F485172

General Info

Members Datasets Scaffolds Average Seq Length
901 347 1802 200

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10227396|Ga0114129_102273962
Length 241
Sequence VSASGPAAHADDFRAAVASEGKTTGHRRRGAAQVLRPGKELPMSKVVAIMSMSLDGYVADENDGVAEVFDWYFSGDVEIPMPSERSHMTFRVSAPSAEHVRGLMAEVGAMLTGRRTFEVADGWDGQHPFDVPAFIAAHEVPDGWPRPGSTVHFVTDGIESAVARAKSAAGPKSVGVHGAETIQECLNAGLLDEIHIDLAAVLLGAGVRLFDHLADTPVVLGNPTVVTGVGVTHLRYPVHTS

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
201 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
213 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
214 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
215 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
222 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
223 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
242 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
270 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
271 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
294 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
318 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
319 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
320 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
321 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
322 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
325 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
326 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
327 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
328 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
329 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
335 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
336 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
337 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
338 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
343 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
344 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
345 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
346 2643221711 Terrabacter sp. Root85 Isolate Unclassified
347 2643221722 Cellulomonas sp. Root930 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.33
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 8.44
Rhizosphere 89.35
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10227396 3300009147 Bacteria 2514
2 JGI24743J22301_10067890 3300001991 Bacteria 741
3 JGI24744J21845_10010846 3300002077 Bacteria 1865
4 Ga0006562J51391_1108637 3300003578 Bacteria 2096
5 Ga0058858_1044707 3300004785 Bacteria 1682
6 Ga0065712_10270263 3300005290 Bacteria 917
7 Ga0065715_10097157 3300005293 Bacteria 3753
8 Ga0065707_10108042 3300005295 Bacteria 2527
9 Ga0065707_10210927 3300005295 Bacteria 1266
10 Ga0065707_10214934 3300005295 Bacteria 1249
11 Ga0065707_10398980 3300005295 Bacteria 855
12 Ga0070658_10005666 3300005327 Bacteria 10125
13 Ga0070658_10471619 3300005327 Bacteria 1083
14 Ga0070676_10018980 3300005328 Bacteria 3819
15 Ga0070676_10121584 3300005328 Bacteria 1640
16 Ga0070683_100019158 3300005329 Bacteria 6075
17 Ga0070683_100070406 3300005329 Bacteria 3262
18 Ga0070683_100230538 3300005329 Bacteria 1761
19 Ga0070683_100260271 3300005329 Unclassified 1650
20 Ga0070683_101017244 3300005329 Bacteria 796
21 Ga0070690_100003939 3300005330 Bacteria 8196
22 Ga0070690_100604865 3300005330 Bacteria 832
23 Ga0070670_100004448 3300005331 Bacteria 11734
24 Ga0070670_100005891 3300005331 Bacteria 10361
25 Ga0070670_100040002 3300005331 Bacteria 4032
26 Ga0070670_100224511 3300005331 Bacteria 1634
27 Ga0070670_100292861 3300005331 Bacteria 1423
28 Ga0070670_100398543 3300005331 Bacteria 1215
29 Ga0070666_10045961 3300005335 Bacteria 2927
30 Ga0070666_10373626 3300005335 Bacteria 1023
31 Ga0070680_100082278 3300005336 Bacteria 2657
32 Ga0070682_100012679 3300005337 Bacteria 4838
33 Ga0070682_100889945 3300005337 Bacteria 731
34 Ga0068868_100386796 3300005338 Bacteria 1205
35 Ga0068868_100507091 3300005338 Bacteria 1058
36 Ga0068868_100579587 3300005338 Bacteria 992
37 Ga0070660_100112004 3300005339 Bacteria 2172
38 Ga0070660_100493010 3300005339 Bacteria 1019
39 Ga0070689_100054089 3300005340 Bacteria 3107
40 Ga0070689_100276437 3300005340 Unclassified 1392
41 Ga0070689_100297554 3300005340 Bacteria 1342
42 Ga0070689_100365795 3300005340 Bacteria 1213
43 Ga0070689_100744640 3300005340 Bacteria 858
44 Ga0070691_10038378 3300005341 Bacteria 2261
45 Ga0070691_10085712 3300005341 Bacteria 1547
46 Ga0070687_100011113 3300005343 Bacteria 3924
47 Ga0070687_100057652 3300005343 Bacteria 2038
48 Ga0070661_100315249 3300005344 Bacteria 1220
49 Ga0070661_100337018 3300005344 Bacteria 1181
50 Ga0070661_100535737 3300005344 Bacteria 941
51 Ga0070661_100536905 3300005344 Bacteria 940
52 Ga0070692_10092759 3300005345 Bacteria 1644
53 Ga0070692_10103276 3300005345 Bacteria 1565
54 Ga0070668_100054846 3300005347 Bacteria 3075
55 Ga0070668_100064246 3300005347 Bacteria 2845
56 Ga0070668_100204878 3300005347 Bacteria 1621
57 Ga0070669_100000010 3300005353 Bacteria 222186
58 Ga0070669_100000355 3300005353 Bacteria 35508
59 Ga0070669_100030200 3300005353 Bacteria 3909
60 Ga0070669_100093613 3300005353 Bacteria 2257
61 Ga0070669_100159147 3300005353 Bacteria 1753
62 Ga0070669_100257227 3300005353 Bacteria 1392
63 Ga0070669_100313690 3300005353 Bacteria 1265
64 Ga0070669_100473206 3300005353 Bacteria 1036
65 Ga0070675_100003158 3300005354 Bacteria 12465
66 Ga0070675_100070686 3300005354 Bacteria 2893
67 Ga0070675_100165727 3300005354 Unclassified 1903
68 Ga0070675_100184498 3300005354 Bacteria 1805
69 Ga0070675_100236022 3300005354 Bacteria 1597
70 Ga0070671_100035433 3300005355 Bacteria 4134
71 Ga0070671_101050432 3300005355 Bacteria 715
72 Ga0070674_100007573 3300005356 Bacteria 6410
73 Ga0070674_100039404 3300005356 Bacteria 3190
74 Ga0070674_100863273 3300005356 Bacteria 786
75 Ga0070673_100015199 3300005364 Bacteria 5397
76 Ga0070673_100108296 3300005364 Bacteria 2300
77 Ga0070673_100173049 3300005364 Bacteria 1844
78 Ga0070688_100004552 3300005365 Bacteria 7231
79 Ga0070659_100141178 3300005366 Bacteria 1961
80 Ga0070667_100145032 3300005367 Bacteria 2081
81 Ga0070709_10001377 3300005434 Bacteria 13236
82 Ga0070709_10040339 3300005434 Bacteria 2870
83 Ga0070709_10207926 3300005434 Bacteria 1390
84 Ga0070714_100013628 3300005435 Bacteria 6518
85 Ga0070714_100017489 3300005435 Bacteria 5808
86 Ga0070714_100043234 3300005435 Bacteria 3809
87 Ga0070714_100536464 3300005435 Bacteria 1119
88 Ga0070713_100017684 3300005436 Bacteria 5401
89 Ga0070713_100126839 3300005436 Bacteria 2246
90 Ga0070701_10036101 3300005438 Bacteria 2488
91 Ga0070701_10337379 3300005438 Bacteria 937
92 Ga0070701_10494938 3300005438 Bacteria 793
93 Ga0070711_100000130 3300005439 Bacteria 40022
94 Ga0070711_100034251 3300005439 Bacteria 3387
95 Ga0070711_100158688 3300005439 Bacteria 1713
96 Ga0070711_100636075 3300005439 Bacteria 893
97 Ga0070705_100008930 3300005440 Bacteria 4969
98 Ga0070705_100183426 3300005440 Bacteria 1420
99 Ga0070705_100390801 3300005440 Bacteria 1027
100 Ga0070700_100005912 3300005441 Bacteria 6506
101 Ga0070700_100075864 3300005441 Bacteria 2158
102 Ga0070700_100081621 3300005441 Bacteria 2089
103 Ga0070700_100944570 3300005441 Bacteria 705
104 Ga0070694_100008862 3300005444 Bacteria 6163
105 Ga0070694_100090377 3300005444 Bacteria 2147
106 Ga0070694_100307936 3300005444 Bacteria 1216
107 Ga0070694_100563353 3300005444 Bacteria 914
108 Ga0070708_100000182 3300005445 Bacteria 45329
109 Ga0070708_100015430 3300005445 Bacteria 6310
110 Ga0070708_100055809 3300005445 Bacteria 3513
111 Ga0070708_100092616 3300005445 Bacteria 2753
112 Ga0070708_100232107 3300005445 Bacteria 1731
113 Ga0070708_100248811 3300005445 Bacteria 1670
114 Ga0070678_100084616 3300005456 Bacteria 2415
115 Ga0070678_100370472 3300005456 Bacteria 1237
116 Ga0070678_100531234 3300005456 Bacteria 1042
117 Ga0070662_100289510 3300005457 Bacteria 1328
118 Ga0070681_10015253 3300005458 Bacteria 7644
119 Ga0070681_10016923 3300005458 Bacteria 7284
120 Ga0068867_100167275 3300005459 Bacteria 1738
121 Ga0068867_100185712 3300005459 Bacteria 1656
122 Ga0068867_100247487 3300005459 Unclassified 1448
123 Ga0070685_10000543 3300005466 Bacteria 21169
124 Ga0070685_10011612 3300005466 Bacteria 4614
125 Ga0070685_10033787 3300005466 Bacteria 2877
126 Ga0070685_10073938 3300005466 Bacteria 2027
127 Ga0070706_100092529 3300005467 Bacteria 2805
128 Ga0070706_100372328 3300005467 Bacteria 1331
129 Ga0070706_100418250 3300005467 Bacteria 1247
130 Ga0070707_100009010 3300005468 Bacteria 9254
131 Ga0070707_100024085 3300005468 Bacteria 5762
132 Ga0070698_100009229 3300005471 Bacteria 10584
133 Ga0070698_100292258 3300005471 Bacteria 1561
134 Ga0070698_100730869 3300005471 Bacteria 933
135 Ga0070698_100805028 3300005471 Bacteria 884
136 Ga0070699_100000002 3300005518 Bacteria 423451
137 Ga0070699_100001204 3300005518 Bacteria 23906
138 Ga0070699_100476268 3300005518 Viruses 1133
139 Ga0070679_100073632 3300005530 Bacteria 3407
140 Ga0070679_100140885 3300005530 Bacteria 2391
141 Ga0070679_100201676 3300005530 Bacteria 1955
142 Ga0070679_100265666 3300005530 Bacteria 1671
143 Ga0070684_100014462 3300005535 Bacteria 6395
144 Ga0070684_100025136 3300005535 Bacteria 5002
145 Ga0070684_100178271 3300005535 Bacteria 1932
146 Ga0070684_100298049 3300005535 Bacteria 1479
147 Ga0070684_100369516 3300005535 Bacteria 1320
148 Ga0070684_100742693 3300005535 Bacteria 916
149 Ga0070697_100001696 3300005536 Bacteria 16828
150 Ga0070697_100438590 3300005536 Bacteria 1136
151 Ga0070672_100021183 3300005543 Bacteria 4752
152 Ga0070672_100036796 3300005543 Bacteria 3732
153 Ga0070672_100048237 3300005543 Bacteria 3308
154 Ga0070672_100055050 3300005543 Bacteria 3116
155 Ga0070672_100067959 3300005543 Bacteria 2825
156 Ga0070672_100081069 3300005543 Bacteria 2601
157 Ga0070672_100161248 3300005543 Bacteria 1861
158 Ga0070686_100041560 3300005544 Bacteria 2874
159 Ga0070686_100309950 3300005544 Bacteria 1173
160 Ga0070686_100418936 3300005544 Bacteria 1022
161 Ga0070695_100051589 3300005545 Bacteria 2640
162 Ga0070695_100101957 3300005545 Bacteria 1934
163 Ga0070696_100002019 3300005546 Bacteria 13314
164 Ga0070696_100042522 3300005546 Bacteria 3141
165 Ga0070696_100309669 3300005546 Bacteria 1212
166 Ga0070696_101063303 3300005546 Bacteria 679
167 Ga0070693_100016240 3300005547 Bacteria 3849
168 Ga0070693_100018236 3300005547 Bacteria 3663
169 Ga0070693_100696638 3300005547 Bacteria 743
170 Ga0070665_100000456 3300005548 Bacteria 59546
171 Ga0070665_100315317 3300005548 Bacteria 1568
172 Ga0070704_100026832 3300005549 Bacteria 3812
173 Ga0070704_100240763 3300005549 Bacteria 1480
174 Ga0070704_100259599 3300005549 Bacteria 1431
175 Ga0070704_100607620 3300005549 Unclassified 962
176 Ga0068855_100359059 3300005563 Bacteria 1603
177 Ga0068855_101062560 3300005563 Bacteria 848
178 Ga0070664_100008794 3300005564 Bacteria 8180
179 Ga0070664_100023014 3300005564 Bacteria 5141
180 Ga0070664_100055317 3300005564 Bacteria 3368
181 Ga0070664_100530038 3300005564 Bacteria 1088
182 Ga0068857_100012104 3300005577 Bacteria 7502
183 Ga0068857_100019648 3300005577 Bacteria 5935
184 Ga0068857_100041062 3300005577 Bacteria 4102
185 Ga0068854_100083519 3300005578 Bacteria 2362
186 Ga0068854_100366123 3300005578 Bacteria 1184
187 Ga0068856_100254471 3300005614 Bacteria 1771
188 Ga0070702_100241403 3300005615 Bacteria 1219
189 Ga0068852_100397230 3300005616 Bacteria 1355
190 Ga0068852_100847402 3300005616 Bacteria 930
191 Ga0068859_100000002 3300005617 Bacteria 541370
192 Ga0068859_100034996 3300005617 Bacteria 5038
193 Ga0068859_100071464 3300005617 Bacteria 3506
194 Ga0068859_100090427 3300005617 Bacteria 3112
195 Ga0068859_100156615 3300005617 Bacteria 2355
196 Ga0068864_100022424 3300005618 Bacteria 5295
197 Ga0068864_100412994 3300005618 Bacteria 1284
198 Ga0068866_10261478 3300005718 Bacteria 1064
199 Ga0068861_100071041 3300005719 Bacteria 2697
200 Ga0068861_100259557 3300005719 Bacteria 1487
201 Ga0068861_100294997 3300005719 Bacteria 1402
202 Ga0068861_100296989 3300005719 Bacteria 1397
203 Ga0068870_10001155 3300005840 Bacteria 10560
204 Ga0068870_10002560 3300005840 Bacteria 7599
205 Ga0068870_10004100 3300005840 Bacteria 6234
206 Ga0068870_10100495 3300005840 Bacteria 1634
207 Ga0068870_10416307 3300005840 Bacteria 878
208 Ga0068863_100202302 3300005841 Bacteria 1911
209 Ga0068858_100121139 3300005842 Bacteria 2447
210 Ga0068860_100605943 3300005843 Bacteria 1101
211 Ga0068862_100006021 3300005844 Bacteria 10102
212 Ga0068862_100006883 3300005844 Bacteria 9429
213 Ga0068862_100100886 3300005844 Bacteria 2524
214 Ga0068862_100104403 3300005844 Bacteria 2482
215 Ga0068862_100166825 3300005844 Bacteria 1969
216 Ga0068862_100340771 3300005844 Bacteria 1388
217 Ga0081455_10128977 3300005937 Bacteria 1980
218 Ga0081455_10268282 3300005937 Bacteria 1240
219 Ga0081539_10038680 3300005985 Bacteria 2824
220 Ga0070717_10014966 3300006028 Bacteria 5975
221 Ga0070717_10123906 3300006028 Bacteria 2217
222 Ga0075365_10010859 3300006038 Bacteria 5329
223 Ga0075365_10216454 3300006038 Bacteria 1343
224 Ga0070712_100005418 3300006175 Bacteria 7900
225 Ga0075366_10048000 3300006195 Bacteria 2531
226 Ga0097621_100074353 3300006237 Unclassified 2814
227 Ga0075428_100088569 3300006844 Bacteria 3376
228 Ga0075428_100115303 3300006844 Bacteria 2927
229 Ga0075428_100228724 3300006844 Unclassified 2007
230 Ga0075428_100480065 3300006844 Bacteria 1330
231 Ga0075430_100078438 3300006846 Bacteria 2768
232 Ga0075431_100004702 3300006847 Bacteria 13408
233 Ga0075431_100086727 3300006847 Bacteria 3230
234 Ga0075431_100194747 3300006847 Bacteria 2075
235 Ga0075431_100196076 3300006847 Bacteria 2067
236 Ga0075433_10051698 3300006852 Bacteria 3579
237 Ga0075433_10054477 3300006852 Bacteria 3489
238 Ga0075433_10141375 3300006852 Bacteria 2139
239 Ga0075433_10194066 3300006852 Bacteria 1806
240 Ga0075433_10553006 3300006852 Bacteria 1012
241 Ga0075434_100442847 3300006871 Bacteria 1320
242 Ga0075429_100006861 3300006880 Bacteria 9883
243 Ga0075429_101272761 3300006880 Bacteria 641
244 Ga0068865_100074734 3300006881 Bacteria 2414
245 Ga0068865_100148835 3300006881 Bacteria 1774
246 Ga0075436_100010674 3300006914 Bacteria 6300
247 Ga0075436_100057938 3300006914 Bacteria 2676
248 Ga0075436_100465514 3300006914 Unclassified 922
249 Ga0075436_100629669 3300006914 Bacteria 792
250 Ga0097620_100000002 3300006931 Bacteria 541370
251 Ga0097620_100034996 3300006931 Bacteria 5038
252 Ga0097620_100071468 3300006931 Bacteria 3506
253 Ga0097620_100090427 3300006931 Bacteria 3112
254 Ga0097620_100156606 3300006931 Bacteria 2355
255 Ga0075435_100181758 3300007076 Bacteria 1777
256 Ga0105240_10012432 3300009093 Bacteria 11751
257 Ga0105240_10880798 3300009093 Bacteria 964
258 Ga0111539_10002237 3300009094 Bacteria 25818
259 Ga0111539_10082052 3300009094 Bacteria 3792
260 Ga0111539_10413417 3300009094 Bacteria 1571
261 Ga0111539_10490216 3300009094 Bacteria 1431
262 Ga0111539_10539755 3300009094 Bacteria 1358
263 Ga0111539_11275846 3300009094 Bacteria 853
264 Ga0105245_10086502 3300009098 Bacteria 2875
265 Ga0105245_10096247 3300009098 Unclassified 2731
266 Ga0105245_10250204 3300009098 Bacteria 1721
267 Ga0105247_10163259 3300009101 Bacteria 1476
268 Ga0114129_10009264 3300009147 Bacteria 14040
269 Ga0114129_10010629 3300009147 Bacteria 13127
270 Ga0114129_10024117 3300009147 Bacteria 8620
271 Ga0114129_10376243 3300009147 Bacteria 1876
272 Ga0114129_11962667 3300009147 Bacteria 708
273 Ga0105243_10054382 3300009148 Bacteria 3178
274 Ga0105243_10105194 3300009148 Bacteria 2350
275 Ga0105243_10139224 3300009148 Bacteria 2068
276 Ga0105243_10173512 3300009148 Bacteria 1869
277 Ga0105243_10356703 3300009148 Bacteria 1344
278 Ga0105241_10263386 3300009174 Bacteria 1466
279 Ga0105241_10714530 3300009174 Bacteria 916
280 Ga0105242_10016986 3300009176 Bacteria 5665
281 Ga0105242_10126583 3300009176 Bacteria 2199
282 Ga0105242_10293584 3300009176 Unclassified 1481
283 Ga0105242_11214124 3300009176 Bacteria 774
284 Ga0105248_10133648 3300009177 Bacteria 2799
285 Ga0105248_10331050 3300009177 Bacteria 1715
286 Ga0105248_10588818 3300009177 Bacteria 1255
287 Ga0105248_10877714 3300009177 Unclassified 1013
288 Ga0105248_11028577 3300009177 Bacteria 931
289 Ga0105248_11493268 3300009177 Bacteria 765
290 Ga0105237_10603538 3300009545 Bacteria 1105
291 Ga0105238_10000025 3300009551 Bacteria 196198
292 Ga0105238_10165154 3300009551 Bacteria 2189
293 Ga0105238_10189952 3300009551 Bacteria 2030
294 Ga0105238_10658693 3300009551 Bacteria 1057
295 Ga0105238_10783581 3300009551 Bacteria 968
296 Ga0105249_10064422 3300009553 Bacteria 3369
297 Ga0105249_10121532 3300009553 Bacteria 2482
298 Ga0105249_10157789 3300009553 Bacteria 2190
299 Ga0105239_11306122 3300010375 Bacteria 837
300 Ga0105246_10018666 3300011119 Bacteria 4422
301 Ga0105246_10107473 3300011119 Bacteria 2043
302 Ga0105246_10146081 3300011119 Bacteria 1784
303 Ga0105246_10200189 3300011119 Bacteria 1552
304 Ga0157373_10025312 3300013100 Bacteria 4294
305 Ga0157373_10143931 3300013100 Bacteria 1676
306 Ga0157373_10298218 3300013100 Bacteria 1144
307 Ga0157373_10518680 3300013100 Bacteria 862
308 Ga0157371_10466673 3300013102 Bacteria 929
309 Ga0157370_10041302 3300013104 Bacteria 4451
310 Ga0157369_10048591 3300013105 Bacteria 4603
311 Ga0157369_10051312 3300013105 Bacteria 4464
312 Ga0157369_10594924 3300013105 Bacteria 1142
313 Ga0157374_10265094 3300013296 Bacteria 1693
314 Ga0157374_10563349 3300013296 Bacteria 1148
315 Ga0157374_10781615 3300013296 Bacteria 970
316 Ga0157378_10253403 3300013297 Bacteria 1686
317 Ga0157378_10363343 3300013297 Bacteria 1417
318 Ga0157378_11386555 3300013297 Bacteria 746
319 Ga0163162_10023050 3300013306 Bacteria 6141
320 Ga0163162_10086823 3300013306 Bacteria 3206
321 Ga0163162_10094675 3300013306 Bacteria 3073
322 Ga0157372_10022007 3300013307 Bacteria 6893
323 Ga0157372_10024632 3300013307 Bacteria 6540
324 Ga0157372_10173727 3300013307 Bacteria 2493
325 Ga0157372_10210704 3300013307 Bacteria 2252
326 Ga0157372_10448346 3300013307 Bacteria 1504
327 Ga0157375_10020034 3300013308 Bacteria 6102
328 Ga0157375_10037888 3300013308 Bacteria 4625
329 Ga0157375_10059060 3300013308 Bacteria 3797
330 Ga0157375_10114908 3300013308 Bacteria 2794
331 Ga0157375_10244602 3300013308 Bacteria 1954
332 Ga0157375_10394082 3300013308 Bacteria 1551
333 Ga0157375_10903637 3300013308 Bacteria 1027
334 Ga0157375_11039062 3300013308 Bacteria 957
335 Ga0163163_10033516 3300014325 Bacteria 4969
336 Ga0163163_10053203 3300014325 Bacteria 3996
337 Ga0157380_10109398 3300014326 Bacteria 2319
338 Ga0157377_10000118 3300014745 Bacteria 53087
339 Ga0157377_10029055 3300014745 Bacteria 2981
340 Ga0157377_10073085 3300014745 Bacteria 1986
341 Ga0157377_10139911 3300014745 Bacteria 1486
342 Ga0157377_10759321 3300014745 Bacteria 711
343 Ga0157379_10461350 3300014968 Bacteria 1174
344 Ga0157376_10269790 3300014969 Bacteria 1598
345 Ga0157376_10497789 3300014969 Bacteria 1197
346 Ga0182007_10105340 3300015262 Bacteria 936
347 Ga0206356_10375597 3300020070 Bacteria 764
348 Ga0213876_10023185 3300021384 Bacteria 3279
349 Ga0213876_10113732 3300021384 Bacteria 1436
350 Ga0207697_10098126 3300025315 Bacteria 1247
351 Ga0207697_10138254 3300025315 Bacteria 1055
352 Ga0207653_10004465 3300025885 Bacteria 4387
353 Ga0207653_10064267 3300025885 Bacteria 1244
354 Ga0207682_10049511 3300025893 Bacteria 1735
355 Ga0207642_10124935 3300025899 Bacteria 1333
356 Ga0207688_10030859 3300025901 Bacteria 2957
357 Ga0207688_10034265 3300025901 Bacteria 2811
358 Ga0207680_10036449 3300025903 Bacteria 2833
359 Ga0207699_10001514 3300025906 Bacteria 11026
360 Ga0207699_10005929 3300025906 Bacteria 5879
361 Ga0207699_10486659 3300025906 Bacteria 889
362 Ga0207645_10002445 3300025907 Bacteria 14621
363 Ga0207645_10028442 3300025907 Bacteria 3608
364 Ga0207645_10128087 3300025907 Bacteria 1651
365 Ga0207643_10001430 3300025908 Bacteria 13700
366 Ga0207643_10002851 3300025908 Bacteria 9337
367 Ga0207643_10005860 3300025908 Bacteria 6564
368 Ga0207643_10663547 3300025908 Bacteria 673
369 Ga0207684_10036272 3300025910 Bacteria 4186
370 Ga0207684_10330773 3300025910 Bacteria 1313
371 Ga0207654_10355245 3300025911 Bacteria 1010
372 Ga0207707_10006030 3300025912 Bacteria 10603
373 Ga0207707_10036510 3300025912 Bacteria 4296
374 Ga0207707_10214084 3300025912 Bacteria 1678
375 Ga0207707_10414104 3300025912 Bacteria 1156
376 Ga0207695_10010982 3300025913 Bacteria 11005
377 Ga0207695_10072985 3300025913 Bacteria 3499
378 Ga0207695_10313866 3300025913 Bacteria 1458
379 Ga0207671_10430313 3300025914 Bacteria 1050
380 Ga0207671_10533358 3300025914 Bacteria 936
381 Ga0207693_10004270 3300025915 Bacteria 12117
382 Ga0207693_10142772 3300025915 Bacteria 1882
383 Ga0207663_10000061 3300025916 Bacteria 53664
384 Ga0207663_10093668 3300025916 Bacteria 2000
385 Ga0207660_10432013 3300025917 Bacteria 1063
386 Ga0207662_10014497 3300025918 Bacteria 4426
387 Ga0207662_10020159 3300025918 Bacteria 3803
388 Ga0207662_10028640 3300025918 Bacteria 3222
389 Ga0207662_10089359 3300025918 Bacteria 1893
390 Ga0207662_10305222 3300025918 Bacteria 1059
391 Ga0207657_10800654 3300025919 Bacteria 729
392 Ga0207649_10019705 3300025920 Bacteria 3860
393 Ga0207649_10111793 3300025920 Bacteria 1826
394 Ga0207649_10450133 3300025920 Bacteria 972
395 Ga0207649_10538999 3300025920 Bacteria 892
396 Ga0207652_10188274 3300025921 Bacteria 1856
397 Ga0207652_10193041 3300025921 Bacteria 1832
398 Ga0207652_10560117 3300025921 Bacteria 1027
399 Ga0207646_10000023 3300025922 Bacteria 255171
400 Ga0207646_10000943 3300025922 Bacteria 37403
401 Ga0207646_10182728 3300025922 Bacteria 1894
402 Ga0207681_10000011 3300025923 Bacteria 366878
403 Ga0207681_10002044 3300025923 Bacteria 12940
404 Ga0207681_10041048 3300025923 Bacteria 3082
405 Ga0207681_10206718 3300025923 Bacteria 1510
406 Ga0207681_10490086 3300025923 Bacteria 1005
407 Ga0207694_10000013 3300025924 Bacteria 384823
408 Ga0207650_10002065 3300025925 Bacteria 14037
409 Ga0207650_10003793 3300025925 Bacteria 10336
410 Ga0207650_10112385 3300025925 Bacteria 2110
411 Ga0207650_10143835 3300025925 Bacteria 1877
412 Ga0207659_10041538 3300025926 Bacteria 3221
413 Ga0207659_10116420 3300025926 Bacteria 2041
414 Ga0207687_10093361 3300025927 Bacteria 2200
415 Ga0207687_10386345 3300025927 Bacteria 1148
416 Ga0207687_10522105 3300025927 Bacteria 993
417 Ga0207687_10529807 3300025927 Bacteria 986
418 Ga0207700_10004918 3300025928 Bacteria 7938
419 Ga0207700_10208006 3300025928 Bacteria 1652
420 Ga0207664_10066938 3300025929 Bacteria 2881
421 Ga0207664_10156534 3300025929 Bacteria 1940
422 Ga0207690_10079910 3300025932 Bacteria 2280
423 Ga0207706_10083742 3300025933 Bacteria 2804
424 Ga0207686_10163319 3300025934 Bacteria 1563
425 Ga0207686_10327277 3300025934 Bacteria 1147
426 Ga0207686_10584858 3300025934 Bacteria 877
427 Ga0207709_10111800 3300025935 Bacteria 1828
428 Ga0207709_10122038 3300025935 Bacteria 1761
429 Ga0207709_10482378 3300025935 Bacteria 964
430 Ga0207670_10007151 3300025936 Bacteria 6219
431 Ga0207670_10067305 3300025936 Bacteria 2464
432 Ga0207670_10369936 3300025936 Bacteria 1139
433 Ga0207670_10860076 3300025936 Bacteria 758
434 Ga0207669_10049430 3300025937 Bacteria 2506
435 Ga0207669_10562664 3300025937 Bacteria 922
436 Ga0207669_10721186 3300025937 Bacteria 821
437 Ga0207669_10921919 3300025937 Bacteria 731
438 Ga0207704_10054666 3300025938 Bacteria 2435
439 Ga0207704_10161657 3300025938 Bacteria 1594
440 Ga0207704_10247681 3300025938 Bacteria 1335
441 Ga0207704_10453184 3300025938 Bacteria 1024
442 Ga0207691_10010332 3300025940 Bacteria 8953
443 Ga0207691_10030615 3300025940 Bacteria 5027
444 Ga0207691_10068785 3300025940 Bacteria 3199
445 Ga0207691_10071730 3300025940 Bacteria 3125
446 Ga0207691_10079327 3300025940 Bacteria 2954
447 Ga0207691_10108189 3300025940 Bacteria 2474
448 Ga0207691_10147556 3300025940 Bacteria 2069
449 Ga0207691_10150191 3300025940 Bacteria 2049
450 Ga0207691_10166235 3300025940 Bacteria 1933
451 Ga0207691_10168595 3300025940 Unclassified 1918
452 Ga0207691_10207046 3300025940 Bacteria 1705
453 Ga0207691_10267667 3300025940 Bacteria 1472
454 Ga0207711_10215408 3300025941 Bacteria 1755
455 Ga0207711_10456899 3300025941 Bacteria 1189
456 Ga0207711_10875958 3300025941 Bacteria 835
457 Ga0207689_10083349 3300025942 Bacteria 2629
458 Ga0207661_10038806 3300025944 Bacteria 3735
459 Ga0207661_10068357 3300025944 Unclassified 2893
460 Ga0207661_10160490 3300025944 Bacteria 1950
461 Ga0207661_10172713 3300025944 Bacteria 1882
462 Ga0207661_10193120 3300025944 Bacteria 1786
463 Ga0207661_10450864 3300025944 Bacteria 1172
464 Ga0207679_10017577 3300025945 Bacteria 4774
465 Ga0207679_10033236 3300025945 Bacteria 3628
466 Ga0207679_10238322 3300025945 Bacteria 1540
467 Ga0207679_10335352 3300025945 Bacteria 1314
468 Ga0207679_10340984 3300025945 Bacteria 1303
469 Ga0207679_10424378 3300025945 Bacteria 1174
470 Ga0207679_10749409 3300025945 Bacteria 888
471 Ga0207667_10368816 3300025949 Bacteria 1463
472 Ga0207651_10032000 3300025960 Bacteria 3371
473 Ga0207651_10036803 3300025960 Bacteria 3199
474 Ga0207651_10053982 3300025960 Bacteria 2750
475 Ga0207651_10188430 3300025960 Bacteria 1643
476 Ga0207651_10223460 3300025960 Bacteria 1524
477 Ga0207712_10031271 3300025961 Bacteria 3584
478 Ga0207712_10109549 3300025961 Bacteria 2069
479 Ga0207712_10222434 3300025961 Unclassified 1510
480 Ga0207712_10463732 3300025961 Bacteria 1077
481 Ga0207712_11096928 3300025961 Bacteria 708
482 Ga0207712_11401080 3300025961 Bacteria 625
483 Ga0207668_10053354 3300025972 Bacteria 2801
484 Ga0207668_10180362 3300025972 Bacteria 1665
485 Ga0207668_10316332 3300025972 Bacteria 1294
486 Ga0207668_10599412 3300025972 Bacteria 959
487 Ga0207668_10965082 3300025972 Bacteria 761
488 Ga0207640_10157946 3300025981 Bacteria 1674
489 Ga0207640_10216204 3300025981 Bacteria 1464
490 Ga0207640_10233002 3300025981 Bacteria 1418
491 Ga0207640_10398783 3300025981 Bacteria 1120
492 Ga0207640_10488309 3300025981 Bacteria 1023
493 Ga0207658_10066930 3300025986 Bacteria 2704
494 Ga0207658_10076122 3300025986 Bacteria 2556
495 Ga0207677_10323485 3300026023 Bacteria 1282
496 Ga0207677_10645909 3300026023 Bacteria 933
497 Ga0207703_10094208 3300026035 Bacteria 2524
498 Ga0207639_10195969 3300026041 Bacteria 1729
499 Ga0207678_10267076 3300026067 Bacteria 1467
500 Ga0207678_10815201 3300026067 Bacteria 824
501 Ga0207708_10000865 3300026075 Bacteria 22817
502 Ga0207708_10033196 3300026075 Bacteria 3920
503 Ga0207708_10114135 3300026075 Bacteria 2100
504 Ga0207708_10316881 3300026075 Unclassified 1272
505 Ga0207708_10787088 3300026075 Bacteria 818
506 Ga0207702_10127797 3300026078 Bacteria 2284
507 Ga0207641_10322024 3300026088 Bacteria 1466
508 Ga0207641_10740070 3300026088 Unclassified 970
509 Ga0207641_11001715 3300026088 Bacteria 832
510 Ga0207648_10014451 3300026089 Bacteria 7296
511 Ga0207648_10068483 3300026089 Unclassified 3092
512 Ga0207648_10233856 3300026089 Bacteria 1635
513 Ga0207648_10359027 3300026089 Bacteria 1314
514 Ga0207648_10754228 3300026089 Bacteria 904
515 Ga0207676_10031938 3300026095 Bacteria 3963
516 Ga0207674_10004554 3300026116 Bacteria 16652
517 Ga0207674_10010666 3300026116 Bacteria 10391
518 Ga0207674_10047392 3300026116 Bacteria 4406
519 Ga0207674_10062753 3300026116 Bacteria 3753
520 Ga0207674_10382678 3300026116 Bacteria 1360
521 Ga0207674_10625976 3300026116 Bacteria 1039
522 Ga0207675_100010127 3300026118 Bacteria 8835
523 Ga0207675_100088537 3300026118 Bacteria 2908
524 Ga0207675_100195706 3300026118 Bacteria 1940
525 Ga0207675_100267006 3300026118 Bacteria 1660
526 Ga0207675_100297848 3300026118 Bacteria 1570
527 Ga0207675_100326511 3300026118 Bacteria 1499
528 Ga0207683_10050796 3300026121 Bacteria 3633
529 Ga0207683_10077267 3300026121 Bacteria 2948
530 Ga0207683_10400010 3300026121 Bacteria 1263
531 Ga0207683_10557222 3300026121 Bacteria 1060
532 Ga0209966_1008189 3300027695 Bacteria 1851
533 Ga0207428_10001371 3300027907 Bacteria 25827
534 Ga0207428_10084874 3300027907 Bacteria 2467
535 Ga0268266_10000192 3300028379 Bacteria 107069
536 Ga0268266_10603215 3300028379 Bacteria 1055
537 Ga0268265_10006714 3300028380 Bacteria 7788
538 Ga0268265_10007027 3300028380 Bacteria 7612
539 Ga0268265_10181157 3300028380 Bacteria 1810
540 Ga0268265_10181346 3300028380 Bacteria 1809
541 Ga0268265_10194338 3300028380 Bacteria 1755
542 Ga0268265_10471602 3300028380 Unclassified 1177
543 Ga0268265_11124619 3300028380 Bacteria 780
544 Ga0307513_10003075 3300031456 Bacteria 22759
545 Ga0307408_100164606 3300031548 Bacteria 1765
546 Ga0307408_100826453 3300031548 Bacteria 843
547 Ga0307408_101159064 3300031548 Bacteria 719
548 Ga0307405_10101779 3300031731 Bacteria 1928
549 Ga0307405_10238768 3300031731 Bacteria 1345
550 Ga0307405_10256374 3300031731 Bacteria 1304
551 Ga0307413_10057698 3300031824 Bacteria 2375
552 Ga0307410_10008812 3300031852 Bacteria 5621
553 Ga0307410_10042244 3300031852 Bacteria 3012
554 Ga0307410_10118591 3300031852 Bacteria 1926
555 Ga0307410_10204625 3300031852 Bacteria 1509
556 Ga0307410_10237335 3300031852 Bacteria 1411
557 Ga0307406_10004503 3300031901 Bacteria 7587
558 Ga0307406_10085103 3300031901 Bacteria 2113
559 Ga0307406_10136563 3300031901 Bacteria 1729
560 Ga0307406_10162786 3300031901 Bacteria 1606
561 Ga0307407_10075978 3300031903 Bacteria 2016
562 Ga0307407_10127382 3300031903 Bacteria 1623
563 Ga0307407_10481488 3300031903 Bacteria 906
564 Ga0307412_10025440 3300031911 Bacteria 3667
565 Ga0307409_100015564 3300031995 Bacteria 4997
566 Ga0307409_100231878 3300031995 Bacteria 1674
567 Ga0307409_100236480 3300031995 Bacteria 1660
568 Ga0307409_101356688 3300031995 Bacteria 737
569 Ga0307416_100037918 3300032002 Bacteria 3713
570 Ga0307416_100049541 3300032002 Bacteria 3340
571 Ga0307416_100244147 3300032002 Unclassified 1743
572 Ga0307416_100332985 3300032002 Bacteria 1527
573 Ga0307416_101037442 3300032002 Bacteria 924
574 Ga0307414_10034630 3300032004 Bacteria 3351
575 Ga0307414_10057506 3300032004 Bacteria 2734
576 Ga0307414_10714756 3300032004 Bacteria 908
577 Ga0307411_10159011 3300032005 Bacteria 1689
578 Ga0307411_10794949 3300032005 Bacteria 832
579 Ga0307415_100039188 3300032126 Bacteria 3129
580 Ga0307415_100089360 3300032126 Bacteria 2225
581 Ga0307415_100143928 3300032126 Bacteria 1825
582 Ga0307415_100523835 3300032126 Bacteria 1041
583 Ga0373959_0000270 3300034820 Bacteria 11184
584 Ga0373938_0066871 3300034957 Bacteria 852
585 Ga0373953_0037932 3300035117 Bacteria 1904
586 Ga0373960_0018697 3300035121 Bacteria 1812
587 Ga0373946_0171801 3300035171 Bacteria 1024
588 Ga0373925_0064392 3300037068 Bacteria 2760
589 Ga0395899_0021220 3300037312 Bacteria 4926
590 Ga0395899_0271561 3300037312 Viruses 1156
591 Ga0395900_0074462 3300037418 Bacteria 3490
592 Ga0395900_0100903 3300037418 Unclassified 2964
593 Ga0395900_0353130 3300037418 Bacteria 1443
594 Ga0395898_0002980 3300037466 Bacteria 19235
595 Ga0395898_0012349 3300037466 Bacteria 8834
596 Ga0395898_0016612 3300037466 Bacteria 7523
597 Ga0395898_1004500 3300037466 Bacteria 770
598 Ga0395905_0045227 3300037471 Bacteria 4129
599 Ga0395905_0057219 3300037471 Bacteria 3647
600 Ga0395905_0060036 3300037471 Bacteria 3555
601 Ga0395905_0300477 3300037471 Bacteria 1492
602 Ga0395905_0682619 3300037471 Unclassified 929
603 Ga0395901_0002370 3300038443 Bacteria 19167
604 Ga0395901_0002689 3300038443 Bacteria 17931
605 Ga0395901_0033882 3300038443 Bacteria 5274
606 Ga0395901_0072825 3300038443 Bacteria 3582
607 Ga0395901_0569959 3300038443 Unclassified 1145
608 Ga0436365_0180598 3300039437 Bacteria 2331
609 Ga0436365_0235987 3300039437 Bacteria 8320
610 Ga0436365_0761506 3300039437 Bacteria 1770
611 Ga0439453_0004225 3300041408 Bacteria 2124
612 Ga0451791_0034873 3300041451 Bacteria 878
613 Ga0451791_1265163 3300041451 Bacteria 976
614 Ga0451798_0209743 3300041458 Unclassified 836
615 Ga0451804_0560457 3300041463 Bacteria 752
616 Ga0451853_3881101 3300041512 Bacteria 824
617 Ga0451853_4040657 3300041512 Bacteria 1126
618 Ga0439459_0046630 3300042438 Unclassified 939
619 Ga0451577_0015716 3300042876 Bacteria 7029
620 Ga0451577_0083898 3300042876 Bacteria 2843
621 Ga0453683_0111004 3300044673 Bacteria 1724
622 Ga0466963_0057527 3300044694 Bacteria 2589
623 Ga0466964_0004051 3300044706 Bacteria 5390
624 Ga0453684_0000939 3300044712 Bacteria 96146
625 Ga0453684_0016584 3300044712 Bacteria 11499
626 Ga0453684_0139567 3300044712 Bacteria 2897
627 Ga0453684_0530050 3300044712 Bacteria 1300
628 Ga0453684_0592217 3300044712 Bacteria 1216
629 Ga0466968_0072848 3300044735 Bacteria 1498
630 Ga0466957_0075198 3300044842 Bacteria 2096
631 Ga0451576_0030368 3300045051 Bacteria 5776
632 Ga0451576_0037836 3300045051 Bacteria 5109
633 Ga0451576_0595879 3300045051 Bacteria 1161
634 Ga0466967_0008259 3300045976 Bacteria 7604
635 Ga0466967_0009501 3300045976 Bacteria 7220
636 Ga0495592_0150898 3300046454 Unclassified 1607
637 Ga0495603_0021160 3300046455 Bacteria 3938
638 Ga0495603_0064688 3300046455 Bacteria 2156
639 Ga0495603_0068506 3300046455 Bacteria 2088
640 Ga0495603_0428947 3300046455 Bacteria 757
641 Ga0495590_0168249 3300046457 Bacteria 798
642 Ga0495638_0149526 3300046460 Bacteria 1355
643 Ga0495653_0097259 3300046463 Unclassified 2139
644 Ga0495582_0014676 3300046473 Bacteria 4305
645 Ga0495664_0023818 3300046477 Bacteria 3554
646 Ga0495664_0154099 3300046477 Bacteria 1394
647 Ga0495585_0297204 3300046492 Bacteria 795
648 Ga0495594_0098695 3300046499 Bacteria 1642
649 Ga0495608_0000523 3300046511 Bacteria 26314
650 Ga0495608_0079101 3300046511 Unclassified 2138
651 Ga0495618_0028342 3300046514 Bacteria 3489
652 Ga0495618_0199174 3300046514 Bacteria 1268
653 Ga0495620_0002882 3300046515 Bacteria 9883
654 Ga0495628_0604345 3300046516 Bacteria 783
655 Ga0495630_0203629 3300046517 Bacteria 1510
656 Ga0495663_0144729 3300046525 Bacteria 808
657 Ga0495663_0161477 3300046525 Bacteria 769
658 Ga0495642_0259224 3300046528 Bacteria 760
659 Ga0495652_0037937 3300046529 Bacteria 4177
660 Ga0495652_0178480 3300046529 Unclassified 1632
661 Ga0495640_0139172 3300046533 Bacteria 1565
662 Ga0495587_0061479 3300046536 Bacteria 2201
663 Ga0495598_0096276 3300046537 Bacteria 973
664 Ga0495645_0188124 3300046543 Bacteria 1409
665 Ga0495667_0026136 3300046559 Bacteria 3932
666 Ga0495667_0076628 3300046559 Bacteria 2176
667 Ga0495668_0332258 3300046616 Bacteria 834
668 Ga0495634_0020817 3300046642 Bacteria 4646
669 Ga0495634_0174011 3300046642 Bacteria 1352
670 Ga0495635_0030297 3300046663 Bacteria 3759
671 Ga0495635_0114365 3300046663 Unclassified 1842
672 Ga0495588_0007644 3300046674 Bacteria 4933
673 Ga0495657_0014092 3300046675 Bacteria 5874
674 Ga0495599_0021895 3300046678 Bacteria 3990
675 Ga0495599_0118276 3300046678 Unclassified 1648
676 Ga0495646_0081080 3300046680 Bacteria 1891
677 Ga0495646_0199337 3300046680 Bacteria 1091
678 Ga0495658_0084378 3300046683 Bacteria 1870
679 Ga0495613_0008475 3300046689 Bacteria 7627
680 Ga0495613_0309055 3300046689 Bacteria 1093
681 Ga0495670_0291062 3300046691 Unclassified 874
682 Ga0495671_0196366 3300046692 Bacteria 979
683 Ga0495589_0234579 3300046794 Bacteria 860
684 Ga0495600_0188470 3300046809 Bacteria 1327
685 Ga0495581_0219719 3300047315 Bacteria 1111
686 Ga0495604_0054528 3300047317 Bacteria 3084
687 Ga0495636_0131469 3300047318 Bacteria 1113
688 Ga0495674_0111889 3300047319 Bacteria 2314
689 Ga0495674_0455956 3300047319 Bacteria 1027
690 Ga0495672_0013125 3300047320 Bacteria 5731
691 Ga0495672_0286470 3300047320 Bacteria 785
692 Ga0495676_0052606 3300047321 Unclassified 3249
693 Ga0495680_0013755 3300047322 Bacteria 7042
694 Ga0495680_0316720 3300047322 Bacteria 1092
695 Ga0495675_0104145 3300047444 Bacteria 1774
696 Ga0495675_0145051 3300047444 Bacteria 1469
697 Ga0495677_0089370 3300047445 Bacteria 1160
698 Ga0495685_181591 3300047447 Bacteria 678
699 Ga0495684_0032912 3300047471 Bacteria 3981
700 Ga0495684_0040287 3300047471 Bacteria 3581
701 Ga0495686_0120378 3300047472 Bacteria 1565
702 Ga0495593_0167893 3300047673 Bacteria 1107
703 Ga0495602_0077957 3300048088 Bacteria 2800
704 Ga0495615_0107909 3300048090 Bacteria 793
705 Ga0496100_0053007 3300048903 Bacteria 2640
706 Ga0496100_0308799 3300048903 Bacteria 1185
707 Ga0496100_0562707 3300048903 Bacteria 883
708 Ga0496101_0028511 3300048904 Bacteria 3898
709 Ga0496101_0123215 3300048904 Bacteria 1962
710 Ga0496102_0003529 3300048905 Bacteria 13260
711 Ga0496102_0084280 3300048905 Bacteria 2933
712 Ga0496102_0218997 3300048905 Bacteria 1794
713 Ga0496103_0151190 3300048906 Bacteria 1487
714 Ga0496103_0689289 3300048906 Bacteria 648
715 Ga0496104_0057954 3300048907 Bacteria 3666
716 Ga0496104_0144553 3300048907 Bacteria 2284
717 Ga0496104_0153534 3300048907 Archaea 2210
718 Ga0496105_0044227 3300048908 Bacteria 3673
719 Ga0496105_0046520 3300048908 Bacteria 3581
720 Ga0496105_0164013 3300048908 Bacteria 1823
721 Ga0496105_0258682 3300048908 Bacteria 1408
722 Ga0496106_0004265 3300048909 Bacteria 10639
723 Ga0496106_0072560 3300048909 Bacteria 2633
724 Ga0496106_0372441 3300048909 Unclassified 1148
725 Ga0496107_0027301 3300048910 Bacteria 4053
726 Ga0496107_0061654 3300048910 Bacteria 2715
727 Ga0496107_0149230 3300048910 Bacteria 1729
728 Ga0496107_0185956 3300048910 Bacteria 1543
729 Ga0496107_0360096 3300048910 Bacteria 1082
730 Ga0496108_0004331 3300048911 Bacteria 11410
731 Ga0496108_0098913 3300048911 Bacteria 2486
732 Ga0496108_0145832 3300048911 Bacteria 2041
733 Ga0496108_0182725 3300048911 Bacteria 1816
734 Ga0496108_0183250 3300048911 Bacteria 1814
735 Ga0496108_0666880 3300048911 Unclassified 903
736 Ga0496109_0003979 3300048912 Bacteria 12339
737 Ga0496109_0062903 3300048912 Bacteria 3394
738 Ga0496109_0108854 3300048912 Bacteria 2576
739 Ga0496109_0195469 3300048912 Bacteria 1901
740 Ga0496109_0299912 3300048912 Bacteria 1515
741 Ga0496109_0397043 3300048912 Bacteria 1303
742 Ga0496109_0591858 3300048912 Unclassified 1045
743 Ga0496110_0061769 3300048913 Bacteria 3308
744 Ga0496110_0067853 3300048913 Bacteria 3156
745 Ga0496110_0068794 3300048913 Bacteria 3134
746 Ga0496110_0145831 3300048913 Bacteria 2141
747 Ga0496110_0215475 3300048913 Bacteria 1746
748 Ga0496110_0594778 3300048913 Bacteria 1004
749 Ga0496110_1051634 3300048913 Bacteria 722
750 Ga0496111_0046827 3300048914 Bacteria 3114
751 Ga0496111_0047891 3300048914 Bacteria 3079
752 Ga0496111_0209460 3300048914 Bacteria 1448
753 Ga0496111_0291820 3300048914 Bacteria 1209
754 Ga0496112_0053929 3300048915 Bacteria 3950
755 Ga0496112_0054607 3300048915 Bacteria 3925
756 Ga0496112_0349487 3300048915 Bacteria 1421
757 Ga0496112_0813689 3300048915 Bacteria 859
758 Ga0496113_0062762 3300048916 Bacteria 2807
759 Ga0496113_0091929 3300048916 Bacteria 2340
760 Ga0496113_0110426 3300048916 Bacteria 2140
761 Ga0496113_0733003 3300048916 Bacteria 788
762 Ga0496113_0805237 3300048916 Bacteria 746
763 Ga0496114_0007655 3300048917 Bacteria 8540
764 Ga0496114_0041791 3300048917 Bacteria 3799
765 Ga0496114_0050107 3300048917 Bacteria 3475
766 Ga0496114_0055959 3300048917 Bacteria 3290
767 Ga0496114_0080570 3300048917 Bacteria 2750
768 Ga0496114_0168853 3300048917 Bacteria 1906
769 Ga0496114_0175653 3300048917 Bacteria 1869
770 Ga0496114_0264630 3300048917 Bacteria 1515
771 Ga0496114_0340162 3300048917 Bacteria 1327
772 Ga0496114_0373059 3300048917 Bacteria 1263
773 Ga0496114_0435891 3300048917 Bacteria 1161
774 Ga0496114_0776018 3300048917 Bacteria 836
775 Ga0496115_0024880 3300048918 Bacteria 4657
776 Ga0496115_0122715 3300048918 Bacteria 2138
777 Ga0501299_042531 3300049522 Bacteria 916
778 Ga0501031_0007185 3300049568 Bacteria 7266
779 Ga0501031_0068249 3300049568 Bacteria 2316
780 Ga0501032_0174962 3300049569 Bacteria 1406
781 Ga0501032_0199425 3300049569 Bacteria 1306
782 Ga0501036_0016551 3300049572 Bacteria 6158
783 Ga0501036_0018506 3300049572 Bacteria 5838
784 Ga0501036_0697955 3300049572 Bacteria 839
785 Ga0501037_0018571 3300049573 Bacteria 5125
786 Ga0501037_0298339 3300049573 Bacteria 1120
787 Ga0501038_0012440 3300049574 Bacteria 7776
788 Ga0501038_0061508 3300049574 Bacteria 3211
789 Ga0501039_0059227 3300049575 Bacteria 2966
790 Ga0501039_0090576 3300049575 Bacteria 2383
791 Ga0501040_0005558 3300049576 Bacteria 8163
792 Ga0501040_0143160 3300049576 Bacteria 1684
793 Ga0501041_0006632 3300049577 Bacteria 6779
794 Ga0501041_0037820 3300049577 Bacteria 2925
795 Ga0501042_0008854 3300049578 Bacteria 6672
796 Ga0501042_0014392 3300049578 Bacteria 5399
797 Ga0501043_0004735 3300049579 Bacteria 11037
798 Ga0501043_0024765 3300049579 Bacteria 4707
799 Ga0501043_0274819 3300049579 Bacteria 1293
800 Ga0501046_0003063 3300049580 Bacteria 15438
801 Ga0501046_0007373 3300049580 Bacteria 9675
802 Ga0501046_0424536 3300049580 Bacteria 958
803 Ga0501048_0006419 3300049582 Bacteria 8935
804 Ga0501048_0040725 3300049582 Bacteria 3327
805 Ga0501067_0000047 3300049583 Bacteria 71799
806 Ga0501068_0065523 3300049584 Bacteria 2211
807 Ga0501068_0129837 3300049584 Bacteria 1575
808 Ga0501069_0040602 3300049585 Bacteria 2572
809 Ga0501069_0074195 3300049585 Bacteria 1908
810 Ga0501070_0038931 3300049586 Bacteria 3967
811 Ga0501071_0004171 3300049587 Bacteria 9146
812 Ga0501071_0006783 3300049587 Bacteria 7456
813 Ga0501072_0018365 3300049588 Bacteria 5383
814 Ga0501072_0542773 3300049588 Bacteria 918
815 Ga0501073_0000116 3300049589 Bacteria 51190
816 Ga0501073_0007400 3300049589 Bacteria 8163
817 Ga0501073_0034872 3300049589 Bacteria 3579
818 Ga0501074_0016499 3300049590 Bacteria 5360
819 Ga0501074_0024925 3300049590 Bacteria 4345
820 Ga0501075_0050422 3300049591 Bacteria 3128
821 Ga0501075_0056099 3300049591 Bacteria 2965
822 Ga0501075_0122568 3300049591 Bacteria 1978
823 Ga0501075_0781071 3300049591 Unclassified 727
824 Ga0501076_0027677 3300049592 Bacteria 4396
825 Ga0501076_0137421 3300049592 Bacteria 1984
826 Ga0501076_0275538 3300049592 Bacteria 1378
827 Ga0501076_0872439 3300049592 Bacteria 742
828 Ga0501077_0073217 3300049593 Bacteria 2170
829 Ga0501077_0180022 3300049593 Bacteria 1343
830 Ga0501077_0248185 3300049593 Bacteria 1132
831 Ga0501247_009009 3300049677 Bacteria 1173
832 Ga0501249_028614 3300049679 Bacteria 1236
833 Ga0501079_0010968 3300049741 Bacteria 6905
834 Ga0501079_0879543 3300049741 Bacteria 706
835 Ga0501080_0019866 3300049742 Bacteria 6220
836 Ga0501080_0123496 3300049742 Bacteria 2398
837 Ga0501081_0030491 3300049743 Bacteria 3650
838 Ga0501083_0030287 3300049744 Bacteria 3718
839 Ga0501044_0098117 3300049823 Bacteria 2950
840 Ga0501044_0263930 3300049823 Bacteria 1659
841 Ga0501045_0021902 3300049824 Bacteria 4573
842 Ga0501045_0089744 3300049824 Bacteria 2270
843 Ga0501045_0639291 3300049824 Bacteria 787
844 nmdc:mga0yw44_34144_c1 3300050492 Bacteria 2978
845 nmdc:mga0k408_173553_c1 3300050493 Bacteria 1285
846 nmdc:mga06z11_78429_c1 3300050494 Bacteria 1765
847 nmdc:mga05p37_133427_c1 3300050507 Unclassified 3046
848 nmdc:mga05p37_17736_c1 3300050507 Bacteria 8590
849 nmdc:mga05p37_19520_c1 3300050507 Bacteria 8199
850 nmdc:mga05p37_33747_c1 3300050507 Bacteria 6268
851 nmdc:mga05p37_604203_c1 3300050507 Bacteria 1238
852 nmdc:mga05p37_857241_c1 3300050507 Bacteria 986
853 nmdc:mga09592_638_c1 3300050508 Bacteria 26635
854 nmdc:mga0qj67_572139_c1 3300050509 Unclassified 905
855 nmdc:mga06r32_274940_c1 3300050510 Bacteria 1672
856 nmdc:mga06r32_762877_c1 3300050510 Bacteria 930
857 nmdc:mga08y16_101979_c1 3300050511 Bacteria 2988
858 nmdc:mga08y16_1177_c1 3300050511 Bacteria 25822
859 nmdc:mga08y16_134432_c1 3300050511 Bacteria 800
860 nmdc:mga08y16_288953_c1 3300050511 Bacteria 1690
861 nmdc:mga08y16_51595_c1 3300050511 Bacteria 4304
862 nmdc:mga08y16_581443_c1 3300050511 Bacteria 1131
863 nmdc:mga08y16_758492_c1 3300050511 Bacteria 966
864 nmdc:mga0n895_118128_c1 3300050512 Bacteria 2672
865 nmdc:mga0n895_198498_c1 3300050512 Bacteria 2038
866 nmdc:mga0n895_345341_c1 3300050512 Unclassified 1507
867 nmdc:mga0rr50_124056_c1 3300050513 Bacteria 2060
868 nmdc:mga0rr50_340692_c1 3300050513 Bacteria 1260
869 nmdc:mga0rr50_423382_c1 3300050513 Bacteria 1126
870 nmdc:mga08x19_13517_c1 3300050514 Bacteria 4938
871 nmdc:mga08x19_161277_c1 3300050514 Bacteria 1523
872 nmdc:mga08x19_246446_c1 3300050514 Bacteria 1233
873 nmdc:mga08x19_578366_c1 3300050514 Bacteria 795
874 nmdc:mga0a205_171938_c1 3300050515 Bacteria 2062
875 nmdc:mga0a205_37574_c1 3300050515 Bacteria 4657
876 nmdc:mga0a205_48760_c1 3300050515 Bacteria 4088
877 nmdc:mga0a205_505074_c1 3300050515 Bacteria 1066
878 nmdc:mga0a205_671714_c1 3300050515 Bacteria 887
879 nmdc:mga0a205_68295_c1 3300050515 Bacteria 3433
880 nmdc:mga0a205_915649_c1 3300050515 Bacteria 724
881 Ga0495601_0013836 3300053077 Bacteria 4857
882 Ga0495601_0032213 3300053077 Bacteria 3262
883 Ga0495601_0145731 3300053077 Unclassified 1545
884 Ga0495601_0465477 3300053077 Bacteria 817
885 Ga0495612_0013977 3300053078 Bacteria 3233
886 Ga0495612_0085511 3300053078 Bacteria 1330
887 Ga0495619_0046364 3300053085 Bacteria 2858
888 Ga0495619_0147163 3300053085 Bacteria 1624
889 Ga0500594_0015792 3300053118 Unclassified 1827
890 Ga0501084_0015504 3300054114 Bacteria 6320
891 Ga0501084_0058408 3300054114 Bacteria 3227
892 Ga0501084_0155637 3300054114 Bacteria 1927
893 Ga0590077_056758 3300059426 Bacteria 884
894 Ga0501082_0134474 3300060353 Bacteria 2145
895 Ga0501082_0275159 3300060353 Bacteria 1466
896 Ga0501082_1231324 3300060353 Bacteria 654
897 Ga0530510_0004878 3300061734 Bacteria 9287
898 Ga0530510_0069882 3300061734 Bacteria 2548
899 2644526975 2643221694 Bacteria 4392972
900 2644610024 2643221711 Bacteria 4865335
901 2644670292 2643221722 Bacteria 4247614
902 Ga0114129_10227396
903 JGI24743J22301_10067890
904 JGI24744J21845_10010846
905 Ga0006562J51391_1108637
906 Ga0058858_1044707
907 Ga0065712_10270263
908 Ga0065715_10097157
909 Ga0065707_10108042
910 Ga0065707_10210927
911 Ga0065707_10214934
912 Ga0065707_10398980
913 Ga0070658_10005666
914 Ga0070658_10471619
915 Ga0070676_10018980
916 Ga0070676_10121584
917 Ga0070683_100019158
918 Ga0070683_100070406
919 Ga0070683_100230538
920 Ga0070683_100260271
921 Ga0070683_101017244
922 Ga0070690_100003939
923 Ga0070690_100604865
924 Ga0070670_100004448
925 Ga0070670_100005891
926 Ga0070670_100040002
927 Ga0070670_100224511
928 Ga0070670_100292861
929 Ga0070670_100398543
930 Ga0070666_10045961
931 Ga0070666_10373626
932 Ga0070680_100082278
933 Ga0070682_100012679
934 Ga0070682_100889945
935 Ga0068868_100386796
936 Ga0068868_100507091
937 Ga0068868_100579587
938 Ga0070660_100112004
939 Ga0070660_100493010
940 Ga0070689_100054089
941 Ga0070689_100276437
942 Ga0070689_100297554
943 Ga0070689_100365795
944 Ga0070689_100744640
945 Ga0070691_10038378
946 Ga0070691_10085712
947 Ga0070687_100011113
948 Ga0070687_100057652
949 Ga0070661_100315249
950 Ga0070661_100337018
951 Ga0070661_100535737
952 Ga0070661_100536905
953 Ga0070692_10092759
954 Ga0070692_10103276
955 Ga0070668_100054846
956 Ga0070668_100064246
957 Ga0070668_100204878
958 Ga0070669_100000010
959 Ga0070669_100000355
960 Ga0070669_100030200
961 Ga0070669_100093613
962 Ga0070669_100159147
963 Ga0070669_100257227
964 Ga0070669_100313690
965 Ga0070669_100473206
966 Ga0070675_100003158
967 Ga0070675_100070686
968 Ga0070675_100165727
969 Ga0070675_100184498
970 Ga0070675_100236022
971 Ga0070671_100035433
972 Ga0070671_101050432
973 Ga0070674_100007573
974 Ga0070674_100039404
975 Ga0070674_100863273
976 Ga0070673_100015199
977 Ga0070673_100108296
978 Ga0070673_100173049
979 Ga0070688_100004552
980 Ga0070659_100141178
981 Ga0070667_100145032
982 Ga0070709_10001377
983 Ga0070709_10040339
984 Ga0070709_10207926
985 Ga0070714_100013628
986 Ga0070714_100017489
987 Ga0070714_100043234
988 Ga0070714_100536464
989 Ga0070713_100017684
990 Ga0070713_100126839
991 Ga0070701_10036101
992 Ga0070701_10337379
993 Ga0070701_10494938
994 Ga0070711_100000130
995 Ga0070711_100034251
996 Ga0070711_100158688
997 Ga0070711_100636075
998 Ga0070705_100008930
999 Ga0070705_100183426
1000 Ga0070705_100390801
1001 Ga0070700_100005912
1002 Ga0070700_100075864
1003 Ga0070700_100081621
1004 Ga0070700_100944570
1005 Ga0070694_100008862
1006 Ga0070694_100090377
1007 Ga0070694_100307936
1008 Ga0070694_100563353
1009 Ga0070708_100000182
1010 Ga0070708_100015430
1011 Ga0070708_100055809
1012 Ga0070708_100092616
1013 Ga0070708_100232107
1014 Ga0070708_100248811
1015 Ga0070678_100084616
1016 Ga0070678_100370472
1017 Ga0070678_100531234
1018 Ga0070662_100289510
1019 Ga0070681_10015253
1020 Ga0070681_10016923
1021 Ga0068867_100167275
1022 Ga0068867_100185712
1023 Ga0068867_100247487
1024 Ga0070685_10000543
1025 Ga0070685_10011612
1026 Ga0070685_10033787
1027 Ga0070685_10073938
1028 Ga0070706_100092529
1029 Ga0070706_100372328
1030 Ga0070706_100418250
1031 Ga0070707_100009010
1032 Ga0070707_100024085
1033 Ga0070698_100009229
1034 Ga0070698_100292258
1035 Ga0070698_100730869
1036 Ga0070698_100805028
1037 Ga0070699_100000002
1038 Ga0070699_100001204
1039 Ga0070699_100476268
1040 Ga0070679_100073632
1041 Ga0070679_100140885
1042 Ga0070679_100201676
1043 Ga0070679_100265666
1044 Ga0070684_100014462
1045 Ga0070684_100025136
1046 Ga0070684_100178271
1047 Ga0070684_100298049
1048 Ga0070684_100369516
1049 Ga0070684_100742693
1050 Ga0070697_100001696
1051 Ga0070697_100438590
1052 Ga0070672_100021183
1053 Ga0070672_100036796
1054 Ga0070672_100048237
1055 Ga0070672_100055050
1056 Ga0070672_100067959
1057 Ga0070672_100081069
1058 Ga0070672_100161248
1059 Ga0070686_100041560
1060 Ga0070686_100309950
1061 Ga0070686_100418936
1062 Ga0070695_100051589
1063 Ga0070695_100101957
1064 Ga0070696_100002019
1065 Ga0070696_100042522
1066 Ga0070696_100309669
1067 Ga0070696_101063303
1068 Ga0070693_100016240
1069 Ga0070693_100018236
1070 Ga0070693_100696638
1071 Ga0070665_100000456
1072 Ga0070665_100315317
1073 Ga0070704_100026832
1074 Ga0070704_100240763
1075 Ga0070704_100259599
1076 Ga0070704_100607620
1077 Ga0068855_100359059
1078 Ga0068855_101062560
1079 Ga0070664_100008794
1080 Ga0070664_100023014
1081 Ga0070664_100055317
1082 Ga0070664_100530038
1083 Ga0068857_100012104
1084 Ga0068857_100019648
1085 Ga0068857_100041062
1086 Ga0068854_100083519
1087 Ga0068854_100366123
1088 Ga0068856_100254471
1089 Ga0070702_100241403
1090 Ga0068852_100397230
1091 Ga0068852_100847402
1092 Ga0068859_100000002
1093 Ga0068859_100034996
1094 Ga0068859_100071464
1095 Ga0068859_100090427
1096 Ga0068859_100156615
1097 Ga0068864_100022424
1098 Ga0068864_100412994
1099 Ga0068866_10261478
1100 Ga0068861_100071041
1101 Ga0068861_100259557
1102 Ga0068861_100294997
1103 Ga0068861_100296989
1104 Ga0068870_10001155
1105 Ga0068870_10002560
1106 Ga0068870_10004100
1107 Ga0068870_10100495
1108 Ga0068870_10416307
1109 Ga0068863_100202302
1110 Ga0068858_100121139
1111 Ga0068860_100605943
1112 Ga0068862_100006021
1113 Ga0068862_100006883
1114 Ga0068862_100100886
1115 Ga0068862_100104403
1116 Ga0068862_100166825
1117 Ga0068862_100340771
1118 Ga0081455_10128977
1119 Ga0081455_10268282
1120 Ga0081539_10038680
1121 Ga0070717_10014966
1122 Ga0070717_10123906
1123 Ga0075365_10010859
1124 Ga0075365_10216454
1125 Ga0070712_100005418
1126 Ga0075366_10048000
1127 Ga0097621_100074353
1128 Ga0075428_100088569
1129 Ga0075428_100115303
1130 Ga0075428_100228724
1131 Ga0075428_100480065
1132 Ga0075430_100078438
1133 Ga0075431_100004702
1134 Ga0075431_100086727
1135 Ga0075431_100194747
1136 Ga0075431_100196076
1137 Ga0075433_10051698
1138 Ga0075433_10054477
1139 Ga0075433_10141375
1140 Ga0075433_10194066
1141 Ga0075433_10553006
1142 Ga0075434_100442847
1143 Ga0075429_100006861
1144 Ga0075429_101272761
1145 Ga0068865_100074734
1146 Ga0068865_100148835
1147 Ga0075436_100010674
1148 Ga0075436_100057938
1149 Ga0075436_100465514
1150 Ga0075436_100629669
1151 Ga0097620_100000002
1152 Ga0097620_100034996
1153 Ga0097620_100071468
1154 Ga0097620_100090427
1155 Ga0097620_100156606
1156 Ga0075435_100181758
1157 Ga0105240_10012432
1158 Ga0105240_10880798
1159 Ga0111539_10002237
1160 Ga0111539_10082052
1161 Ga0111539_10413417
1162 Ga0111539_10490216
1163 Ga0111539_10539755
1164 Ga0111539_11275846
1165 Ga0105245_10086502
1166 Ga0105245_10096247
1167 Ga0105245_10250204
1168 Ga0105247_10163259
1169 Ga0114129_10009264
1170 Ga0114129_10010629
1171 Ga0114129_10024117
1172 Ga0114129_10376243
1173 Ga0114129_11962667
1174 Ga0105243_10054382
1175 Ga0105243_10105194
1176 Ga0105243_10139224
1177 Ga0105243_10173512
1178 Ga0105243_10356703
1179 Ga0105241_10263386
1180 Ga0105241_10714530
1181 Ga0105242_10016986
1182 Ga0105242_10126583
1183 Ga0105242_10293584
1184 Ga0105242_11214124
1185 Ga0105248_10133648
1186 Ga0105248_10331050
1187 Ga0105248_10588818
1188 Ga0105248_10877714
1189 Ga0105248_11028577
1190 Ga0105248_11493268
1191 Ga0105237_10603538
1192 Ga0105238_10000025
1193 Ga0105238_10165154
1194 Ga0105238_10189952
1195 Ga0105238_10658693
1196 Ga0105238_10783581
1197 Ga0105249_10064422
1198 Ga0105249_10121532
1199 Ga0105249_10157789
1200 Ga0105239_11306122
1201 Ga0105246_10018666
1202 Ga0105246_10107473
1203 Ga0105246_10146081
1204 Ga0105246_10200189
1205 Ga0157373_10025312
1206 Ga0157373_10143931
1207 Ga0157373_10298218
1208 Ga0157373_10518680
1209 Ga0157371_10466673
1210 Ga0157370_10041302
1211 Ga0157369_10048591
1212 Ga0157369_10051312
1213 Ga0157369_10594924
1214 Ga0157374_10265094
1215 Ga0157374_10563349
1216 Ga0157374_10781615
1217 Ga0157378_10253403
1218 Ga0157378_10363343
1219 Ga0157378_11386555
1220 Ga0163162_10023050
1221 Ga0163162_10086823
1222 Ga0163162_10094675
1223 Ga0157372_10022007
1224 Ga0157372_10024632
1225 Ga0157372_10173727
1226 Ga0157372_10210704
1227 Ga0157372_10448346
1228 Ga0157375_10020034
1229 Ga0157375_10037888
1230 Ga0157375_10059060
1231 Ga0157375_10114908
1232 Ga0157375_10244602
1233 Ga0157375_10394082
1234 Ga0157375_10903637
1235 Ga0157375_11039062
1236 Ga0163163_10033516
1237 Ga0163163_10053203
1238 Ga0157380_10109398
1239 Ga0157377_10000118
1240 Ga0157377_10029055
1241 Ga0157377_10073085
1242 Ga0157377_10139911
1243 Ga0157377_10759321
1244 Ga0157379_10461350
1245 Ga0157376_10269790
1246 Ga0157376_10497789
1247 Ga0182007_10105340
1248 Ga0206356_10375597
1249 Ga0213876_10023185
1250 Ga0213876_10113732
1251 Ga0207697_10098126
1252 Ga0207697_10138254
1253 Ga0207653_10004465
1254 Ga0207653_10064267
1255 Ga0207682_10049511
1256 Ga0207642_10124935
1257 Ga0207688_10030859
1258 Ga0207688_10034265
1259 Ga0207680_10036449
1260 Ga0207699_10001514
1261 Ga0207699_10005929
1262 Ga0207699_10486659
1263 Ga0207645_10002445
1264 Ga0207645_10028442
1265 Ga0207645_10128087
1266 Ga0207643_10001430
1267 Ga0207643_10002851
1268 Ga0207643_10005860
1269 Ga0207643_10663547
1270 Ga0207684_10036272
1271 Ga0207684_10330773
1272 Ga0207654_10355245
1273 Ga0207707_10006030
1274 Ga0207707_10036510
1275 Ga0207707_10214084
1276 Ga0207707_10414104
1277 Ga0207695_10010982
1278 Ga0207695_10072985
1279 Ga0207695_10313866
1280 Ga0207671_10430313
1281 Ga0207671_10533358
1282 Ga0207693_10004270
1283 Ga0207693_10142772
1284 Ga0207663_10000061
1285 Ga0207663_10093668
1286 Ga0207660_10432013
1287 Ga0207662_10014497
1288 Ga0207662_10020159
1289 Ga0207662_10028640
1290 Ga0207662_10089359
1291 Ga0207662_10305222
1292 Ga0207657_10800654
1293 Ga0207649_10019705
1294 Ga0207649_10111793
1295 Ga0207649_10450133
1296 Ga0207649_10538999
1297 Ga0207652_10188274
1298 Ga0207652_10193041
1299 Ga0207652_10560117
1300 Ga0207646_10000023
1301 Ga0207646_10000943
1302 Ga0207646_10182728
1303 Ga0207681_10000011
1304 Ga0207681_10002044
1305 Ga0207681_10041048
1306 Ga0207681_10206718
1307 Ga0207681_10490086
1308 Ga0207694_10000013
1309 Ga0207650_10002065
1310 Ga0207650_10003793
1311 Ga0207650_10112385
1312 Ga0207650_10143835
1313 Ga0207659_10041538
1314 Ga0207659_10116420
1315 Ga0207687_10093361
1316 Ga0207687_10386345
1317 Ga0207687_10522105
1318 Ga0207687_10529807
1319 Ga0207700_10004918
1320 Ga0207700_10208006
1321 Ga0207664_10066938
1322 Ga0207664_10156534
1323 Ga0207690_10079910
1324 Ga0207706_10083742
1325 Ga0207686_10163319
1326 Ga0207686_10327277
1327 Ga0207686_10584858
1328 Ga0207709_10111800
1329 Ga0207709_10122038
1330 Ga0207709_10482378
1331 Ga0207670_10007151
1332 Ga0207670_10067305
1333 Ga0207670_10369936
1334 Ga0207670_10860076
1335 Ga0207669_10049430
1336 Ga0207669_10562664
1337 Ga0207669_10721186
1338 Ga0207669_10921919
1339 Ga0207704_10054666
1340 Ga0207704_10161657
1341 Ga0207704_10247681
1342 Ga0207704_10453184
1343 Ga0207691_10010332
1344 Ga0207691_10030615
1345 Ga0207691_10068785
1346 Ga0207691_10071730
1347 Ga0207691_10079327
1348 Ga0207691_10108189
1349 Ga0207691_10147556
1350 Ga0207691_10150191
1351 Ga0207691_10166235
1352 Ga0207691_10168595
1353 Ga0207691_10207046
1354 Ga0207691_10267667
1355 Ga0207711_10215408
1356 Ga0207711_10456899
1357 Ga0207711_10875958
1358 Ga0207689_10083349
1359 Ga0207661_10038806
1360 Ga0207661_10068357
1361 Ga0207661_10160490
1362 Ga0207661_10172713
1363 Ga0207661_10193120
1364 Ga0207661_10450864
1365 Ga0207679_10017577
1366 Ga0207679_10033236
1367 Ga0207679_10238322
1368 Ga0207679_10335352
1369 Ga0207679_10340984
1370 Ga0207679_10424378
1371 Ga0207679_10749409
1372 Ga0207667_10368816
1373 Ga0207651_10032000
1374 Ga0207651_10036803
1375 Ga0207651_10053982
1376 Ga0207651_10188430
1377 Ga0207651_10223460
1378 Ga0207712_10031271
1379 Ga0207712_10109549
1380 Ga0207712_10222434
1381 Ga0207712_10463732
1382 Ga0207712_11096928
1383 Ga0207712_11401080
1384 Ga0207668_10053354
1385 Ga0207668_10180362
1386 Ga0207668_10316332
1387 Ga0207668_10599412
1388 Ga0207668_10965082
1389 Ga0207640_10157946
1390 Ga0207640_10216204
1391 Ga0207640_10233002
1392 Ga0207640_10398783
1393 Ga0207640_10488309
1394 Ga0207658_10066930
1395 Ga0207658_10076122
1396 Ga0207677_10323485
1397 Ga0207677_10645909
1398 Ga0207703_10094208
1399 Ga0207639_10195969
1400 Ga0207678_10267076
1401 Ga0207678_10815201
1402 Ga0207708_10000865
1403 Ga0207708_10033196
1404 Ga0207708_10114135
1405 Ga0207708_10316881
1406 Ga0207708_10787088
1407 Ga0207702_10127797
1408 Ga0207641_10322024
1409 Ga0207641_10740070
1410 Ga0207641_11001715
1411 Ga0207648_10014451
1412 Ga0207648_10068483
1413 Ga0207648_10233856
1414 Ga0207648_10359027
1415 Ga0207648_10754228
1416 Ga0207676_10031938
1417 Ga0207674_10004554
1418 Ga0207674_10010666
1419 Ga0207674_10047392
1420 Ga0207674_10062753
1421 Ga0207674_10382678
1422 Ga0207674_10625976
1423 Ga0207675_100010127
1424 Ga0207675_100088537
1425 Ga0207675_100195706
1426 Ga0207675_100267006
1427 Ga0207675_100297848
1428 Ga0207675_100326511
1429 Ga0207683_10050796
1430 Ga0207683_10077267
1431 Ga0207683_10400010
1432 Ga0207683_10557222
1433 Ga0209966_1008189
1434 Ga0207428_10001371
1435 Ga0207428_10084874
1436 Ga0268266_10000192
1437 Ga0268266_10603215
1438 Ga0268265_10006714
1439 Ga0268265_10007027
1440 Ga0268265_10181157
1441 Ga0268265_10181346
1442 Ga0268265_10194338
1443 Ga0268265_10471602
1444 Ga0268265_11124619
1445 Ga0307513_10003075
1446 Ga0307408_100164606
1447 Ga0307408_100826453
1448 Ga0307408_101159064
1449 Ga0307405_10101779
1450 Ga0307405_10238768
1451 Ga0307405_10256374
1452 Ga0307413_10057698
1453 Ga0307410_10008812
1454 Ga0307410_10042244
1455 Ga0307410_10118591
1456 Ga0307410_10204625
1457 Ga0307410_10237335
1458 Ga0307406_10004503
1459 Ga0307406_10085103
1460 Ga0307406_10136563
1461 Ga0307406_10162786
1462 Ga0307407_10075978
1463 Ga0307407_10127382
1464 Ga0307407_10481488
1465 Ga0307412_10025440
1466 Ga0307409_100015564
1467 Ga0307409_100231878
1468 Ga0307409_100236480
1469 Ga0307409_101356688
1470 Ga0307416_100037918
1471 Ga0307416_100049541
1472 Ga0307416_100244147
1473 Ga0307416_100332985
1474 Ga0307416_101037442
1475 Ga0307414_10034630
1476 Ga0307414_10057506
1477 Ga0307414_10714756
1478 Ga0307411_10159011
1479 Ga0307411_10794949
1480 Ga0307415_100039188
1481 Ga0307415_100089360
1482 Ga0307415_100143928
1483 Ga0307415_100523835
1484 Ga0373959_0000270
1485 Ga0373938_0066871
1486 Ga0373953_0037932
1487 Ga0373960_0018697
1488 Ga0373946_0171801
1489 Ga0373925_0064392
1490 Ga0395899_0021220
1491 Ga0395899_0271561
1492 Ga0395900_0074462
1493 Ga0395900_0100903
1494 Ga0395900_0353130
1495 Ga0395898_0002980
1496 Ga0395898_0012349
1497 Ga0395898_0016612
1498 Ga0395898_1004500
1499 Ga0395905_0045227
1500 Ga0395905_0057219
1501 Ga0395905_0060036
1502 Ga0395905_0300477
1503 Ga0395905_0682619
1504 Ga0395901_0002370
1505 Ga0395901_0002689
1506 Ga0395901_0033882
1507 Ga0395901_0072825
1508 Ga0395901_0569959
1509 Ga0436365_0180598
1510 Ga0436365_0235987
1511 Ga0436365_0761506
1512 Ga0439453_0004225
1513 Ga0451791_0034873
1514 Ga0451791_1265163
1515 Ga0451798_0209743
1516 Ga0451804_0560457
1517 Ga0451853_3881101
1518 Ga0451853_4040657
1519 Ga0439459_0046630
1520 Ga0451577_0015716
1521 Ga0451577_0083898
1522 Ga0453683_0111004
1523 Ga0466963_0057527
1524 Ga0466964_0004051
1525 Ga0453684_0000939
1526 Ga0453684_0016584
1527 Ga0453684_0139567
1528 Ga0453684_0530050
1529 Ga0453684_0592217
1530 Ga0466968_0072848
1531 Ga0466957_0075198
1532 Ga0451576_0030368
1533 Ga0451576_0037836
1534 Ga0451576_0595879
1535 Ga0466967_0008259
1536 Ga0466967_0009501
1537 Ga0495592_0150898
1538 Ga0495603_0021160
1539 Ga0495603_0064688
1540 Ga0495603_0068506
1541 Ga0495603_0428947
1542 Ga0495590_0168249
1543 Ga0495638_0149526
1544 Ga0495653_0097259
1545 Ga0495582_0014676
1546 Ga0495664_0023818
1547 Ga0495664_0154099
1548 Ga0495585_0297204
1549 Ga0495594_0098695
1550 Ga0495608_0000523
1551 Ga0495608_0079101
1552 Ga0495618_0028342
1553 Ga0495618_0199174
1554 Ga0495620_0002882
1555 Ga0495628_0604345
1556 Ga0495630_0203629
1557 Ga0495663_0144729
1558 Ga0495663_0161477
1559 Ga0495642_0259224
1560 Ga0495652_0037937
1561 Ga0495652_0178480
1562 Ga0495640_0139172
1563 Ga0495587_0061479
1564 Ga0495598_0096276
1565 Ga0495645_0188124
1566 Ga0495667_0026136
1567 Ga0495667_0076628
1568 Ga0495668_0332258
1569 Ga0495634_0020817
1570 Ga0495634_0174011
1571 Ga0495635_0030297
1572 Ga0495635_0114365
1573 Ga0495588_0007644
1574 Ga0495657_0014092
1575 Ga0495599_0021895
1576 Ga0495599_0118276
1577 Ga0495646_0081080
1578 Ga0495646_0199337
1579 Ga0495658_0084378
1580 Ga0495613_0008475
1581 Ga0495613_0309055
1582 Ga0495670_0291062
1583 Ga0495671_0196366
1584 Ga0495589_0234579
1585 Ga0495600_0188470
1586 Ga0495581_0219719
1587 Ga0495604_0054528
1588 Ga0495636_0131469
1589 Ga0495674_0111889
1590 Ga0495674_0455956
1591 Ga0495672_0013125
1592 Ga0495672_0286470
1593 Ga0495676_0052606
1594 Ga0495680_0013755
1595 Ga0495680_0316720
1596 Ga0495675_0104145
1597 Ga0495675_0145051
1598 Ga0495677_0089370
1599 Ga0495685_181591
1600 Ga0495684_0032912
1601 Ga0495684_0040287
1602 Ga0495686_0120378
1603 Ga0495593_0167893
1604 Ga0495602_0077957
1605 Ga0495615_0107909
1606 Ga0496100_0053007
1607 Ga0496100_0308799
1608 Ga0496100_0562707
1609 Ga0496101_0028511
1610 Ga0496101_0123215
1611 Ga0496102_0003529
1612 Ga0496102_0084280
1613 Ga0496102_0218997
1614 Ga0496103_0151190
1615 Ga0496103_0689289
1616 Ga0496104_0057954
1617 Ga0496104_0144553
1618 Ga0496104_0153534
1619 Ga0496105_0044227
1620 Ga0496105_0046520
1621 Ga0496105_0164013
1622 Ga0496105_0258682
1623 Ga0496106_0004265
1624 Ga0496106_0072560
1625 Ga0496106_0372441
1626 Ga0496107_0027301
1627 Ga0496107_0061654
1628 Ga0496107_0149230
1629 Ga0496107_0185956
1630 Ga0496107_0360096
1631 Ga0496108_0004331
1632 Ga0496108_0098913
1633 Ga0496108_0145832
1634 Ga0496108_0182725
1635 Ga0496108_0183250
1636 Ga0496108_0666880
1637 Ga0496109_0003979
1638 Ga0496109_0062903
1639 Ga0496109_0108854
1640 Ga0496109_0195469
1641 Ga0496109_0299912
1642 Ga0496109_0397043
1643 Ga0496109_0591858
1644 Ga0496110_0061769
1645 Ga0496110_0067853
1646 Ga0496110_0068794
1647 Ga0496110_0145831
1648 Ga0496110_0215475
1649 Ga0496110_0594778
1650 Ga0496110_1051634
1651 Ga0496111_0046827
1652 Ga0496111_0047891
1653 Ga0496111_0209460
1654 Ga0496111_0291820
1655 Ga0496112_0053929
1656 Ga0496112_0054607
1657 Ga0496112_0349487
1658 Ga0496112_0813689
1659 Ga0496113_0062762
1660 Ga0496113_0091929
1661 Ga0496113_0110426
1662 Ga0496113_0733003
1663 Ga0496113_0805237
1664 Ga0496114_0007655
1665 Ga0496114_0041791
1666 Ga0496114_0050107
1667 Ga0496114_0055959
1668 Ga0496114_0080570
1669 Ga0496114_0168853
1670 Ga0496114_0175653
1671 Ga0496114_0264630
1672 Ga0496114_0340162
1673 Ga0496114_0373059
1674 Ga0496114_0435891
1675 Ga0496114_0776018
1676 Ga0496115_0024880
1677 Ga0496115_0122715
1678 Ga0501299_042531
1679 Ga0501031_0007185
1680 Ga0501031_0068249
1681 Ga0501032_0174962
1682 Ga0501032_0199425
1683 Ga0501036_0016551
1684 Ga0501036_0018506
1685 Ga0501036_0697955
1686 Ga0501037_0018571
1687 Ga0501037_0298339
1688 Ga0501038_0012440
1689 Ga0501038_0061508
1690 Ga0501039_0059227
1691 Ga0501039_0090576
1692 Ga0501040_0005558
1693 Ga0501040_0143160
1694 Ga0501041_0006632
1695 Ga0501041_0037820
1696 Ga0501042_0008854
1697 Ga0501042_0014392
1698 Ga0501043_0004735
1699 Ga0501043_0024765
1700 Ga0501043_0274819
1701 Ga0501046_0003063
1702 Ga0501046_0007373
1703 Ga0501046_0424536
1704 Ga0501048_0006419
1705 Ga0501048_0040725
1706 Ga0501067_0000047
1707 Ga0501068_0065523
1708 Ga0501068_0129837
1709 Ga0501069_0040602
1710 Ga0501069_0074195
1711 Ga0501070_0038931
1712 Ga0501071_0004171
1713 Ga0501071_0006783
1714 Ga0501072_0018365
1715 Ga0501072_0542773
1716 Ga0501073_0000116
1717 Ga0501073_0007400
1718 Ga0501073_0034872
1719 Ga0501074_0016499
1720 Ga0501074_0024925
1721 Ga0501075_0050422
1722 Ga0501075_0056099
1723 Ga0501075_0122568
1724 Ga0501075_0781071
1725 Ga0501076_0027677
1726 Ga0501076_0137421
1727 Ga0501076_0275538
1728 Ga0501076_0872439
1729 Ga0501077_0073217
1730 Ga0501077_0180022
1731 Ga0501077_0248185
1732 Ga0501247_009009
1733 Ga0501249_028614
1734 Ga0501079_0010968
1735 Ga0501079_0879543
1736 Ga0501080_0019866
1737 Ga0501080_0123496
1738 Ga0501081_0030491
1739 Ga0501083_0030287
1740 Ga0501044_0098117
1741 Ga0501044_0263930
1742 Ga0501045_0021902
1743 Ga0501045_0089744
1744 Ga0501045_0639291
1745 nmdc:mga0yw44_34144_c1
1746 nmdc:mga0k408_173553_c1
1747 nmdc:mga06z11_78429_c1
1748 nmdc:mga05p37_133427_c1
1749 nmdc:mga05p37_17736_c1
1750 nmdc:mga05p37_19520_c1
1751 nmdc:mga05p37_33747_c1
1752 nmdc:mga05p37_604203_c1
1753 nmdc:mga05p37_857241_c1
1754 nmdc:mga09592_638_c1
1755 nmdc:mga0qj67_572139_c1
1756 nmdc:mga06r32_274940_c1
1757 nmdc:mga06r32_762877_c1
1758 nmdc:mga08y16_101979_c1
1759 nmdc:mga08y16_1177_c1
1760 nmdc:mga08y16_134432_c1
1761 nmdc:mga08y16_288953_c1
1762 nmdc:mga08y16_51595_c1
1763 nmdc:mga08y16_581443_c1
1764 nmdc:mga08y16_758492_c1
1765 nmdc:mga0n895_118128_c1
1766 nmdc:mga0n895_198498_c1
1767 nmdc:mga0n895_345341_c1
1768 nmdc:mga0rr50_124056_c1
1769 nmdc:mga0rr50_340692_c1
1770 nmdc:mga0rr50_423382_c1
1771 nmdc:mga08x19_13517_c1
1772 nmdc:mga08x19_161277_c1
1773 nmdc:mga08x19_246446_c1
1774 nmdc:mga08x19_578366_c1
1775 nmdc:mga0a205_171938_c1
1776 nmdc:mga0a205_37574_c1
1777 nmdc:mga0a205_48760_c1
1778 nmdc:mga0a205_505074_c1
1779 nmdc:mga0a205_671714_c1
1780 nmdc:mga0a205_68295_c1
1781 nmdc:mga0a205_915649_c1
1782 Ga0495601_0013836
1783 Ga0495601_0032213
1784 Ga0495601_0145731
1785 Ga0495601_0465477
1786 Ga0495612_0013977
1787 Ga0495612_0085511
1788 Ga0495619_0046364
1789 Ga0495619_0147163
1790 Ga0500594_0015792
1791 Ga0501084_0015504
1792 Ga0501084_0058408
1793 Ga0501084_0155637
1794 Ga0590077_056758
1795 Ga0501082_0134474
1796 Ga0501082_0275159
1797 Ga0501082_1231324
1798 Ga0530510_0004878
1799 Ga0530510_0069882
1800 2644526975
1801 2644610024
1802 2644670292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

44

236

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8205 1 194
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8121 1 194
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8097 1 194
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.8092 1 194
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.7906 1 194
ID Description Score Start End Superfamily
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8092 1 194 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7879 1 194 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7867 1 194 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7746 1 194 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7725 2 198 3.40.430.10
ID Description Score Start End GO Terms
AF-E3FW03-F1-model_v4 Dihydrofolate reductase 0.9831 2 198 GO:0008703
GO:0009231
AF-A0A534XRZ0-F1-model_v4 Dihydrofolate reductase 0.9808 1 123
AF-A0A4Q3QIT0-F1-model_v4 deleted 0.974 46 198
AF-E3FW03-F1-model_v4 Dihydrofolate reductase 0.9733 2 198 GO:0008703
GO:0009231
AF-A0A6C0GVG0-F1-model_v4 Deaminase 0.9681 8 198 GO:0008703
GO:0009231

Map