 2906609456 2906602504 Bacteria 8295279
828 2906613582
829 2906635823 2906635258 Bacteria 8601019
830 2906668116 2906660503 Bacteria 8595048
831 2908747644 2908739725 Bacteria 8628932
832 2908757071 2908756301 Bacteria 8864324
833 2919073901 2919073203 Bacteria 6531949
834 2922363199 2922361189 Bacteria 7436256
835 2922388496 2922386360 Bacteria 7017218
836 2922396592 2922393267 Bacteria 8285685
837 2922434019
838 2935615529 2935608549 Bacteria 8203142
839 2935636046 2935630451 Bacteria 8169952
840 2935654459 2935648319 Bacteria 8801166
841 2935663339 2935656913 Bacteria 8965014
842 2935774298 2935769743 Bacteria 7878163
843 2935783337 2935777560 Bacteria 8077691
844 2935788987 2935785616 Bacteria 7962367
845 2935796737 2935793552 Bacteria 8012592
846 2935825670 2935819856 Bacteria 8261050
847 2935853434 2935847175 Bacteria 8228321
848 2935915036 2935908558 Bacteria 8568796
849 2935918884 2935916978 Bacteria 9113783
850 2935931399 2935926038 Bacteria 8601059
851 2935939996 2935934488 Bacteria 8602579
852 2935947657 2935942939 Bacteria 8599779
853 2935956428 2935951376 Bacteria 8602333
854 2935966726 2935959822 Bacteria 7869783
855 2935973222 2935967501 Bacteria 8603075
856 2935980534 2935975950 Bacteria 8347125
857 2935990114 2935984226 Bacteria 8302647
858 2936017502 2936011229 Bacteria 8801034
859 2936025997 2936019824 Bacteria 8804134
860 2936034839 2936028420 Bacteria 8965941
861 2936052903 2936046547 Bacteria 8903709
862 2936060238 2936055302 Bacteria 8785755
863 2941512650 2941507105 Bacteria 8166816
864 2941520512 2941515067 Bacteria 8166720
865 2941528526 2941523033 Bacteria 8169134
866 3005475266 3005474847 Bacteria 9259049
867 3005486682 3005483717 Bacteria 7877331
868 3005508988 3005506211 Bacteria 6943378
869 3005594129 3005587118 Bacteria 7794411
870 3005595227 3005594810 Bacteria 8716512
871 3005711169 3005710791 Bacteria 7622528
872 3005718465 3005718088 Bacteria 8283608
873 8006936011 8006933436 Bacteria 10410654
874 8006967628 8006964411 Bacteria 8966052
875 8006975865 8006973647 Bacteria 10679141
876 8006991098 8006984368 Bacteria 9651211
877 8007000427 8006994254 Bacteria 8309700
878 8016526319 8016522445 Bacteria 8156687
879 8016531381 8016530956 Bacteria 8155261
880 8016544595 8016539877 Bacteria 8155419
881 8016557480 8016548790 Bacteria 8155074
882 8016565838 8016557553 Bacteria 8154380
883 8016569647 8016566248 Bacteria 8158151
884 8016586158 8016583857 Bacteria 10421953
885 8016603437 8016595262 Bacteria 8149947
886 8016606374 8016603502 Bacteria 8731218
887 8016618282 8016613128 Bacteria 8794220
888 8016622931 8016622563 Bacteria 7999408
889 8019531215 8019530166 Bacteria 8155624
890 8019540340 8019538911 Bacteria 7872763
891 8019549931 8019547302 Bacteria 7996444
892 8019562643 8019555841 Bacteria 9642137
893 8019572722 8019565922 Bacteria 9639779
894 8019623154 8019619141 Bacteria 9218857
895 8019629944 8019629233 Bacteria 8687553
896 8019640662 8019638758 Bacteria 9062356
897 8019676542 8019668869 Bacteria 8791617
898 8019696057 8019687851 Bacteria 8712826
899 8056676132 8056673599 Bacteria 7871253
900 8056682932 8056681323 Bacteria 8472857
901 8056691136 8056689827 Bacteria 6712655
902 Ga0105237_10014356
903 JGI24740J21852_10019014
904 JGI24737J22298_10000979
905 JGI24738J21930_10031241
906 JGI25406J46586_10045046
907 JGI25165J46597_1009200
908 Ga0006777J48905_1044268
909 Ga0007409J51694_1018315
910 Ga0055526_1019675
911 JGI25405J52794_10031793
912 Ga0058859_10002637
913 Ga0058860_12101187
914 Ga0058862_12634862
915 Ga0065165_1038109
916 Ga0070658_10018416
917 Ga0070683_100009865
918 Ga0070670_100359760
919 Ga0068869_100064257
920 Ga0070666_10143604
921 Ga0070680_100036908
922 Ga0070680_100574888
923 Ga0070691_10048168
924 Ga0070668_100084817
925 Ga0070668_100260994
926 Ga0070668_100342991
927 Ga0070669_100023783
928 Ga0070669_100523000
929 Ga0070675_100511647
930 Ga0070671_100000542
931 Ga0070673_100212996
932 Ga0070688_100342197
933 Ga0070659_100084996
934 Ga0070667_100035887
935 Ga0070667_100246357
936 Ga0070709_10014869
937 Ga0070709_10019171
938 Ga0070709_10044929
939 Ga0070714_100073568
940 Ga0070714_100191652
941 Ga0070713_100025592
942 Ga0070713_100045297
943 Ga0070713_100079741
944 Ga0070713_100119688
945 Ga0070713_100168405
946 Ga0070713_100348883
947 Ga0070710_10002858
948 Ga0070710_10020812
949 Ga0070710_10412975
950 Ga0070663_100001941
951 Ga0070663_100060988
952 Ga0070681_10001077
953 Ga0070681_10132401
954 Ga0068867_100176355
955 Ga0070707_100142842
956 Ga0070699_100168805
957 Ga0070679_100005644
958 Ga0070679_100028700
959 Ga0070679_100097238
960 Ga0070679_100103273
961 Ga0070684_100008528
962 Ga0070684_100133161
963 Ga0068853_100015795
964 Ga0068853_100280674
965 Ga0070672_100256992
966 Ga0070686_100303674
967 Ga0070695_100045867
968 Ga0070693_100059830
969 Ga0070693_100089949
970 Ga0070665_100001356
971 Ga0070665_100182360
972 Ga0070665_100331908
973 Ga0068855_100024520
974 Ga0068855_100046913
975 Ga0068855_100188673
976 Ga0068855_100240999
977 Ga0068855_100415431
978 Ga0070664_100431467
979 Ga0068857_100005034
980 Ga0068857_100166962
981 Ga0068857_100223783
982 Ga0068854_100003979
983 Ga0068854_100342861
984 Ga0068856_100000883
985 Ga0068856_100004208
986 Ga0068856_100152442
987 Ga0068859_100093827
988 Ga0068864_100085987
989 Ga0068851_10006246
990 Ga0068870_10164917
991 Ga0068863_100074583
992 Ga0068863_100150925
993 Ga0068858_100039033
994 Ga0068858_100478227
995 Ga0068860_100261639
996 Ga0068862_100034179
997 Ga0068862_100238505
998 Ga0081455_10000738
999 Ga0081455_10011519
1000 Ga0081455_10025851
1001 Ga0081455_10029499
1002 Ga0081538_10007441
1003 Ga0081538_10032665
1004 Ga0081540_1005811
1005 Ga0081540_1007723
1006 Ga0081540_1040622
1007 Ga0081539_10000371
1008 Ga0081539_10025876
1009 Ga0081539_10075608
1010 Ga0070717_10003277
1011 Ga0070717_10018898
1012 Ga0070717_10053768
1013 Ga0070717_10208139
1014 Ga0075365_10006761
1015 Ga0075365_10087096
1016 Ga0075365_10145024
1017 Ga0075368_10028408
1018 Ga0075363_100052946
1019 Ga0075364_10110184
1020 Ga0075364_10165743
1021 Ga0075364_10289396
1022 Ga0070716_100005454
1023 Ga0070712_100051297
1024 Ga0075362_10028375
1025 Ga0075362_10068248
1026 Ga0075367_10013523
1027 Ga0075367_10022578
1028 Ga0075369_10009920
1029 Ga0075369_10049655
1030 Ga0075366_10118823
1031 Ga0075370_10031036
1032 Ga0075370_10107073
1033 Ga0075370_10136094
1034 Ga0075370_10184506
1035 Ga0075370_10212095
1036 Ga0068865_100140332
1037 Ga0075436_100045387
1038 Ga0097620_100093827
1039 Ga0079104_1041320
1040 Ga0105251_10001526
1041 Ga0105240_10002459
1042 Ga0105240_10007949
1043 Ga0105240_10056136
1044 Ga0105240_10061018
1045 Ga0105240_10093949
1046 Ga0105240_10470262
1047 Ga0111539_10089486
1048 Ga0105247_10237703
1049 Ga0105247_10362207
1050 Ga0105241_10020741
1051 Ga0105241_10223420
1052 Ga0105248_10013528
1053 Ga0105248_10089282
1054 Ga0105237_10014927
1055 Ga0105237_10151573
1056 Ga0105237_10194513
1057 Ga0105238_10001235
1058 Ga0105238_10018660
1059 Ga0105238_10021262
1060 Ga0105238_10116101
1061 Ga0105249_10379015
1062 Ga0105249_10386249
1063 Ga0099796_10016687
1064 Ga0105239_10018536
1065 Ga0105239_10053677
1066 Ga0105239_10456862
1067 Ga0105239_10710672
1068 Ga0157314_1005405
1069 Ga0157369_10032756
1070 Ga0157369_10223644
1071 Ga0157374_10080278
1072 Ga0157374_10154653
1073 Ga0157374_10314643
1074 Ga0163162_10055722
1075 Ga0157375_10239363
1076 Ga0163163_10026240
1077 Ga0182008_10237463
1078 Ga0157379_10530911
1079 Ga0197907_10122096
1080 Ga0197907_11428149
1081 Ga0206356_10841646
1082 Ga0206356_11019694
1083 Ga0206356_11227967
1084 Ga0206349_1112773
1085 Ga0206349_1345775
1086 Ga0206349_1694165
1087 Ga0206349_1878734
1088 Ga0206355_1022003
1089 Ga0206355_1140956
1090 Ga0206351_10137541
1091 Ga0206351_10685837
1092 Ga0206351_10853499
1093 Ga0206352_10853849
1094 Ga0206352_11018583
1095 Ga0206352_11297536
1096 Ga0206350_10047531
1097 Ga0206350_10124601
1098 Ga0206350_10258629
1099 Ga0206350_10783199
1100 Ga0206350_11138243
1101 Ga0206350_11301687
1102 Ga0206354_10001066
1103 Ga0206354_10892454
1104 Ga0206354_11650149
1105 Ga0206353_10006930
1106 Ga0206353_11260487
1107 Ga0206353_11903621
1108 Ga0154015_1265539
1109 Ga0154015_1529450
1110 Ga0213873_10001008
1111 Ga0213876_10003470
1112 Ga0213876_10023883
1113 Ga0213876_10268756
1114 Ga0213875_10027840
1115 Ga0224712_10119344
1116 Ga0224712_10139243
1117 Ga0224712_10186241
1118 Ga0224712_10187736
1119 Ga0224712_10190267
1120 Ga0209677_100170
1121 Ga0209148_1006148
1122 Ga0209233_1012365
1123 Ga0209455_1002203
1124 Ga0209455_1007613
1125 Ga0209564_1000671
1126 Ga0209564_1010723
1127 Ga0209758_1001900
1128 Ga0207656_10011551
1129 Ga0207713_1002460
1130 Ga0207692_10006838
1131 Ga0207710_10105055
1132 Ga0207688_10086352
1133 Ga0207680_10126573
1134 Ga0207647_10022531
1135 Ga0207647_10027240
1136 Ga0207699_10169105
1137 Ga0207643_10070154
1138 Ga0207707_10001830
1139 Ga0207707_10028688
1140 Ga0207707_10299982
1141 Ga0207695_10051771
1142 Ga0207695_10139657
1143 Ga0207671_10062068
1144 Ga0207671_10099663
1145 Ga0207693_10003895
1146 Ga0207693_10004610
1147 Ga0207693_10107617
1148 Ga0207693_10304145
1149 Ga0207663_10054053
1150 Ga0207663_10098371
1151 Ga0207660_10413582
1152 Ga0207660_10488399
1153 Ga0207657_10268499
1154 Ga0207652_10005820
1155 Ga0207652_10315488
1156 Ga0207652_10394162
1157 Ga0207681_10000503
1158 Ga0207694_10018629
1159 Ga0207694_10023665
1160 Ga0207694_10185041
1161 Ga0207687_10404930
1162 Ga0207700_10070457
1163 Ga0207700_10345410
1164 Ga0207664_10023800
1165 Ga0207664_10429104
1166 Ga0207664_10501200
1167 Ga0207644_10001520
1168 Ga0207704_10433479
1169 Ga0207665_10006607
1170 Ga0207665_10113232
1171 Ga0207711_10002363
1172 Ga0207711_10048929
1173 Ga0207711_10567891
1174 Ga0207661_10000878
1175 Ga0207661_10092182
1176 Ga0207679_10214993
1177 Ga0207679_10319399
1178 Ga0207667_10037414
1179 Ga0207667_10152080
1180 Ga0207667_10482417
1181 Ga0207668_10003815
1182 Ga0207668_10846220
1183 Ga0207658_10197038
1184 Ga0207703_10302433
1185 Ga0207703_10339404
1186 Ga0207639_10213299
1187 Ga0207678_10043043
1188 Ga0207678_10149983
1189 Ga0207678_10237780
1190 Ga0207708_10280685
1191 Ga0207702_10000318
1192 Ga0207702_10232747
1193 Ga0207702_10567464
1194 Ga0207674_10014753
1195 Ga0207683_10088714
1196 Ga0207698_10089767
1197 Ga0207698_10627039
1198 Ga0209179_1015611
1199 Ga0268266_10000534
1200 Ga0268266_10001906
1201 Ga0268266_10009681
1202 Ga0268266_10394682
1203 Ga0268266_10465051
1204 Ga0268265_10065886
1205 Ga0268265_10125312
1206 Ga0268265_10211107
1207 Ga0268265_10853020
1208 Ga0268264_10000062
1209 Ga0268264_10353623
1210 Ga0265334_10006202
1211 Ga0307517_10000232
1212 Ga0307515_10354065
1213 Ga0310981_1033463
1214 Ga0307511_10085070
1215 Ga0307511_10114742
1216 Ga0265763_1004318
1217 Ga0265764_102331
1218 Ga0265332_10063996
1219 Ga0265332_10079800
1220 Ga0265325_10032360
1221 Ga0265340_10012805
1222 Ga0265340_10097790
1223 Ga0265339_10001952
1224 Ga0307513_10083845
1225 Ga0307513_10299956
1226 Ga0307509_10207829
1227 Ga0307508_10105800
1228 Ga0307508_10147504
1229 Ga0265314_10087483
1230 Ga0265314_10188651
1231 Ga0307516_10029260
1232 Ga0307516_10132990
1233 Ga0307516_10181291
1234 Ga0307409_100077156
1235 Ga0307415_100039352
1236 Ga0307507_10061770
1237 Ga0307510_10024915
1238 Ga0316215_1000881
1239 Ga0373950_0017256
1240 Ga0373936_0009753
1241 Ga0373943_0035254
1242 Ga0373943_0045855
1243 Ga0373955_0148985
1244 Ga0373935_0001267
1245 Ga0373935_0036686
1246 Ga0373935_0398511
1247 Ga0373927_0000766
1248 Ga0373927_0005757
1249 Ga0373927_0234532
1250 Ga0373933_0000218
1251 Ga0373933_0133166
1252 Ga0373947_0000310
1253 Ga0373937_0101471
1254 Ga0310112_018378
1255 Ga0310109_018809
1256 Ga0373925_0002455
1257 Ga0373925_0004991
1258 Ga0373925_0130723
1259 Ga0373925_0131430
1260 Ga0373925_0137215
1261 Ga0373925_0161821
1262 Ga0373925_0375173
1263 Ga0395899_0046650
1264 Ga0395900_0005138
1265 Ga0395900_0013190
1266 Ga0395900_0187341
1267 Ga0395900_0477755
1268 Ga0395900_0757346
1269 Ga0395898_0033290
1270 Ga0395898_0035036
1271 Ga0395898_0041886
1272 Ga0395898_0070416
1273 Ga0395898_0105024
1274 Ga0395898_0148501
1275 Ga0395905_0259901
1276 Ga0436364_0281278
1277 Ga0436364_0904449
1278 Ga0436364_0984338
1279 Ga0436364_1231246
1280 Ga0436364_1337275
1281 Ga0395901_0154816
1282 Ga0395901_0240173
1283 Ga0395901_0810645
1284 Ga0395901_1012062
1285 Ga0400483_031226
1286 Ga0436365_0261699
1287 Ga0436365_0457696
1288 Ga0436365_0829696
1289 Ga0436365_1063208
1290 Ga0436365_1359706
1291 Ga0436365_1369925
1292 Ga0436365_1436379
1293 Ga0436365_1844499
1294 Ga0436360_0832565
1295 Ga0436360_0851954
1296 Ga0436361_0379028
1297 Ga0436361_0987636
1298 Ga0436363_0292864
1299 Ga0436363_0436908
1300 Ga0436363_0451258
1301 Ga0436363_0655475
1302 Ga0436363_0775146
1303 Ga0436363_0802555
1304 Ga0436363_1571051
1305 Ga0436363_1571660
1306 Ga0436362_0963821
1307 Ga0436362_1185069
1308 Ga0451797_0777937
1309 Ga0466969_0044243
1310 Ga0466972_0000299
1311 Ga0466972_0052825
1312 Ga0466966_0002843
1313 Ga0466966_0081395
1314 Ga0466961_0002447
1315 Ga0466961_0141153
1316 Ga0466963_0095903
1317 Ga0466963_0237919
1318 Ga0466963_0361743
1319 Ga0466964_0092544
1320 Ga0466968_0002351
1321 Ga0466968_0081500
1322 Ga0466970_0171981
1323 Ga0466957_0059708
1324 Ga0466960_0097824
1325 Ga0466958_0145600
1326 Ga0466967_0070195
1327 Ga0466967_0115827
1328 Ga0495592_0026073
1329 Ga0495603_0000801
1330 Ga0495603_0007385
1331 Ga0495603_0298947
1332 Ga0495590_0075863
1333 Ga0495629_0004806
1334 Ga0495629_0007739
1335 Ga0495638_0017844
1336 Ga0495638_0034495
1337 Ga0495638_0158860
1338 Ga0495638_0199003
1339 Ga0495641_0002198
1340 Ga0495651_0111889
1341 Ga0495651_0343390
1342 Ga0495653_0215187
1343 Ga0495580_0038398
1344 Ga0495582_0000855
1345 Ga0495639_0000072
1346 Ga0495639_0020710
1347 Ga0495662_0000572
1348 Ga0495662_0197010
1349 Ga0495664_0002994
1350 Ga0495664_0011398
1351 Ga0495584_0078381
1352 Ga0495584_0115366
1353 Ga0495594_0000046
1354 Ga0495583_0081903
1355 Ga0495606_0034430
1356 Ga0495610_0027759
1357 Ga0495616_0048814
1358 Ga0495616_0056120
1359 Ga0495620_0040172
1360 Ga0495630_0011525
1361 Ga0495643_0007651
1362 Ga0495648_0052615
1363 Ga0495663_0034611
1364 Ga0495666_0003632
1365 Ga0495666_0154266
1366 Ga0495652_0031563
1367 Ga0495665_0000128
1368 Ga0495640_0012908
1369 Ga0495621_0065406
1370 Ga0495597_0042608
1371 Ga0495597_0134503
1372 Ga0495645_0015358
1373 Ga0495645_0044984
1374 Ga0495645_0162030
1375 Ga0495622_0007496
1376 Ga0495622_0022209
1377 Ga0495667_0025221
1378 Ga0495656_0028598
1379 Ga0495656_0054370
1380 Ga0495634_0003037
1381 Ga0495634_0320167
1382 Ga0495625_0218111
1383 Ga0495635_0002038
1384 Ga0495635_0003646
1385 Ga0495661_0033443
1386 Ga0495588_0010612
1387 Ga0495588_0044719
1388 Ga0495657_0002636
1389 Ga0495658_0004429
1390 Ga0495669_0131590
1391 Ga0495613_0003702
1392 Ga0495624_0000795
1393 Ga0495600_0126739
1394 Ga0495581_0000030
1395 Ga0495604_0020841
1396 Ga0495636_0068370
1397 Ga0495674_0001230
1398 Ga0495672_0028262
1399 Ga0495672_0219222
1400 Ga0495676_0017129
1401 Ga0495676_0475670
1402 Ga0495680_0000836
1403 Ga0495680_0094218
1404 Ga0495675_0036875
1405 Ga0495681_0038105
1406 Ga0495684_0018978
1407 Ga0495684_0089426
1408 Ga0495593_0000470
1409 Ga0495593_0013800
1410 Ga0495602_0360503
1411 Ga0495614_0022266
1412 Ga0495614_0038654
1413 Ga0495626_0013148
1414 Ga0496100_0045464
1415 Ga0496100_0427594
1416 Ga0496101_0272312
1417 Ga0496102_0457189
1418 Ga0496103_0016321
1419 Ga0496103_0387068
1420 Ga0496104_0004634
1421 Ga0496104_0006887
1422 Ga0496104_0058668
1423 Ga0496105_0018687
1424 Ga0496105_0043484
1425 Ga0496105_0199333
1426 Ga0496106_0003643
1427 Ga0496107_0046717
1428 Ga0496107_0181458
1429 Ga0496108_0155438
1430 Ga0496108_0238859
1431 Ga0496108_0410894
1432 Ga0496109_0095265
1433 Ga0496109_0130510
1434 Ga0496109_0151503
1435 Ga0496110_0017143
1436 Ga0496110_0127423
1437 Ga0496110_0138630
1438 Ga0496110_0411456
1439 Ga0496111_0015674
1440 Ga0496112_0004525
1441 Ga0496112_0004583
1442 Ga0496112_0146271
1443 Ga0496112_0215534
1444 Ga0496114_0109828
1445 Ga0496115_0003360
1446 Ga0496115_0044258
1447 Ga0496116_0001930
1448 Ga0496117_0012405
1449 Ga0496117_0051814
1450 Ga0496117_0219744
1451 Ga0496118_0010865
1452 Ga0496118_0020331
1453 Ga0496118_0060316
1454 Ga0496118_0135418
1455 Ga0496118_0149541
1456 Ga0496119_0140410
1457 Ga0496120_0008022
1458 Ga0496120_0021337
1459 Ga0496121_0000811
1460 Ga0496121_0000870
1461 Ga0496121_0017520
1462 Ga0496121_0024640
1463 Ga0496121_0174913
1464 Ga0496121_0230428
1465 Ga0496123_0054650
1466 Ga0496124_0002001
1467 Ga0496124_0046080
1468 Ga0496124_0051368
1469 Ga0496124_0099848
1470 Ga0496124_0355129
1471 Ga0496125_0000869
1472 Ga0496125_0006645
1473 Ga0496125_0015348
1474 Ga0496125_0018462
1475 Ga0496125_0026599
1476 Ga0496125_0066354
1477 Ga0496125_0108616
1478 Ga0496125_0212982
1479 Ga0496125_0322812
1480 Ga0496125_0326778
1481 Ga0496126_0028135
1482 Ga0496126_0036323
1483 Ga0496126_0055197
1484 Ga0496126_0064657
1485 Ga0496126_0074215
1486 Ga0496126_0145097
1487 Ga0496126_0217168
1488 Ga0496126_0260193
1489 Ga0496126_0399814
1490 Ga0501308_015165
1491 Ga0501344_01846
1492 Ga0495678_066654
1493 Ga0495678_080423
1494 Ga0501317_023690
1495 Ga0501031_0002390
1496 Ga0501032_0001465
1497 Ga0501032_0009394
1498 Ga0501032_0111245
1499 Ga0501033_0000221
1500 Ga0501033_0014226
1501 Ga0501033_0161719
1502 Ga0501034_0063989
1503 Ga0501034_0387516
1504 Ga0501036_0112469
1505 Ga0501036_0116278
1506 Ga0501036_0149151
1507 Ga0501036_0185584
1508 Ga0501037_0000211
1509 Ga0501037_0199519
1510 Ga0501038_0117785
1511 Ga0501038_0214098
1512 Ga0501039_0004618
1513 Ga0501039_0073196
1514 Ga0501039_0078518
1515 Ga0501041_0022265
1516 Ga0501041_0168583
1517 Ga0501042_0102050
1518 Ga0501042_0417913
1519 Ga0501043_0002234
1520 Ga0501043_0097788
1521 Ga0501043_0215386
1522 Ga0501046_0097963
1523 Ga0501046_0179534
1524 Ga0501047_0036900
1525 Ga0501047_0082949
1526 Ga0501047_0170043
1527 Ga0501048_0070529
1528 Ga0501068_0097814
1529 Ga0501070_0014987
1530 Ga0501070_0067905
1531 Ga0501070_0121560
1532 Ga0501071_0012141
1533 Ga0501071_0470326
1534 Ga0501072_0004379
1535 Ga0501073_0024476
1536 Ga0501074_0012908
1537 Ga0501075_0027955
1538 Ga0501076_0134528
1539 Ga0501077_0037268
1540 Ga0501080_0009730
1541 Ga0501080_0113318
1542 Ga0501081_0324216
1543 Ga0501035_0003613
1544 Ga0501035_0040812
1545 Ga0501035_0144235
1546 Ga0501035_0160333
1547 Ga0501044_0006548
1548 Ga0501044_0030992
1549 Ga0501044_0038489
1550 Ga0501044_0101594
1551 Ga0501044_0119655
1552 Ga0501044_0266664
1553 Ga0501044_0504743
1554 Ga0501044_0973984
1555 Ga0501045_0081117
1556 nmdc:mga03683_58931_c1
1557 nmdc:mga03n38_12117_c1
1558 nmdc:mga03n38_7962_c1
1559 nmdc:mga00v17_16675_c2
1560 nmdc:mga00v17_84585_c1
1561 nmdc:mga00v17_95829_c1
1562 nmdc:mga0yw44_13126_c1
1563 nmdc:mga0yw44_171654_c1
1564 nmdc:mga0yw44_63003_c1
1565 nmdc:mga0yw44_63079_c1
1566 nmdc:mga0k408_153467_c1
1567 nmdc:mga0k408_61581_c1
1568 nmdc:mga06z11_58021_c1
1569 nmdc:mga06z11_85331_c1
1570 nmdc:mga06z11_92058_c1
1571 nmdc:mga07m45_135204_c1
1572 nmdc:mga07m45_316726_c1
1573 nmdc:mga07m45_7843_c1
1574 nmdc:mga07m45_97861_c1
1575 nmdc:mga08y16_188038_c1
1576 nmdc:mga08x19_91753_c1
1577 nmdc:mga0a205_241895_c1
1578 nmdc:mga0sz30_47631_c1
1579 nmdc:mga0sz30_6347_c1
1580 nmdc:mga0sz30_7031_c1
1581 Ga0495612_0101059
1582 Ga0500635_0011112
1583 Ga0495595_0150542
1584 Ga0495619_0006419
1585 Ga0495619_0472753
1586 Ga0500643_032856
1587 Ga0500581_049278
1588 Ga0500581_172258
1589 Ga0500566_0000055
1590 Ga0500566_0003437
1591 Ga0500566_0038668
1592 Ga0500641_0001366
1593 Ga0500650_0000245
1594 Ga0500554_006966
1595 Ga0500556_0000006
1596 Ga0500569_002880
1597 Ga0500591_020057
1598 Ga0500595_001016
1599 Ga0500595_002547
1600 Ga0500595_077621
1601 Ga0500608_000604
1602 Ga0500608_027696
1603 Ga0500642_0000004
1604 Ga0500652_000294
1605 Ga0500658_0028806
1606 Ga0500559_0000362
1607 Ga0500559_0019096
1608 Ga0500568_0001522
1609 Ga0500568_0050342
1610 Ga0500586_017738
1611 Ga0500590_025848
1612 Ga0500590_125280
1613 Ga0500603_000630
1614 Ga0500604_0002744
1615 Ga0500616_0000022
1616 Ga0500616_0000244
1617 Ga0500622_0000953
1618 Ga0500630_152704
1619 Ga0500633_0061126
1620 Ga0500634_0011130
1621 Ga0500638_000160
1622 Ga0500638_025570
1623 Ga0500639_026342
1624 Ga0500639_184390
1625 Ga0500636_0004749
1626 Ga0500637_0000180
1627 Ga0500637_0026584
1628 Ga0500637_0117530
1629 Ga0500637_0132267
1630 Ga0500567_062807
1631 Ga0500645_043501
1632 Ga0500552_018595
1633 Ga0500596_001070
1634 Ga0501084_0132762
1635 Ga0587093_015825
1636 Ga0587066_033408
1637 Ga0587077_039774
1638 Ga0587080_027782
1639 Ga0587082_026592
1640 Ga0587083_0049948
1641 Ga0587083_0053841
1642 Ga0587085_024953
1643 Ga0587088_035480
1644 Ga0587091_038584
1645 Ga0587106_015136
1646 Ga0587125_010223
1647 Ga0587101_022396
1648 Ga0587113_008368
1649 Ga0587115_019465
1650 Ga0587117_019089
1651 Ga0587130_008774
1652 Ga0587062_019188
1653 Ga0587062_020778
1654 Ga0587069_016120
1655 Ga0587069_030050
1656 Ga0587079_034016
1657 Ga0587108_006445
1658 Ga0501082_0553466
1659 Ga0530510_0031863
1660 2507505442
1661 2508539327
1662 2508695654
1663 2511400450
1664 2513623934
1665 2513642181
1666 2513659501
1667 2513676307
1668 2513695279
1669 2513718232
1670 2513859392
1671 2513873358
1672 2513888588
1673 2513921566
1674 2515627637
1675 2517106288
1676 2517889042
1677 2524441433
1678 2524467235
1679 2524537477
1680 2603858633
1681 2617352069
1682 2644291085
1683 2671124031
1684 2723841813
1685 2728748440
1686 2745077567
1687 2793072719
1688 2793078313
1689 2805920706
1690 2824608728
1691 2824617671
1692 2824660134
1693 2824687600
1694 2824702614
1695 2824710492
1696 2824761763
1697 2824772262
1698 2824780852
1699 2841965354
1700 2844315535
1701 2847942331
1702 2849083204
1703 2857526247
1704 2874592557
1705 2874607894
1706 2874617988
1707 2874647176
1708 2876772560
1709 2876814195
1710 2876819821
1711 2879076327
1712 2879113321
1713 2879128811
1714 2879143632
1715 2884298507
1716 2885377546
1717 2885386910
1718 2885415844
1719 2888420130
1720 2889035311
1721 2893067481
1722 2903733696
1723 2903758805
1724 2903774497
1725 2904691013
1726 2904708410
1727 2904716338
1728 2906609456
1729 2906613582
1730 2906635823
1731 2906668116
1732 2908747644
1733 2908757071
1734 2919073901
1735 2922363199
1736 2922388496
1737 2922396592
1738 2922434019
1739 2935615529
1740 2935636046
1741 2935654459
1742 2935663339
1743 2935774298
1744 2935783337
1745 2935788987
1746 2935796737
1747 2935825670
1748 2935853434
1749 2935915036
1750 2935918884
1751 2935931399
1752 2935939996
1753 2935947657
1754 2935956428
1755 2935966726
1756 2935973222
1757 2935980534
1758 2935990114
1759 2936017502
1760 2936025997
1761 2936034839
1762 2936052903
1763 2936060238
1764 2941512650
1765 2941520512
1766 2941528526
1767 3005475266
1768 3005486682
1769 3005508988
1770 3005594129
1771 3005595227
1772 3005711169
1773 3005718465
1774 8006936011
1775 8006967628
1776 8006975865
1777 8006991098
1778 8007000427
1779 8016526319
1780 8016531381
1781 8016544595
1782 8016557480
1783 8016565838
1784 8016569647
1785 8016586158
1786 8016603437
1787 8016606374
1788 8016618282
1789 8016622931
1790 8019531215
1791 8019540340
1792 8019549931
1793 8019562643
1794 8019572722
1795 8019623154
1796 8019629944
1797 8019640662
1798 8019676542
1799 8019696057
1800 8056676132
1801 8056682932
1802 8056691136

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01027

Bax1-I

Inhibitor of apoptosis-promoting Bax1

47

279

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u3f-assembly2.cif.gz_B structural basis for the interaction of pyk2 pat domain with paxillin ld motifs 0.4837 49 221
1k40-assembly1.cif.gz_A crystal structure of the fat domain of focal adhesion kinase 0.4808 51 221
3u3f-assembly3.cif.gz_C structural basis for the interaction of pyk2 pat domain with paxillin ld motifs 0.4652 50 227
4xev-assembly1.cif.gz_A fusion of pyk2-fat domain with leupaxin ld1 motif, complexed with leupaxin ld4 peptide 0.4574 49 225
6fvq-assembly1.cif.gz_A the active form of a pentameric ion channel (stelic) gated by alkaline ph - r86a 0.4573 104 219
ID Description Score Start End Superfamily
af_P75769_17_224_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5439 49 222 1.20.1250.20
3gm3A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.4925 49 221 1.20.120.330
4xefA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.486 50 221 1.20.120.330
3u3fB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.4837 49 221 1.20.120.330
1k40A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.4808 51 221 1.20.120.330
ID Description Score Start End GO Terms
AF-A0A2I8QUK8-F1-model_v4 deleted 0.7241 87 224
AF-A0A2I8QUK8-F1-model_v4 deleted 0.6701 87 224
AF-G0QXC9-F1-model_v4 Uncharacterized protein 0.6578 50 227 GO:0016020
AF-A0A853I235-F1-model_v4 deleted 0.6566 41 226
AF-A0A1R2AM22-F1-model_v4 Uncharacterized protein 0.648 50 227 GO:0016020

Map