F485165

General Info

Members Datasets Scaffolds Average Seq Length
901 438 852 246

Family's Representative Sequence

Representative Sequence 3300006177|Ga0075362_10014484|Ga0075362_100144842
Length 283
Sequence MWYVVGHVGGSRTSETRPRAWMSLSRVPAVAFTLLPAVDVAEGQAVRLVQGEAGTETSYGSPRDAALAWQADGAEWIHLVDLDAAFGRGSNAELLADVLGELDVKVQLSGGIRDDATLARALSTGCARVVIGTASLEDPAWCARAIAAHGELVAVGLDVRIGEHPDGSTQHRLAARGWTRDGGDLWATVARLDRDGCARYVITDVSRDGMLRGPNVELYRAVTSATTTPVIASGGISTIGDLNLLAEAARAGATVEGAIVGKALYAGRFTLPEALEAMRRVDA

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
3 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
4 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
5 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
6 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
7 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
8 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
9 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
10 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
11 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
12 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
13 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
14 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
15 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
16 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
17 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
18 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
19 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
20 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
21 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
22 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
23 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
24 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
25 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
26 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
27 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
28 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
29 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
30 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
31 2922554459 Rhodococcus sp. 66b Isolate Unclassified
32 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
33 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
34 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
35 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
36 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
37 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
38 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
39 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
40 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
41 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
42 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
43 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
44 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
45 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
46 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
47 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
48 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
49 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
50 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
63 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
64 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
71 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
72 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
73 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
74 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
75 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
76 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
77 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
83 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
84 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
85 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
86 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
91 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
99 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
107 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
108 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
112 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
122 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
123 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
124 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
136 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
157 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
216 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
217 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
218 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
221 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
222 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
235 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
236 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
237 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
238 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
239 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
240 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
241 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
244 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
245 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
246 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
247 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
248 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
249 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
250 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
251 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
252 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
253 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
256 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
260 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
261 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
262 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
265 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
266 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
267 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
268 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
269 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
270 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
271 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
272 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
273 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
274 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
275 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
276 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
277 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
278 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
279 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
280 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
281 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
282 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
283 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
284 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
285 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
286 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
287 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
288 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
289 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
290 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
291 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
292 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
293 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
294 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
295 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
296 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
297 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
298 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
299 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
302 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
303 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
304 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
305 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
306 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
307 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
308 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
309 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
310 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
311 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
312 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
313 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
314 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
315 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
316 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
317 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
318 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
319 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
320 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
321 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
322 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
323 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
324 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
325 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
326 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
327 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
328 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
329 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
330 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
331 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
332 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
333 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
334 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
335 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
336 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
337 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
338 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
339 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
340 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
341 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
342 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
343 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
344 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
345 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
346 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
347 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
348 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
349 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
350 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
351 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
352 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
353 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
354 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
355 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
356 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
357 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
358 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
359 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
360 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
361 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
362 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
363 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
364 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
365 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
366 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
367 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
368 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
369 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
370 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
371 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
372 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
373 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
374 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
375 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
376 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
377 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
378 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
379 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
380 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
381 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
382 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
383 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
384 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
401 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
402 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
403 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
404 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
405 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
406 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
407 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
410 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
411 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
412 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
413 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
414 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
415 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
416 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
417 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
418 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
419 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
420 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
421 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
422 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
423 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
424 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
425 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
426 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
427 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
428 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
429 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
436 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
437 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
438 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.12
Metatranscriptomes 1.44
Isolates 5.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.11
Nodule 0
Rhizoplane 6.88
Rhizosphere 83.35
Stem 0
Stem Tuber 0
Unclassified 5.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000894 3300000549 Bacteria 4635
2 LJQas_1004940 3300000549 Bacteria 1710
3 LJQas_1016927 3300000549 Bacteria 850
4 JGI25152J39213_1001276 3300002773 Bacteria 11352
5 JGI25151J46595_10018721 3300003187 Bacteria 2962
6 Ga0055542_1009605 3300003762 Bacteria 1815
7 JGI25405J52794_10023857 3300003911 Bacteria 1246
8 Ga0065714_10181819 3300005288 Bacteria 960
9 Ga0070658_10113399 3300005327 Bacteria 2248
10 Ga0070676_10156071 3300005328 Bacteria 1465
11 Ga0070683_100111560 3300005329 Bacteria 2580
12 Ga0070683_100157186 3300005329 Bacteria 2156
13 Ga0070670_100320778 3300005331 Bacteria 1357
14 Ga0070677_10027580 3300005333 Bacteria 2139
15 Ga0068869_100402203 3300005334 Bacteria 1126
16 Ga0070666_10025308 3300005335 Bacteria 3868
17 Ga0070680_100003180 3300005336 Bacteria 12203
18 Ga0070682_100037193 3300005337 Bacteria 2978
19 Ga0070682_100317881 3300005337 Bacteria 1149
20 Ga0070660_100072756 3300005339 Bacteria 2687
21 Ga0070660_100232672 3300005339 Bacteria 1499
22 Ga0070687_100129563 3300005343 Bacteria 1455
23 Ga0070692_10021303 3300005345 Bacteria 3152
24 Ga0070668_100088774 3300005347 Bacteria 2434
25 Ga0070668_100136961 3300005347 Bacteria 1970
26 Ga0070668_100170438 3300005347 Bacteria 1772
27 Ga0070669_100032271 3300005353 Bacteria 3784
28 Ga0070675_100002626 3300005354 Bacteria 13505
29 Ga0070671_100009726 3300005355 Bacteria 7724
30 Ga0070671_100164961 3300005355 Bacteria 1873
31 Ga0070674_100450115 3300005356 Bacteria 1063
32 Ga0070673_100029237 3300005364 Bacteria 4108
33 Ga0070673_100224133 3300005364 Bacteria 1628
34 Ga0070688_100231013 3300005365 Bacteria 1308
35 Ga0070659_100084646 3300005366 Bacteria 2536
36 Ga0070659_100096133 3300005366 Bacteria 2379
37 Ga0070659_100422496 3300005366 Bacteria 1127
38 Ga0070667_100010876 3300005367 Bacteria 7525
39 Ga0070667_100271885 3300005367 Bacteria 1520
40 Ga0070714_100000077 3300005435 Bacteria 84205
41 Ga0070714_100087516 3300005435 Bacteria 2725
42 Ga0070714_100106572 3300005435 Bacteria 2476
43 Ga0070714_100141760 3300005435 Bacteria 2158
44 Ga0070714_100217236 3300005435 Bacteria 1755
45 Ga0070714_100218003 3300005435 Bacteria 1752
46 Ga0070713_100205830 3300005436 Bacteria 1779
47 Ga0070713_100261214 3300005436 Bacteria 1582
48 Ga0070710_10067089 3300005437 Bacteria 2058
49 Ga0070710_10104449 3300005437 Bacteria 1692
50 Ga0070705_100241917 3300005440 Bacteria 1261
51 Ga0070663_100056157 3300005455 Bacteria 2820
52 Ga0070662_100475493 3300005457 Bacteria 1040
53 Ga0070681_10000004 3300005458 Bacteria 205157
54 Ga0070681_10103684 3300005458 Bacteria 2788
55 Ga0068867_100388771 3300005459 Bacteria 1174
56 Ga0070706_100011378 3300005467 Bacteria 8269
57 Ga0070707_100001697 3300005468 Bacteria 21256
58 Ga0070707_100066121 3300005468 Bacteria 3474
59 Ga0070707_100068898 3300005468 Bacteria 3405
60 Ga0070698_100003640 3300005471 Bacteria 16926
61 Ga0070679_100000012 3300005530 Bacteria 155885
62 Ga0070679_100039191 3300005530 Bacteria 4710
63 Ga0070679_100092819 3300005530 Bacteria 3006
64 Ga0070684_100066242 3300005535 Bacteria 3171
65 Ga0070684_100158119 3300005535 Bacteria 2055
66 Ga0070684_100413532 3300005535 Bacteria 1244
67 Ga0070684_100666698 3300005535 Bacteria 969
68 Ga0070697_100525930 3300005536 Bacteria 1036
69 Ga0068853_100237921 3300005539 Bacteria 1668
70 Ga0070672_100043672 3300005543 Bacteria 3458
71 Ga0070686_100097118 3300005544 Bacteria 1983
72 Ga0070695_100191152 3300005545 Bacteria 1457
73 Ga0070695_100423670 3300005545 Bacteria 1014
74 Ga0070696_100168722 3300005546 Bacteria 1617
75 Ga0070665_100005452 3300005548 Bacteria 13115
76 Ga0070665_100531390 3300005548 Bacteria 1188
77 Ga0070704_100510128 3300005549 Bacteria 1045
78 Ga0068855_100014121 3300005563 Bacteria 9623
79 Ga0068855_100105577 3300005563 Bacteria 3238
80 Ga0068855_100155772 3300005563 Bacteria 2596
81 Ga0068855_100377826 3300005563 Bacteria 1556
82 Ga0068855_100605564 3300005563 Bacteria 1181
83 Ga0070664_100240408 3300005564 Bacteria 1625
84 Ga0068857_100233476 3300005577 Bacteria 1683
85 Ga0068854_100077209 3300005578 Bacteria 2450
86 Ga0068856_100049387 3300005614 Bacteria 4147
87 Ga0068856_100873292 3300005614 Bacteria 918
88 Ga0070702_100306046 3300005615 Bacteria 1101
89 Ga0068864_100362584 3300005618 Bacteria 1370
90 Ga0068864_100415662 3300005618 Bacteria 1280
91 Ga0068863_100001468 3300005841 Bacteria 23376
92 Ga0068863_100885554 3300005841 Bacteria 892
93 Ga0068858_100053472 3300005842 Bacteria 3735
94 Ga0068858_100972728 3300005842 Bacteria 831
95 Ga0068860_100132394 3300005843 Bacteria 2394
96 Ga0068862_100049143 3300005844 Bacteria 3602
97 Ga0081455_10027607 3300005937 Bacteria 5200
98 Ga0081540_1001125 3300005983 Bacteria 23625
99 Ga0070717_10003162 3300006028 Bacteria 11760
100 Ga0070717_10313589 3300006028 Bacteria 1396
101 Ga0070717_10320109 3300006028 Bacteria 1382
102 Ga0070717_10349210 3300006028 Bacteria 1322
103 Ga0070717_10721872 3300006028 Bacteria 906
104 Ga0075365_10083434 3300006038 Bacteria 2167
105 Ga0075365_10143586 3300006038 Bacteria 1658
106 Ga0075363_100044586 3300006048 Bacteria 2350
107 Ga0075363_100176965 3300006048 Bacteria 1213
108 Ga0075364_10001017 3300006051 Bacteria 14886
109 Ga0075364_10005942 3300006051 Bacteria 7137
110 Ga0075364_10061979 3300006051 Bacteria 2454
111 Ga0075432_10000069 3300006058 Bacteria 20468
112 Ga0075432_10003595 3300006058 Bacteria 5267
113 Ga0070715_10132303 3300006163 Bacteria 1202
114 Ga0070716_100044122 3300006173 Bacteria 2497
115 Ga0070712_100153461 3300006175 Bacteria 1771
116 Ga0070712_100168027 3300006175 Bacteria 1699
117 Ga0070712_100242808 3300006175 Bacteria 1435
118 Ga0075362_10014484 3300006177 Bacteria 3184
119 Ga0075362_10056011 3300006177 Bacteria 1774
120 Ga0075367_10035850 3300006178 Bacteria 2874
121 Ga0075367_10112500 3300006178 Bacteria 1672
122 Ga0075367_10149100 3300006178 Bacteria 1451
123 Ga0075367_10150608 3300006178 Bacteria 1443
124 Ga0075369_10032193 3300006186 Bacteria 2218
125 Ga0075428_100002980 3300006844 Bacteria 18447
126 Ga0075430_100058082 3300006846 Bacteria 3253
127 Ga0075430_100427824 3300006846 Bacteria 1093
128 Ga0075431_100042289 3300006847 Bacteria 4699
129 Ga0075431_100194880 3300006847 Bacteria 2075
130 Ga0075433_10180848 3300006852 Bacteria 1876
131 Ga0075434_100141090 3300006871 Bacteria 2429
132 Ga0075434_100286109 3300006871 Bacteria 1668
133 Ga0075436_100062217 3300006914 Bacteria 2580
134 Ga0075435_100169387 3300007076 Bacteria 1842
135 Ga0075435_100568410 3300007076 Bacteria 982
136 Ga0105251_10004541 3300009011 Bacteria 9414
137 Ga0105244_10002542 3300009036 Bacteria 13703
138 Ga0105244_10084825 3300009036 Bacteria 1564
139 Ga0105244_10129290 3300009036 Bacteria 1219
140 Ga0105244_10138678 3300009036 Bacteria 1171
141 Ga0105244_10141965 3300009036 Bacteria 1154
142 Ga0111539_10160560 3300009094 Bacteria 2629
143 Ga0105245_10181051 3300009098 Bacteria 2014
144 Ga0105245_10360547 3300009098 Bacteria 1443
145 Ga0105245_10402327 3300009098 Bacteria 1368
146 Ga0114129_10138907 3300009147 Bacteria 3332
147 Ga0114129_10409683 3300009147 Bacteria 1785
148 Ga0114129_10449302 3300009147 Bacteria 1690
149 Ga0114129_10487164 3300009147 Bacteria 1612
150 Ga0105243_10097946 3300009148 Bacteria 2428
151 Ga0105243_10134106 3300009148 Bacteria 2105
152 Ga0105243_10404312 3300009148 Bacteria 1269
153 Ga0105243_10766104 3300009148 Bacteria 948
154 Ga0105241_10038232 3300009174 Bacteria 3617
155 Ga0105241_10108471 3300009174 Bacteria 2219
156 Ga0105241_10212034 3300009174 Bacteria 1623
157 Ga0105248_10584416 3300009177 Bacteria 1260
158 Ga0105248_11104160 3300009177 Bacteria 896
159 Ga0105237_10007223 3300009545 Bacteria 12187
160 Ga0105237_10745612 3300009545 Bacteria 986
161 Ga0105249_10496754 3300009553 Bacteria 1265
162 Ga0105249_10667460 3300009553 Bacteria 1098
163 Ga0105035_101024 3300009988 Bacteria 1842
164 Ga0105028_106357 3300009993 Bacteria 1233
165 Ga0105239_10007509 3300010375 Bacteria 12503
166 Ga0105246_10004515 3300011119 Bacteria 8463
167 Ga0105246_10005509 3300011119 Bacteria 7719
168 Ga0105246_10064212 3300011119 Bacteria 2564
169 Ga0105246_10262114 3300011119 Bacteria 1377
170 Ga0157373_10027559 3300013100 Bacteria 4099
171 Ga0157371_10031861 3300013102 Bacteria 3796
172 Ga0157370_10088762 3300013104 Bacteria 2904
173 Ga0157370_10143901 3300013104 Bacteria 2221
174 Ga0157369_10057267 3300013105 Bacteria 4205
175 Ga0157369_10106123 3300013105 Bacteria 2990
176 Ga0157369_10142993 3300013105 Bacteria 2530
177 Ga0157374_10076077 3300013296 Bacteria 3173
178 Ga0157374_10258429 3300013296 Bacteria 1715
179 Ga0163162_10072094 3300013306 Bacteria 3508
180 Ga0163162_10096257 3300013306 Bacteria 3048
181 Ga0157372_10425056 3300013307 Bacteria 1548
182 Ga0157375_10113904 3300013308 Bacteria 2806
183 Ga0157375_10360809 3300013308 Bacteria 1619
184 Ga0157375_10485775 3300013308 Bacteria 1400
185 Ga0163163_10033959 3300014325 Bacteria 4938
186 Ga0163163_10339634 3300014325 Bacteria 1557
187 Ga0163163_10394768 3300014325 Bacteria 1441
188 Ga0157380_10329367 3300014326 Bacteria 1420
189 Ga0157377_10138848 3300014745 Bacteria 1491
190 Ga0157379_10003833 3300014968 Bacteria 12819
191 Ga0157379_10044210 3300014968 Bacteria 3975
192 Ga0157379_10149295 3300014968 Bacteria 2108
193 Ga0157376_10087435 3300014969 Bacteria 2690
194 Ga0163161_10348779 3300017792 Bacteria 1176
195 Ga0206353_10234997 3300020082 Bacteria 2319
196 Ga0206353_10257727 3300020082 Bacteria 1027
197 Ga0206353_11044474 3300020082 Bacteria 2531
198 Ga0213876_10001682 3300021384 Bacteria 13460
199 Ga0213876_10021732 3300021384 Bacteria 3394
200 Ga0209148_1002131 3300025254 Bacteria 7410
201 Ga0209148_1002475 3300025254 Bacteria 6295
202 Ga0209129_1000079 3300025258 Bacteria 187308
203 Ga0209025_1001855 3300025294 Bacteria 24786
204 Ga0209051_1005744 3300025303 Bacteria 7162
205 Ga0209051_1038351 3300025303 Bacteria 1745
206 Ga0207697_10050249 3300025315 Bacteria 1722
207 Ga0207655_1008786 3300025728 Bacteria 6358
208 Ga0207655_1069302 3300025728 Bacteria 1319
209 Ga0207655_1079983 3300025728 Bacteria 1183
210 Ga0207682_10024037 3300025893 Bacteria 2410
211 Ga0207692_10008827 3300025898 Bacteria 4188
212 Ga0207692_10060809 3300025898 Bacteria 1955
213 Ga0207710_10220525 3300025900 Bacteria 941
214 Ga0207688_10050211 3300025901 Bacteria 2334
215 Ga0207688_10072980 3300025901 Bacteria 1950
216 Ga0207680_10014941 3300025903 Bacteria 4038
217 Ga0207685_10050621 3300025905 Bacteria 1601
218 Ga0207699_10042181 3300025906 Bacteria 2641
219 Ga0207645_10068872 3300025907 Bacteria 2263
220 Ga0207645_10115876 3300025907 Bacteria 1737
221 Ga0207705_10009092 3300025909 Bacteria 7242
222 Ga0207684_10002393 3300025910 Bacteria 18981
223 Ga0207654_10067644 3300025911 Bacteria 2111
224 Ga0207654_10130130 3300025911 Bacteria 1592
225 Ga0207707_10000159 3300025912 Bacteria 70857
226 Ga0207707_10088992 3300025912 Bacteria 2698
227 Ga0207671_10194852 3300025914 Bacteria 1581
228 Ga0207693_10019661 3300025915 Bacteria 5371
229 Ga0207693_10234233 3300025915 Bacteria 1442
230 Ga0207693_10258236 3300025915 Bacteria 1366
231 Ga0207663_10000822 3300025916 Bacteria 14036
232 Ga0207663_10041147 3300025916 Bacteria 2814
233 Ga0207663_10441736 3300025916 Bacteria 1002
234 Ga0207660_10002821 3300025917 Bacteria 11403
235 Ga0207660_10656430 3300025917 Bacteria 855
236 Ga0207662_10067009 3300025918 Bacteria 2164
237 Ga0207657_10037523 3300025919 Bacteria 4325
238 Ga0207657_10204637 3300025919 Bacteria 1586
239 Ga0207649_10136904 3300025920 Bacteria 1671
240 Ga0207652_10000106 3300025921 Bacteria 90763
241 Ga0207652_10039621 3300025921 Bacteria 3999
242 Ga0207646_10000470 3300025922 Bacteria 53859
243 Ga0207646_10205196 3300025922 Bacteria 1780
244 Ga0207694_10138498 3300025924 Bacteria 1956
245 Ga0207650_10039178 3300025925 Bacteria 3463
246 Ga0207687_10207532 3300025927 Bacteria 1535
247 Ga0207700_10026702 3300025928 Bacteria 4031
248 Ga0207700_10037670 3300025928 Bacteria 3504
249 Ga0207700_10224923 3300025928 Bacteria 1593
250 Ga0207700_10252753 3300025928 Bacteria 1506
251 Ga0207664_10031206 3300025929 Bacteria 4075
252 Ga0207664_10043106 3300025929 Bacteria 3527
253 Ga0207664_10047380 3300025929 Bacteria 3376
254 Ga0207664_10092428 3300025929 Bacteria 2483
255 Ga0207664_10272111 3300025929 Bacteria 1484
256 Ga0207644_10007637 3300025931 Bacteria 7052
257 Ga0207644_10123777 3300025931 Bacteria 1972
258 Ga0207644_10622225 3300025931 Bacteria 897
259 Ga0207690_10213819 3300025932 Bacteria 1471
260 Ga0207690_10557269 3300025932 Bacteria 932
261 Ga0207706_10078234 3300025933 Bacteria 2909
262 Ga0207709_10045923 3300025935 Bacteria 2648
263 Ga0207669_10398173 3300025937 Bacteria 1078
264 Ga0207665_10007304 3300025939 Bacteria 7308
265 Ga0207665_10031236 3300025939 Bacteria 3523
266 Ga0207665_10377618 3300025939 Bacteria 1075
267 Ga0207691_10000656 3300025940 Bacteria 34145
268 Ga0207689_10043095 3300025942 Bacteria 3731
269 Ga0207689_10285737 3300025942 Bacteria 1366
270 Ga0207661_10433456 3300025944 Bacteria 1195
271 Ga0207679_10552994 3300025945 Bacteria 1033
272 Ga0207667_10055483 3300025949 Bacteria 4165
273 Ga0207667_10105517 3300025949 Bacteria 2907
274 Ga0207667_10142719 3300025949 Bacteria 2466
275 Ga0207667_10287791 3300025949 Bacteria 1679
276 Ga0207651_10467211 3300025960 Bacteria 1085
277 Ga0207640_10164421 3300025981 Bacteria 1646
278 Ga0207658_10005327 3300025986 Bacteria 8842
279 Ga0207658_10076758 3300025986 Bacteria 2547
280 Ga0207658_10143447 3300025986 Bacteria 1936
281 Ga0207677_10059987 3300026023 Bacteria 2627
282 Ga0207677_10357513 3300026023 Bacteria 1226
283 Ga0207703_10365663 3300026035 Bacteria 1331
284 Ga0207703_10425432 3300026035 Bacteria 1236
285 Ga0207708_10031425 3300026075 Bacteria 4029
286 Ga0207641_10003692 3300026088 Bacteria 13484
287 Ga0207641_10402952 3300026088 Bacteria 1314
288 Ga0207641_10553467 3300026088 Bacteria 1122
289 Ga0207648_10274304 3300026089 Bacteria 1507
290 Ga0207676_10234831 3300026095 Bacteria 1641
291 Ga0207674_10137274 3300026116 Bacteria 2406
292 Ga0207675_100047439 3300026118 Bacteria 4010
293 Ga0207683_10009067 3300026121 Bacteria 8476
294 Ga0207683_10058584 3300026121 Bacteria 3382
295 Ga0207698_10140684 3300026142 Bacteria 2079
296 Ga0207428_10009026 3300027907 Bacteria 8976
297 Ga0207428_10353962 3300027907 Bacteria 1080
298 Ga0268266_10017879 3300028379 Bacteria 6041
299 Ga0268265_10061879 3300028380 Bacteria 2874
300 Ga0268264_10062204 3300028381 Bacteria 3134
301 Ga0268264_10080238 3300028381 Bacteria 2786
302 Ga0268264_10917072 3300028381 Bacteria 880
303 Ga0265334_10002543 3300028573 Bacteria 8521
304 Ga0307517_10129982 3300028786 Bacteria 1818
305 Ga0265338_10005536 3300028800 Bacteria 16440
306 Ga0316181_1100102 3300030744 Bacteria 2263
307 Ga0265325_10072537 3300031241 Bacteria 1725
308 Ga0265327_10000041 3300031251 Bacteria 288506
309 Ga0307513_10006049 3300031456 Bacteria 15877
310 Ga0307408_100006256 3300031548 Bacteria 7901
311 Ga0307408_100018989 3300031548 Bacteria 4623
312 Ga0307408_100042860 3300031548 Bacteria 3217
313 Ga0307408_100064815 3300031548 Bacteria 2677
314 Ga0307408_100086588 3300031548 Bacteria 2355
315 Ga0307408_100183868 3300031548 Bacteria 1678
316 Ga0307408_100208453 3300031548 Bacteria 1587
317 Ga0307405_10019871 3300031731 Bacteria 3742
318 Ga0307405_10025869 3300031731 Bacteria 3375
319 Ga0307405_10029340 3300031731 Bacteria 3215
320 Ga0307405_10044992 3300031731 Bacteria 2702
321 Ga0307405_10050603 3300031731 Bacteria 2573
322 Ga0307405_10071411 3300031731 Bacteria 2233
323 Ga0307405_10100900 3300031731 Bacteria 1935
324 Ga0307405_10497421 3300031731 Bacteria 976
325 Ga0307413_10014569 3300031824 Bacteria 3999
326 Ga0307413_10020642 3300031824 Bacteria 3509
327 Ga0307413_10035669 3300031824 Bacteria 2855
328 Ga0307413_10189279 3300031824 Bacteria 1476
329 Ga0307410_10004235 3300031852 Bacteria 7377
330 Ga0307410_10007743 3300031852 Bacteria 5901
331 Ga0307410_10009937 3300031852 Bacteria 5365
332 Ga0307410_10015070 3300031852 Bacteria 4573
333 Ga0307410_10033381 3300031852 Bacteria 3322
334 Ga0307410_10059086 3300031852 Bacteria 2616
335 Ga0307410_10205494 3300031852 Bacteria 1506
336 Ga0307410_10455520 3300031852 Bacteria 1044
337 Ga0307406_10177997 3300031901 Bacteria 1546
338 Ga0307406_10264132 3300031901 Bacteria 1304
339 Ga0307406_10390801 3300031901 Bacteria 1100
340 Ga0307407_10021248 3300031903 Bacteria 3344
341 Ga0307407_10033714 3300031903 Bacteria 2796
342 Ga0307407_10110414 3300031903 Bacteria 1725
343 Ga0307412_10003121 3300031911 Bacteria 9205
344 Ga0307412_10039879 3300031911 Bacteria 3035
345 Ga0307412_10050641 3300031911 Bacteria 2741
346 Ga0307412_10091001 3300031911 Bacteria 2134
347 Ga0307412_10170890 3300031911 Bacteria 1625
348 Ga0307412_10259642 3300031911 Bacteria 1353
349 Ga0307412_10349004 3300031911 Bacteria 1187
350 Ga0307412_10395347 3300031911 Bacteria 1123
351 Ga0307409_100014797 3300031995 Bacteria 5091
352 Ga0307409_100032798 3300031995 Bacteria 3771
353 Ga0307409_100054693 3300031995 Bacteria 3076
354 Ga0307409_100115149 3300031995 Bacteria 2263
355 Ga0307409_100158844 3300031995 Bacteria 1974
356 Ga0307409_100160865 3300031995 Bacteria 1963
357 Ga0307409_100293965 3300031995 Bacteria 1508
358 Ga0307409_100717345 3300031995 Bacteria 1001
359 Ga0307409_100799996 3300031995 Bacteria 950
360 Ga0307409_100958359 3300031995 Bacteria 872
361 Ga0307416_100052270 3300032002 Bacteria 3270
362 Ga0307416_100103675 3300032002 Bacteria 2484
363 Ga0307416_100193287 3300032002 Bacteria 1922
364 Ga0307416_100220426 3300032002 Bacteria 1818
365 Ga0307416_100338341 3300032002 Bacteria 1516
366 Ga0307416_100552226 3300032002 Bacteria 1225
367 Ga0307416_101161474 3300032002 Bacteria 877
368 Ga0307414_10134136 3300032004 Bacteria 1927
369 Ga0307411_10007696 3300032005 Bacteria 5515
370 Ga0307415_100012770 3300032126 Bacteria 4871
371 Ga0307415_100040745 3300032126 Bacteria 3079
372 Ga0373948_0006156 3300034817 Bacteria 1974
373 Ga0373958_0011442 3300034819 Bacteria 1500
374 Ga0373928_0032819 3300035084 Bacteria 1159
375 Ga0373934_0000159 3300035086 Bacteria 24489
376 Ga0373934_0003379 3300035086 Bacteria 5843
377 Ga0373934_0024268 3300035086 Bacteria 2345
378 Ga0373940_0010591 3300035088 Bacteria 2172
379 Ga0373944_0009529 3300035089 Bacteria 2635
380 Ga0373952_0001767 3300035092 Bacteria 3931
381 Ga0373923_0006383 3300035111 Bacteria 4072
382 Ga0373923_0033337 3300035111 Bacteria 2085
383 Ga0373923_0047308 3300035111 Bacteria 1792
384 Ga0373936_0008358 3300035113 Bacteria 3895
385 Ga0373945_0010973 3300035116 Bacteria 2989
386 Ga0373945_0033909 3300035116 Bacteria 1817
387 Ga0373953_0000270 3300035117 Bacteria 14188
388 Ga0373953_0018848 3300035117 Bacteria 2559
389 Ga0373954_0000963 3300035118 Bacteria 11273
390 Ga0373954_0034461 3300035118 Bacteria 2345
391 Ga0373954_0062474 3300035118 Bacteria 1759
392 Ga0373954_0081307 3300035118 Bacteria 1548
393 Ga0373956_0000328 3300035119 Bacteria 19087
394 Ga0373956_0008455 3300035119 Bacteria 4166
395 Ga0373957_0000203 3300035120 Bacteria 15228
396 Ga0373957_0023821 3300035120 Bacteria 2192
397 Ga0373960_0036262 3300035121 Bacteria 1404
398 Ga0373946_0015848 3300035171 Bacteria 2864
399 Ga0373946_0024549 3300035171 Bacteria 2363
400 Ga0373955_0000024 3300035172 Bacteria 60102
401 Ga0373955_0032348 3300035172 Bacteria 2744
402 Ga0373961_0072725 3300035241 Bacteria 1066
403 Ga0316574_0161863 3300035398 Bacteria 1441
404 Ga0373924_0000562 3300035410 Bacteria 11432
405 Ga0373924_0041093 3300035410 Bacteria 1894
406 Ga0373924_0049711 3300035410 Bacteria 1735
407 Ga0373924_0107290 3300035410 Bacteria 1204
408 Ga0373935_0011440 3300035692 Bacteria 5327
409 Ga0373935_0113478 3300035692 Bacteria 1801
410 Ga0373933_0000153 3300035724 Bacteria 44821
411 Ga0373933_0006584 3300035724 Bacteria 6330
412 Ga0373933_0090094 3300035724 Bacteria 1891
413 Ga0373933_0093361 3300035724 Bacteria 1859
414 Ga0373947_0050366 3300035725 Bacteria 2504
415 Ga0373947_0077247 3300035725 Bacteria 2053
416 Ga0373937_0000333 3300036401 Bacteria 44782
417 Ga0373937_0004325 3300036401 Bacteria 12051
418 Ga0373937_0448464 3300036401 Bacteria 1225
419 Ga0373925_0010690 3300037068 Bacteria 6655
420 Ga0373925_0047563 3300037068 Bacteria 3193
421 Ga0373925_0237583 3300037068 Bacteria 1458
422 Ga0373925_0765766 3300037068 Bacteria 796
423 Ga0395899_0030686 3300037312 Bacteria 4042
424 Ga0395900_0025974 3300037418 Bacteria 5997
425 Ga0395900_0109545 3300037418 Bacteria 2837
426 Ga0395900_0144442 3300037418 Bacteria 2434
427 Ga0395898_0040409 3300037466 Bacteria 4612
428 Ga0395898_0073964 3300037466 Bacteria 3292
429 Ga0395898_0074393 3300037466 Bacteria 3281
430 Ga0395898_0088668 3300037466 Bacteria 2978
431 Ga0436364_0435806 3300037853 Bacteria 4556
432 Ga0395901_0053453 3300038443 Bacteria 4196
433 Ga0395901_0064752 3300038443 Bacteria 3805
434 Ga0395901_0088380 3300038443 Bacteria 3241
435 Ga0395901_0102240 3300038443 Bacteria 3007
436 Ga0436365_0327584 3300039437 Bacteria 17350
437 Ga0436365_1520643 3300039437 Bacteria 6551
438 Ga0436363_0242477 3300039450 Bacteria 1608
439 Ga0439436_0043325 3300041404 Bacteria 1284
440 Ga0439438_004277 3300041405 Bacteria 5537
441 Ga0439461_0003351 3300041410 Bacteria 2630
442 Ga0439466_0006264 3300041411 Bacteria 4528
443 Ga0451789_0133254 3300041443 Bacteria 1597
444 Ga0451837_1733010 3300041494 Bacteria 2116
445 Ga0439433_0000401 3300041999 Bacteria 7835
446 Ga0439433_0000801 3300041999 Bacteria 6213
447 Ga0439433_0011097 3300041999 Bacteria 1971
448 Ga0439442_000065 3300042002 Bacteria 24630
449 Ga0439442_000238 3300042002 Bacteria 13464
450 Ga0439442_000357 3300042002 Bacteria 10845
451 Ga0439442_002111 3300042002 Bacteria 3905
452 Ga0439442_003645 3300042002 Bacteria 3050
453 Ga0439449_0002718 3300042007 Bacteria 6884
454 Ga0439449_0017536 3300042007 Bacteria 2689
455 Ga0439449_0018955 3300042007 Bacteria 2579
456 Ga0439449_0047242 3300042007 Bacteria 1594
457 Ga0439452_000681 3300042010 Bacteria 16723
458 Ga0439457_001288 3300042014 Bacteria 7531
459 Ga0439457_006709 3300042014 Bacteria 2797
460 Ga0439462_0002654 3300042015 Bacteria 4194
461 Ga0450911_016773 3300042115 Bacteria 966
462 Ga0450919_000628 3300042121 Bacteria 4473
463 Ga0450919_001373 3300042121 Bacteria 3176
464 Ga0450920_001609 3300042122 Bacteria 3761
465 Ga0450920_021510 3300042122 Bacteria 1247
466 Ga0450923_012645 3300042125 Bacteria 1539
467 Ga0450907_000368 3300042146 Bacteria 13822
468 Ga0450907_003174 3300042146 Bacteria 2971
469 Ga0439446_0052557 3300042156 Bacteria 1219
470 Ga0450908_005626 3300042184 Bacteria 2397
471 Ga0450908_032318 3300042184 Bacteria 908
472 Ga0450909_002538 3300042185 Bacteria 2588
473 Ga0439434_0000396 3300042435 Bacteria 12430
474 Ga0439434_0000500 3300042435 Bacteria 11161
475 Ga0439434_0021671 3300042435 Bacteria 1931
476 Ga0439460_0026137 3300042461 Bacteria 1631
477 Ga0450918_000261 3300042531 Bacteria 11863
478 Ga0450918_000491 3300042531 Bacteria 8466
479 Ga0466972_0022779 3300044658 Bacteria 3117
480 Ga0466972_0119950 3300044658 Bacteria 1241
481 Ga0466965_0003568 3300044683 Bacteria 6842
482 Ga0466965_0121127 3300044683 Bacteria 1351
483 Ga0466965_0227999 3300044683 Bacteria 994
484 Ga0466966_0010743 3300044684 Bacteria 6086
485 Ga0466966_0102772 3300044684 Bacteria 1766
486 Ga0466966_0129419 3300044684 Bacteria 1546
487 Ga0466966_0310739 3300044684 Bacteria 947
488 Ga0466961_0005653 3300044693 Bacteria 7902
489 Ga0466961_0022970 3300044693 Bacteria 4012
490 Ga0466961_0032293 3300044693 Bacteria 3363
491 Ga0466961_0033450 3300044693 Bacteria 3303
492 Ga0466961_0165242 3300044693 Bacteria 1378
493 Ga0466963_0061983 3300044694 Bacteria 2501
494 Ga0466963_0065057 3300044694 Bacteria 2444
495 Ga0466963_0090171 3300044694 Bacteria 2087
496 Ga0466963_0193221 3300044694 Bacteria 1422
497 Ga0466963_0214221 3300044694 Bacteria 1348
498 Ga0466963_0262725 3300044694 Bacteria 1212
499 Ga0466963_0487776 3300044694 Bacteria 870
500 Ga0466964_0020191 3300044706 Bacteria 2564
501 Ga0466964_0122137 3300044706 Bacteria 1176
502 Ga0466964_0292101 3300044706 Bacteria 819
503 Ga0466971_0028907 3300044719 Bacteria 2479
504 Ga0466971_0091298 3300044719 Bacteria 1395
505 Ga0466971_0093670 3300044719 Bacteria 1376
506 Ga0466968_0028759 3300044735 Bacteria 2294
507 Ga0466970_0003681 3300044765 Bacteria 7483
508 Ga0466970_0023804 3300044765 Bacteria 3201
509 Ga0466970_0028223 3300044765 Bacteria 2948
510 Ga0466970_0273314 3300044765 Bacteria 949
511 Ga0466970_0371252 3300044765 Bacteria 814
512 Ga0466957_0016139 3300044842 Bacteria 4365
513 Ga0466957_0165673 3300044842 Bacteria 1437
514 Ga0466960_0000611 3300044901 Bacteria 12330
515 Ga0466960_0001863 3300044901 Bacteria 7744
516 Ga0466960_0031091 3300044901 Bacteria 2461
517 Ga0466960_0137887 3300044901 Bacteria 1293
518 Ga0466960_0386106 3300044901 Bacteria 804
519 Ga0466959_0026906 3300045049 Bacteria 4266
520 Ga0466959_0044312 3300045049 Bacteria 3279
521 Ga0466959_0221928 3300045049 Bacteria 1310
522 Ga0466959_0272469 3300045049 Bacteria 1163
523 Ga0466958_0012090 3300045836 Bacteria 4880
524 Ga0466958_0130123 3300045836 Bacteria 1580
525 Ga0466958_0135532 3300045836 Bacteria 1548
526 Ga0466958_0398857 3300045836 Bacteria 888
527 Ga0466967_0000806 3300045976 Bacteria 16409
528 Ga0466967_0024879 3300045976 Bacteria 4930
529 Ga0466967_0055658 3300045976 Bacteria 3485
530 Ga0466967_0059069 3300045976 Bacteria 3393
531 Ga0466967_0067289 3300045976 Bacteria 3195
532 Ga0466967_0139627 3300045976 Bacteria 2256
533 Ga0466967_0148808 3300045976 Bacteria 2186
534 Ga0466967_0180976 3300045976 Bacteria 1988
535 Ga0466967_0186688 3300045976 Bacteria 1958
536 Ga0466967_0189133 3300045976 Bacteria 1945
537 Ga0466967_0217859 3300045976 Bacteria 1813
538 Ga0466967_0330419 3300045976 Bacteria 1472
539 Ga0466967_0545322 3300045976 Bacteria 1141
540 Ga0466967_0856685 3300045976 Bacteria 903
541 Ga0466967_0989605 3300045976 Bacteria 837
542 Ga0495592_0001610 3300046454 Bacteria 15812
543 Ga0495592_0026981 3300046454 Bacteria 4354
544 Ga0495592_0181237 3300046454 Bacteria 1434
545 Ga0495603_0383506 3300046455 Bacteria 806
546 Ga0495629_0001760 3300046459 Bacteria 16982
547 Ga0495629_0073986 3300046459 Bacteria 2379
548 Ga0495629_0151871 3300046459 Bacteria 1609
549 Ga0495629_0157547 3300046459 Bacteria 1577
550 Ga0495641_0024636 3300046461 Bacteria 2967
551 Ga0495641_0070931 3300046461 Bacteria 1564
552 Ga0495651_0001169 3300046462 Bacteria 20282
553 Ga0495651_0032137 3300046462 Bacteria 4094
554 Ga0495651_0095803 3300046462 Bacteria 2218
555 Ga0495653_0002881 3300046463 Bacteria 13759
556 Ga0495653_0016459 3300046463 Bacteria 6020
557 Ga0495653_0063855 3300046463 Bacteria 2776
558 Ga0495653_0109244 3300046463 Bacteria 1990
559 Ga0495653_0144694 3300046463 Bacteria 1667
560 Ga0495650_0028197 3300046471 Bacteria 2582
561 Ga0495580_0008712 3300046472 Bacteria 8042
562 Ga0495580_0370499 3300046472 Bacteria 968
563 Ga0495582_0004201 3300046473 Bacteria 8098
564 Ga0495582_0029435 3300046473 Bacteria 3015
565 Ga0495639_0003255 3300046475 Bacteria 7053
566 Ga0495639_0044076 3300046475 Bacteria 2016
567 Ga0495662_0058634 3300046476 Bacteria 1859
568 Ga0495664_0029292 3300046477 Bacteria 3218
569 Ga0495594_0143742 3300046499 Bacteria 1353
570 Ga0495608_0000101 3300046511 Bacteria 61678
571 Ga0495608_0063468 3300046511 Bacteria 2423
572 Ga0495608_0094496 3300046511 Bacteria 1931
573 Ga0495608_0101153 3300046511 Bacteria 1858
574 Ga0495608_0274347 3300046511 Bacteria 1048
575 Ga0495618_0018008 3300046514 Bacteria 4335
576 Ga0495618_0018898 3300046514 Bacteria 4234
577 Ga0495618_0057965 3300046514 Bacteria 2452
578 Ga0495628_0000327 3300046516 Bacteria 43068
579 Ga0495628_0018571 3300046516 Bacteria 5757
580 Ga0495628_0043331 3300046516 Bacteria 3585
581 Ga0495630_0014076 3300046517 Bacteria 5821
582 Ga0495630_0049171 3300046517 Bacteria 3155
583 Ga0495630_0109195 3300046517 Bacteria 2095
584 Ga0495630_0295465 3300046517 Bacteria 1238
585 Ga0495631_0026625 3300046518 Bacteria 2652
586 Ga0495663_0108176 3300046525 Bacteria 922
587 Ga0495642_0070743 3300046528 Bacteria 1459
588 Ga0495652_0000775 3300046529 Bacteria 36861
589 Ga0495652_0014267 3300046529 Bacteria 7133
590 Ga0495652_0031573 3300046529 Bacteria 4637
591 Ga0495652_0163175 3300046529 Bacteria 1727
592 Ga0495665_0000966 3300046531 Bacteria 15212
593 Ga0495665_0003548 3300046531 Bacteria 8477
594 Ga0495665_0123569 3300046531 Bacteria 1355
595 Ga0495640_0045893 3300046533 Bacteria 3030
596 Ga0495586_0009865 3300046535 Bacteria 5084
597 Ga0495586_0014946 3300046535 Bacteria 4125
598 Ga0495587_0000861 3300046536 Bacteria 20061
599 Ga0495587_0008620 3300046536 Bacteria 6554
600 Ga0495587_0013878 3300046536 Bacteria 5058
601 Ga0495587_0024850 3300046536 Bacteria 3666
602 Ga0495587_0063562 3300046536 Bacteria 2158
603 Ga0495645_0023381 3300046543 Bacteria 4475
604 Ga0495645_0039139 3300046543 Bacteria 3458
605 Ga0495645_0075048 3300046543 Bacteria 2433
606 Ga0495645_0116610 3300046543 Bacteria 1884
607 Ga0495645_0309091 3300046543 Bacteria 1030
608 Ga0495645_0422548 3300046543 Bacteria 846
609 Ga0495633_0053583 3300046558 Bacteria 1899
610 Ga0495667_0000742 3300046559 Bacteria 20968
611 Ga0495667_0013612 3300046559 Bacteria 5500
612 Ga0495667_0055495 3300046559 Bacteria 2605
613 Ga0495667_0080633 3300046559 Bacteria 2115
614 Ga0495667_0151773 3300046559 Bacteria 1491
615 Ga0495656_0004822 3300046615 Bacteria 4641
616 Ga0495668_0011500 3300046616 Bacteria 5299
617 Ga0495635_0041672 3300046663 Bacteria 3171
618 Ga0495635_0113408 3300046663 Bacteria 1851
619 Ga0495635_0170609 3300046663 Bacteria 1479
620 Ga0495659_0057590 3300046664 Bacteria 1428
621 Ga0495588_0004869 3300046674 Bacteria 5948
622 Ga0495588_0010663 3300046674 Bacteria 4284
623 Ga0495588_0010771 3300046674 Bacteria 4267
624 Ga0495588_0087062 3300046674 Bacteria 1634
625 Ga0495657_0000156 3300046675 Bacteria 61702
626 Ga0495657_0037723 3300046675 Bacteria 3328
627 Ga0495657_0055426 3300046675 Bacteria 2644
628 Ga0495657_0237960 3300046675 Bacteria 1099
629 Ga0495599_0000097 3300046678 Bacteria 61561
630 Ga0495599_0026887 3300046678 Bacteria 3606
631 Ga0495599_0076248 3300046678 Bacteria 2093
632 Ga0495599_0080383 3300046678 Bacteria 2035
633 Ga0495623_0000471 3300046679 Bacteria 26602
634 Ga0495623_0028141 3300046679 Bacteria 3617
635 Ga0495623_0040229 3300046679 Bacteria 2985
636 Ga0495623_0207401 3300046679 Bacteria 1123
637 Ga0495646_0010359 3300046680 Bacteria 5929
638 Ga0495646_0011151 3300046680 Bacteria 5708
639 Ga0495646_0035868 3300046680 Bacteria 3073
640 Ga0495647_0035103 3300046681 Bacteria 1881
641 Ga0495658_0009347 3300046683 Bacteria 4884
642 Ga0495658_0061558 3300046683 Bacteria 2155
643 Ga0495658_0064147 3300046683 Bacteria 2115
644 Ga0495613_0031742 3300046689 Bacteria 3923
645 Ga0495613_0050844 3300046689 Bacteria 3056
646 Ga0495624_0042138 3300046690 Bacteria 2917
647 Ga0495624_0291403 3300046690 Bacteria 985
648 Ga0495670_0007465 3300046691 Bacteria 5369
649 Ga0495670_0400549 3300046691 Bacteria 741
650 Ga0495600_0003272 3300046809 Bacteria 9490
651 Ga0495600_0008509 3300046809 Bacteria 6306
652 Ga0495600_0025545 3300046809 Bacteria 3807
653 Ga0495600_0122208 3300046809 Bacteria 1693
654 Ga0495581_0015765 3300047315 Bacteria 4388
655 Ga0495581_0026136 3300047315 Bacteria 3386
656 Ga0495581_0059254 3300047315 Bacteria 2212
657 Ga0495581_0148918 3300047315 Bacteria 1366
658 Ga0495581_0215401 3300047315 Bacteria 1123
659 Ga0495581_0261193 3300047315 Bacteria 1013
660 Ga0495604_0000196 3300047317 Bacteria 54755
661 Ga0495604_0014318 3300047317 Bacteria 6324
662 Ga0495604_0060756 3300047317 Bacteria 2892
663 Ga0495604_0074011 3300047317 Bacteria 2568
664 Ga0495636_0027025 3300047318 Bacteria 2337
665 Ga0495674_0099293 3300047319 Bacteria 2478
666 Ga0495674_0237852 3300047319 Bacteria 1501
667 Ga0495676_0154971 3300047321 Bacteria 1626
668 Ga0495680_0000226 3300047322 Bacteria 61646
669 Ga0495680_0007648 3300047322 Bacteria 9866
670 Ga0495680_0045310 3300047322 Bacteria 3472
671 Ga0495680_0127907 3300047322 Bacteria 1869
672 Ga0495680_0162360 3300047322 Bacteria 1621
673 Ga0495675_0001884 3300047444 Bacteria 12501
674 Ga0495675_0023989 3300047444 Bacteria 3886
675 Ga0495675_0077676 3300047444 Bacteria 2091
676 Ga0495675_0118966 3300047444 Bacteria 1645
677 Ga0495677_0014276 3300047445 Bacteria 2893
678 Ga0495684_0079380 3300047471 Bacteria 2491
679 Ga0495684_0086336 3300047471 Bacteria 2378
680 Ga0495593_0006917 3300047673 Bacteria 6641
681 Ga0495593_0019418 3300047673 Bacteria 3811
682 Ga0495593_0033640 3300047673 Bacteria 2791
683 Ga0495602_0000172 3300048088 Bacteria 60316
684 Ga0495602_0040638 3300048088 Bacteria 4260
685 Ga0495614_0019723 3300048089 Bacteria 2917
686 Ga0496100_0049946 3300048903 Bacteria 2707
687 Ga0496100_0085770 3300048903 Bacteria 2137
688 Ga0496100_0148811 3300048903 Bacteria 1667
689 Ga0496100_0462568 3300048903 Bacteria 974
690 Ga0496100_0611973 3300048903 Bacteria 846
691 Ga0496101_0000046 3300048904 Bacteria 155997
692 Ga0496101_0004798 3300048904 Bacteria 8579
693 Ga0496101_0017537 3300048904 Bacteria 4856
694 Ga0496101_0261220 3300048904 Bacteria 1350
695 Ga0496102_0000025 3300048905 Bacteria 227201
696 Ga0496102_0000350 3300048905 Bacteria 55813
697 Ga0496102_0001790 3300048905 Bacteria 18631
698 Ga0496102_0047115 3300048905 Bacteria 3916
699 Ga0496102_0070197 3300048905 Bacteria 3216
700 Ga0496102_0096512 3300048905 Bacteria 2740
701 Ga0496102_0370522 3300048905 Bacteria 1348
702 Ga0496102_0434821 3300048905 Bacteria 1232
703 Ga0496102_0657041 3300048905 Bacteria 971
704 Ga0496103_0000022 3300048906 Bacteria 227208
705 Ga0496103_0000217 3300048906 Bacteria 56706
706 Ga0496103_0016005 3300048906 Bacteria 4473
707 Ga0496103_0058952 3300048906 Bacteria 2385
708 Ga0496103_0060711 3300048906 Bacteria 2350
709 Ga0496103_0464277 3300048906 Bacteria 811
710 Ga0496104_0066197 3300048907 Bacteria 3430
711 Ga0496104_0082215 3300048907 Bacteria 3071
712 Ga0496104_0655591 3300048907 Bacteria 958
713 Ga0496105_0008133 3300048908 Bacteria 8156
714 Ga0496105_0047568 3300048908 Bacteria 3540
715 Ga0496106_0006732 3300048909 Bacteria 8514
716 Ga0496106_0041236 3300048909 Bacteria 3459
717 Ga0496106_0141820 3300048909 Bacteria 1890
718 Ga0496107_0005672 3300048910 Bacteria 8542
719 Ga0496107_0239999 3300048910 Bacteria 1348
720 Ga0496107_0276211 3300048910 Bacteria 1250
721 Ga0496108_0022780 3300048911 Bacteria 5153
722 Ga0496108_0042167 3300048911 Bacteria 3810
723 Ga0496108_0157803 3300048911 Bacteria 1959
724 Ga0496108_0415174 3300048911 Bacteria 1175
725 Ga0496108_0699061 3300048911 Bacteria 879
726 Ga0496109_0005843 3300048912 Bacteria 10321
727 Ga0496109_0102507 3300048912 Bacteria 2656
728 Ga0496110_0030124 3300048913 Bacteria 4676
729 Ga0496110_0057883 3300048913 Bacteria 3413
730 Ga0496110_0058928 3300048913 Bacteria 3382
731 Ga0496110_0472304 3300048913 Bacteria 1143
732 Ga0496111_0037292 3300048914 Bacteria 3478
733 Ga0496111_0163035 3300048914 Bacteria 1655
734 Ga0496111_0186420 3300048914 Bacteria 1542
735 Ga0496111_0235572 3300048914 Bacteria 1359
736 Ga0496111_0238639 3300048914 Bacteria 1350
737 Ga0496111_0617040 3300048914 Bacteria 793
738 Ga0496112_0007354 3300048915 Bacteria 9770
739 Ga0496112_0067824 3300048915 Bacteria 3522
740 Ga0496112_0251832 3300048915 Bacteria 1717
741 Ga0496113_0056108 3300048916 Bacteria 2956
742 Ga0496113_0132401 3300048916 Bacteria 1957
743 Ga0496114_0017465 3300048917 Bacteria 5790
744 Ga0496114_0062525 3300048917 Bacteria 3115
745 Ga0496114_0373374 3300048917 Bacteria 1262
746 Ga0496115_0019992 3300048918 Bacteria 5159
747 Ga0496116_0000059 3300048919 Bacteria 274491
748 Ga0496116_0000468 3300048919 Bacteria 55723
749 Ga0496117_0000055 3300048920 Bacteria 274518
750 Ga0496117_0000274 3300048920 Bacteria 96150
751 Ga0496117_0163313 3300048920 Bacteria 1302
752 Ga0496118_0000058 3300048921 Bacteria 227245
753 Ga0496118_0000100 3300048921 Bacteria 160138
754 Ga0496119_0004453 3300048922 Bacteria 13940
755 Ga0496120_0005409 3300048923 Bacteria 10192
756 Ga0496120_0027940 3300048923 Bacteria 3463
757 Ga0496121_0000113 3300048924 Bacteria 181807
758 Ga0496121_0040790 3300048924 Bacteria 4067
759 Ga0496123_0121321 3300048926 Bacteria 1470
760 Ga0496124_0197439 3300048927 Bacteria 1533
761 Ga0496125_0030554 3300048928 Bacteria 4817
762 Ga0496125_0165162 3300048928 Bacteria 1497
763 Ga0496125_0202760 3300048928 Bacteria 1296
764 Ga0496126_0000781 3300048929 Bacteria 57361
765 Ga0496126_0000794 3300048929 Bacteria 56733
766 Ga0501313_009025 3300049529 Bacteria 1118
767 Ga0501317_005036 3300049533 Bacteria 1400
768 Ga0501321_011129 3300049537 Bacteria 998
769 Ga0501323_002272 3300049539 Bacteria 1843
770 Ga0501031_0024732 3300049568 Bacteria 3915
771 Ga0501032_0001524 3300049569 Bacteria 18460
772 Ga0501032_0003639 3300049569 Bacteria 11723
773 Ga0501032_0036550 3300049569 Bacteria 3352
774 Ga0501034_0000015 3300049571 Bacteria 296163
775 Ga0501034_0188951 3300049571 Bacteria 2023
776 Ga0501034_0306069 3300049571 Bacteria 1525
777 Ga0501036_0329713 3300049572 Bacteria 1275
778 Ga0501037_0064246 3300049573 Bacteria 2675
779 Ga0501037_0094633 3300049573 Bacteria 2160
780 Ga0501038_0104850 3300049574 Bacteria 2349
781 Ga0501039_0539340 3300049575 Bacteria 915
782 Ga0501040_0067131 3300049576 Bacteria 2471
783 Ga0501041_0041482 3300049577 Bacteria 2796
784 Ga0501042_0045499 3300049578 Bacteria 3128
785 Ga0501043_0021832 3300049579 Bacteria 5020
786 Ga0501043_0549752 3300049579 Bacteria 858
787 Ga0501047_0213792 3300049581 Bacteria 1786
788 Ga0501047_0340621 3300049581 Bacteria 1337
789 Ga0501069_0024117 3300049585 Bacteria 3318
790 Ga0501070_0001434 3300049586 Bacteria 21325
791 Ga0501070_0010162 3300049586 Bacteria 7967
792 Ga0501070_0015602 3300049586 Bacteria 6388
793 Ga0501070_0018008 3300049586 Bacteria 5926
794 Ga0501070_0317603 3300049586 Bacteria 1267
795 Ga0501075_0046761 3300049591 Bacteria 3251
796 Ga0501077_0028838 3300049593 Bacteria 3528
797 Ga0501079_0025655 3300049741 Bacteria 4518
798 Ga0501080_0000253 3300049742 Bacteria 40425
799 Ga0501080_0007864 3300049742 Bacteria 9649
800 Ga0501080_0549678 3300049742 Bacteria 1028
801 Ga0501081_0265174 3300049743 Bacteria 1256
802 Ga0501035_0066662 3300049822 Bacteria 3195
803 Ga0501044_0004741 3300049823 Bacteria 15203
804 Ga0501044_0343851 3300049823 Bacteria 1412
805 Ga0501045_0159550 3300049824 Bacteria 1678
806 nmdc:mga03683_19321_c1 3300050489 Bacteria 2600
807 nmdc:mga03683_94012_c1 3300050489 Bacteria 1310
808 nmdc:mga03n38_38320_c1 3300050490 Bacteria 2072
809 nmdc:mga03n38_57112_c1 3300050490 Bacteria 1764
810 nmdc:mga00v17_124511_c1 3300050491 Bacteria 1644
811 nmdc:mga00v17_209055_c1 3300050491 Bacteria 1262
812 nmdc:mga00v17_412792_c1 3300050491 Bacteria 877
813 nmdc:mga0yw44_14710_c1 3300050492 Bacteria 4165
814 nmdc:mga0yw44_378816_c1 3300050492 Bacteria 955
815 nmdc:mga0yw44_45837_c1 3300050492 Bacteria 2623
816 nmdc:mga0yw44_5862_c1 3300050492 Bacteria 5867
817 nmdc:mga06z11_255394_c1 3300050494 Bacteria 1033
818 nmdc:mga04h51_79575_c1 3300050495 Bacteria 1160
819 nmdc:mga05p37_151345_c1 3300050507 Bacteria 2838
820 nmdc:mga05p37_43016_c1 3300050507 Bacteria 5554
821 nmdc:mga05p37_497991_c1 3300050507 Bacteria 1399
822 nmdc:mga0qj67_204695_c1 3300050509 Bacteria 1603
823 nmdc:mga0qj67_46644_c1 3300050509 Bacteria 3421
824 nmdc:mga06r32_21177_c1 3300050510 Bacteria 6000
825 nmdc:mga06r32_80_c9 3300050510 Bacteria 2766
826 nmdc:mga0n895_483060_c1 3300050512 Bacteria 1249
827 nmdc:mga0rr50_240880_c1 3300050513 Bacteria 1499
828 nmdc:mga0rr50_274872_c1 3300050513 Bacteria 1405
829 nmdc:mga0rr50_411318_c1 3300050513 Bacteria 1144
830 nmdc:mga08x19_153305_c1 3300050514 Bacteria 1562
831 nmdc:mga08x19_52984_c1 3300050514 Bacteria 2610
832 nmdc:mga0a205_326000_c1 3300050515 Bacteria 1406
833 nmdc:mga0sz30_14454_c1 3300050516 Bacteria 3108
834 Ga0495601_0028210 3300053077 Bacteria 3475
835 Ga0495601_0031299 3300053077 Bacteria 3306
836 Ga0495601_0306628 3300053077 Bacteria 1034
837 Ga0495612_0006591 3300053078 Bacteria 4765
838 Ga0495595_0010883 3300053084 Bacteria 3794
839 Ga0495595_0026070 3300053084 Bacteria 2594
840 Ga0495595_0026966 3300053084 Bacteria 2556
841 Ga0495619_0022384 3300053085 Bacteria 4044
842 Ga0495619_0033600 3300053085 Bacteria 3331
843 Ga0495619_0116373 3300053085 Bacteria 1830
844 Ga0501084_0165353 3300054114 Bacteria 1867
845 Ga0587090_000391 3300059510 Bacteria 3541
846 Ga0587091_049331 3300059511 Bacteria 859
847 Ga0587115_006932 3300059626 Bacteria 1323
848 Ga0587128_040680 3300059630 Bacteria 812
849 Ga0587072_000734 3300059643 Bacteria 3576
850 Ga0587079_049515 3300059647 Bacteria 877
851 Ga0466962_0028309 3300061719 Bacteria 2685
852 Ga0466962_0031843 3300061719 Bacteria 2525

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0265174 Ga0501081_0265174_41_826 206
2 3300006048 Ga0075363_100044586 Ga0075363_1000445865 219
3 3300050490 nmdc:mga03n38_38320_c1 nmdc:mga03n38_38320_c1_403_1221 219
4 3300013104 Ga0157370_10088762 Ga0157370_100887624 221
5 3300048912 Ga0496109_0005843 Ga0496109_0005843_5195_5920 221
6 3300006178 Ga0075367_10149100 Ga0075367_101491001 222
7 3300025912 Ga0207707_10000159 Ga0207707_1000015912 222
8 3300025917 Ga0207660_10002821 Ga0207660_100028214 222
9 3300025921 Ga0207652_10000106 Ga0207652_1000010676 222
10 3300046691 Ga0495670_0400549 Ga0495670_0400549_44_712 222
11 3300025924 Ga0207694_10138498 Ga0207694_101384983 223
12 3300044683 Ga0466965_0003568 Ga0466965_0003568_925_1626 228
13 3300044765 Ga0466970_0003681 Ga0466970_0003681_1662_2363 228
14 3300044842 Ga0466957_0165673 Ga0466957_0165673_636_1337 228
15 3300044901 Ga0466960_0000611 Ga0466960_0000611_1750_2451 228
16 3300045976 Ga0466967_0856685 Ga0466967_0856685_109_810 228
17 3300048923 Ga0496120_0027940 Ga0496120_0027940_371_1075 229
18 3300044706 Ga0466964_0122137 Ga0466964_0122137_12_707 230
19 3300045976 Ga0466967_0148808 Ga0466967_0148808_1047_1775 232
20 iso_pu_bacteria 2915358134 2915364415 232
21 iso_pu_bacteria 8054472261 8054476371 232
22 3300005339 Ga0070660_100072756 Ga0070660_1000727563 233
23 3300005458 Ga0070681_10103684 Ga0070681_101036842 233
24 3300037068 Ga0373925_0047563 Ga0373925_0047563_610_1470 234
25 3300044683 Ga0466965_0121127 Ga0466965_0121127_133_879 234
26 3300044694 Ga0466963_0065057 Ga0466963_0065057_330_1076 234
27 3300044706 Ga0466964_0020191 Ga0466964_0020191_1650_2393 234
28 3300044719 Ga0466971_0028907 Ga0466971_0028907_420_1166 234
29 3300044735 Ga0466968_0028759 Ga0466968_0028759_687_1433 234
30 3300044842 Ga0466957_0016139 Ga0466957_0016139_148_894 234
31 3300045836 Ga0466958_0012090 Ga0466958_0012090_480_1226 234
32 3300061719 Ga0466962_0028309 Ga0466962_0028309_196_942 234
33 iso_pu_bacteria 2565956761 2566994868 235
34 iso_pu_bacteria 2751185734 2753070983 235
35 iso_pu_bacteria 2870721527 2870726436 235
36 iso_pu_bacteria 2904535858 2904540226 235
37 iso_pu_bacteria 2922554459 2922556631 235
38 3300005347 Ga0070668_100170438 Ga0070668_1001704383 236
39 3300005355 Ga0070671_100009726 Ga0070671_1000097265 236
40 3300005548 Ga0070665_100005452 Ga0070665_10000545214 236
41 3300005841 Ga0068863_100001468 Ga0068863_1000014689 236
42 3300005843 Ga0068860_100132394 Ga0068860_1001323942 236
43 3300014968 Ga0157379_10003833 Ga0157379_100038332 236
44 3300025931 Ga0207644_10007637 Ga0207644_100076376 236
45 3300026088 Ga0207641_10003692 Ga0207641_100036922 236
46 3300026095 Ga0207676_10234831 Ga0207676_102348311 236
47 3300028379 Ga0268266_10017879 Ga0268266_100178794 236
48 3300028381 Ga0268264_10062204 Ga0268264_100622043 236
49 3300044684 Ga0466966_0102772 Ga0466966_0102772_487_1200 236
50 3300044693 Ga0466961_0005653 Ga0466961_0005653_4607_5320 236
51 3300044693 Ga0466961_0165242 Ga0466961_0165242_152_865 236
52 3300044694 Ga0466963_0061983 Ga0466963_0061983_403_1116 236
53 3300044694 Ga0466963_0487776 Ga0466963_0487776_51_767 236
54 3300044719 Ga0466971_0093670 Ga0466971_0093670_63_776 236
55 3300044765 Ga0466970_0273314 Ga0466970_0273314_217_930 236
56 3300044765 Ga0466970_0371252 Ga0466970_0371252_69_782 236
57 3300045049 Ga0466959_0026906 Ga0466959_0026906_1075_1788 236
58 3300045836 Ga0466958_0135532 Ga0466958_0135532_220_933 236
59 3300045836 Ga0466958_0398857 Ga0466958_0398857_128_841 236
60 3300045976 Ga0466967_0180976 Ga0466967_0180976_18_731 236
61 3300048904 Ga0496101_0017537 Ga0496101_0017537_4078_4803 236
62 3300048905 Ga0496102_0000350 Ga0496102_0000350_7372_8097 236
63 3300048906 Ga0496103_0000217 Ga0496103_0000217_8365_9090 236
64 3300048907 Ga0496104_0066197 Ga0496104_0066197_172_897 236
65 3300048908 Ga0496105_0047568 Ga0496105_0047568_2465_3190 236
66 3300048911 Ga0496108_0699061 Ga0496108_0699061_85_810 236
67 3300048917 Ga0496114_0373374 Ga0496114_0373374_60_785 236
68 3300048919 Ga0496116_0000468 Ga0496116_0000468_7321_8046 236
69 3300048920 Ga0496117_0000274 Ga0496117_0000274_25889_26614 236
70 3300048921 Ga0496118_0000100 Ga0496118_0000100_10206_10931 236
71 3300048922 Ga0496119_0004453 Ga0496119_0004453_3105_3830 236
72 3300048923 Ga0496120_0005409 Ga0496120_0005409_1274_1999 236
73 3300048924 Ga0496121_0040790 Ga0496121_0040790_3321_4046 236
74 3300048928 Ga0496125_0030554 Ga0496125_0030554_3918_4643 236
75 3300048929 Ga0496126_0000794 Ga0496126_0000794_47691_48416 236
76 3300061719 Ga0466962_0031843 Ga0466962_0031843_705_1418 236
77 iso_pu_bacteria 2816332139 2816504138 236
78 iso_pu_bacteria 8047710418 8047713566 236
79 3300009174 Ga0105241_10108471 Ga0105241_101084712 237
80 3300013296 Ga0157374_10258429 Ga0157374_102584292 237
81 3300044684 Ga0466966_0310739 Ga0466966_0310739_108_824 237
82 3300044694 Ga0466963_0262725 Ga0466963_0262725_307_1023 237
83 3300044901 Ga0466960_0137887 Ga0466960_0137887_350_1078 237
84 3300045976 Ga0466967_0545322 Ga0466967_0545322_129_845 237
85 3300048905 Ga0496102_0001790 Ga0496102_0001790_6416_7132 237
86 3300048906 Ga0496103_0060711 Ga0496103_0060711_252_968 237
87 3300049586 Ga0501070_0317603 Ga0501070_0317603_521_1237 237
88 3300050492 nmdc:mga0yw44_378816_c1 nmdc:mga0yw44_378816_c1_48_776 237
89 3300050510 nmdc:mga06r32_80_c9 nmdc:mga06r32_80_c9_197_934 237
90 iso_pu_bacteria 2523231044 2523387562 237
91 3300005367 Ga0070667_100010876 Ga0070667_1000108763 238
92 3300005435 Ga0070714_100087516 Ga0070714_1000875161 238
93 3300005435 Ga0070714_100217236 Ga0070714_1002172362 238
94 3300005437 Ga0070710_10067089 Ga0070710_100670892 238
95 3300005539 Ga0068853_100237921 Ga0068853_1002379213 238
96 3300005545 Ga0070695_100423670 Ga0070695_1004236702 238
97 3300005563 Ga0068855_100014121 Ga0068855_1000141215 238
98 3300005563 Ga0068855_100105577 Ga0068855_1001055773 238
99 3300005563 Ga0068855_100155772 Ga0068855_1001557724 238
100 3300005618 Ga0068864_100415662 Ga0068864_1004156622 238
101 3300005841 Ga0068863_100885554 Ga0068863_1008855542 238
102 3300006163 Ga0070715_10132303 Ga0070715_101323032 238
103 3300006175 Ga0070712_100168027 Ga0070712_1001680273 238
104 3300009098 Ga0105245_10402327 Ga0105245_104023272 238
105 3300009147 Ga0114129_10487164 Ga0114129_104871642 238
106 3300009174 Ga0105241_10038232 Ga0105241_100382324 238
107 3300013296 Ga0157374_10076077 Ga0157374_100760774 238
108 3300013308 Ga0157375_10360809 Ga0157375_103608093 238
109 3300014325 Ga0163163_10394768 Ga0163163_103947682 238
110 3300014968 Ga0157379_10044210 Ga0157379_100442105 238
111 3300014969 Ga0157376_10087435 Ga0157376_100874352 238
112 3300020082 Ga0206353_10257727 Ga0206353_102577272 238
113 3300025905 Ga0207685_10050621 Ga0207685_100506212 238
114 3300025911 Ga0207654_10130130 Ga0207654_101301302 238
115 3300025916 Ga0207663_10041147 Ga0207663_100411473 238
116 3300025929 Ga0207664_10031206 Ga0207664_100312064 238
117 3300025949 Ga0207667_10055483 Ga0207667_100554834 238
118 3300025949 Ga0207667_10142719 Ga0207667_101427193 238
119 3300025986 Ga0207658_10005327 Ga0207658_100053275 238
120 3300026023 Ga0207677_10059987 Ga0207677_100599873 238
121 3300026035 Ga0207703_10425432 Ga0207703_104254322 238
122 3300026088 Ga0207641_10553467 Ga0207641_105534672 238
123 3300035111 Ga0373923_0047308 Ga0373923_0047308_152_877 238
124 3300035118 Ga0373954_0081307 Ga0373954_0081307_531_1262 238
125 3300035171 Ga0373946_0024549 Ga0373946_0024549_1475_2200 238
126 3300035410 Ga0373924_0107290 Ga0373924_0107290_378_1103 238
127 3300035692 Ga0373935_0113478 Ga0373935_0113478_248_973 238
128 3300035724 Ga0373933_0090094 Ga0373933_0090094_402_1127 238
129 3300035725 Ga0373947_0077247 Ga0373947_0077247_170_895 238
130 3300037853 Ga0436364_0435806 Ga0436364_0435806_2962_3693 238
131 3300044684 Ga0466966_0129419 Ga0466966_0129419_323_1042 238
132 3300044693 Ga0466961_0022970 Ga0466961_0022970_1643_2383 238
133 3300044693 Ga0466961_0032293 Ga0466961_0032293_1991_2710 238
134 3300044693 Ga0466961_0033450 Ga0466961_0033450_801_1520 238
135 3300044706 Ga0466964_0292101 Ga0466964_0292101_47_766 238
136 3300045049 Ga0466959_0044312 Ga0466959_0044312_2090_2809 238
137 3300045976 Ga0466967_0024879 Ga0466967_0024879_875_1594 238
138 3300045976 Ga0466967_0989605 Ga0466967_0989605_65_787 238
139 3300046454 Ga0495592_0026981 Ga0495592_0026981_123_848 238
140 3300046455 Ga0495603_0383506 Ga0495603_0383506_25_750 238
141 3300046459 Ga0495629_0073986 Ga0495629_0073986_484_1209 238
142 3300046462 Ga0495651_0032137 Ga0495651_0032137_2744_3469 238
143 3300046463 Ga0495653_0109244 Ga0495653_0109244_1075_1800 238
144 3300046471 Ga0495650_0028197 Ga0495650_0028197_961_1716 238
145 3300046511 Ga0495608_0063468 Ga0495608_0063468_1313_2038 238
146 3300046514 Ga0495618_0018898 Ga0495618_0018898_2606_3331 238
147 3300046516 Ga0495628_0043331 Ga0495628_0043331_1855_2580 238
148 3300046517 Ga0495630_0109195 Ga0495630_0109195_532_1257 238
149 3300046529 Ga0495652_0031573 Ga0495652_0031573_3009_3734 238
150 3300046536 Ga0495587_0013878 Ga0495587_0013878_2838_3563 238
151 3300046543 Ga0495645_0039139 Ga0495645_0039139_1075_1800 238
152 3300046559 Ga0495667_0080633 Ga0495667_0080633_1258_1983 238
153 3300046663 Ga0495635_0170609 Ga0495635_0170609_129_854 238
154 3300046678 Ga0495599_0026887 Ga0495599_0026887_1066_1791 238
155 3300046680 Ga0495646_0011151 Ga0495646_0011151_4569_5294 238
156 3300046683 Ga0495658_0009347 Ga0495658_0009347_1047_1772 238
157 3300047315 Ga0495581_0215401 Ga0495581_0215401_61_786 238
158 3300047317 Ga0495604_0014318 Ga0495604_0014318_2800_3525 238
159 3300047319 Ga0495674_0099293 Ga0495674_0099293_532_1257 238
160 3300047322 Ga0495680_0162360 Ga0495680_0162360_764_1489 238
161 3300047444 Ga0495675_0023989 Ga0495675_0023989_298_1023 238
162 3300047471 Ga0495684_0079380 Ga0495684_0079380_1637_2362 238
163 3300048088 Ga0495602_0040638 Ga0495602_0040638_2801_3526 238
164 3300048905 Ga0496102_0434821 Ga0496102_0434821_132_857 238
165 3300048907 Ga0496104_0082215 Ga0496104_0082215_1421_2146 238
166 3300048908 Ga0496105_0008133 Ga0496105_0008133_2361_3086 238
167 3300048911 Ga0496108_0022780 Ga0496108_0022780_3735_4460 238
168 3300048913 Ga0496110_0057883 Ga0496110_0057883_538_1263 238
169 3300048914 Ga0496111_0186420 Ga0496111_0186420_317_1042 238
170 3300048916 Ga0496113_0056108 Ga0496113_0056108_622_1347 238
171 3300050507 nmdc:mga05p37_497991_c1 nmdc:mga05p37_497991_c1_551_1270 238
172 3300053077 Ga0495601_0028210 Ga0495601_0028210_982_1707 238
173 3300053084 Ga0495595_0026070 Ga0495595_0026070_1727_2452 238
174 3300053085 Ga0495619_0022384 Ga0495619_0022384_1081_1806 238
175 iso_pu_bacteria 2902792274 2902795884 238
176 3300005329 Ga0070683_100111560 Ga0070683_1001115603 239
177 3300005329 Ga0070683_100157186 Ga0070683_1001571862 239
178 3300005336 Ga0070680_100003180 Ga0070680_1000031809 239
179 3300005337 Ga0070682_100317881 Ga0070682_1003178812 239
180 3300005355 Ga0070671_100164961 Ga0070671_1001649612 239
181 3300005435 Ga0070714_100106572 Ga0070714_1001065723 239
182 3300005435 Ga0070714_100141760 Ga0070714_1001417603 239
183 3300005435 Ga0070714_100218003 Ga0070714_1002180032 239
184 3300005436 Ga0070713_100205830 Ga0070713_1002058302 239
185 3300005436 Ga0070713_100261214 Ga0070713_1002612142 239
186 3300005437 Ga0070710_10104449 Ga0070710_101044492 239
187 3300005440 Ga0070705_100241917 Ga0070705_1002419171 239
188 3300005458 Ga0070681_10000004 Ga0070681_10000004114 239
189 3300005467 Ga0070706_100011378 Ga0070706_1000113784 239
190 3300005468 Ga0070707_100001697 Ga0070707_10000169712 239
191 3300005471 Ga0070698_100003640 Ga0070698_1000036408 239
192 3300005530 Ga0070679_100000012 Ga0070679_10000001284 239
193 3300005530 Ga0070679_100039191 Ga0070679_1000391912 239
194 3300005530 Ga0070679_100092819 Ga0070679_1000928191 239
195 3300005535 Ga0070684_100158119 Ga0070684_1001581193 239
196 3300005536 Ga0070697_100525930 Ga0070697_1005259301 239
197 3300005545 Ga0070695_100191152 Ga0070695_1001911522 239
198 3300005546 Ga0070696_100168722 Ga0070696_1001687221 239
199 3300005549 Ga0070704_100510128 Ga0070704_1005101281 239
200 3300005563 Ga0068855_100377826 Ga0068855_1003778262 239
201 3300005614 Ga0068856_100049387 Ga0068856_1000493873 239
202 3300006028 Ga0070717_10313589 Ga0070717_103135892 239
203 3300006028 Ga0070717_10349210 Ga0070717_103492102 239
204 3300006028 Ga0070717_10721872 Ga0070717_107218722 239
205 3300006048 Ga0075363_100176965 Ga0075363_1001769652 239
206 3300006173 Ga0070716_100044122 Ga0070716_1000441224 239
207 3300006175 Ga0070712_100153461 Ga0070712_1001534612 239
208 3300006175 Ga0070712_100242808 Ga0070712_1002428082 239
209 3300006178 Ga0075367_10112500 Ga0075367_101125002 239
210 3300006186 Ga0075369_10032193 Ga0075369_100321934 239
211 3300006847 Ga0075431_100042289 Ga0075431_1000422895 239
212 3300006852 Ga0075433_10180848 Ga0075433_101808483 239
213 3300006914 Ga0075436_100062217 Ga0075436_1000622173 239
214 3300007076 Ga0075435_100169387 Ga0075435_1001693873 239
215 3300007076 Ga0075435_100568410 Ga0075435_1005684102 239
216 3300009147 Ga0114129_10138907 Ga0114129_101389072 239
217 3300009148 Ga0105243_10404312 Ga0105243_104043122 239
218 3300009177 Ga0105248_11104160 Ga0105248_111041601 239
219 3300009545 Ga0105237_10745612 Ga0105237_107456121 239
220 3300009553 Ga0105249_10667460 Ga0105249_106674602 239
221 3300020082 Ga0206353_11044474 Ga0206353_110444742 239
222 3300025898 Ga0207692_10008827 Ga0207692_100088275 239
223 3300025898 Ga0207692_10060809 Ga0207692_100608093 239
224 3300025906 Ga0207699_10042181 Ga0207699_100421813 239
225 3300025910 Ga0207684_10002393 Ga0207684_1000239311 239
226 3300025912 Ga0207707_10088992 Ga0207707_100889923 239
227 3300025915 Ga0207693_10019661 Ga0207693_100196612 239
228 3300025915 Ga0207693_10258236 Ga0207693_102582362 239
229 3300025916 Ga0207663_10000822 Ga0207663_100008225 239
230 3300025921 Ga0207652_10039621 Ga0207652_100396212 239
231 3300025922 Ga0207646_10000470 Ga0207646_1000047011 239
232 3300025928 Ga0207700_10037670 Ga0207700_100376705 239
233 3300025928 Ga0207700_10224923 Ga0207700_102249232 239
234 3300025928 Ga0207700_10252753 Ga0207700_102527532 239
235 3300025929 Ga0207664_10043106 Ga0207664_100431062 239
236 3300025929 Ga0207664_10047380 Ga0207664_100473801 239
237 3300025929 Ga0207664_10092428 Ga0207664_100924282 239
238 3300025929 Ga0207664_10272111 Ga0207664_102721112 239
239 3300025931 Ga0207644_10123777 Ga0207644_101237772 239
240 3300025939 Ga0207665_10007304 Ga0207665_100073046 239
241 3300025939 Ga0207665_10031236 Ga0207665_100312365 239
242 3300025939 Ga0207665_10377618 Ga0207665_103776182 239
243 3300025945 Ga0207679_10552994 Ga0207679_105529942 239
244 3300025949 Ga0207667_10287791 Ga0207667_102877912 239
245 3300026088 Ga0207641_10402952 Ga0207641_104029522 239
246 3300031251 Ga0265327_10000041 Ga0265327_10000041181 239
247 3300034817 Ga0373948_0006156 Ga0373948_0006156_33_755 239
248 3300034819 Ga0373958_0011442 Ga0373958_0011442_413_1135 239
249 3300035084 Ga0373928_0032819 Ga0373928_0032819_376_1098 239
250 3300035086 Ga0373934_0000159 Ga0373934_0000159_3180_3902 239
251 3300035086 Ga0373934_0003379 Ga0373934_0003379_1025_1747 239
252 3300035086 Ga0373934_0024268 Ga0373934_0024268_1536_2258 239
253 3300035088 Ga0373940_0010591 Ga0373940_0010591_840_1562 239
254 3300035089 Ga0373944_0009529 Ga0373944_0009529_101_823 239
255 3300035092 Ga0373952_0001767 Ga0373952_0001767_2767_3489 239
256 3300035111 Ga0373923_0006383 Ga0373923_0006383_1730_2452 239
257 3300035111 Ga0373923_0033337 Ga0373923_0033337_413_1135 239
258 3300035113 Ga0373936_0008358 Ga0373936_0008358_2082_2804 239
259 3300035116 Ga0373945_0010973 Ga0373945_0010973_1929_2651 239
260 3300035116 Ga0373945_0033909 Ga0373945_0033909_1073_1795 239
261 3300035117 Ga0373953_0000270 Ga0373953_0000270_10925_11647 239
262 3300035117 Ga0373953_0018848 Ga0373953_0018848_957_1679 239
263 3300035118 Ga0373954_0000963 Ga0373954_0000963_6452_7174 239
264 3300035118 Ga0373954_0034461 Ga0373954_0034461_845_1567 239
265 3300035118 Ga0373954_0062474 Ga0373954_0062474_238_960 239
266 3300035119 Ga0373956_0000328 Ga0373956_0000328_16936_17658 239
267 3300035119 Ga0373956_0008455 Ga0373956_0008455_3414_4136 239
268 3300035120 Ga0373957_0000203 Ga0373957_0000203_2096_2818 239
269 3300035120 Ga0373957_0023821 Ga0373957_0023821_1436_2158 239
270 3300035121 Ga0373960_0036262 Ga0373960_0036262_535_1257 239
271 3300035171 Ga0373946_0015848 Ga0373946_0015848_1082_1804 239
272 3300035172 Ga0373955_0000024 Ga0373955_0000024_15395_16117 239
273 3300035172 Ga0373955_0032348 Ga0373955_0032348_1864_2586 239
274 3300035241 Ga0373961_0072725 Ga0373961_0072725_260_982 239
275 3300035410 Ga0373924_0000562 Ga0373924_0000562_9205_9927 239
276 3300035410 Ga0373924_0041093 Ga0373924_0041093_113_835 239
277 3300035410 Ga0373924_0049711 Ga0373924_0049711_979_1701 239
278 3300035692 Ga0373935_0011440 Ga0373935_0011440_801_1523 239
279 3300035724 Ga0373933_0000153 Ga0373933_0000153_27163_27885 239
280 3300035724 Ga0373933_0006584 Ga0373933_0006584_926_1648 239
281 3300035724 Ga0373933_0093361 Ga0373933_0093361_338_1060 239
282 3300035725 Ga0373947_0050366 Ga0373947_0050366_800_1522 239
283 3300036401 Ga0373937_0000333 Ga0373937_0000333_17_739 239
284 3300036401 Ga0373937_0004325 Ga0373937_0004325_2449_3171 239
285 3300036401 Ga0373937_0448464 Ga0373937_0448464_430_1152 239
286 3300037068 Ga0373925_0010690 Ga0373925_0010690_2040_2762 239
287 3300037068 Ga0373925_0237583 Ga0373925_0237583_497_1219 239
288 3300037068 Ga0373925_0765766 Ga0373925_0765766_13_735 239
289 3300039450 Ga0436363_0242477 Ga0436363_0242477_26_748 239
290 3300041443 Ga0451789_0133254 Ga0451789_0133254_510_1271 239
291 3300042007 Ga0439449_0017536 Ga0439449_0017536_315_1049 239
292 3300042461 Ga0439460_0026137 Ga0439460_0026137_91_813 239
293 3300044683 Ga0466965_0227999 Ga0466965_0227999_208_930 239
294 3300045976 Ga0466967_0189133 Ga0466967_0189133_1106_1840 239
295 3300046454 Ga0495592_0001610 Ga0495592_0001610_2672_3394 239
296 3300046454 Ga0495592_0181237 Ga0495592_0181237_611_1333 239
297 3300046459 Ga0495629_0001760 Ga0495629_0001760_3890_4612 239
298 3300046459 Ga0495629_0157547 Ga0495629_0157547_429_1151 239
299 3300046461 Ga0495641_0024636 Ga0495641_0024636_2222_2944 239
300 3300046461 Ga0495641_0070931 Ga0495641_0070931_162_884 239
301 3300046462 Ga0495651_0001169 Ga0495651_0001169_2624_3346 239
302 3300046462 Ga0495651_0095803 Ga0495651_0095803_441_1163 239
303 3300046463 Ga0495653_0002881 Ga0495653_0002881_7729_8451 239
304 3300046463 Ga0495653_0063855 Ga0495653_0063855_35_757 239
305 3300046463 Ga0495653_0144694 Ga0495653_0144694_18_740 239
306 3300046473 Ga0495582_0004201 Ga0495582_0004201_5745_6467 239
307 3300046475 Ga0495639_0003255 Ga0495639_0003255_3932_4654 239
308 3300046475 Ga0495639_0044076 Ga0495639_0044076_1080_1802 239
309 3300046476 Ga0495662_0058634 Ga0495662_0058634_461_1183 239
310 3300046477 Ga0495664_0029292 Ga0495664_0029292_1264_1986 239
311 3300046511 Ga0495608_0000101 Ga0495608_0000101_44028_44750 239
312 3300046511 Ga0495608_0094496 Ga0495608_0094496_103_825 239
313 3300046511 Ga0495608_0101153 Ga0495608_0101153_337_1059 239
314 3300046511 Ga0495608_0274347 Ga0495608_0274347_165_887 239
315 3300046514 Ga0495618_0018008 Ga0495618_0018008_2362_3084 239
316 3300046514 Ga0495618_0057965 Ga0495618_0057965_659_1381 239
317 3300046516 Ga0495628_0000327 Ga0495628_0000327_25428_26150 239
318 3300046516 Ga0495628_0018571 Ga0495628_0018571_1522_2244 239
319 3300046517 Ga0495630_0014076 Ga0495630_0014076_4551_5273 239
320 3300046517 Ga0495630_0049171 Ga0495630_0049171_1730_2452 239
321 3300046529 Ga0495652_0000775 Ga0495652_0000775_23432_24154 239
322 3300046529 Ga0495652_0014267 Ga0495652_0014267_1992_2714 239
323 3300046529 Ga0495652_0163175 Ga0495652_0163175_347_1069 239
324 3300046531 Ga0495665_0003548 Ga0495665_0003548_6652_7374 239
325 3300046533 Ga0495640_0045893 Ga0495640_0045893_2147_2869 239
326 3300046536 Ga0495587_0000861 Ga0495587_0000861_2537_3259 239
327 3300046536 Ga0495587_0008620 Ga0495587_0008620_4778_5500 239
328 3300046536 Ga0495587_0063562 Ga0495587_0063562_1402_2124 239
329 3300046543 Ga0495645_0023381 Ga0495645_0023381_1671_2393 239
330 3300046543 Ga0495645_0075048 Ga0495645_0075048_535_1257 239
331 3300046543 Ga0495645_0422548 Ga0495645_0422548_89_811 239
332 3300046559 Ga0495667_0000742 Ga0495667_0000742_3962_4684 239
333 3300046559 Ga0495667_0055495 Ga0495667_0055495_1774_2496 239
334 3300046559 Ga0495667_0151773 Ga0495667_0151773_659_1381 239
335 3300046616 Ga0495668_0011500 Ga0495668_0011500_1444_2178 239
336 3300046663 Ga0495635_0041672 Ga0495635_0041672_2245_2967 239
337 3300046675 Ga0495657_0000156 Ga0495657_0000156_16937_17659 239
338 3300046675 Ga0495657_0037723 Ga0495657_0037723_2573_3295 239
339 3300046675 Ga0495657_0237960 Ga0495657_0237960_31_753 239
340 3300046678 Ga0495599_0000097 Ga0495599_0000097_43921_44643 239
341 3300046678 Ga0495599_0076248 Ga0495599_0076248_1025_1747 239
342 3300046678 Ga0495599_0080383 Ga0495599_0080383_637_1359 239
343 3300046679 Ga0495623_0000471 Ga0495623_0000471_9554_10276 239
344 3300046679 Ga0495623_0028141 Ga0495623_0028141_2316_3038 239
345 3300046679 Ga0495623_0040229 Ga0495623_0040229_491_1213 239
346 3300046680 Ga0495646_0010359 Ga0495646_0010359_801_1523 239
347 3300046680 Ga0495646_0035868 Ga0495646_0035868_2249_2971 239
348 3300046681 Ga0495647_0035103 Ga0495647_0035103_1012_1734 239
349 3300046683 Ga0495658_0061558 Ga0495658_0061558_1395_2117 239
350 3300046683 Ga0495658_0064147 Ga0495658_0064147_555_1277 239
351 3300046689 Ga0495613_0031742 Ga0495613_0031742_1472_2194 239
352 3300046689 Ga0495613_0050844 Ga0495613_0050844_557_1279 239
353 3300046690 Ga0495624_0042138 Ga0495624_0042138_1210_1932 239
354 3300046690 Ga0495624_0291403 Ga0495624_0291403_42_764 239
355 3300046809 Ga0495600_0003272 Ga0495600_0003272_2680_3402 239
356 3300046809 Ga0495600_0025545 Ga0495600_0025545_2230_2952 239
357 3300046809 Ga0495600_0122208 Ga0495600_0122208_940_1662 239
358 3300047315 Ga0495581_0026136 Ga0495581_0026136_776_1498 239
359 3300047317 Ga0495604_0000196 Ga0495604_0000196_11238_11960 239
360 3300047317 Ga0495604_0060756 Ga0495604_0060756_347_1069 239
361 3300047317 Ga0495604_0074011 Ga0495604_0074011_1744_2466 239
362 3300047319 Ga0495674_0237852 Ga0495674_0237852_745_1467 239
363 3300047321 Ga0495676_0154971 Ga0495676_0154971_250_972 239
364 3300047322 Ga0495680_0000226 Ga0495680_0000226_16912_17634 239
365 3300047322 Ga0495680_0007648 Ga0495680_0007648_2020_2742 239
366 3300047322 Ga0495680_0045310 Ga0495680_0045310_1571_2293 239
367 3300047444 Ga0495675_0001884 Ga0495675_0001884_10506_11228 239
368 3300047444 Ga0495675_0077676 Ga0495675_0077676_822_1544 239
369 3300047444 Ga0495675_0118966 Ga0495675_0118966_800_1522 239
370 3300047471 Ga0495684_0086336 Ga0495684_0086336_1108_1830 239
371 3300047673 Ga0495593_0006917 Ga0495593_0006917_3206_3928 239
372 3300047673 Ga0495593_0019418 Ga0495593_0019418_2425_3180 239
373 3300047673 Ga0495593_0033640 Ga0495593_0033640_1226_1948 239
374 3300048088 Ga0495602_0000172 Ga0495602_0000172_16781_17503 239
375 3300048089 Ga0495614_0019723 Ga0495614_0019723_1372_2094 239
376 3300048905 Ga0496102_0047115 Ga0496102_0047115_2579_3301 239
377 3300048911 Ga0496108_0042167 Ga0496108_0042167_82_816 239
378 3300048911 Ga0496108_0415174 Ga0496108_0415174_26_748 239
379 3300048913 Ga0496110_0030124 Ga0496110_0030124_2869_3591 239
380 3300048914 Ga0496111_0617040 Ga0496111_0617040_20_742 239
381 3300048918 Ga0496115_0019992 Ga0496115_0019992_2919_3641 239
382 3300048928 Ga0496125_0202760 Ga0496125_0202760_247_981 239
383 3300050507 nmdc:mga05p37_43016_c1 nmdc:mga05p37_43016_c1_1844_2566 239
384 3300050510 nmdc:mga06r32_21177_c1 nmdc:mga06r32_21177_c1_2724_3446 239
385 3300050513 nmdc:mga0rr50_274872_c1 nmdc:mga0rr50_274872_c1_255_977 239
386 3300050513 nmdc:mga0rr50_411318_c1 nmdc:mga0rr50_411318_c1_136_858 239
387 3300050514 nmdc:mga08x19_153305_c1 nmdc:mga08x19_153305_c1_539_1261 239
388 3300050514 nmdc:mga08x19_52984_c1 nmdc:mga08x19_52984_c1_1364_2086 239
389 3300050515 nmdc:mga0a205_326000_c1 nmdc:mga0a205_326000_c1_19_741 239
390 3300053077 Ga0495601_0031299 Ga0495601_0031299_856_1578 239
391 3300053077 Ga0495601_0306628 Ga0495601_0306628_236_958 239
392 3300053078 Ga0495612_0006591 Ga0495612_0006591_2469_3191 239
393 3300053084 Ga0495595_0010883 Ga0495595_0010883_548_1270 239
394 3300053084 Ga0495595_0026966 Ga0495595_0026966_1287_2009 239
395 3300053085 Ga0495619_0033600 Ga0495619_0033600_2533_3255 239
396 3300053085 Ga0495619_0116373 Ga0495619_0116373_831_1553 239
397 iso_pu_bacteria 2643221690 2644506456 239
398 iso_pu_bacteria 2643221694 2644526625 239
399 3300005327 Ga0070658_10113399 Ga0070658_101133994 240
400 3300005334 Ga0068869_100402203 Ga0068869_1004022031 240
401 3300005337 Ga0070682_100037193 Ga0070682_1000371933 240
402 3300005339 Ga0070660_100232672 Ga0070660_1002326722 240
403 3300005343 Ga0070687_100129563 Ga0070687_1001295632 240
404 3300005345 Ga0070692_10021303 Ga0070692_100213032 240
405 3300005347 Ga0070668_100088774 Ga0070668_1000887742 240
406 3300005364 Ga0070673_100224133 Ga0070673_1002241332 240
407 3300005365 Ga0070688_100231013 Ga0070688_1002310132 240
408 3300005366 Ga0070659_100084646 Ga0070659_1000846462 240
409 3300005366 Ga0070659_100096133 Ga0070659_1000961332 240
410 3300005366 Ga0070659_100422496 Ga0070659_1004224962 240
411 3300005435 Ga0070714_100000077 Ga0070714_10000007768 240
412 3300005455 Ga0070663_100056157 Ga0070663_1000561572 240
413 3300005457 Ga0070662_100475493 Ga0070662_1004754932 240
414 3300005459 Ga0068867_100388771 Ga0068867_1003887712 240
415 3300005535 Ga0070684_100413532 Ga0070684_1004135322 240
416 3300005535 Ga0070684_100666698 Ga0070684_1006666981 240
417 3300005544 Ga0070686_100097118 Ga0070686_1000971182 240
418 3300005548 Ga0070665_100531390 Ga0070665_1005313902 240
419 3300005563 Ga0068855_100605564 Ga0068855_1006055642 240
420 3300005564 Ga0070664_100240408 Ga0070664_1002404082 240
421 3300005577 Ga0068857_100233476 Ga0068857_1002334762 240
422 3300005578 Ga0068854_100077209 Ga0068854_1000772092 240
423 3300005614 Ga0068856_100873292 Ga0068856_1008732921 240
424 3300005615 Ga0070702_100306046 Ga0070702_1003060461 240
425 3300005618 Ga0068864_100362584 Ga0068864_1003625842 240
426 3300005842 Ga0068858_100053472 Ga0068858_1000534725 240
427 3300005844 Ga0068862_100049143 Ga0068862_1000491433 240
428 3300005983 Ga0081540_1001125 Ga0081540_100112513 240
429 3300006028 Ga0070717_10003162 Ga0070717_1000316210 240
430 3300006028 Ga0070717_10320109 Ga0070717_103201092 240
431 3300006038 Ga0075365_10083434 Ga0075365_100834343 240
432 3300006038 Ga0075365_10143586 Ga0075365_101435862 240
433 3300006051 Ga0075364_10001017 Ga0075364_100010174 240
434 3300006051 Ga0075364_10005942 Ga0075364_100059426 240
435 3300006051 Ga0075364_10061979 Ga0075364_100619792 240
436 3300006177 Ga0075362_10056011 Ga0075362_100560111 240
437 3300006846 Ga0075430_100427824 Ga0075430_1004278241 240
438 3300006847 Ga0075431_100194880 Ga0075431_1001948803 240
439 3300006871 Ga0075434_100141090 Ga0075434_1001410902 240
440 3300009148 Ga0105243_10766104 Ga0105243_107661042 240
441 3300009177 Ga0105248_10584416 Ga0105248_105844162 240
442 3300009553 Ga0105249_10496754 Ga0105249_104967542 240
443 3300009988 Ga0105035_101024 Ga0105035_1010242 240
444 3300009993 Ga0105028_106357 Ga0105028_1063571 240
445 3300017792 Ga0163161_10348779 Ga0163161_103487792 240
446 3300020082 Ga0206353_10234997 Ga0206353_102349972 240
447 3300021384 Ga0213876_10021732 Ga0213876_100217324 240
448 3300025900 Ga0207710_10220525 Ga0207710_102205251 240
449 3300025901 Ga0207688_10050211 Ga0207688_100502112 240
450 3300025901 Ga0207688_10072980 Ga0207688_100729802 240
451 3300025903 Ga0207680_10014941 Ga0207680_100149415 240
452 3300025907 Ga0207645_10068872 Ga0207645_100688721 240
453 3300025909 Ga0207705_10009092 Ga0207705_100090923 240
454 3300025911 Ga0207654_10067644 Ga0207654_100676442 240
455 3300025914 Ga0207671_10194852 Ga0207671_101948522 240
456 3300025915 Ga0207693_10234233 Ga0207693_102342332 240
457 3300025916 Ga0207663_10441736 Ga0207663_104417362 240
458 3300025917 Ga0207660_10656430 Ga0207660_106564301 240
459 3300025918 Ga0207662_10067009 Ga0207662_100670092 240
460 3300025919 Ga0207657_10037523 Ga0207657_100375234 240
461 3300025920 Ga0207649_10136904 Ga0207649_101369042 240
462 3300025928 Ga0207700_10026702 Ga0207700_100267021 240
463 3300025932 Ga0207690_10213819 Ga0207690_102138192 240
464 3300025932 Ga0207690_10557269 Ga0207690_105572691 240
465 3300025933 Ga0207706_10078234 Ga0207706_100782344 240
466 3300025935 Ga0207709_10045923 Ga0207709_100459234 240
467 3300025937 Ga0207669_10398173 Ga0207669_103981732 240
468 3300025942 Ga0207689_10043095 Ga0207689_100430954 240
469 3300025942 Ga0207689_10285737 Ga0207689_102857372 240
470 3300025960 Ga0207651_10467211 Ga0207651_104672111 240
471 3300025981 Ga0207640_10164421 Ga0207640_101644213 240
472 3300025986 Ga0207658_10076758 Ga0207658_100767582 240
473 3300026023 Ga0207677_10357513 Ga0207677_103575132 240
474 3300026035 Ga0207703_10365663 Ga0207703_103656632 240
475 3300026075 Ga0207708_10031425 Ga0207708_100314254 240
476 3300026089 Ga0207648_10274304 Ga0207648_102743042 240
477 3300026116 Ga0207674_10137274 Ga0207674_101372742 240
478 3300026118 Ga0207675_100047439 Ga0207675_1000474394 240
479 3300026121 Ga0207683_10058584 Ga0207683_100585843 240
480 3300026142 Ga0207698_10140684 Ga0207698_101406843 240
481 3300028380 Ga0268265_10061879 Ga0268265_100618792 240
482 3300028381 Ga0268264_10080238 Ga0268264_100802383 240
483 3300028381 Ga0268264_10917072 Ga0268264_109170721 240
484 3300028786 Ga0307517_10129982 Ga0307517_101299822 240
485 3300028800 Ga0265338_10005536 Ga0265338_100055367 240
486 3300031995 Ga0307409_100799996 Ga0307409_1007999962 240
487 3300032002 Ga0307416_100193287 Ga0307416_1001932873 240
488 3300041494 Ga0451837_1733010 Ga0451837_1733010_287_1081 240
489 3300044694 Ga0466963_0090171 Ga0466963_0090171_1171_1914 240
490 3300044719 Ga0466971_0091298 Ga0466971_0091298_109_852 240
491 3300044765 Ga0466970_0028223 Ga0466970_0028223_2165_2896 240
492 3300044901 Ga0466960_0031091 Ga0466960_0031091_758_1486 240
493 3300044901 Ga0466960_0386106 Ga0466960_0386106_51_776 240
494 3300045049 Ga0466959_0221928 Ga0466959_0221928_410_1141 240
495 3300045976 Ga0466967_0000806 Ga0466967_0000806_12310_13047 240
496 3300045976 Ga0466967_0055658 Ga0466967_0055658_258_983 240
497 3300045976 Ga0466967_0059069 Ga0466967_0059069_1656_2423 240
498 3300045976 Ga0466967_0067289 Ga0466967_0067289_174_899 240
499 3300045976 Ga0466967_0139627 Ga0466967_0139627_969_1694 240
500 3300045976 Ga0466967_0186688 Ga0466967_0186688_428_1195 240
501 3300045976 Ga0466967_0330419 Ga0466967_0330419_634_1401 240
502 3300048914 Ga0496111_0238639 Ga0496111_0238639_90_872 240
503 3300048917 Ga0496114_0017465 Ga0496114_0017465_4544_5275 240
504 3300049571 Ga0501034_0306069 Ga0501034_0306069_518_1285 240
505 3300049579 Ga0501043_0549752 Ga0501043_0549752_44_811 240
506 3300049581 Ga0501047_0340621 Ga0501047_0340621_411_1139 240
507 3300049822 Ga0501035_0066662 Ga0501035_0066662_339_1067 240
508 3300050489 nmdc:mga03683_94012_c1 nmdc:mga03683_94012_c1_84_872 240
509 3300050490 nmdc:mga03n38_57112_c1 nmdc:mga03n38_57112_c1_827_1615 240
510 3300050491 nmdc:mga00v17_124511_c1 nmdc:mga00v17_124511_c1_562_1383 240
511 3300050491 nmdc:mga00v17_412792_c1 nmdc:mga00v17_412792_c1_88_858 240
512 3300050492 nmdc:mga0yw44_14710_c1 nmdc:mga0yw44_14710_c1_2141_2962 240
513 3300050492 nmdc:mga0yw44_45837_c1 nmdc:mga0yw44_45837_c1_1397_2185 240
514 3300050509 nmdc:mga0qj67_204695_c1 nmdc:mga0qj67_204695_c1_50_817 240
515 3300050509 nmdc:mga0qj67_46644_c1 nmdc:mga0qj67_46644_c1_2251_3039 240
516 3300050512 nmdc:mga0n895_483060_c1 nmdc:mga0n895_483060_c1_336_1079 240
517 3300050513 nmdc:mga0rr50_240880_c1 nmdc:mga0rr50_240880_c1_488_1255 240
518 iso_pu_bacteria 2905926851 2905927668 240
519 iso_pu_bacteria 2905926851 2905929225 240
520 3300009098 Ga0105245_10360547 Ga0105245_103605472 241
521 3300021384 Ga0213876_10001682 Ga0213876_1000168211 241
522 3300039437 Ga0436365_0327584 Ga0436365_0327584_14576_15304 241
523 3300049571 Ga0501034_0188951 Ga0501034_0188951_1232_1960 241
524 3300049585 Ga0501069_0024117 Ga0501069_0024117_1788_2516 241
525 3300049586 Ga0501070_0010162 Ga0501070_0010162_6428_7156 241
526 3300049586 Ga0501070_0015602 Ga0501070_0015602_2195_2923 241
527 3300049586 Ga0501070_0018008 Ga0501070_0018008_2866_3594 241
528 3300049742 Ga0501080_0000253 Ga0501080_0000253_38922_39650 241
529 3300049742 Ga0501080_0007864 Ga0501080_0007864_6908_7636 241
530 3300049742 Ga0501080_0549678 Ga0501080_0549678_179_907 241
531 3300050491 nmdc:mga00v17_209055_c1 nmdc:mga00v17_209055_c1_371_1159 241
532 iso_pu_bacteria 2906799679 2906801410 241
533 iso_pu_bacteria 2928121344 2928124628 241
534 3300005842 Ga0068858_100972728 Ga0068858_1009727281 242
535 3300005937 Ga0081455_10027607 Ga0081455_100276072 242
536 3300006846 Ga0075430_100058082 Ga0075430_1000580823 242
537 3300009545 Ga0105237_10007223 Ga0105237_100072237 242
538 3300010375 Ga0105239_10007509 Ga0105239_1000750912 242
539 3300014325 Ga0163163_10033959 Ga0163163_100339596 242
540 3300035398 Ga0316574_0161863 Ga0316574_0161863_537_1295 242
541 3300044658 Ga0466972_0022779 Ga0466972_0022779_1983_2726 242
542 3300044658 Ga0466972_0119950 Ga0466972_0119950_215_952 242
543 3300044765 Ga0466970_0023804 Ga0466970_0023804_2360_3091 242
544 3300048903 Ga0496100_0049946 Ga0496100_0049946_530_1273 242
545 3300048904 Ga0496101_0000046 Ga0496101_0000046_100931_101674 242
546 3300048905 Ga0496102_0000025 Ga0496102_0000025_146507_147250 242
547 3300048906 Ga0496103_0000022 Ga0496103_0000022_146507_147250 242
548 3300048909 Ga0496106_0006732 Ga0496106_0006732_1029_1772 242
549 3300048919 Ga0496116_0000059 Ga0496116_0000059_127242_127985 242
550 3300048920 Ga0496117_0000055 Ga0496117_0000055_146507_147250 242
551 3300048921 Ga0496118_0000058 Ga0496118_0000058_146507_147250 242
552 3300048924 Ga0496121_0000113 Ga0496121_0000113_80128_80871 242
553 3300048929 Ga0496126_0000781 Ga0496126_0000781_15712_16455 242
554 3300049569 Ga0501032_0036550 Ga0501032_0036550_102_833 242
555 3300049581 Ga0501047_0213792 Ga0501047_0213792_19_750 242
556 3300049586 Ga0501070_0001434 Ga0501070_0001434_6608_7339 242
557 3300049823 Ga0501044_0004741 Ga0501044_0004741_3400_4131 242
558 3300050516 nmdc:mga0sz30_14454_c1 nmdc:mga0sz30_14454_c1_352_1095 242
559 3300006178 Ga0075367_10035850 Ga0075367_100358504 243
560 3300009094 Ga0111539_10160560 Ga0111539_101605601 243
561 3300009147 Ga0114129_10449302 Ga0114129_104493021 243
562 3300009174 Ga0105241_10212034 Ga0105241_102120342 243
563 3300013104 Ga0157370_10143901 Ga0157370_101439012 243
564 3300013307 Ga0157372_10425056 Ga0157372_104250562 243
565 3300013308 Ga0157375_10485775 Ga0157375_104857752 243
566 3300014325 Ga0163163_10339634 Ga0163163_103396342 243
567 3300014326 Ga0157380_10329367 Ga0157380_103293671 243
568 3300014745 Ga0157377_10138848 Ga0157377_101388482 243
569 3300014968 Ga0157379_10149295 Ga0157379_101492952 243
570 3300025949 Ga0207667_10105517 Ga0207667_101055172 243
571 3300031241 Ga0265325_10072537 Ga0265325_100725372 243
572 3300031995 Ga0307409_100717345 Ga0307409_1007173452 243
573 3300039437 Ga0436365_1520643 Ga0436365_1520643_2995_3771 243
574 3300044694 Ga0466963_0193221 Ga0466963_0193221_397_1131 243
575 3300044694 Ga0466963_0214221 Ga0466963_0214221_518_1252 243
576 3300045836 Ga0466958_0130123 Ga0466958_0130123_267_1001 243
577 3300045976 Ga0466967_0217859 Ga0466967_0217859_406_1140 243
578 3300046517 Ga0495630_0295465 Ga0495630_0295465_341_1162 243
579 3300048913 Ga0496110_0472304 Ga0496110_0472304_220_996 243
580 3300048915 Ga0496112_0251832 Ga0496112_0251832_752_1528 243
581 3300049568 Ga0501031_0024732 Ga0501031_0024732_757_1575 243
582 3300049576 Ga0501040_0067131 Ga0501040_0067131_1610_2428 243
583 3300049577 Ga0501041_0041482 Ga0501041_0041482_558_1376 243
584 3300049578 Ga0501042_0045499 Ga0501042_0045499_2201_3019 243
585 3300049591 Ga0501075_0046761 Ga0501075_0046761_1799_2617 243
586 3300049593 Ga0501077_0028838 Ga0501077_0028838_2515_3333 243
587 3300049741 Ga0501079_0025655 Ga0501079_0025655_2912_3730 243
588 3300049824 Ga0501045_0159550 Ga0501045_0159550_611_1429 243
589 3300050492 nmdc:mga0yw44_5862_c1 nmdc:mga0yw44_5862_c1_4666_5439 243
590 3300050507 nmdc:mga05p37_151345_c1 nmdc:mga05p37_151345_c1_1207_2001 243
591 3300054114 Ga0501084_0165353 Ga0501084_0165353_214_1032 243
592 iso_pu_bacteria 2857740372 2857743772 243
593 iso_pu_bacteria 2904497146 2904499674 243
594 iso_pu_bacteria 2904776348 2904780330 243
595 iso_pu_bacteria 2910809715 2910812729 243
596 iso_pu_bacteria 2919034639 2919036125 243
597 iso_pu_bacteria 2919059106 2919060842 243
598 iso_pu_bacteria 2919538618 2919538660 243
599 iso_pu_bacteria 2932426870 2932431073 243
600 iso_pu_bacteria 2933418574 2933419154 243
601 iso_pu_bacteria 2939647034 2939647898 243
602 iso_pu_bacteria 2939674588 2939678520 243
603 3300005468 Ga0070707_100066121 Ga0070707_1000661211 244
604 3300009098 Ga0105245_10181051 Ga0105245_101810513 244
605 3300025927 Ga0207687_10207532 Ga0207687_102075322 244
606 3300044684 Ga0466966_0010743 Ga0466966_0010743_1278_2015 244
607 3300045049 Ga0466959_0272469 Ga0466959_0272469_199_936 244
608 iso_pu_bacteria 2690315906 2691513476 244
609 iso_pu_bacteria 2775506735 2775658878 244
610 iso_pu_bacteria 2808606357 2808830726 244
611 iso_pu_bacteria 2808606360 2808851914 244
612 iso_pu_bacteria 2808606366 2808879771 244
613 iso_pu_bacteria 2808606370 2808890660 244
614 iso_pu_bacteria 2808606371 2808895934 244
615 iso_pu_bacteria 2811994871 2812321717 244
616 iso_pu_bacteria 2844849076 2844852278 244
617 iso_pu_bacteria 2870801768 2870802920 244
618 iso_pu_bacteria 2919391150 2919392405 244
619 iso_pu_bacteria 2939598168 2939600039 244
620 iso_pu_bacteria 2945916053 2945919588 244
621 iso_pu_bacteria 2945920336 2945924500 244
622 iso_pu_bacteria 2945941187 2945943767 244
623 iso_pu_bacteria 2945956166 2945958044 244
624 iso_pu_bacteria 2946037020 2946039732 244
625 iso_pu_bacteria 2946059875 2946063313 244
626 iso_pu_bacteria 2953998280 2954000957 244
627 iso_pu_bacteria 2974302888 2974303237 244
628 3300005535 Ga0070684_100066242 Ga0070684_1000662421 245
629 3300013308 Ga0157375_10113904 Ga0157375_101139042 245
630 3300025919 Ga0207657_10204637 Ga0207657_102046373 245
631 3300025944 Ga0207661_10433456 Ga0207661_104334561 245
632 3300028573 Ga0265334_10002543 Ga0265334_100025437 245
633 3300031995 Ga0307409_100293965 Ga0307409_1002939652 245
634 3300048906 Ga0496103_0058952 Ga0496103_0058952_1543_2280 245
635 3300048920 Ga0496117_0163313 Ga0496117_0163313_176_922 245
636 3300048926 Ga0496123_0121321 Ga0496123_0121321_485_1231 245
637 iso_pu_bacteria 8054107350 8054109979 245
638 3300003911 JGI25405J52794_10023857 JGI25405J52794_100238571 246
639 3300006177 Ga0075362_10014484 Ga0075362_100144842 246
640 3300006178 Ga0075367_10150608 Ga0075367_101506081 246
641 3300006844 Ga0075428_100002980 Ga0075428_1000029809 246
642 3300006871 Ga0075434_100286109 Ga0075434_1002861093 246
643 3300013102 Ga0157371_10031861 Ga0157371_100318613 246
644 3300031456 Ga0307513_10006049 Ga0307513_100060495 246
645 3300050489 nmdc:mga03683_19321_c1 nmdc:mga03683_19321_c1_1657_2445 246
646 3300050494 nmdc:mga06z11_255394_c1 nmdc:mga06z11_255394_c1_22_810 246
647 3300050495 nmdc:mga04h51_79575_c1 nmdc:mga04h51_79575_c1_348_1136 246
648 3300005468 Ga0070707_100068898 Ga0070707_1000688983 247
649 3300009036 Ga0105244_10002542 Ga0105244_1000254214 247
650 3300009036 Ga0105244_10138678 Ga0105244_101386781 247
651 3300009148 Ga0105243_10134106 Ga0105243_101341062 247
652 3300011119 Ga0105246_10064212 Ga0105246_100642123 247
653 3300025303 Ga0209051_1005744 Ga0209051_10057442 247
654 3300025315 Ga0207697_10050249 Ga0207697_100502492 247
655 3300025728 Ga0207655_1008786 Ga0207655_10087867 247
656 3300025728 Ga0207655_1069302 Ga0207655_10693022 247
657 3300025922 Ga0207646_10205196 Ga0207646_102051962 247
658 3300031911 Ga0307412_10039879 Ga0307412_100398795 247
659 3300031995 Ga0307409_100958359 Ga0307409_1009583591 247
660 3300037418 Ga0395900_0144442 Ga0395900_0144442_171_914 247
661 3300037466 Ga0395898_0088668 Ga0395898_0088668_1875_2618 247
662 3300038443 Ga0395901_0102240 Ga0395901_0102240_2203_2946 247
663 3300044901 Ga0466960_0001863 Ga0466960_0001863_1307_2056 247
664 3300049569 Ga0501032_0001524 Ga0501032_0001524_11413_12156 247
665 3300049571 Ga0501034_0000015 Ga0501034_0000015_33304_34047 247
666 3300059511 Ga0587091_049331 Ga0587091_049331_99_842 247
667 3300059643 Ga0587072_000734 Ga0587072_000734_2759_3502 247
668 3300059647 Ga0587079_049515 Ga0587079_049515_24_767 247
669 3300000549 LJQas_1000894 LJQas_10008943 248
670 3300000549 LJQas_1004940 LJQas_10049402 248
671 3300000549 LJQas_1016927 LJQas_10169271 248
672 3300002773 JGI25152J39213_1001276 JGI25152J39213_10012764 248
673 3300003187 JGI25151J46595_10018721 JGI25151J46595_100187214 248
674 3300003762 Ga0055542_1009605 Ga0055542_10096052 248
675 3300005288 Ga0065714_10181819 Ga0065714_101818191 248
676 3300005328 Ga0070676_10156071 Ga0070676_101560712 248
677 3300005331 Ga0070670_100320778 Ga0070670_1003207782 248
678 3300005333 Ga0070677_10027580 Ga0070677_100275802 248
679 3300005335 Ga0070666_10025308 Ga0070666_100253085 248
680 3300005347 Ga0070668_100136961 Ga0070668_1001369614 248
681 3300005353 Ga0070669_100032271 Ga0070669_1000322714 248
682 3300005354 Ga0070675_100002626 Ga0070675_10000262614 248
683 3300005356 Ga0070674_100450115 Ga0070674_1004501152 248
684 3300005364 Ga0070673_100029237 Ga0070673_1000292375 248
685 3300005367 Ga0070667_100271885 Ga0070667_1002718852 248
686 3300005543 Ga0070672_100043672 Ga0070672_1000436723 248
687 3300006058 Ga0075432_10000069 Ga0075432_100000695 248
688 3300006058 Ga0075432_10003595 Ga0075432_100035955 248
689 3300009011 Ga0105251_10004541 Ga0105251_100045416 248
690 3300009036 Ga0105244_10084825 Ga0105244_100848252 248
691 3300009036 Ga0105244_10129290 Ga0105244_101292901 248
692 3300009036 Ga0105244_10141965 Ga0105244_101419651 248
693 3300009147 Ga0114129_10409683 Ga0114129_104096833 248
694 3300009148 Ga0105243_10097946 Ga0105243_100979462 248
695 3300011119 Ga0105246_10004515 Ga0105246_100045153 248
696 3300011119 Ga0105246_10005509 Ga0105246_100055097 248
697 3300011119 Ga0105246_10262114 Ga0105246_102621142 248
698 3300013100 Ga0157373_10027559 Ga0157373_100275593 248
699 3300013105 Ga0157369_10057267 Ga0157369_100572674 248
700 3300013105 Ga0157369_10106123 Ga0157369_101061233 248
701 3300013105 Ga0157369_10142993 Ga0157369_101429933 248
702 3300013306 Ga0163162_10072094 Ga0163162_100720944 248
703 3300013306 Ga0163162_10096257 Ga0163162_100962574 248
704 3300025254 Ga0209148_1002131 Ga0209148_10021318 248
705 3300025254 Ga0209148_1002475 Ga0209148_10024758 248
706 3300025258 Ga0209129_1000079 Ga0209129_100007938 248
707 3300025294 Ga0209025_1001855 Ga0209025_10018559 248
708 3300025303 Ga0209051_1038351 Ga0209051_10383511 248
709 3300025728 Ga0207655_1079983 Ga0207655_10799832 248
710 3300025893 Ga0207682_10024037 Ga0207682_100240372 248
711 3300025907 Ga0207645_10115876 Ga0207645_101158762 248
712 3300025925 Ga0207650_10039178 Ga0207650_100391783 248
713 3300025931 Ga0207644_10622225 Ga0207644_106222251 248
714 3300025940 Ga0207691_10000656 Ga0207691_1000065634 248
715 3300025986 Ga0207658_10143447 Ga0207658_101434472 248
716 3300026121 Ga0207683_10009067 Ga0207683_100090673 248
717 3300027907 Ga0207428_10009026 Ga0207428_100090262 248
718 3300027907 Ga0207428_10353962 Ga0207428_103539622 248
719 3300030744 Ga0316181_1100102 Ga0316181_11001022 248
720 3300031548 Ga0307408_100006256 Ga0307408_1000062562 248
721 3300031548 Ga0307408_100018989 Ga0307408_1000189892 248
722 3300031548 Ga0307408_100042860 Ga0307408_1000428602 248
723 3300031548 Ga0307408_100064815 Ga0307408_1000648152 248
724 3300031548 Ga0307408_100086588 Ga0307408_1000865882 248
725 3300031548 Ga0307408_100183868 Ga0307408_1001838682 248
726 3300031548 Ga0307408_100208453 Ga0307408_1002084532 248
727 3300031731 Ga0307405_10019871 Ga0307405_100198715 248
728 3300031731 Ga0307405_10025869 Ga0307405_100258692 248
729 3300031731 Ga0307405_10029340 Ga0307405_100293403 248
730 3300031731 Ga0307405_10044992 Ga0307405_100449923 248
731 3300031731 Ga0307405_10050603 Ga0307405_100506034 248
732 3300031731 Ga0307405_10071411 Ga0307405_100714112 248
733 3300031731 Ga0307405_10100900 Ga0307405_101009003 248
734 3300031731 Ga0307405_10497421 Ga0307405_104974212 248
735 3300031824 Ga0307413_10014569 Ga0307413_100145695 248
736 3300031824 Ga0307413_10020642 Ga0307413_100206422 248
737 3300031824 Ga0307413_10035669 Ga0307413_100356693 248
738 3300031824 Ga0307413_10189279 Ga0307413_101892793 248
739 3300031852 Ga0307410_10004235 Ga0307410_100042357 248
740 3300031852 Ga0307410_10007743 Ga0307410_100077432 248
741 3300031852 Ga0307410_10009937 Ga0307410_100099372 248
742 3300031852 Ga0307410_10015070 Ga0307410_100150703 248
743 3300031852 Ga0307410_10033381 Ga0307410_100333813 248
744 3300031852 Ga0307410_10059086 Ga0307410_100590861 248
745 3300031852 Ga0307410_10205494 Ga0307410_102054942 248
746 3300031852 Ga0307410_10455520 Ga0307410_104555202 248
747 3300031901 Ga0307406_10177997 Ga0307406_101779972 248
748 3300031901 Ga0307406_10264132 Ga0307406_102641323 248
749 3300031901 Ga0307406_10390801 Ga0307406_103908011 248
750 3300031903 Ga0307407_10021248 Ga0307407_100212485 248
751 3300031903 Ga0307407_10033714 Ga0307407_100337144 248
752 3300031903 Ga0307407_10110414 Ga0307407_101104142 248
753 3300031911 Ga0307412_10003121 Ga0307412_100031216 248
754 3300031911 Ga0307412_10050641 Ga0307412_100506412 248
755 3300031911 Ga0307412_10091001 Ga0307412_100910012 248
756 3300031911 Ga0307412_10170890 Ga0307412_101708903 248
757 3300031911 Ga0307412_10259642 Ga0307412_102596422 248
758 3300031911 Ga0307412_10349004 Ga0307412_103490041 248
759 3300031911 Ga0307412_10395347 Ga0307412_103953472 248
760 3300031995 Ga0307409_100014797 Ga0307409_1000147975 248
761 3300031995 Ga0307409_100032798 Ga0307409_1000327983 248
762 3300031995 Ga0307409_100054693 Ga0307409_1000546933 248
763 3300031995 Ga0307409_100115149 Ga0307409_1001151493 248
764 3300031995 Ga0307409_100158844 Ga0307409_1001588442 248
765 3300031995 Ga0307409_100160865 Ga0307409_1001608654 248
766 3300032002 Ga0307416_100052270 Ga0307416_1000522703 248
767 3300032002 Ga0307416_100103675 Ga0307416_1001036753 248
768 3300032002 Ga0307416_100220426 Ga0307416_1002204263 248
769 3300032002 Ga0307416_100338341 Ga0307416_1003383412 248
770 3300032002 Ga0307416_100552226 Ga0307416_1005522261 248
771 3300032002 Ga0307416_101161474 Ga0307416_1011614741 248
772 3300032004 Ga0307414_10134136 Ga0307414_101341362 248
773 3300032005 Ga0307411_10007696 Ga0307411_100076966 248
774 3300032126 Ga0307415_100012770 Ga0307415_1000127704 248
775 3300032126 Ga0307415_100040745 Ga0307415_1000407455 248
776 3300037312 Ga0395899_0030686 Ga0395899_0030686_799_1545 248
777 3300037418 Ga0395900_0025974 Ga0395900_0025974_3214_3960 248
778 3300037418 Ga0395900_0109545 Ga0395900_0109545_1627_2373 248
779 3300037466 Ga0395898_0040409 Ga0395898_0040409_2509_3255 248
780 3300037466 Ga0395898_0073964 Ga0395898_0073964_847_1593 248
781 3300037466 Ga0395898_0074393 Ga0395898_0074393_1596_2342 248
782 3300038443 Ga0395901_0053453 Ga0395901_0053453_2259_3005 248
783 3300038443 Ga0395901_0064752 Ga0395901_0064752_1953_2699 248
784 3300038443 Ga0395901_0088380 Ga0395901_0088380_350_1096 248
785 3300041404 Ga0439436_0043325 Ga0439436_0043325_185_931 248
786 3300041405 Ga0439438_004277 Ga0439438_004277_2392_3138 248
787 3300041410 Ga0439461_0003351 Ga0439461_0003351_741_1487 248
788 3300041411 Ga0439466_0006264 Ga0439466_0006264_3005_3751 248
789 3300041999 Ga0439433_0000401 Ga0439433_0000401_797_1543 248
790 3300041999 Ga0439433_0000801 Ga0439433_0000801_2513_3259 248
791 3300041999 Ga0439433_0011097 Ga0439433_0011097_59_805 248
792 3300042002 Ga0439442_000065 Ga0439442_000065_19331_20077 248
793 3300042002 Ga0439442_000238 Ga0439442_000238_9875_10633 248
794 3300042002 Ga0439442_000357 Ga0439442_000357_1020_1766 248
795 3300042002 Ga0439442_002111 Ga0439442_002111_2288_3034 248
796 3300042002 Ga0439442_003645 Ga0439442_003645_734_1480 248
797 3300042007 Ga0439449_0002718 Ga0439449_0002718_2204_2950 248
798 3300042007 Ga0439449_0018955 Ga0439449_0018955_1413_2159 248
799 3300042007 Ga0439449_0047242 Ga0439449_0047242_507_1253 248
800 3300042010 Ga0439452_000681 Ga0439452_000681_15012_15758 248
801 3300042014 Ga0439457_001288 Ga0439457_001288_5190_5936 248
802 3300042014 Ga0439457_006709 Ga0439457_006709_72_818 248
803 3300042015 Ga0439462_0002654 Ga0439462_0002654_55_801 248
804 3300042115 Ga0450911_016773 Ga0450911_016773_161_907 248
805 3300042121 Ga0450919_000628 Ga0450919_000628_2429_3175 248
806 3300042121 Ga0450919_001373 Ga0450919_001373_686_1432 248
807 3300042122 Ga0450920_001609 Ga0450920_001609_1575_2321 248
808 3300042122 Ga0450920_021510 Ga0450920_021510_56_802 248
809 3300042125 Ga0450923_012645 Ga0450923_012645_252_998 248
810 3300042146 Ga0450907_000368 Ga0450907_000368_4852_5598 248
811 3300042146 Ga0450907_003174 Ga0450907_003174_1566_2312 248
812 3300042156 Ga0439446_0052557 Ga0439446_0052557_426_1172 248
813 3300042184 Ga0450908_005626 Ga0450908_005626_237_983 248
814 3300042184 Ga0450908_032318 Ga0450908_032318_134_880 248
815 3300042185 Ga0450909_002538 Ga0450909_002538_124_870 248
816 3300042435 Ga0439434_0000396 Ga0439434_0000396_1266_2012 248
817 3300042435 Ga0439434_0000500 Ga0439434_0000500_744_1490 248
818 3300042435 Ga0439434_0021671 Ga0439434_0021671_487_1233 248
819 3300042531 Ga0450918_000261 Ga0450918_000261_9699_10445 248
820 3300042531 Ga0450918_000491 Ga0450918_000491_2867_3613 248
821 3300046459 Ga0495629_0151871 Ga0495629_0151871_164_910 248
822 3300046463 Ga0495653_0016459 Ga0495653_0016459_2612_3358 248
823 3300046472 Ga0495580_0008712 Ga0495580_0008712_316_1062 248
824 3300046472 Ga0495580_0370499 Ga0495580_0370499_162_908 248
825 3300046473 Ga0495582_0029435 Ga0495582_0029435_2035_2781 248
826 3300046499 Ga0495594_0143742 Ga0495594_0143742_465_1211 248
827 3300046518 Ga0495631_0026625 Ga0495631_0026625_1523_2269 248
828 3300046525 Ga0495663_0108176 Ga0495663_0108176_51_797 248
829 3300046528 Ga0495642_0070743 Ga0495642_0070743_643_1389 248
830 3300046531 Ga0495665_0000966 Ga0495665_0000966_13695_14441 248
831 3300046531 Ga0495665_0123569 Ga0495665_0123569_218_964 248
832 3300046535 Ga0495586_0009865 Ga0495586_0009865_1123_1869 248
833 3300046535 Ga0495586_0014946 Ga0495586_0014946_1041_1787 248
834 3300046536 Ga0495587_0024850 Ga0495587_0024850_605_1351 248
835 3300046543 Ga0495645_0116610 Ga0495645_0116610_514_1260 248
836 3300046543 Ga0495645_0309091 Ga0495645_0309091_110_856 248
837 3300046558 Ga0495633_0053583 Ga0495633_0053583_501_1247 248
838 3300046559 Ga0495667_0013612 Ga0495667_0013612_1017_1763 248
839 3300046615 Ga0495656_0004822 Ga0495656_0004822_2390_3136 248
840 3300046663 Ga0495635_0113408 Ga0495635_0113408_550_1296 248
841 3300046664 Ga0495659_0057590 Ga0495659_0057590_249_995 248
842 3300046674 Ga0495588_0004869 Ga0495588_0004869_14_760 248
843 3300046674 Ga0495588_0010663 Ga0495588_0010663_1332_2078 248
844 3300046674 Ga0495588_0010771 Ga0495588_0010771_616_1362 248
845 3300046674 Ga0495588_0087062 Ga0495588_0087062_59_805 248
846 3300046675 Ga0495657_0055426 Ga0495657_0055426_342_1088 248
847 3300046679 Ga0495623_0207401 Ga0495623_0207401_321_1067 248
848 3300046691 Ga0495670_0007465 Ga0495670_0007465_2677_3423 248
849 3300046809 Ga0495600_0008509 Ga0495600_0008509_2360_3106 248
850 3300047315 Ga0495581_0015765 Ga0495581_0015765_2430_3176 248
851 3300047315 Ga0495581_0059254 Ga0495581_0059254_1053_1799 248
852 3300047315 Ga0495581_0148918 Ga0495581_0148918_98_844 248
853 3300047315 Ga0495581_0261193 Ga0495581_0261193_76_822 248
854 3300047318 Ga0495636_0027025 Ga0495636_0027025_1246_1992 248
855 3300047322 Ga0495680_0127907 Ga0495680_0127907_464_1210 248
856 3300047445 Ga0495677_0014276 Ga0495677_0014276_1966_2712 248
857 3300048903 Ga0496100_0085770 Ga0496100_0085770_266_1012 248
858 3300048903 Ga0496100_0148811 Ga0496100_0148811_26_772 248
859 3300048903 Ga0496100_0462568 Ga0496100_0462568_177_923 248
860 3300048903 Ga0496100_0611973 Ga0496100_0611973_48_794 248
861 3300048904 Ga0496101_0004798 Ga0496101_0004798_2430_3176 248
862 3300048904 Ga0496101_0261220 Ga0496101_0261220_506_1252 248
863 3300048905 Ga0496102_0070197 Ga0496102_0070197_136_882 248
864 3300048905 Ga0496102_0096512 Ga0496102_0096512_1453_2199 248
865 3300048905 Ga0496102_0370522 Ga0496102_0370522_180_926 248
866 3300048905 Ga0496102_0657041 Ga0496102_0657041_193_939 248
867 3300048906 Ga0496103_0016005 Ga0496103_0016005_523_1269 248
868 3300048906 Ga0496103_0464277 Ga0496103_0464277_33_779 248
869 3300048907 Ga0496104_0655591 Ga0496104_0655591_25_771 248
870 3300048909 Ga0496106_0041236 Ga0496106_0041236_2438_3184 248
871 3300048909 Ga0496106_0141820 Ga0496106_0141820_655_1401 248
872 3300048910 Ga0496107_0005672 Ga0496107_0005672_2318_3064 248
873 3300048910 Ga0496107_0239999 Ga0496107_0239999_31_777 248
874 3300048910 Ga0496107_0276211 Ga0496107_0276211_77_823 248
875 3300048911 Ga0496108_0157803 Ga0496108_0157803_403_1149 248
876 3300048912 Ga0496109_0102507 Ga0496109_0102507_83_829 248
877 3300048913 Ga0496110_0058928 Ga0496110_0058928_676_1422 248
878 3300048914 Ga0496111_0037292 Ga0496111_0037292_772_1518 248
879 3300048914 Ga0496111_0163035 Ga0496111_0163035_437_1183 248
880 3300048914 Ga0496111_0235572 Ga0496111_0235572_17_763 248
881 3300048915 Ga0496112_0007354 Ga0496112_0007354_5717_6463 248
882 3300048915 Ga0496112_0067824 Ga0496112_0067824_2356_3102 248
883 3300048916 Ga0496113_0132401 Ga0496113_0132401_826_1572 248
884 3300048917 Ga0496114_0062525 Ga0496114_0062525_835_1581 248
885 3300048927 Ga0496124_0197439 Ga0496124_0197439_347_1093 248
886 3300048928 Ga0496125_0165162 Ga0496125_0165162_38_784 248
887 3300049529 Ga0501313_009025 Ga0501313_009025_337_1083 248
888 3300049533 Ga0501317_005036 Ga0501317_005036_468_1214 248
889 3300049537 Ga0501321_011129 Ga0501321_011129_189_935 248
890 3300049539 Ga0501323_002272 Ga0501323_002272_585_1331 248
891 3300049569 Ga0501032_0003639 Ga0501032_0003639_9735_10487 248
892 3300049572 Ga0501036_0329713 Ga0501036_0329713_65_817 248
893 3300049573 Ga0501037_0064246 Ga0501037_0064246_1453_2205 248
894 3300049573 Ga0501037_0094633 Ga0501037_0094633_1031_1777 248
895 3300049574 Ga0501038_0104850 Ga0501038_0104850_651_1397 248
896 3300049575 Ga0501039_0539340 Ga0501039_0539340_20_772 248
897 3300049579 Ga0501043_0021832 Ga0501043_0021832_3363_4109 248
898 3300049823 Ga0501044_0343851 Ga0501044_0343851_271_1023 248
899 3300059510 Ga0587090_000391 Ga0587090_000391_2754_3500 248
900 3300059626 Ga0587115_006932 Ga0587115_006932_27_773 248
901 3300059630 Ga0587128_040680 Ga0587128_040680_23_769 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

33

270

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vzw-assembly1.cif.gz_A crystal structure of the bifunctional protein pria 0.9751 9 245
4u28-assembly1.cif.gz_A crystal structure of apo phosphoribosyl isomerase a from streptomyces sviceus atcc 29083 0.9724 9 245
4w9t-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9724 9 245
4x9s-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9696 9 245
2vep-assembly1.cif.gz_A crystal structure of the full length bifunctional enzyme pria 0.9675 9 245
ID Description Score Start End Superfamily
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9584 9 248 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9259 10 245 3.20.20.70
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.924 9 248 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9174 12 248 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9148 10 245 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2N3F272-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 0.9892 147 248 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A388P1H9-F1-model_v4 Phosphoribosyl isomerase A 0.9816 119 247 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A2N3F272-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 0.9797 147 248 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A7K0SNI1-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 0.9795 30 245 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A3D4SXN0-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 0.9791 10 134 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737

Feature Viewer

pLDDT pTM Quality
90.89 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map