F485162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 901 | 383 | 1802 | 257 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100130590|Ga0070713_1001305902 |
| Length | 247 |
| Sequence | MPRPRKPIPGVDGKALIGDAGKLLPEPSRRLFLRGAASVGALATLTGCDIIDGPTAENALRVVSNFNDWVQARLFSSHTLAPTFSESEVTRPFPFNAYYQQDEAPDIEGDKYQLEIGGLVDNKKSWSLPELYVCVEGWSAIGSWQGVRLSDFLKLIGADTRAKYVWFQCAEGYSNTIDMPTALHPQTQLTLKFDHKILPQAYGFPIRIRIPTKLGFKNPKYVTAMWVQNNDAGGYWENQGYNWFSGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 19 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 20 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 99 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 100 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 107 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 108 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 109 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 115 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 132 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 133 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 143 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 148 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 149 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 223 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 228 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 229 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 233 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 234 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 235 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 236 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 237 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 238 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 239 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 240 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 241 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 242 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 247 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 251 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 257 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 264 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 268 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 270 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 273 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 274 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 275 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 276 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 277 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 278 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 279 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 280 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 281 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 282 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 283 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 284 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 285 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 286 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 287 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 336 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 337 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 338 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 339 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 340 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 341 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 344 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 345 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 346 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 347 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 348 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 349 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 350 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 358 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 362 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 363 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 377 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 379 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 380 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 381 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 382 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 383 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.45 |
| Metatranscriptomes | 0 |
| Isolates | 0.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.66 |
| Nodule | 0.33 |
| Rhizoplane | 5.99 |
| Rhizosphere | 91.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070713_100130590 | 3300005436 | Bacteria | 2215 |
| 2 | 2214628267 | 2209111006 | Bacteria | 5188 |
| 3 | ARcpr5oldR_c000007 | 3300000041 | Bacteria | 41749 |
| 4 | ARcpr5yngRDRAFT_c000456 | 3300000043 | Bacteria | 5288 |
| 5 | ARSoilOldRDRAFT_c000004 | 3300000044 | Bacteria | 62556 |
| 6 | ARCol0oldRDRAFT_c00335 | 3300000045 | Bacteria | 4570 |
| 7 | ARCol0yngRDRAFT_1000002 | 3300000652 | Bacteria | 55259 |
| 8 | JGI24746J21847_1001973 | 3300001977 | Bacteria | 3270 |
| 9 | JGI24740J21852_10024717 | 3300001979 | Bacteria | 2035 |
| 10 | JGI24737J22298_10001147 | 3300001990 | Bacteria | 9321 |
| 11 | JGI24750J21931_1000100 | 3300002070 | Bacteria | 13291 |
| 12 | JGI24745J21846_1002936 | 3300002073 | Bacteria | 1764 |
| 13 | JGI24738J21930_10000155 | 3300002075 | Bacteria | 17211 |
| 14 | JGI24749J21850_1000093 | 3300002076 | Bacteria | 15913 |
| 15 | JGI24744J21845_10000499 | 3300002077 | Bacteria | 6981 |
| 16 | JGI24742J22300_10000079 | 3300002244 | Bacteria | 14048 |
| 17 | JGI25153J46596_10013295 | 3300003215 | Bacteria | 3486 |
| 18 | JGI25153J46596_10015068 | 3300003215 | Bacteria | 3173 |
| 19 | JGI25405J52794_10013204 | 3300003911 | Bacteria | 1599 |
| 20 | JGI25405J52794_10031827 | 3300003911 | Bacteria | 1097 |
| 21 | Ga0065717_1002392 | 3300005276 | Bacteria | 2056 |
| 22 | Ga0065716_1000034 | 3300005277 | Bacteria | 4261 |
| 23 | Ga0065704_10102560 | 3300005289 | Bacteria | 2200 |
| 24 | Ga0065715_10000599 | 3300005293 | Bacteria | 9975 |
| 25 | Ga0065715_10088946 | 3300005293 | Bacteria | 21692 |
| 26 | Ga0070676_10000514 | 3300005328 | Bacteria | 18558 |
| 27 | Ga0070676_10084468 | 3300005328 | Bacteria | 1933 |
| 28 | Ga0070683_100000931 | 3300005329 | Bacteria | 21734 |
| 29 | Ga0070683_100109638 | 3300005329 | Bacteria | 2604 |
| 30 | Ga0070690_100002803 | 3300005330 | Bacteria | 9405 |
| 31 | Ga0070690_100024319 | 3300005330 | Bacteria | 3724 |
| 32 | Ga0070690_100426610 | 3300005330 | Bacteria | 979 |
| 33 | Ga0070670_100013151 | 3300005331 | Bacteria | 7087 |
| 34 | Ga0068869_100000153 | 3300005334 | Bacteria | 34191 |
| 35 | Ga0068869_100267360 | 3300005334 | Bacteria | 1371 |
| 36 | Ga0070666_10013476 | 3300005335 | Bacteria | 5188 |
| 37 | Ga0070680_100000814 | 3300005336 | Bacteria | 21982 |
| 38 | Ga0070680_100061445 | 3300005336 | Bacteria | 3075 |
| 39 | Ga0070680_100152901 | 3300005336 | Bacteria | 1938 |
| 40 | Ga0070682_100000445 | 3300005337 | Bacteria | 26505 |
| 41 | Ga0070682_100002065 | 3300005337 | Bacteria | 11183 |
| 42 | Ga0070682_100107042 | 3300005337 | Bacteria | 1856 |
| 43 | Ga0068868_100000148 | 3300005338 | Bacteria | 45833 |
| 44 | Ga0068868_100246395 | 3300005338 | Bacteria | 1503 |
| 45 | Ga0070660_100001480 | 3300005339 | Bacteria | 16083 |
| 46 | Ga0070660_100076309 | 3300005339 | Bacteria | 2625 |
| 47 | Ga0070660_100237325 | 3300005339 | Bacteria | 1484 |
| 48 | Ga0070689_100000880 | 3300005340 | Bacteria | 18718 |
| 49 | Ga0070689_100008335 | 3300005340 | Bacteria | 7297 |
| 50 | Ga0070689_100014989 | 3300005340 | Bacteria | 5644 |
| 51 | Ga0070689_100072547 | 3300005340 | Bacteria | 2691 |
| 52 | Ga0070689_100086333 | 3300005340 | Bacteria | 2468 |
| 53 | Ga0070691_10002726 | 3300005341 | Bacteria | 7865 |
| 54 | Ga0070691_10153385 | 3300005341 | Bacteria | 1182 |
| 55 | Ga0070687_100000187 | 3300005343 | Bacteria | 21513 |
| 56 | Ga0070687_100000759 | 3300005343 | Bacteria | 10700 |
| 57 | Ga0070687_100022132 | 3300005343 | Bacteria | 3000 |
| 58 | Ga0070661_100004477 | 3300005344 | Bacteria | 9635 |
| 59 | Ga0070661_100139005 | 3300005344 | Bacteria | 1829 |
| 60 | Ga0070692_10001230 | 3300005345 | Bacteria | 9128 |
| 61 | Ga0070692_10056825 | 3300005345 | Bacteria | 2050 |
| 62 | Ga0070668_100100592 | 3300005347 | Bacteria | 2290 |
| 63 | Ga0070668_100220924 | 3300005347 | Bacteria | 1563 |
| 64 | Ga0070669_100000501 | 3300005353 | Bacteria | 29467 |
| 65 | Ga0070669_100157391 | 3300005353 | Bacteria | 1763 |
| 66 | Ga0070669_100204113 | 3300005353 | Bacteria | 1557 |
| 67 | Ga0070675_100027368 | 3300005354 | Bacteria | 4580 |
| 68 | Ga0070675_100086697 | 3300005354 | Bacteria | 2617 |
| 69 | Ga0070675_100231393 | 3300005354 | Bacteria | 1612 |
| 70 | Ga0070675_100410630 | 3300005354 | Bacteria | 1209 |
| 71 | Ga0070671_100000595 | 3300005355 | Bacteria | 25844 |
| 72 | Ga0070671_100015975 | 3300005355 | Bacteria | 6064 |
| 73 | Ga0070671_100017211 | 3300005355 | Bacteria | 5851 |
| 74 | Ga0070671_100135240 | 3300005355 | Bacteria | 2078 |
| 75 | Ga0070674_100000249 | 3300005356 | Bacteria | 26766 |
| 76 | Ga0070673_100000233 | 3300005364 | Bacteria | 27866 |
| 77 | Ga0070673_100353400 | 3300005364 | Bacteria | 1305 |
| 78 | Ga0070688_100000432 | 3300005365 | Bacteria | 21144 |
| 79 | Ga0070688_100011750 | 3300005365 | Bacteria | 4880 |
| 80 | Ga0070688_100044365 | 3300005365 | Bacteria | 2744 |
| 81 | Ga0070688_100137683 | 3300005365 | Bacteria | 1655 |
| 82 | Ga0070659_100000746 | 3300005366 | Bacteria | 23656 |
| 83 | Ga0070659_100031480 | 3300005366 | Bacteria | 4109 |
| 84 | Ga0070659_100203184 | 3300005366 | Bacteria | 1631 |
| 85 | Ga0070659_100420286 | 3300005366 | Bacteria | 1130 |
| 86 | Ga0070667_100001881 | 3300005367 | Bacteria | 18641 |
| 87 | Ga0070667_100091596 | 3300005367 | Bacteria | 2614 |
| 88 | Ga0070709_10332630 | 3300005434 | Bacteria | 1118 |
| 89 | Ga0070714_100034213 | 3300005435 | Bacteria | 4254 |
| 90 | Ga0070714_100286953 | 3300005435 | Bacteria | 1531 |
| 91 | Ga0070714_100543427 | 3300005435 | Bacteria | 1112 |
| 92 | Ga0070714_100562348 | 3300005435 | Bacteria | 1093 |
| 93 | Ga0070713_100008986 | 3300005436 | Bacteria | 7121 |
| 94 | Ga0070713_100049334 | 3300005436 | Bacteria | 3472 |
| 95 | Ga0070713_100370313 | 3300005436 | Bacteria | 1333 |
| 96 | Ga0070710_10008769 | 3300005437 | Bacteria | 4931 |
| 97 | Ga0070710_10048777 | 3300005437 | Bacteria | 2366 |
| 98 | Ga0070701_10000164 | 3300005438 | Bacteria | 20655 |
| 99 | Ga0070701_10023111 | 3300005438 | Bacteria | 2990 |
| 100 | Ga0070711_100024101 | 3300005439 | Bacteria | 3965 |
| 101 | Ga0070711_100045468 | 3300005439 | Bacteria | 2987 |
| 102 | Ga0070711_100047217 | 3300005439 | Bacteria | 2938 |
| 103 | Ga0070711_100579964 | 3300005439 | Bacteria | 933 |
| 104 | Ga0070705_100000361 | 3300005440 | Bacteria | 26716 |
| 105 | Ga0070705_100046519 | 3300005440 | Bacteria | 2502 |
| 106 | Ga0070705_100199445 | 3300005440 | Bacteria | 1371 |
| 107 | Ga0070700_100000357 | 3300005441 | Bacteria | 23494 |
| 108 | Ga0070700_100097542 | 3300005441 | Bacteria | 1930 |
| 109 | Ga0070694_100006390 | 3300005444 | Bacteria | 7149 |
| 110 | Ga0070708_100075489 | 3300005445 | Bacteria | 3043 |
| 111 | Ga0070708_100181371 | 3300005445 | Bacteria | 1968 |
| 112 | Ga0070708_100194207 | 3300005445 | Bacteria | 1899 |
| 113 | Ga0070663_100000582 | 3300005455 | Bacteria | 19491 |
| 114 | Ga0070663_100055944 | 3300005455 | Bacteria | 2825 |
| 115 | Ga0070678_100001403 | 3300005456 | Bacteria | 12829 |
| 116 | Ga0070678_100018262 | 3300005456 | Bacteria | 4545 |
| 117 | Ga0070662_100067944 | 3300005457 | Bacteria | 2618 |
| 118 | Ga0070662_100217534 | 3300005457 | Bacteria | 1523 |
| 119 | Ga0070662_100249064 | 3300005457 | Bacteria | 1427 |
| 120 | Ga0070681_10004898 | 3300005458 | Bacteria | 12850 |
| 121 | Ga0070681_10119251 | 3300005458 | Bacteria | 2574 |
| 122 | Ga0070681_10341154 | 3300005458 | Bacteria | 1408 |
| 123 | Ga0068867_100001099 | 3300005459 | Bacteria | 18474 |
| 124 | Ga0068867_100230617 | 3300005459 | Bacteria | 1496 |
| 125 | Ga0070685_10003380 | 3300005466 | Bacteria | 8119 |
| 126 | Ga0070685_10011632 | 3300005466 | Bacteria | 4611 |
| 127 | Ga0070685_10036784 | 3300005466 | Bacteria | 2769 |
| 128 | Ga0070685_10258981 | 3300005466 | Bacteria | 1156 |
| 129 | Ga0070706_100007863 | 3300005467 | Bacteria | 9965 |
| 130 | Ga0070698_100001449 | 3300005471 | Bacteria | 26331 |
| 131 | Ga0070698_100418283 | 3300005471 | Bacteria | 1275 |
| 132 | Ga0070699_100063915 | 3300005518 | Bacteria | 3192 |
| 133 | Ga0070679_100002583 | 3300005530 | Bacteria | 16455 |
| 134 | Ga0070679_100021338 | 3300005530 | Bacteria | 6321 |
| 135 | Ga0070679_100054026 | 3300005530 | Bacteria | 3998 |
| 136 | Ga0070679_100250784 | 3300005530 | Bacteria | 1726 |
| 137 | Ga0070684_100000101 | 3300005535 | Bacteria | 55960 |
| 138 | Ga0070684_100114837 | 3300005535 | Bacteria | 2417 |
| 139 | Ga0070697_100092376 | 3300005536 | Bacteria | 2504 |
| 140 | Ga0070697_100094047 | 3300005536 | Bacteria | 2483 |
| 141 | Ga0070697_100275893 | 3300005536 | Bacteria | 1442 |
| 142 | Ga0068853_100003127 | 3300005539 | Bacteria | 12655 |
| 143 | Ga0068853_100009271 | 3300005539 | Bacteria | 7937 |
| 144 | Ga0068853_100021629 | 3300005539 | Bacteria | 5365 |
| 145 | Ga0070672_100001273 | 3300005543 | Bacteria | 15485 |
| 146 | Ga0070672_100081337 | 3300005543 | Bacteria | 2597 |
| 147 | Ga0070686_100000532 | 3300005544 | Bacteria | 22792 |
| 148 | Ga0070686_100120629 | 3300005544 | Bacteria | 1800 |
| 149 | Ga0070695_100002491 | 3300005545 | Bacteria | 10599 |
| 150 | Ga0070695_100015081 | 3300005545 | Bacteria | 4664 |
| 151 | Ga0070696_100014847 | 3300005546 | Bacteria | 5228 |
| 152 | Ga0070693_100000138 | 3300005547 | Bacteria | 32988 |
| 153 | Ga0070693_100004377 | 3300005547 | Bacteria | 6668 |
| 154 | Ga0070665_100027794 | 3300005548 | Bacteria | 5696 |
| 155 | Ga0070665_100169759 | 3300005548 | Bacteria | 2183 |
| 156 | Ga0070665_100218608 | 3300005548 | Bacteria | 1906 |
| 157 | Ga0070665_100587568 | 3300005548 | Bacteria | 1127 |
| 158 | Ga0070704_100003765 | 3300005549 | Bacteria | 8733 |
| 159 | Ga0070704_100087143 | 3300005549 | Bacteria | 2316 |
| 160 | Ga0070704_100096936 | 3300005549 | Bacteria | 2212 |
| 161 | Ga0068855_100020794 | 3300005563 | Bacteria | 7868 |
| 162 | Ga0068855_100052371 | 3300005563 | Bacteria | 4805 |
| 163 | Ga0068855_100301574 | 3300005563 | Bacteria | 1774 |
| 164 | Ga0070664_100000614 | 3300005564 | Bacteria | 27230 |
| 165 | Ga0070664_100161850 | 3300005564 | Bacteria | 1980 |
| 166 | Ga0070664_100229707 | 3300005564 | Bacteria | 1663 |
| 167 | Ga0070664_100327166 | 3300005564 | Bacteria | 1390 |
| 168 | Ga0070664_100649104 | 3300005564 | Bacteria | 981 |
| 169 | Ga0068857_100001072 | 3300005577 | Bacteria | 21170 |
| 170 | Ga0068854_100000909 | 3300005578 | Bacteria | 17803 |
| 171 | Ga0068856_100017822 | 3300005614 | Bacteria | 6888 |
| 172 | Ga0068856_100100018 | 3300005614 | Bacteria | 2892 |
| 173 | Ga0068856_100524182 | 3300005614 | Bacteria | 1206 |
| 174 | Ga0070702_100212642 | 3300005615 | Bacteria | 1288 |
| 175 | Ga0068852_100000713 | 3300005616 | Bacteria | 21734 |
| 176 | Ga0068859_100001523 | 3300005617 | Bacteria | 23646 |
| 177 | Ga0068859_100075587 | 3300005617 | Bacteria | 3409 |
| 178 | Ga0068859_100171343 | 3300005617 | Bacteria | 2251 |
| 179 | Ga0068864_100000715 | 3300005618 | Bacteria | 27854 |
| 180 | Ga0068864_100150463 | 3300005618 | Bacteria | 2108 |
| 181 | Ga0068866_10000861 | 3300005718 | Bacteria | 13443 |
| 182 | Ga0068861_100000574 | 3300005719 | Bacteria | 21775 |
| 183 | Ga0068861_100060575 | 3300005719 | Bacteria | 2901 |
| 184 | Ga0068861_100307059 | 3300005719 | Bacteria | 1376 |
| 185 | Ga0068870_10000009 | 3300005840 | Bacteria | 70353 |
| 186 | Ga0068870_10009685 | 3300005840 | Bacteria | 4392 |
| 187 | Ga0068863_100001272 | 3300005841 | Bacteria | 25149 |
| 188 | Ga0068863_100346092 | 3300005841 | Bacteria | 1447 |
| 189 | Ga0068858_100048713 | 3300005842 | Bacteria | 3925 |
| 190 | Ga0068858_100048887 | 3300005842 | Bacteria | 3917 |
| 191 | Ga0068858_100124860 | 3300005842 | Bacteria | 2409 |
| 192 | Ga0068860_100001758 | 3300005843 | Bacteria | 23120 |
| 193 | Ga0068860_100045883 | 3300005843 | Bacteria | 4167 |
| 194 | Ga0068860_100053056 | 3300005843 | Bacteria | 3855 |
| 195 | Ga0068860_100281328 | 3300005843 | Bacteria | 1626 |
| 196 | Ga0068862_100005607 | 3300005844 | Bacteria | 10490 |
| 197 | Ga0068862_100070041 | 3300005844 | Bacteria | 3028 |
| 198 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 199 | Ga0081455_10075087 | 3300005937 | Bacteria | 2790 |
| 200 | Ga0081455_10263365 | 3300005937 | Bacteria | 1255 |
| 201 | Ga0070717_10060654 | 3300006028 | Bacteria | 3132 |
| 202 | Ga0070717_10205797 | 3300006028 | Bacteria | 1725 |
| 203 | Ga0075363_100191467 | 3300006048 | Bacteria | 1167 |
| 204 | Ga0075432_10003208 | 3300006058 | Bacteria | 5518 |
| 205 | Ga0070716_100021278 | 3300006173 | Bacteria | 3415 |
| 206 | Ga0070712_100050502 | 3300006175 | Bacteria | 2893 |
| 207 | Ga0070712_100136022 | 3300006175 | Bacteria | 1869 |
| 208 | Ga0075367_10111970 | 3300006178 | Bacteria | 1676 |
| 209 | Ga0075369_10018049 | 3300006186 | Bacteria | 2869 |
| 210 | Ga0075366_10033744 | 3300006195 | Bacteria | 3015 |
| 211 | Ga0075366_10107721 | 3300006195 | Bacteria | 1675 |
| 212 | Ga0097621_100001018 | 3300006237 | Bacteria | 19728 |
| 213 | Ga0075370_10145685 | 3300006353 | Bacteria | 1386 |
| 214 | Ga0068871_100000012 | 3300006358 | Bacteria | 105267 |
| 215 | Ga0068871_100148471 | 3300006358 | Bacteria | 1998 |
| 216 | Ga0075428_100001200 | 3300006844 | Bacteria | 27756 |
| 217 | Ga0075428_100170370 | 3300006844 | Bacteria | 2360 |
| 218 | Ga0075428_100245014 | 3300006844 | Bacteria | 1933 |
| 219 | Ga0075430_100000032 | 3300006846 | Bacteria | 72679 |
| 220 | Ga0075430_100024887 | 3300006846 | Bacteria | 5092 |
| 221 | Ga0075431_100000462 | 3300006847 | Bacteria | 33505 |
| 222 | Ga0075431_100148619 | 3300006847 | Bacteria | 2413 |
| 223 | Ga0075433_10000072 | 3300006852 | Bacteria | 45390 |
| 224 | Ga0075433_10001122 | 3300006852 | Bacteria | 19376 |
| 225 | Ga0075433_10023300 | 3300006852 | Bacteria | 5210 |
| 226 | Ga0075433_10033971 | 3300006852 | Bacteria | 4376 |
| 227 | Ga0075433_10038289 | 3300006852 | Bacteria | 4141 |
| 228 | Ga0075434_100000341 | 3300006871 | Bacteria | 33666 |
| 229 | Ga0075434_100001564 | 3300006871 | Bacteria | 19411 |
| 230 | Ga0075434_100001937 | 3300006871 | Bacteria | 17946 |
| 231 | Ga0075434_100013026 | 3300006871 | Bacteria | 7896 |
| 232 | Ga0075434_100023536 | 3300006871 | Bacteria | 6004 |
| 233 | Ga0075434_100026026 | 3300006871 | Bacteria | 5728 |
| 234 | Ga0075434_100050267 | 3300006871 | Bacteria | 4141 |
| 235 | Ga0075434_100192179 | 3300006871 | Bacteria | 2062 |
| 236 | Ga0075434_100269253 | 3300006871 | Bacteria | 1723 |
| 237 | Ga0075429_100000631 | 3300006880 | Bacteria | 27160 |
| 238 | Ga0075429_100111563 | 3300006880 | Bacteria | 2390 |
| 239 | Ga0075429_100692360 | 3300006880 | Bacteria | 893 |
| 240 | Ga0068865_100000328 | 3300006881 | Bacteria | 26279 |
| 241 | Ga0075436_100471206 | 3300006914 | Bacteria | 916 |
| 242 | Ga0097620_100001523 | 3300006931 | Bacteria | 23646 |
| 243 | Ga0097620_100075588 | 3300006931 | Bacteria | 3409 |
| 244 | Ga0097620_100171336 | 3300006931 | Bacteria | 2251 |
| 245 | Ga0075435_100007539 | 3300007076 | Bacteria | 7767 |
| 246 | Ga0075435_100018432 | 3300007076 | Bacteria | 5309 |
| 247 | Ga0075435_100033377 | 3300007076 | Bacteria | 4069 |
| 248 | Ga0075435_100096198 | 3300007076 | Bacteria | 2450 |
| 249 | Ga0075435_100199808 | 3300007076 | Bacteria | 1694 |
| 250 | Ga0099795_10051916 | 3300007788 | Bacteria | 1496 |
| 251 | Ga0099795_10116589 | 3300007788 | Bacteria | 1064 |
| 252 | Ga0105251_10051946 | 3300009011 | Bacteria | 1953 |
| 253 | Ga0105240_10016810 | 3300009093 | Bacteria | 9893 |
| 254 | Ga0111539_10000915 | 3300009094 | Bacteria | 38573 |
| 255 | Ga0111539_10001908 | 3300009094 | Bacteria | 27756 |
| 256 | Ga0111539_10002936 | 3300009094 | Bacteria | 22607 |
| 257 | Ga0111539_10033531 | 3300009094 | Bacteria | 6234 |
| 258 | Ga0111539_10041767 | 3300009094 | Bacteria | 5512 |
| 259 | Ga0111539_10041772 | 3300009094 | Bacteria | 5511 |
| 260 | Ga0111539_10129768 | 3300009094 | Bacteria | 2952 |
| 261 | Ga0105245_10001404 | 3300009098 | Bacteria | 21834 |
| 262 | Ga0105245_10200346 | 3300009098 | Bacteria | 1917 |
| 263 | Ga0105247_10020951 | 3300009101 | Bacteria | 3933 |
| 264 | Ga0105247_10087657 | 3300009101 | Bacteria | 1971 |
| 265 | Ga0105247_10167039 | 3300009101 | Bacteria | 1461 |
| 266 | Ga0105247_10314403 | 3300009101 | Bacteria | 1091 |
| 267 | Ga0114129_10001035 | 3300009147 | Bacteria | 36374 |
| 268 | Ga0114129_10001551 | 3300009147 | Bacteria | 31169 |
| 269 | Ga0114129_10232960 | 3300009147 | Bacteria | 2479 |
| 270 | Ga0114129_10264205 | 3300009147 | Bacteria | 2305 |
| 271 | Ga0114129_10686897 | 3300009147 | Bacteria | 1317 |
| 272 | Ga0105243_10001028 | 3300009148 | Bacteria | 25704 |
| 273 | Ga0105243_10100290 | 3300009148 | Bacteria | 2402 |
| 274 | Ga0105243_10139703 | 3300009148 | Bacteria | 2065 |
| 275 | Ga0105243_10408260 | 3300009148 | Bacteria | 1263 |
| 276 | Ga0105241_10000720 | 3300009174 | Bacteria | 25072 |
| 277 | Ga0105241_10028053 | 3300009174 | Bacteria | 4192 |
| 278 | Ga0105242_10000607 | 3300009176 | Bacteria | 28041 |
| 279 | Ga0105242_10131222 | 3300009176 | Bacteria | 2163 |
| 280 | Ga0105242_10147864 | 3300009176 | Bacteria | 2046 |
| 281 | Ga0105248_10000309 | 3300009177 | Bacteria | 58008 |
| 282 | Ga0105248_10019080 | 3300009177 | Bacteria | 7583 |
| 283 | Ga0105248_10099089 | 3300009177 | Bacteria | 3284 |
| 284 | Ga0105248_10522825 | 3300009177 | Bacteria | 1338 |
| 285 | Ga0105237_10004962 | 3300009545 | Bacteria | 15190 |
| 286 | Ga0105237_10266048 | 3300009545 | Bacteria | 1717 |
| 287 | Ga0105238_10281483 | 3300009551 | Bacteria | 1644 |
| 288 | Ga0105238_10377742 | 3300009551 | Bacteria | 1408 |
| 289 | Ga0105249_10000486 | 3300009553 | Bacteria | 36821 |
| 290 | Ga0105249_10053545 | 3300009553 | Bacteria | 3688 |
| 291 | Ga0105249_10111857 | 3300009553 | Bacteria | 2582 |
| 292 | Ga0105249_10190487 | 3300009553 | Bacteria | 2001 |
| 293 | Ga0105249_10554833 | 3300009553 | Bacteria | 1200 |
| 294 | Ga0099796_10002137 | 3300010159 | Bacteria | 4255 |
| 295 | Ga0099796_10050021 | 3300010159 | Bacteria | 1447 |
| 296 | Ga0105239_10039493 | 3300010375 | Bacteria | 5171 |
| 297 | Ga0105239_10165990 | 3300010375 | Bacteria | 2469 |
| 298 | Ga0105239_10230457 | 3300010375 | Bacteria | 2078 |
| 299 | Ga0105239_10328480 | 3300010375 | Bacteria | 1725 |
| 300 | Ga0105246_10000696 | 3300011119 | Bacteria | 18957 |
| 301 | Ga0105246_10192445 | 3300011119 | Bacteria | 1580 |
| 302 | Ga0105246_10386840 | 3300011119 | Bacteria | 1158 |
| 303 | Ga0157328_1000562 | 3300012478 | Bacteria | 1378 |
| 304 | Ga0157339_1000408 | 3300012505 | Bacteria | 2205 |
| 305 | Ga0157373_10004002 | 3300013100 | Bacteria | 11114 |
| 306 | Ga0157370_10026919 | 3300013104 | Bacteria | 5672 |
| 307 | Ga0157374_10001864 | 3300013296 | Bacteria | 17741 |
| 308 | Ga0157374_10046182 | 3300013296 | Bacteria | 4032 |
| 309 | Ga0157378_10000872 | 3300013297 | Bacteria | 27839 |
| 310 | Ga0157378_10052559 | 3300013297 | Bacteria | 3625 |
| 311 | Ga0157378_10261242 | 3300013297 | Bacteria | 1661 |
| 312 | Ga0157378_10397902 | 3300013297 | Bacteria | 1356 |
| 313 | Ga0157378_10770705 | 3300013297 | Bacteria | 986 |
| 314 | Ga0163162_10000992 | 3300013306 | Bacteria | 26439 |
| 315 | Ga0163162_10031909 | 3300013306 | Bacteria | 5228 |
| 316 | Ga0163162_10094359 | 3300013306 | Bacteria | 3078 |
| 317 | Ga0163162_10829707 | 3300013306 | Bacteria | 1040 |
| 318 | Ga0157372_10010113 | 3300013307 | Bacteria | 10021 |
| 319 | Ga0157372_10017064 | 3300013307 | Bacteria | 7794 |
| 320 | Ga0157372_10593453 | 3300013307 | Bacteria | 1291 |
| 321 | Ga0157375_10002320 | 3300013308 | Bacteria | 16428 |
| 322 | Ga0157375_10101463 | 3300013308 | Bacteria | 2961 |
| 323 | Ga0157375_10192104 | 3300013308 | Bacteria | 2197 |
| 324 | Ga0163163_10010760 | 3300014325 | Bacteria | 8252 |
| 325 | Ga0163163_10079007 | 3300014325 | Bacteria | 3288 |
| 326 | Ga0163163_10129460 | 3300014325 | Bacteria | 2564 |
| 327 | Ga0163163_10695674 | 3300014325 | Bacteria | 1080 |
| 328 | Ga0157380_10000711 | 3300014326 | Bacteria | 20809 |
| 329 | Ga0157380_10621602 | 3300014326 | Bacteria | 1072 |
| 330 | Ga0182008_10045970 | 3300014497 | Bacteria | 2171 |
| 331 | Ga0157377_10000336 | 3300014745 | Bacteria | 21014 |
| 332 | Ga0157377_10184741 | 3300014745 | Bacteria | 1314 |
| 333 | Ga0157379_10000678 | 3300014968 | Bacteria | 27608 |
| 334 | Ga0157379_10002722 | 3300014968 | Bacteria | 14925 |
| 335 | Ga0157379_10219614 | 3300014968 | Bacteria | 1722 |
| 336 | Ga0157379_10443863 | 3300014968 | Bacteria | 1197 |
| 337 | Ga0157376_10002160 | 3300014969 | Bacteria | 13240 |
| 338 | Ga0157376_10035957 | 3300014969 | Bacteria | 4009 |
| 339 | Ga0163161_10000534 | 3300017792 | Bacteria | 31044 |
| 340 | Ga0163161_10216521 | 3300017792 | Bacteria | 1481 |
| 341 | Ga0224572_1005870 | 3300024225 | Bacteria | 2205 |
| 342 | Ga0228598_1000172 | 3300024227 | Bacteria | 11396 |
| 343 | Ga0207666_1000066 | 3300025271 | Bacteria | 18185 |
| 344 | Ga0207673_1000028 | 3300025290 | Bacteria | 11640 |
| 345 | Ga0209758_1001049 | 3300025297 | Bacteria | 36203 |
| 346 | Ga0209758_1034288 | 3300025297 | Bacteria | 2022 |
| 347 | Ga0207697_10000374 | 3300025315 | Bacteria | 25123 |
| 348 | Ga0207682_10000011 | 3300025893 | Bacteria | 85533 |
| 349 | Ga0207692_10092178 | 3300025898 | Bacteria | 1645 |
| 350 | Ga0207642_10027213 | 3300025899 | Bacteria | 2338 |
| 351 | Ga0207642_10056394 | 3300025899 | Bacteria | 1802 |
| 352 | Ga0207642_10153813 | 3300025899 | Bacteria | 1228 |
| 353 | Ga0207710_10000805 | 3300025900 | Bacteria | 16991 |
| 354 | Ga0207688_10000020 | 3300025901 | Bacteria | 51200 |
| 355 | Ga0207688_10117233 | 3300025901 | Bacteria | 1551 |
| 356 | Ga0207688_10137384 | 3300025901 | Bacteria | 1436 |
| 357 | Ga0207680_10009400 | 3300025903 | Bacteria | 4850 |
| 358 | Ga0207647_10002391 | 3300025904 | Bacteria | 14250 |
| 359 | Ga0207647_10006919 | 3300025904 | Bacteria | 8222 |
| 360 | Ga0207699_10037402 | 3300025906 | Bacteria | 2774 |
| 361 | Ga0207645_10000108 | 3300025907 | Bacteria | 61630 |
| 362 | Ga0207645_10025122 | 3300025907 | Bacteria | 3858 |
| 363 | Ga0207645_10151095 | 3300025907 | Bacteria | 1516 |
| 364 | Ga0207645_10237533 | 3300025907 | Bacteria | 1204 |
| 365 | Ga0207643_10000685 | 3300025908 | Bacteria | 21167 |
| 366 | Ga0207643_10055619 | 3300025908 | Bacteria | 2250 |
| 367 | Ga0207643_10261948 | 3300025908 | Bacteria | 1068 |
| 368 | Ga0207684_10059283 | 3300025910 | Bacteria | 3250 |
| 369 | Ga0207654_10000818 | 3300025911 | Bacteria | 17142 |
| 370 | Ga0207707_10000689 | 3300025912 | Bacteria | 33589 |
| 371 | Ga0207707_10081183 | 3300025912 | Bacteria | 2831 |
| 372 | Ga0207695_10094120 | 3300025913 | Bacteria | 3004 |
| 373 | Ga0207671_10138505 | 3300025914 | Bacteria | 1873 |
| 374 | Ga0207693_10004461 | 3300025915 | Bacteria | 11827 |
| 375 | Ga0207693_10027984 | 3300025915 | Bacteria | 4456 |
| 376 | Ga0207693_10121826 | 3300025915 | Bacteria | 2048 |
| 377 | Ga0207693_10282649 | 3300025915 | Bacteria | 1300 |
| 378 | Ga0207663_10156566 | 3300025916 | Bacteria | 1603 |
| 379 | Ga0207660_10000442 | 3300025917 | Bacteria | 27342 |
| 380 | Ga0207660_10089954 | 3300025917 | Bacteria | 2273 |
| 381 | Ga0207662_10000249 | 3300025918 | Bacteria | 24950 |
| 382 | Ga0207662_10007168 | 3300025918 | Bacteria | 6064 |
| 383 | Ga0207662_10018925 | 3300025918 | Bacteria | 3912 |
| 384 | Ga0207657_10002726 | 3300025919 | Bacteria | 19014 |
| 385 | Ga0207657_10013158 | 3300025919 | Bacteria | 8123 |
| 386 | Ga0207657_10085746 | 3300025919 | Bacteria | 2637 |
| 387 | Ga0207657_10130560 | 3300025919 | Bacteria | 2059 |
| 388 | Ga0207649_10000057 | 3300025920 | Bacteria | 102314 |
| 389 | Ga0207652_10008629 | 3300025921 | Bacteria | 8201 |
| 390 | Ga0207652_10051097 | 3300025921 | Bacteria | 3543 |
| 391 | Ga0207652_10065099 | 3300025921 | Bacteria | 3155 |
| 392 | Ga0207652_10360595 | 3300025921 | Bacteria | 1312 |
| 393 | Ga0207681_10000181 | 3300025923 | Bacteria | 51755 |
| 394 | Ga0207681_10222391 | 3300025923 | Bacteria | 1461 |
| 395 | Ga0207650_10858233 | 3300025925 | Bacteria | 770 |
| 396 | Ga0207659_10000028 | 3300025926 | Bacteria | 130804 |
| 397 | Ga0207659_10158633 | 3300025926 | Bacteria | 1774 |
| 398 | Ga0207659_10583772 | 3300025926 | Bacteria | 952 |
| 399 | Ga0207687_10000061 | 3300025927 | Bacteria | 84113 |
| 400 | Ga0207687_10020754 | 3300025927 | Bacteria | 4358 |
| 401 | Ga0207700_10197568 | 3300025928 | Bacteria | 1693 |
| 402 | Ga0207664_10279995 | 3300025929 | Bacteria | 1463 |
| 403 | Ga0207664_10311099 | 3300025929 | Bacteria | 1388 |
| 404 | Ga0207664_10463745 | 3300025929 | Bacteria | 1132 |
| 405 | Ga0207644_10000315 | 3300025931 | Bacteria | 31527 |
| 406 | Ga0207644_10016933 | 3300025931 | Bacteria | 4911 |
| 407 | Ga0207644_10186172 | 3300025931 | Bacteria | 1630 |
| 408 | Ga0207690_10000445 | 3300025932 | Bacteria | 26765 |
| 409 | Ga0207690_10130945 | 3300025932 | Bacteria | 1836 |
| 410 | Ga0207706_10002206 | 3300025933 | Bacteria | 18992 |
| 411 | Ga0207706_10114274 | 3300025933 | Bacteria | 2375 |
| 412 | Ga0207706_10625085 | 3300025933 | Bacteria | 924 |
| 413 | Ga0207686_10000972 | 3300025934 | Bacteria | 17055 |
| 414 | Ga0207686_10487425 | 3300025934 | Bacteria | 954 |
| 415 | Ga0207709_10006278 | 3300025935 | Bacteria | 6674 |
| 416 | Ga0207709_10040817 | 3300025935 | Bacteria | 2781 |
| 417 | Ga0207709_10074263 | 3300025935 | Bacteria | 2169 |
| 418 | Ga0207709_10149497 | 3300025935 | Bacteria | 1616 |
| 419 | Ga0207670_10000217 | 3300025936 | Bacteria | 37598 |
| 420 | Ga0207670_10007204 | 3300025936 | Bacteria | 6198 |
| 421 | Ga0207670_10173914 | 3300025936 | Bacteria | 1617 |
| 422 | Ga0207670_10270672 | 3300025936 | Bacteria | 1320 |
| 423 | Ga0207669_10000147 | 3300025937 | Bacteria | 34031 |
| 424 | Ga0207669_10145634 | 3300025937 | Bacteria | 1651 |
| 425 | Ga0207669_10213218 | 3300025937 | Bacteria | 1411 |
| 426 | Ga0207704_10000357 | 3300025938 | Bacteria | 21286 |
| 427 | Ga0207665_10040718 | 3300025939 | Bacteria | 3101 |
| 428 | Ga0207665_10275759 | 3300025939 | Bacteria | 1250 |
| 429 | Ga0207691_10002033 | 3300025940 | Bacteria | 19787 |
| 430 | Ga0207691_10028531 | 3300025940 | Bacteria | 5224 |
| 431 | Ga0207691_10116407 | 3300025940 | Bacteria | 2372 |
| 432 | Ga0207711_10006377 | 3300025941 | Bacteria | 9942 |
| 433 | Ga0207711_10008129 | 3300025941 | Bacteria | 8782 |
| 434 | Ga0207711_10046325 | 3300025941 | Bacteria | 3715 |
| 435 | Ga0207711_10244504 | 3300025941 | Bacteria | 1646 |
| 436 | Ga0207689_10001029 | 3300025942 | Bacteria | 26794 |
| 437 | Ga0207661_10000126 | 3300025944 | Bacteria | 48665 |
| 438 | Ga0207679_10000026 | 3300025945 | Bacteria | 200073 |
| 439 | Ga0207679_10108366 | 3300025945 | Bacteria | 2187 |
| 440 | Ga0207679_10126255 | 3300025945 | Bacteria | 2045 |
| 441 | Ga0207679_10222819 | 3300025945 | Bacteria | 1588 |
| 442 | Ga0207667_10010420 | 3300025949 | Bacteria | 10867 |
| 443 | Ga0207651_10000342 | 3300025960 | Bacteria | 19828 |
| 444 | Ga0207651_10585963 | 3300025960 | Bacteria | 973 |
| 445 | Ga0207712_10000686 | 3300025961 | Bacteria | 26195 |
| 446 | Ga0207712_10311058 | 3300025961 | Bacteria | 1296 |
| 447 | Ga0207712_10312215 | 3300025961 | Bacteria | 1294 |
| 448 | Ga0207712_10350845 | 3300025961 | Bacteria | 1227 |
| 449 | Ga0207668_10000242 | 3300025972 | Bacteria | 36700 |
| 450 | Ga0207668_10402756 | 3300025972 | Bacteria | 1157 |
| 451 | Ga0207640_10000833 | 3300025981 | Bacteria | 17545 |
| 452 | Ga0207658_10038939 | 3300025986 | Bacteria | 3428 |
| 453 | Ga0207658_10534530 | 3300025986 | Bacteria | 1048 |
| 454 | Ga0207677_10000710 | 3300026023 | Bacteria | 19646 |
| 455 | Ga0207677_10137387 | 3300026023 | Bacteria | 1866 |
| 456 | Ga0207677_10291402 | 3300026023 | Bacteria | 1344 |
| 457 | Ga0207703_10001559 | 3300026035 | Bacteria | 20767 |
| 458 | Ga0207703_10328847 | 3300026035 | Bacteria | 1402 |
| 459 | Ga0207639_10002260 | 3300026041 | Bacteria | 12939 |
| 460 | Ga0207639_10034012 | 3300026041 | Bacteria | 3764 |
| 461 | Ga0207639_10244107 | 3300026041 | Bacteria | 1563 |
| 462 | Ga0207639_10341664 | 3300026041 | Bacteria | 1335 |
| 463 | Ga0207678_10001079 | 3300026067 | Bacteria | 24988 |
| 464 | Ga0207678_10022723 | 3300026067 | Bacteria | 5492 |
| 465 | Ga0207678_10277698 | 3300026067 | Bacteria | 1437 |
| 466 | Ga0207678_10330331 | 3300026067 | Bacteria | 1312 |
| 467 | Ga0207708_10000805 | 3300026075 | Bacteria | 23614 |
| 468 | Ga0207708_10006143 | 3300026075 | Bacteria | 8905 |
| 469 | Ga0207702_10002121 | 3300026078 | Bacteria | 19082 |
| 470 | Ga0207702_10068858 | 3300026078 | Bacteria | 3041 |
| 471 | Ga0207641_10001766 | 3300026088 | Bacteria | 20843 |
| 472 | Ga0207641_10429122 | 3300026088 | Bacteria | 1274 |
| 473 | Ga0207641_10485171 | 3300026088 | Bacteria | 1198 |
| 474 | Ga0207648_10000731 | 3300026089 | Bacteria | 36792 |
| 475 | Ga0207676_10000361 | 3300026095 | Bacteria | 38795 |
| 476 | Ga0207674_10002121 | 3300026116 | Bacteria | 25067 |
| 477 | Ga0207675_100001489 | 3300026118 | Bacteria | 23488 |
| 478 | Ga0207675_100039410 | 3300026118 | Bacteria | 4409 |
| 479 | Ga0207675_100089221 | 3300026118 | Bacteria | 2897 |
| 480 | Ga0207675_100104037 | 3300026118 | Bacteria | 2676 |
| 481 | Ga0207683_10000034 | 3300026121 | Bacteria | 101817 |
| 482 | Ga0207683_10012741 | 3300026121 | Bacteria | 7176 |
| 483 | Ga0207683_10035186 | 3300026121 | Bacteria | 4356 |
| 484 | Ga0207683_10385217 | 3300026121 | Bacteria | 1289 |
| 485 | Ga0207698_10000304 | 3300026142 | Bacteria | 29523 |
| 486 | Ga0207698_10416859 | 3300026142 | Bacteria | 1287 |
| 487 | Ga0209973_1001485 | 3300027252 | Bacteria | 2059 |
| 488 | Ga0210002_1000561 | 3300027617 | Bacteria | 5031 |
| 489 | Ga0209983_1035728 | 3300027665 | Bacteria | 1067 |
| 490 | Ga0209588_1002483 | 3300027671 | Bacteria | 5001 |
| 491 | Ga0209971_1003397 | 3300027682 | Bacteria | 3777 |
| 492 | Ga0209966_1002652 | 3300027695 | Bacteria | 2993 |
| 493 | Ga0209966_1002767 | 3300027695 | Bacteria | 2936 |
| 494 | Ga0209998_10000861 | 3300027717 | Bacteria | 7800 |
| 495 | Ga0209974_10000830 | 3300027876 | Bacteria | 10632 |
| 496 | Ga0207428_10000082 | 3300027907 | Bacteria | 133684 |
| 497 | Ga0207428_10000352 | 3300027907 | Bacteria | 59444 |
| 498 | Ga0207428_10001078 | 3300027907 | Bacteria | 29769 |
| 499 | Ga0207428_10005810 | 3300027907 | Bacteria | 11441 |
| 500 | Ga0207428_10018670 | 3300027907 | Bacteria | 5920 |
| 501 | Ga0268266_10039033 | 3300028379 | Bacteria | 4044 |
| 502 | Ga0268266_10070689 | 3300028379 | Bacteria | 3025 |
| 503 | Ga0268266_10582685 | 3300028379 | Bacteria | 1074 |
| 504 | Ga0268265_10001338 | 3300028380 | Bacteria | 21019 |
| 505 | Ga0268265_10404695 | 3300028380 | Bacteria | 1262 |
| 506 | Ga0268264_10002557 | 3300028381 | Bacteria | 15953 |
| 507 | Ga0268264_10065013 | 3300028381 | Bacteria | 3072 |
| 508 | Ga0268264_10079082 | 3300028381 | Bacteria | 2805 |
| 509 | Ga0265338_10129337 | 3300028800 | Bacteria | 1997 |
| 510 | Ga0265325_10000141 | 3300031241 | Bacteria | 50291 |
| 511 | Ga0265325_10005121 | 3300031241 | Bacteria | 8154 |
| 512 | Ga0265325_10005810 | 3300031241 | Bacteria | 7563 |
| 513 | Ga0265325_10005829 | 3300031241 | Bacteria | 7546 |
| 514 | Ga0265325_10009631 | 3300031241 | Bacteria | 5635 |
| 515 | Ga0265340_10004172 | 3300031247 | Bacteria | 8112 |
| 516 | Ga0265339_10000067 | 3300031249 | Bacteria | 91730 |
| 517 | Ga0265339_10026535 | 3300031249 | Bacteria | 3316 |
| 518 | Ga0265313_10000008 | 3300031595 | Bacteria | 173405 |
| 519 | Ga0265313_10000054 | 3300031595 | Bacteria | 110199 |
| 520 | Ga0265313_10001334 | 3300031595 | Bacteria | 23230 |
| 521 | Ga0265313_10012192 | 3300031595 | Bacteria | 5276 |
| 522 | Ga0265342_10018860 | 3300031712 | Bacteria | 4460 |
| 523 | Ga0307416_100752666 | 3300032002 | Bacteria | 1067 |
| 524 | Ga0316583_10001247 | 3300032133 | Bacteria | 8383 |
| 525 | Ga0373948_0000353 | 3300034817 | Bacteria | 5653 |
| 526 | Ga0373948_0007550 | 3300034817 | Bacteria | 1832 |
| 527 | Ga0373950_0021975 | 3300034818 | Bacteria | 1132 |
| 528 | Ga0373958_0000098 | 3300034819 | Bacteria | 9234 |
| 529 | Ga0373958_0001694 | 3300034819 | Bacteria | 2990 |
| 530 | Ga0373959_0015032 | 3300034820 | Bacteria | 1417 |
| 531 | Ga0373938_0004446 | 3300034957 | Bacteria | 2345 |
| 532 | Ga0373938_0014150 | 3300034957 | Bacteria | 1527 |
| 533 | Ga0373926_0040529 | 3300035083 | Bacteria | 1663 |
| 534 | Ga0373926_0071092 | 3300035083 | Bacteria | 1279 |
| 535 | Ga0373928_0007197 | 3300035084 | Bacteria | 2146 |
| 536 | Ga0373928_0042926 | 3300035084 | Bacteria | 1045 |
| 537 | Ga0373929_0000124 | 3300035085 | Bacteria | 12765 |
| 538 | Ga0373929_0006484 | 3300035085 | Bacteria | 2116 |
| 539 | Ga0373929_0007906 | 3300035085 | Bacteria | 1953 |
| 540 | Ga0373929_0025379 | 3300035085 | Bacteria | 1230 |
| 541 | Ga0373934_0099392 | 3300035086 | Bacteria | 1176 |
| 542 | Ga0373940_0011652 | 3300035088 | Bacteria | 2093 |
| 543 | Ga0373940_0047469 | 3300035088 | Bacteria | 1197 |
| 544 | Ga0373949_0005140 | 3300035090 | Bacteria | 2938 |
| 545 | Ga0373951_0000233 | 3300035091 | Bacteria | 18990 |
| 546 | Ga0373951_0016081 | 3300035091 | Bacteria | 1687 |
| 547 | Ga0373952_0002094 | 3300035092 | Bacteria | 3588 |
| 548 | Ga0373952_0008590 | 3300035092 | Bacteria | 1940 |
| 549 | Ga0373923_0012453 | 3300035111 | Bacteria | 3144 |
| 550 | Ga0373932_0000369 | 3300035112 | Bacteria | 13870 |
| 551 | Ga0373936_0030358 | 3300035113 | Bacteria | 2131 |
| 552 | Ga0373939_0000589 | 3300035114 | Bacteria | 9057 |
| 553 | Ga0373939_0000999 | 3300035114 | Bacteria | 7003 |
| 554 | Ga0373939_0003749 | 3300035114 | Bacteria | 3581 |
| 555 | Ga0373941_0005015 | 3300035115 | Bacteria | 3087 |
| 556 | Ga0373945_0071501 | 3300035116 | Bacteria | 1314 |
| 557 | Ga0373953_0004850 | 3300035117 | Bacteria | 4323 |
| 558 | Ga0373954_0007712 | 3300035118 | Bacteria | 4710 |
| 559 | Ga0373954_0009461 | 3300035118 | Bacteria | 4287 |
| 560 | Ga0373956_0003621 | 3300035119 | Bacteria | 6234 |
| 561 | Ga0373957_0003018 | 3300035120 | Bacteria | 4890 |
| 562 | Ga0373957_0005217 | 3300035120 | Bacteria | 4018 |
| 563 | Ga0373960_0000741 | 3300035121 | Bacteria | 6816 |
| 564 | Ga0373960_0025402 | 3300035121 | Bacteria | 1610 |
| 565 | Ga0373943_0018589 | 3300035170 | Bacteria | 3195 |
| 566 | Ga0373946_0022964 | 3300035171 | Bacteria | 2433 |
| 567 | Ga0373955_0001226 | 3300035172 | Bacteria | 10903 |
| 568 | Ga0373955_0026941 | 3300035172 | Bacteria | 2966 |
| 569 | Ga0373942_0002793 | 3300035207 | Bacteria | 4158 |
| 570 | Ga0373942_0003759 | 3300035207 | Bacteria | 3555 |
| 571 | Ga0373942_0004850 | 3300035207 | Bacteria | 3123 |
| 572 | Ga0373942_0019599 | 3300035207 | Bacteria | 1690 |
| 573 | Ga0373961_0004509 | 3300035241 | Bacteria | 3367 |
| 574 | Ga0373961_0012391 | 3300035241 | Bacteria | 2134 |
| 575 | Ga0373962_0000152 | 3300035242 | Bacteria | 14343 |
| 576 | Ga0373962_0000699 | 3300035242 | Bacteria | 7580 |
| 577 | Ga0373962_0023858 | 3300035242 | Bacteria | 1632 |
| 578 | Ga0373924_0011339 | 3300035410 | Bacteria | 3309 |
| 579 | Ga0373924_0047181 | 3300035410 | Bacteria | 1777 |
| 580 | Ga0373924_0131175 | 3300035410 | Bacteria | 1090 |
| 581 | Ga0373931_0000179 | 3300035691 | Bacteria | 27558 |
| 582 | Ga0373931_0005009 | 3300035691 | Bacteria | 6094 |
| 583 | Ga0373931_0009136 | 3300035691 | Bacteria | 4730 |
| 584 | Ga0373931_0011482 | 3300035691 | Bacteria | 4281 |
| 585 | Ga0373931_0034856 | 3300035691 | Bacteria | 2614 |
| 586 | Ga0373931_0165942 | 3300035691 | Bacteria | 1298 |
| 587 | Ga0373931_0210897 | 3300035691 | Bacteria | 1165 |
| 588 | Ga0373935_0028870 | 3300035692 | Bacteria | 3429 |
| 589 | Ga0373935_0044071 | 3300035692 | Bacteria | 2810 |
| 590 | Ga0373935_0056098 | 3300035692 | Bacteria | 2511 |
| 591 | Ga0373935_0083897 | 3300035692 | Bacteria | 2075 |
| 592 | Ga0373935_0156754 | 3300035692 | Bacteria | 1549 |
| 593 | Ga0373935_0206077 | 3300035692 | Bacteria | 1361 |
| 594 | Ga0373927_0029934 | 3300035695 | Bacteria | 3551 |
| 595 | Ga0373927_0033369 | 3300035695 | Bacteria | 3352 |
| 596 | Ga0373927_0050999 | 3300035695 | Bacteria | 2676 |
| 597 | Ga0373927_0051352 | 3300035695 | Bacteria | 2666 |
| 598 | Ga0373927_0073060 | 3300035695 | Bacteria | 2221 |
| 599 | Ga0373927_0082831 | 3300035695 | Bacteria | 2080 |
| 600 | Ga0373927_0104838 | 3300035695 | Bacteria | 1841 |
| 601 | Ga0373927_0185770 | 3300035695 | Bacteria | 1363 |
| 602 | Ga0373933_0001753 | 3300035724 | Bacteria | 12585 |
| 603 | Ga0373947_0021159 | 3300035725 | Bacteria | 3763 |
| 604 | Ga0373947_0022989 | 3300035725 | Bacteria | 3623 |
| 605 | Ga0373947_0050332 | 3300035725 | Bacteria | 2505 |
| 606 | Ga0373947_0076121 | 3300035725 | Bacteria | 2068 |
| 607 | Ga0373947_0115820 | 3300035725 | Bacteria | 1699 |
| 608 | Ga0373937_0000879 | 3300036401 | Bacteria | 25733 |
| 609 | Ga0373937_0023251 | 3300036401 | Bacteria | 5579 |
| 610 | Ga0373937_0030498 | 3300036401 | Bacteria | 4883 |
| 611 | Ga0373937_0114376 | 3300036401 | Bacteria | 2512 |
| 612 | Ga0373937_0118016 | 3300036401 | Bacteria | 2471 |
| 613 | Ga0373937_0172835 | 3300036401 | Bacteria | 2027 |
| 614 | Ga0373925_0013172 | 3300037068 | Bacteria | 5986 |
| 615 | Ga0373925_0041837 | 3300037068 | Bacteria | 3398 |
| 616 | Ga0373925_0046184 | 3300037068 | Bacteria | 3238 |
| 617 | Ga0373925_0169925 | 3300037068 | Bacteria | 1721 |
| 618 | Ga0373925_0236231 | 3300037068 | Bacteria | 1463 |
| 619 | Ga0395898_0125956 | 3300037466 | Bacteria | 2454 |
| 620 | Ga0395905_0015104 | 3300037471 | Bacteria | 7351 |
| 621 | Ga0395901_0058034 | 3300038443 | Bacteria | 4026 |
| 622 | Ga0436361_0602366 | 3300039447 | Bacteria | 1020 |
| 623 | Ga0439453_0002256 | 3300041408 | Bacteria | 2632 |
| 624 | Ga0439453_0018346 | 3300041408 | Bacteria | 1236 |
| 625 | Ga0439434_0085432 | 3300042435 | Bacteria | 1005 |
| 626 | Ga0439435_0005924 | 3300042436 | Bacteria | 2718 |
| 627 | Ga0439444_0030390 | 3300042437 | Bacteria | 1011 |
| 628 | Ga0439460_0013337 | 3300042461 | Bacteria | 2148 |
| 629 | Ga0466963_0053385 | 3300044694 | Bacteria | 2683 |
| 630 | Ga0453684_0163789 | 3300044712 | Bacteria | 2627 |
| 631 | Ga0466957_0038975 | 3300044842 | Bacteria | 2866 |
| 632 | Ga0451576_0084542 | 3300045051 | Bacteria | 3301 |
| 633 | Ga0466958_0082777 | 3300045836 | Bacteria | 1977 |
| 634 | Ga0466967_0000948 | 3300045976 | Bacteria | 15662 |
| 635 | Ga0495592_0000513 | 3300046454 | Bacteria | 28143 |
| 636 | Ga0495592_0004552 | 3300046454 | Bacteria | 10152 |
| 637 | Ga0495592_0029018 | 3300046454 | Bacteria | 4188 |
| 638 | Ga0495592_0106118 | 3300046454 | Bacteria | 1994 |
| 639 | Ga0495603_0007105 | 3300046455 | Bacteria | 6720 |
| 640 | Ga0495603_0047882 | 3300046455 | Bacteria | 2545 |
| 641 | Ga0495590_0057575 | 3300046457 | Bacteria | 1359 |
| 642 | Ga0495629_0000062 | 3300046459 | Bacteria | 97169 |
| 643 | Ga0495629_0002976 | 3300046459 | Bacteria | 12894 |
| 644 | Ga0495629_0186305 | 3300046459 | Bacteria | 1437 |
| 645 | Ga0495651_0000910 | 3300046462 | Bacteria | 22944 |
| 646 | Ga0495651_0006020 | 3300046462 | Bacteria | 9260 |
| 647 | Ga0495651_0030341 | 3300046462 | Bacteria | 4216 |
| 648 | Ga0495653_0002622 | 3300046463 | Bacteria | 14311 |
| 649 | Ga0495653_0003316 | 3300046463 | Bacteria | 12926 |
| 650 | Ga0495580_0055899 | 3300046472 | Bacteria | 2780 |
| 651 | Ga0495580_0130748 | 3300046472 | Bacteria | 1742 |
| 652 | Ga0495580_0168882 | 3300046472 | Bacteria | 1513 |
| 653 | Ga0495580_0402650 | 3300046472 | Bacteria | 922 |
| 654 | Ga0495639_0058896 | 3300046475 | Bacteria | 1758 |
| 655 | Ga0495639_0071772 | 3300046475 | Bacteria | 1600 |
| 656 | Ga0495639_0118000 | 3300046475 | Bacteria | 1264 |
| 657 | Ga0495662_0026233 | 3300046476 | Bacteria | 2814 |
| 658 | Ga0495662_0032498 | 3300046476 | Bacteria | 2521 |
| 659 | Ga0495664_0000434 | 3300046477 | Bacteria | 20493 |
| 660 | Ga0495664_0199514 | 3300046477 | Bacteria | 1212 |
| 661 | Ga0495664_0214078 | 3300046477 | Bacteria | 1167 |
| 662 | Ga0495584_0049211 | 3300046491 | Bacteria | 2124 |
| 663 | Ga0495594_0088820 | 3300046499 | Bacteria | 1730 |
| 664 | Ga0495594_0211177 | 3300046499 | Bacteria | 1107 |
| 665 | Ga0495608_0001525 | 3300046511 | Bacteria | 16483 |
| 666 | Ga0495608_0007060 | 3300046511 | Bacteria | 7950 |
| 667 | Ga0495608_0149567 | 3300046511 | Bacteria | 1488 |
| 668 | Ga0495618_0014292 | 3300046514 | Bacteria | 4834 |
| 669 | Ga0495628_0008936 | 3300046516 | Bacteria | 8568 |
| 670 | Ga0495628_0038743 | 3300046516 | Bacteria | 3813 |
| 671 | Ga0495628_0063040 | 3300046516 | Bacteria | 2904 |
| 672 | Ga0495628_0087887 | 3300046516 | Bacteria | 2409 |
| 673 | Ga0495630_0047958 | 3300046517 | Bacteria | 3196 |
| 674 | Ga0495630_0057021 | 3300046517 | Bacteria | 2927 |
| 675 | Ga0495630_0215911 | 3300046517 | Bacteria | 1464 |
| 676 | Ga0495630_0228151 | 3300046517 | Bacteria | 1422 |
| 677 | Ga0495648_0006759 | 3300046524 | Bacteria | 9274 |
| 678 | Ga0495666_0026964 | 3300046526 | Bacteria | 2828 |
| 679 | Ga0495666_0077515 | 3300046526 | Bacteria | 1575 |
| 680 | Ga0495642_0088866 | 3300046528 | Bacteria | 1307 |
| 681 | Ga0495652_0011195 | 3300046529 | Bacteria | 8123 |
| 682 | Ga0495652_0028653 | 3300046529 | Bacteria | 4898 |
| 683 | Ga0495652_0055382 | 3300046529 | Bacteria | 3372 |
| 684 | Ga0495652_0111242 | 3300046529 | Bacteria | 2202 |
| 685 | Ga0495652_0168606 | 3300046529 | Bacteria | 1692 |
| 686 | Ga0495665_0035362 | 3300046531 | Bacteria | 2669 |
| 687 | Ga0495665_0089448 | 3300046531 | Bacteria | 1618 |
| 688 | Ga0495640_0003016 | 3300046533 | Bacteria | 13550 |
| 689 | Ga0495640_0024844 | 3300046533 | Bacteria | 4353 |
| 690 | Ga0495640_0147263 | 3300046533 | Bacteria | 1514 |
| 691 | Ga0495587_0001060 | 3300046536 | Bacteria | 18094 |
| 692 | Ga0495587_0014613 | 3300046536 | Bacteria | 4918 |
| 693 | Ga0495645_0000746 | 3300046543 | Bacteria | 22248 |
| 694 | Ga0495645_0000974 | 3300046543 | Bacteria | 19495 |
| 695 | Ga0495645_0066570 | 3300046543 | Bacteria | 2603 |
| 696 | Ga0495645_0367647 | 3300046543 | Bacteria | 923 |
| 697 | Ga0495622_0102534 | 3300046557 | Bacteria | 1311 |
| 698 | Ga0495667_0003474 | 3300046559 | Bacteria | 10559 |
| 699 | Ga0495667_0006015 | 3300046559 | Bacteria | 8208 |
| 700 | Ga0495667_0012221 | 3300046559 | Bacteria | 5817 |
| 701 | Ga0495667_0041577 | 3300046559 | Bacteria | 3048 |
| 702 | Ga0495667_0068049 | 3300046559 | Bacteria | 2326 |
| 703 | Ga0495634_0039270 | 3300046642 | Bacteria | 3223 |
| 704 | Ga0495634_0162669 | 3300046642 | Bacteria | 1406 |
| 705 | Ga0495635_0018303 | 3300046663 | Bacteria | 4888 |
| 706 | Ga0495635_0072101 | 3300046663 | Bacteria | 2367 |
| 707 | Ga0495635_0103107 | 3300046663 | Bacteria | 1950 |
| 708 | Ga0495635_0107294 | 3300046663 | Bacteria | 1907 |
| 709 | Ga0495635_0136865 | 3300046663 | Bacteria | 1669 |
| 710 | Ga0495588_0127935 | 3300046674 | Bacteria | 1340 |
| 711 | Ga0495657_0087975 | 3300046675 | Bacteria | 1998 |
| 712 | Ga0495657_0093258 | 3300046675 | Bacteria | 1928 |
| 713 | Ga0495599_0015965 | 3300046678 | Bacteria | 4661 |
| 714 | Ga0495599_0032589 | 3300046678 | Bacteria | 3270 |
| 715 | Ga0495623_0001158 | 3300046679 | Bacteria | 17853 |
| 716 | Ga0495623_0090844 | 3300046679 | Bacteria | 1874 |
| 717 | Ga0495623_0095398 | 3300046679 | Bacteria | 1818 |
| 718 | Ga0495647_0021743 | 3300046681 | Bacteria | 2312 |
| 719 | Ga0495647_0052913 | 3300046681 | Bacteria | 1582 |
| 720 | Ga0495658_0000718 | 3300046683 | Bacteria | 17919 |
| 721 | Ga0495613_0007258 | 3300046689 | Bacteria | 8249 |
| 722 | Ga0495613_0031576 | 3300046689 | Bacteria | 3935 |
| 723 | Ga0495613_0033647 | 3300046689 | Bacteria | 3808 |
| 724 | Ga0495613_0110546 | 3300046689 | Bacteria | 1980 |
| 725 | Ga0495613_0204308 | 3300046689 | Bacteria | 1392 |
| 726 | Ga0495624_0027104 | 3300046690 | Bacteria | 3754 |
| 727 | Ga0495624_0062901 | 3300046690 | Bacteria | 2321 |
| 728 | Ga0495624_0100157 | 3300046690 | Bacteria | 1784 |
| 729 | Ga0495624_0241521 | 3300046690 | Bacteria | 1093 |
| 730 | Ga0495600_0002131 | 3300046809 | Bacteria | 11199 |
| 731 | Ga0495600_0007139 | 3300046809 | Bacteria | 6821 |
| 732 | Ga0495600_0034255 | 3300046809 | Bacteria | 3296 |
| 733 | Ga0495581_0012167 | 3300047315 | Bacteria | 4982 |
| 734 | Ga0495604_0004590 | 3300047317 | Bacteria | 10940 |
| 735 | Ga0495604_0013622 | 3300047317 | Bacteria | 6484 |
| 736 | Ga0495604_0027286 | 3300047317 | Bacteria | 4543 |
| 737 | Ga0495604_0110595 | 3300047317 | Bacteria | 2004 |
| 738 | Ga0495674_0003969 | 3300047319 | Bacteria | 14347 |
| 739 | Ga0495674_0006778 | 3300047319 | Bacteria | 10968 |
| 740 | Ga0495674_0014686 | 3300047319 | Bacteria | 7328 |
| 741 | Ga0495674_0079153 | 3300047319 | Bacteria | 2823 |
| 742 | Ga0495674_0121575 | 3300047319 | Bacteria | 2205 |
| 743 | Ga0495674_0152639 | 3300047319 | Bacteria | 1936 |
| 744 | Ga0495676_0071454 | 3300047321 | Bacteria | 2668 |
| 745 | Ga0495680_0000483 | 3300047322 | Bacteria | 44818 |
| 746 | Ga0495680_0012821 | 3300047322 | Bacteria | 7347 |
| 747 | Ga0495680_0017319 | 3300047322 | Bacteria | 6157 |
| 748 | Ga0495680_0041448 | 3300047322 | Bacteria | 3661 |
| 749 | Ga0495680_0048920 | 3300047322 | Bacteria | 3317 |
| 750 | Ga0495675_0000190 | 3300047444 | Bacteria | 44968 |
| 751 | Ga0495675_0010552 | 3300047444 | Bacteria | 5774 |
| 752 | Ga0495675_0072610 | 3300047444 | Bacteria | 2171 |
| 753 | Ga0495684_0007568 | 3300047471 | Bacteria | 8404 |
| 754 | Ga0495684_0018874 | 3300047471 | Bacteria | 5310 |
| 755 | Ga0495684_0046954 | 3300047471 | Bacteria | 3303 |
| 756 | Ga0495684_0347791 | 3300047471 | Bacteria | 1053 |
| 757 | Ga0495593_0050779 | 3300047673 | Bacteria | 2196 |
| 758 | Ga0495593_0083724 | 3300047673 | Bacteria | 1647 |
| 759 | Ga0495602_0015694 | 3300048088 | Bacteria | 7636 |
| 760 | Ga0495602_0027846 | 3300048088 | Bacteria | 5420 |
| 761 | Ga0495602_0045776 | 3300048088 | Bacteria | 3957 |
| 762 | Ga0496100_0002755 | 3300048903 | Bacteria | 8989 |
| 763 | Ga0496100_0034175 | 3300048903 | Bacteria | 3188 |
| 764 | Ga0496100_0151684 | 3300048903 | Bacteria | 1654 |
| 765 | Ga0496101_0001110 | 3300048904 | Bacteria | 16020 |
| 766 | Ga0496101_0027634 | 3300048904 | Bacteria | 3954 |
| 767 | Ga0496102_0071501 | 3300048905 | Bacteria | 3185 |
| 768 | Ga0496102_0074399 | 3300048905 | Bacteria | 3122 |
| 769 | Ga0496102_0461045 | 3300048905 | Bacteria | 1192 |
| 770 | Ga0496102_0467254 | 3300048905 | Bacteria | 1182 |
| 771 | Ga0496103_0000582 | 3300048906 | Bacteria | 28897 |
| 772 | Ga0496103_0318700 | 3300048906 | Bacteria | 1000 |
| 773 | Ga0496104_0000067 | 3300048907 | Bacteria | 108556 |
| 774 | Ga0496104_0042201 | 3300048907 | Bacteria | 4280 |
| 775 | Ga0496104_0253100 | 3300048907 | Bacteria | 1674 |
| 776 | Ga0496104_0714322 | 3300048907 | Bacteria | 910 |
| 777 | Ga0496105_0002048 | 3300048908 | Bacteria | 14575 |
| 778 | Ga0496105_0126452 | 3300048908 | Bacteria | 2107 |
| 779 | Ga0496105_0150300 | 3300048908 | Bacteria | 1914 |
| 780 | Ga0496106_0002855 | 3300048909 | Bacteria | 12833 |
| 781 | Ga0496106_0013139 | 3300048909 | Bacteria | 6110 |
| 782 | Ga0496106_0046743 | 3300048909 | Bacteria | 3255 |
| 783 | Ga0496107_0001812 | 3300048910 | Bacteria | 13471 |
| 784 | Ga0496107_0013359 | 3300048910 | Bacteria | 5737 |
| 785 | Ga0496107_0025580 | 3300048910 | Bacteria | 4179 |
| 786 | Ga0496107_0120043 | 3300048910 | Bacteria | 1936 |
| 787 | Ga0496107_0415043 | 3300048910 | Bacteria | 1001 |
| 788 | Ga0496108_0007050 | 3300048911 | Bacteria | 9098 |
| 789 | Ga0496109_0000384 | 3300048912 | Bacteria | 40091 |
| 790 | Ga0496109_0011720 | 3300048912 | Bacteria | 7541 |
| 791 | Ga0496110_0022806 | 3300048913 | Bacteria | 5319 |
| 792 | Ga0496110_0062149 | 3300048913 | Bacteria | 3298 |
| 793 | Ga0496110_0217776 | 3300048913 | Bacteria | 1736 |
| 794 | Ga0496110_0222035 | 3300048913 | Bacteria | 1718 |
| 795 | Ga0496110_0281809 | 3300048913 | Bacteria | 1513 |
| 796 | Ga0496110_0328726 | 3300048913 | Bacteria | 1393 |
| 797 | Ga0496111_0044821 | 3300048914 | Bacteria | 3180 |
| 798 | Ga0496111_0045761 | 3300048914 | Bacteria | 3149 |
| 799 | Ga0496111_0073964 | 3300048914 | Bacteria | 2481 |
| 800 | Ga0496111_0099066 | 3300048914 | Bacteria | 2141 |
| 801 | Ga0496111_0349424 | 3300048914 | Bacteria | 1095 |
| 802 | Ga0496112_0093115 | 3300048915 | Bacteria | 2983 |
| 803 | Ga0496112_0235700 | 3300048915 | Bacteria | 1784 |
| 804 | Ga0496113_0000688 | 3300048916 | Bacteria | 17242 |
| 805 | Ga0496113_0041084 | 3300048916 | Bacteria | 3411 |
| 806 | Ga0496113_0176908 | 3300048916 | Bacteria | 1691 |
| 807 | Ga0496113_0351627 | 3300048916 | Bacteria | 1182 |
| 808 | Ga0496113_0416634 | 3300048916 | Bacteria | 1079 |
| 809 | Ga0496113_0570320 | 3300048916 | Bacteria | 907 |
| 810 | Ga0496114_0003688 | 3300048917 | Bacteria | 11784 |
| 811 | Ga0496114_0053456 | 3300048917 | Bacteria | 3366 |
| 812 | Ga0496114_0158427 | 3300048917 | Bacteria | 1967 |
| 813 | Ga0496114_0199098 | 3300048917 | Bacteria | 1754 |
| 814 | Ga0496115_0002409 | 3300048918 | Bacteria | 13422 |
| 815 | Ga0496115_0358420 | 3300048918 | Bacteria | 1189 |
| 816 | Ga0501298_035278 | 3300049521 | Bacteria | 997 |
| 817 | Ga0501034_0588563 | 3300049571 | Bacteria | 1019 |
| 818 | Ga0501040_0319370 | 3300049576 | Bacteria | 1111 |
| 819 | Ga0501047_0004391 | 3300049581 | Bacteria | 13273 |
| 820 | Ga0501047_0085249 | 3300049581 | Bacteria | 3035 |
| 821 | Ga0501067_0200370 | 3300049583 | Bacteria | 1112 |
| 822 | Ga0501070_0347312 | 3300049586 | Bacteria | 1205 |
| 823 | Ga0501076_0016620 | 3300049592 | Bacteria | 5579 |
| 824 | Ga0501077_0122310 | 3300049593 | Bacteria | 1650 |
| 825 | Ga0501216_030767 | 3300049660 | Bacteria | 990 |
| 826 | Ga0501083_0187225 | 3300049744 | Bacteria | 1351 |
| 827 | Ga0501044_0022774 | 3300049823 | Bacteria | 6671 |
| 828 | Ga0501044_0084587 | 3300049823 | Bacteria | 3206 |
| 829 | nmdc:mga0yw44_289343_c1 | 3300050492 | Bacteria | 1096 |
| 830 | nmdc:mga0k408_15140_c1 | 3300050493 | Bacteria | 4263 |
| 831 | nmdc:mga0k408_226267_c1 | 3300050493 | Bacteria | 1117 |
| 832 | nmdc:mga06z11_87457_c1 | 3300050494 | Bacteria | 1685 |
| 833 | nmdc:mga05p37_133416_c1 | 3300050507 | Bacteria | 3046 |
| 834 | nmdc:mga05p37_19_c2 | 3300050507 | Bacteria | 99994 |
| 835 | nmdc:mga05p37_219821_c1 | 3300050507 | Bacteria | 2293 |
| 836 | nmdc:mga05p37_5389_c1 | 3300050507 | Bacteria | 15038 |
| 837 | nmdc:mga05p37_93380_c1 | 3300050507 | Bacteria | 3708 |
| 838 | nmdc:mga09592_238_c1 | 3300050508 | Bacteria | 40013 |
| 839 | nmdc:mga09592_27607_c1 | 3300050508 | Bacteria | 4712 |
| 840 | nmdc:mga0qj67_13539_c1 | 3300050509 | Bacteria | 6153 |
| 841 | nmdc:mga0qj67_67254_c1 | 3300050509 | Bacteria | 2855 |
| 842 | nmdc:mga06r32_108717_c1 | 3300050510 | Bacteria | 2727 |
| 843 | nmdc:mga06r32_2023_c1 | 3300050510 | Bacteria | 18128 |
| 844 | nmdc:mga08y16_18813_c1 | 3300050511 | Bacteria | 7278 |
| 845 | nmdc:mga08y16_208_c1 | 3300050511 | Bacteria | 52742 |
| 846 | nmdc:mga08y16_2735_c1 | 3300050511 | Bacteria | 18090 |
| 847 | nmdc:mga08y16_58085_c1 | 3300050511 | Bacteria | 4042 |
| 848 | nmdc:mga08y16_80129_c1 | 3300050511 | Bacteria | 3404 |
| 849 | nmdc:mga08y16_842162_c1 | 3300050511 | Bacteria | 907 |
| 850 | nmdc:mga08y16_85971_c1 | 3300050511 | Bacteria | 3278 |
| 851 | nmdc:mga0n895_10569_c1 | 3300050512 | Bacteria | 8167 |
| 852 | nmdc:mga0n895_173295_c1 | 3300050512 | Bacteria | 2189 |
| 853 | nmdc:mga0n895_3108_c1 | 3300050512 | Bacteria | 13226 |
| 854 | nmdc:mga0n895_34398_c1 | 3300050512 | Bacteria | 4877 |
| 855 | nmdc:mga0n895_394_c1 | 3300050512 | Bacteria | 29311 |
| 856 | nmdc:mga0n895_7653_c1 | 3300050512 | Bacteria | 9289 |
| 857 | nmdc:mga0rr50_229110_c1 | 3300050513 | Bacteria | 1537 |
| 858 | nmdc:mga0rr50_45215_c1 | 3300050513 | Bacteria | 3234 |
| 859 | nmdc:mga0rr50_5567_c1 | 3300050513 | Bacteria | 7534 |
| 860 | nmdc:mga0rr50_68416_c1 | 3300050513 | Bacteria | 2700 |
| 861 | nmdc:mga0a205_1167_c1 | 3300050515 | Bacteria | 5965 |
| 862 | nmdc:mga0a205_143051_c1 | 3300050515 | Bacteria | 2292 |
| 863 | nmdc:mga0a205_186874_c1 | 3300050515 | Bacteria | 1965 |
| 864 | nmdc:mga0a205_26111_c1 | 3300050515 | Bacteria | 5565 |
| 865 | nmdc:mga0a205_5198_c1 | 3300050515 | Bacteria | 11710 |
| 866 | nmdc:mga0a205_5655_c1 | 3300050515 | Bacteria | 11262 |
| 867 | Ga0495601_0000711 | 3300053077 | Bacteria | 17861 |
| 868 | Ga0495601_0001809 | 3300053077 | Bacteria | 11873 |
| 869 | Ga0495601_0005275 | 3300053077 | Bacteria | 7517 |
| 870 | Ga0495601_0005584 | 3300053077 | Bacteria | 7335 |
| 871 | Ga0495601_0008024 | 3300053077 | Bacteria | 6221 |
| 872 | Ga0495601_0009061 | 3300053077 | Bacteria | 5877 |
| 873 | Ga0495601_0013226 | 3300053077 | Bacteria | 4962 |
| 874 | Ga0495601_0114635 | 3300053077 | Bacteria | 1747 |
| 875 | Ga0495612_0000152 | 3300053078 | Bacteria | 29021 |
| 876 | Ga0495612_0002060 | 3300053078 | Bacteria | 8276 |
| 877 | Ga0495612_0014302 | 3300053078 | Bacteria | 3192 |
| 878 | Ga0495612_0017950 | 3300053078 | Bacteria | 2832 |
| 879 | Ga0495612_0021257 | 3300053078 | Bacteria | 2603 |
| 880 | Ga0495612_0058494 | 3300053078 | Bacteria | 1593 |
| 881 | Ga0495655_0046359 | 3300053083 | Bacteria | 1133 |
| 882 | Ga0495595_0001635 | 3300053084 | Bacteria | 8761 |
| 883 | Ga0495595_0004190 | 3300053084 | Bacteria | 5800 |
| 884 | Ga0495595_0012712 | 3300053084 | Bacteria | 3545 |
| 885 | Ga0495595_0050676 | 3300053084 | Bacteria | 1923 |
| 886 | Ga0495595_0074797 | 3300053084 | Bacteria | 1606 |
| 887 | Ga0495619_0000052 | 3300053085 | Bacteria | 98882 |
| 888 | Ga0495619_0000078 | 3300053085 | Bacteria | 72749 |
| 889 | Ga0495619_0001503 | 3300053085 | Bacteria | 15362 |
| 890 | Ga0495619_0003543 | 3300053085 | Bacteria | 10077 |
| 891 | Ga0495619_0003933 | 3300053085 | Bacteria | 9547 |
| 892 | Ga0495619_0009181 | 3300053085 | Bacteria | 6245 |
| 893 | Ga0495619_0028201 | 3300053085 | Bacteria | 3620 |
| 894 | Ga0500642_0019927 | 3300053130 | Bacteria | 2626 |
| 895 | Ga0501084_0173473 | 3300054114 | Bacteria | 1820 |
| 896 | Ga0530510_0504009 | 3300061734 | Bacteria | 918 |
| 897 | 2876767338 | 2876761206 | Bacteria | 10111113 |
| 898 | 2876816647 | 2876808645 | Bacteria | 8824342 |
| 899 | 2879110174 | 2879110137 | Bacteria | 8907982 |
| 900 | 2885419104 | 2885409591 | Bacteria | 9235467 |
| 901 | 2922361244 | 2922361189 | Bacteria | 7436256 |
| 902 | Ga0070713_100130590 | |||
| 903 | 2214628267 | |||
| 904 | ARcpr5oldR_c000007 | |||
| 905 | ARcpr5yngRDRAFT_c000456 | |||
| 906 | ARSoilOldRDRAFT_c000004 | |||
| 907 | ARCol0oldRDRAFT_c00335 | |||
| 908 | ARCol0yngRDRAFT_1000002 | |||
| 909 | JGI24746J21847_1001973 | |||
| 910 | JGI24740J21852_10024717 | |||
| 911 | JGI24737J22298_10001147 | |||
| 912 | JGI24750J21931_1000100 | |||
| 913 | JGI24745J21846_1002936 | |||
| 914 | JGI24738J21930_10000155 | |||
| 915 | JGI24749J21850_1000093 | |||
| 916 | JGI24744J21845_10000499 | |||
| 917 | JGI24742J22300_10000079 | |||
| 918 | JGI25153J46596_10013295 | |||
| 919 | JGI25153J46596_10015068 | |||
| 920 | JGI25405J52794_10013204 | |||
| 921 | JGI25405J52794_10031827 | |||
| 922 | Ga0065717_1002392 | |||
| 923 | Ga0065716_1000034 | |||
| 924 | Ga0065704_10102560 | |||
| 925 | Ga0065715_10000599 | |||
| 926 | Ga0065715_10088946 | |||
| 927 | Ga0070676_10000514 | |||
| 928 | Ga0070676_10084468 | |||
| 929 | Ga0070683_100000931 | |||
| 930 | Ga0070683_100109638 | |||
| 931 | Ga0070690_100002803 | |||
| 932 | Ga0070690_100024319 | |||
| 933 | Ga0070690_100426610 | |||
| 934 | Ga0070670_100013151 | |||
| 935 | Ga0068869_100000153 | |||
| 936 | Ga0068869_100267360 | |||
| 937 | Ga0070666_10013476 | |||
| 938 | Ga0070680_100000814 | |||
| 939 | Ga0070680_100061445 | |||
| 940 | Ga0070680_100152901 | |||
| 941 | Ga0070682_100000445 | |||
| 942 | Ga0070682_100002065 | |||
| 943 | Ga0070682_100107042 | |||
| 944 | Ga0068868_100000148 | |||
| 945 | Ga0068868_100246395 | |||
| 946 | Ga0070660_100001480 | |||
| 947 | Ga0070660_100076309 | |||
| 948 | Ga0070660_100237325 | |||
| 949 | Ga0070689_100000880 | |||
| 950 | Ga0070689_100008335 | |||
| 951 | Ga0070689_100014989 | |||
| 952 | Ga0070689_100072547 | |||
| 953 | Ga0070689_100086333 | |||
| 954 | Ga0070691_10002726 | |||
| 955 | Ga0070691_10153385 | |||
| 956 | Ga0070687_100000187 | |||
| 957 | Ga0070687_100000759 | |||
| 958 | Ga0070687_100022132 | |||
| 959 | Ga0070661_100004477 | |||
| 960 | Ga0070661_100139005 | |||
| 961 | Ga0070692_10001230 | |||
| 962 | Ga0070692_10056825 | |||
| 963 | Ga0070668_100100592 | |||
| 964 | Ga0070668_100220924 | |||
| 965 | Ga0070669_100000501 | |||
| 966 | Ga0070669_100157391 | |||
| 967 | Ga0070669_100204113 | |||
| 968 | Ga0070675_100027368 | |||
| 969 | Ga0070675_100086697 | |||
| 970 | Ga0070675_100231393 | |||
| 971 | Ga0070675_100410630 | |||
| 972 | Ga0070671_100000595 | |||
| 973 | Ga0070671_100015975 | |||
| 974 | Ga0070671_100017211 | |||
| 975 | Ga0070671_100135240 | |||
| 976 | Ga0070674_100000249 | |||
| 977 | Ga0070673_100000233 | |||
| 978 | Ga0070673_100353400 | |||
| 979 | Ga0070688_100000432 | |||
| 980 | Ga0070688_100011750 | |||
| 981 | Ga0070688_100044365 | |||
| 982 | Ga0070688_100137683 | |||
| 983 | Ga0070659_100000746 | |||
| 984 | Ga0070659_100031480 | |||
| 985 | Ga0070659_100203184 | |||
| 986 | Ga0070659_100420286 | |||
| 987 | Ga0070667_100001881 | |||
| 988 | Ga0070667_100091596 | |||
| 989 | Ga0070709_10332630 | |||
| 990 | Ga0070714_100034213 | |||
| 991 | Ga0070714_100286953 | |||
| 992 | Ga0070714_100543427 | |||
| 993 | Ga0070714_100562348 | |||
| 994 | Ga0070713_100008986 | |||
| 995 | Ga0070713_100049334 | |||
| 996 | Ga0070713_100370313 | |||
| 997 | Ga0070710_10008769 | |||
| 998 | Ga0070710_10048777 | |||
| 999 | Ga0070701_10000164 | |||
| 1000 | Ga0070701_10023111 | |||
| 1001 | Ga0070711_100024101 | |||
| 1002 | Ga0070711_100045468 | |||
| 1003 | Ga0070711_100047217 | |||
| 1004 | Ga0070711_100579964 | |||
| 1005 | Ga0070705_100000361 | |||
| 1006 | Ga0070705_100046519 | |||
| 1007 | Ga0070705_100199445 | |||
| 1008 | Ga0070700_100000357 | |||
| 1009 | Ga0070700_100097542 | |||
| 1010 | Ga0070694_100006390 | |||
| 1011 | Ga0070708_100075489 | |||
| 1012 | Ga0070708_100181371 | |||
| 1013 | Ga0070708_100194207 | |||
| 1014 | Ga0070663_100000582 | |||
| 1015 | Ga0070663_100055944 | |||
| 1016 | Ga0070678_100001403 | |||
| 1017 | Ga0070678_100018262 | |||
| 1018 | Ga0070662_100067944 | |||
| 1019 | Ga0070662_100217534 | |||
| 1020 | Ga0070662_100249064 | |||
| 1021 | Ga0070681_10004898 | |||
| 1022 | Ga0070681_10119251 | |||
| 1023 | Ga0070681_10341154 | |||
| 1024 | Ga0068867_100001099 | |||
| 1025 | Ga0068867_100230617 | |||
| 1026 | Ga0070685_10003380 | |||
| 1027 | Ga0070685_10011632 | |||
| 1028 | Ga0070685_10036784 | |||
| 1029 | Ga0070685_10258981 | |||
| 1030 | Ga0070706_100007863 | |||
| 1031 | Ga0070698_100001449 | |||
| 1032 | Ga0070698_100418283 | |||
| 1033 | Ga0070699_100063915 | |||
| 1034 | Ga0070679_100002583 | |||
| 1035 | Ga0070679_100021338 | |||
| 1036 | Ga0070679_100054026 | |||
| 1037 | Ga0070679_100250784 | |||
| 1038 | Ga0070684_100000101 | |||
| 1039 | Ga0070684_100114837 | |||
| 1040 | Ga0070697_100092376 | |||
| 1041 | Ga0070697_100094047 | |||
| 1042 | Ga0070697_100275893 | |||
| 1043 | Ga0068853_100003127 | |||
| 1044 | Ga0068853_100009271 | |||
| 1045 | Ga0068853_100021629 | |||
| 1046 | Ga0070672_100001273 | |||
| 1047 | Ga0070672_100081337 | |||
| 1048 | Ga0070686_100000532 | |||
| 1049 | Ga0070686_100120629 | |||
| 1050 | Ga0070695_100002491 | |||
| 1051 | Ga0070695_100015081 | |||
| 1052 | Ga0070696_100014847 | |||
| 1053 | Ga0070693_100000138 | |||
| 1054 | Ga0070693_100004377 | |||
| 1055 | Ga0070665_100027794 | |||
| 1056 | Ga0070665_100169759 | |||
| 1057 | Ga0070665_100218608 | |||
| 1058 | Ga0070665_100587568 | |||
| 1059 | Ga0070704_100003765 | |||
| 1060 | Ga0070704_100087143 | |||
| 1061 | Ga0070704_100096936 | |||
| 1062 | Ga0068855_100020794 | |||
| 1063 | Ga0068855_100052371 | |||
| 1064 | Ga0068855_100301574 | |||
| 1065 | Ga0070664_100000614 | |||
| 1066 | Ga0070664_100161850 | |||
| 1067 | Ga0070664_100229707 | |||
| 1068 | Ga0070664_100327166 | |||
| 1069 | Ga0070664_100649104 | |||
| 1070 | Ga0068857_100001072 | |||
| 1071 | Ga0068854_100000909 | |||
| 1072 | Ga0068856_100017822 | |||
| 1073 | Ga0068856_100100018 | |||
| 1074 | Ga0068856_100524182 | |||
| 1075 | Ga0070702_100212642 | |||
| 1076 | Ga0068852_100000713 | |||
| 1077 | Ga0068859_100001523 | |||
| 1078 | Ga0068859_100075587 | |||
| 1079 | Ga0068859_100171343 | |||
| 1080 | Ga0068864_100000715 | |||
| 1081 | Ga0068864_100150463 | |||
| 1082 | Ga0068866_10000861 | |||
| 1083 | Ga0068861_100000574 | |||
| 1084 | Ga0068861_100060575 | |||
| 1085 | Ga0068861_100307059 | |||
| 1086 | Ga0068870_10000009 | |||
| 1087 | Ga0068870_10009685 | |||
| 1088 | Ga0068863_100001272 | |||
| 1089 | Ga0068863_100346092 | |||
| 1090 | Ga0068858_100048713 | |||
| 1091 | Ga0068858_100048887 | |||
| 1092 | Ga0068858_100124860 | |||
| 1093 | Ga0068860_100001758 | |||
| 1094 | Ga0068860_100045883 | |||
| 1095 | Ga0068860_100053056 | |||
| 1096 | Ga0068860_100281328 | |||
| 1097 | Ga0068862_100005607 | |||
| 1098 | Ga0068862_100070041 | |||
| 1099 | Ga0081455_10000002 | |||
| 1100 | Ga0081455_10075087 | |||
| 1101 | Ga0081455_10263365 | |||
| 1102 | Ga0070717_10060654 | |||
| 1103 | Ga0070717_10205797 | |||
| 1104 | Ga0075363_100191467 | |||
| 1105 | Ga0075432_10003208 | |||
| 1106 | Ga0070716_100021278 | |||
| 1107 | Ga0070712_100050502 | |||
| 1108 | Ga0070712_100136022 | |||
| 1109 | Ga0075367_10111970 | |||
| 1110 | Ga0075369_10018049 | |||
| 1111 | Ga0075366_10033744 | |||
| 1112 | Ga0075366_10107721 | |||
| 1113 | Ga0097621_100001018 | |||
| 1114 | Ga0075370_10145685 | |||
| 1115 | Ga0068871_100000012 | |||
| 1116 | Ga0068871_100148471 | |||
| 1117 | Ga0075428_100001200 | |||
| 1118 | Ga0075428_100170370 | |||
| 1119 | Ga0075428_100245014 | |||
| 1120 | Ga0075430_100000032 | |||
| 1121 | Ga0075430_100024887 | |||
| 1122 | Ga0075431_100000462 | |||
| 1123 | Ga0075431_100148619 | |||
| 1124 | Ga0075433_10000072 | |||
| 1125 | Ga0075433_10001122 | |||
| 1126 | Ga0075433_10023300 | |||
| 1127 | Ga0075433_10033971 | |||
| 1128 | Ga0075433_10038289 | |||
| 1129 | Ga0075434_100000341 | |||
| 1130 | Ga0075434_100001564 | |||
| 1131 | Ga0075434_100001937 | |||
| 1132 | Ga0075434_100013026 | |||
| 1133 | Ga0075434_100023536 | |||
| 1134 | Ga0075434_100026026 | |||
| 1135 | Ga0075434_100050267 | |||
| 1136 | Ga0075434_100192179 | |||
| 1137 | Ga0075434_100269253 | |||
| 1138 | Ga0075429_100000631 | |||
| 1139 | Ga0075429_100111563 | |||
| 1140 | Ga0075429_100692360 | |||
| 1141 | Ga0068865_100000328 | |||
| 1142 | Ga0075436_100471206 | |||
| 1143 | Ga0097620_100001523 | |||
| 1144 | Ga0097620_100075588 | |||
| 1145 | Ga0097620_100171336 | |||
| 1146 | Ga0075435_100007539 | |||
| 1147 | Ga0075435_100018432 | |||
| 1148 | Ga0075435_100033377 | |||
| 1149 | Ga0075435_100096198 | |||
| 1150 | Ga0075435_100199808 | |||
| 1151 | Ga0099795_10051916 | |||
| 1152 | Ga0099795_10116589 | |||
| 1153 | Ga0105251_10051946 | |||
| 1154 | Ga0105240_10016810 | |||
| 1155 | Ga0111539_10000915 | |||
| 1156 | Ga0111539_10001908 | |||
| 1157 | Ga0111539_10002936 | |||
| 1158 | Ga0111539_10033531 | |||
| 1159 | Ga0111539_10041767 | |||
| 1160 | Ga0111539_10041772 | |||
| 1161 | Ga0111539_10129768 | |||
| 1162 | Ga0105245_10001404 | |||
| 1163 | Ga0105245_10200346 | |||
| 1164 | Ga0105247_10020951 | |||
| 1165 | Ga0105247_10087657 | |||
| 1166 | Ga0105247_10167039 | |||
| 1167 | Ga0105247_10314403 | |||
| 1168 | Ga0114129_10001035 | |||
| 1169 | Ga0114129_10001551 | |||
| 1170 | Ga0114129_10232960 | |||
| 1171 | Ga0114129_10264205 | |||
| 1172 | Ga0114129_10686897 | |||
| 1173 | Ga0105243_10001028 | |||
| 1174 | Ga0105243_10100290 | |||
| 1175 | Ga0105243_10139703 | |||
| 1176 | Ga0105243_10408260 | |||
| 1177 | Ga0105241_10000720 | |||
| 1178 | Ga0105241_10028053 | |||
| 1179 | Ga0105242_10000607 | |||
| 1180 | Ga0105242_10131222 | |||
| 1181 | Ga0105242_10147864 | |||
| 1182 | Ga0105248_10000309 | |||
| 1183 | Ga0105248_10019080 | |||
| 1184 | Ga0105248_10099089 | |||
| 1185 | Ga0105248_10522825 | |||
| 1186 | Ga0105237_10004962 | |||
| 1187 | Ga0105237_10266048 | |||
| 1188 | Ga0105238_10281483 | |||
| 1189 | Ga0105238_10377742 | |||
| 1190 | Ga0105249_10000486 | |||
| 1191 | Ga0105249_10053545 | |||
| 1192 | Ga0105249_10111857 | |||
| 1193 | Ga0105249_10190487 | |||
| 1194 | Ga0105249_10554833 | |||
| 1195 | Ga0099796_10002137 | |||
| 1196 | Ga0099796_10050021 | |||
| 1197 | Ga0105239_10039493 | |||
| 1198 | Ga0105239_10165990 | |||
| 1199 | Ga0105239_10230457 | |||
| 1200 | Ga0105239_10328480 | |||
| 1201 | Ga0105246_10000696 | |||
| 1202 | Ga0105246_10192445 | |||
| 1203 | Ga0105246_10386840 | |||
| 1204 | Ga0157328_1000562 | |||
| 1205 | Ga0157339_1000408 | |||
| 1206 | Ga0157373_10004002 | |||
| 1207 | Ga0157370_10026919 | |||
| 1208 | Ga0157374_10001864 | |||
| 1209 | Ga0157374_10046182 | |||
| 1210 | Ga0157378_10000872 | |||
| 1211 | Ga0157378_10052559 | |||
| 1212 | Ga0157378_10261242 | |||
| 1213 | Ga0157378_10397902 | |||
| 1214 | Ga0157378_10770705 | |||
| 1215 | Ga0163162_10000992 | |||
| 1216 | Ga0163162_10031909 | |||
| 1217 | Ga0163162_10094359 | |||
| 1218 | Ga0163162_10829707 | |||
| 1219 | Ga0157372_10010113 | |||
| 1220 | Ga0157372_10017064 | |||
| 1221 | Ga0157372_10593453 | |||
| 1222 | Ga0157375_10002320 | |||
| 1223 | Ga0157375_10101463 | |||
| 1224 | Ga0157375_10192104 | |||
| 1225 | Ga0163163_10010760 | |||
| 1226 | Ga0163163_10079007 | |||
| 1227 | Ga0163163_10129460 | |||
| 1228 | Ga0163163_10695674 | |||
| 1229 | Ga0157380_10000711 | |||
| 1230 | Ga0157380_10621602 | |||
| 1231 | Ga0182008_10045970 | |||
| 1232 | Ga0157377_10000336 | |||
| 1233 | Ga0157377_10184741 | |||
| 1234 | Ga0157379_10000678 | |||
| 1235 | Ga0157379_10002722 | |||
| 1236 | Ga0157379_10219614 | |||
| 1237 | Ga0157379_10443863 | |||
| 1238 | Ga0157376_10002160 | |||
| 1239 | Ga0157376_10035957 | |||
| 1240 | Ga0163161_10000534 | |||
| 1241 | Ga0163161_10216521 | |||
| 1242 | Ga0224572_1005870 | |||
| 1243 | Ga0228598_1000172 | |||
| 1244 | Ga0207666_1000066 | |||
| 1245 | Ga0207673_1000028 | |||
| 1246 | Ga0209758_1001049 | |||
| 1247 | Ga0209758_1034288 | |||
| 1248 | Ga0207697_10000374 | |||
| 1249 | Ga0207682_10000011 | |||
| 1250 | Ga0207692_10092178 | |||
| 1251 | Ga0207642_10027213 | |||
| 1252 | Ga0207642_10056394 | |||
| 1253 | Ga0207642_10153813 | |||
| 1254 | Ga0207710_10000805 | |||
| 1255 | Ga0207688_10000020 | |||
| 1256 | Ga0207688_10117233 | |||
| 1257 | Ga0207688_10137384 | |||
| 1258 | Ga0207680_10009400 | |||
| 1259 | Ga0207647_10002391 | |||
| 1260 | Ga0207647_10006919 | |||
| 1261 | Ga0207699_10037402 | |||
| 1262 | Ga0207645_10000108 | |||
| 1263 | Ga0207645_10025122 | |||
| 1264 | Ga0207645_10151095 | |||
| 1265 | Ga0207645_10237533 | |||
| 1266 | Ga0207643_10000685 | |||
| 1267 | Ga0207643_10055619 | |||
| 1268 | Ga0207643_10261948 | |||
| 1269 | Ga0207684_10059283 | |||
| 1270 | Ga0207654_10000818 | |||
| 1271 | Ga0207707_10000689 | |||
| 1272 | Ga0207707_10081183 | |||
| 1273 | Ga0207695_10094120 | |||
| 1274 | Ga0207671_10138505 | |||
| 1275 | Ga0207693_10004461 | |||
| 1276 | Ga0207693_10027984 | |||
| 1277 | Ga0207693_10121826 | |||
| 1278 | Ga0207693_10282649 | |||
| 1279 | Ga0207663_10156566 | |||
| 1280 | Ga0207660_10000442 | |||
| 1281 | Ga0207660_10089954 | |||
| 1282 | Ga0207662_10000249 | |||
| 1283 | Ga0207662_10007168 | |||
| 1284 | Ga0207662_10018925 | |||
| 1285 | Ga0207657_10002726 | |||
| 1286 | Ga0207657_10013158 | |||
| 1287 | Ga0207657_10085746 | |||
| 1288 | Ga0207657_10130560 | |||
| 1289 | Ga0207649_10000057 | |||
| 1290 | Ga0207652_10008629 | |||
| 1291 | Ga0207652_10051097 | |||
| 1292 | Ga0207652_10065099 | |||
| 1293 | Ga0207652_10360595 | |||
| 1294 | Ga0207681_10000181 | |||
| 1295 | Ga0207681_10222391 | |||
| 1296 | Ga0207650_10858233 | |||
| 1297 | Ga0207659_10000028 | |||
| 1298 | Ga0207659_10158633 | |||
| 1299 | Ga0207659_10583772 | |||
| 1300 | Ga0207687_10000061 | |||
| 1301 | Ga0207687_10020754 | |||
| 1302 | Ga0207700_10197568 | |||
| 1303 | Ga0207664_10279995 | |||
| 1304 | Ga0207664_10311099 | |||
| 1305 | Ga0207664_10463745 | |||
| 1306 | Ga0207644_10000315 | |||
| 1307 | Ga0207644_10016933 | |||
| 1308 | Ga0207644_10186172 | |||
| 1309 | Ga0207690_10000445 | |||
| 1310 | Ga0207690_10130945 | |||
| 1311 | Ga0207706_10002206 | |||
| 1312 | Ga0207706_10114274 | |||
| 1313 | Ga0207706_10625085 | |||
| 1314 | Ga0207686_10000972 | |||
| 1315 | Ga0207686_10487425 | |||
| 1316 | Ga0207709_10006278 | |||
| 1317 | Ga0207709_10040817 | |||
| 1318 | Ga0207709_10074263 | |||
| 1319 | Ga0207709_10149497 | |||
| 1320 | Ga0207670_10000217 | |||
| 1321 | Ga0207670_10007204 | |||
| 1322 | Ga0207670_10173914 | |||
| 1323 | Ga0207670_10270672 | |||
| 1324 | Ga0207669_10000147 | |||
| 1325 | Ga0207669_10145634 | |||
| 1326 | Ga0207669_10213218 | |||
| 1327 | Ga0207704_10000357 | |||
| 1328 | Ga0207665_10040718 | |||
| 1329 | Ga0207665_10275759 | |||
| 1330 | Ga0207691_10002033 | |||
| 1331 | Ga0207691_10028531 | |||
| 1332 | Ga0207691_10116407 | |||
| 1333 | Ga0207711_10006377 | |||
| 1334 | Ga0207711_10008129 | |||
| 1335 | Ga0207711_10046325 | |||
| 1336 | Ga0207711_10244504 | |||
| 1337 | Ga0207689_10001029 | |||
| 1338 | Ga0207661_10000126 | |||
| 1339 | Ga0207679_10000026 | |||
| 1340 | Ga0207679_10108366 | |||
| 1341 | Ga0207679_10126255 | |||
| 1342 | Ga0207679_10222819 | |||
| 1343 | Ga0207667_10010420 | |||
| 1344 | Ga0207651_10000342 | |||
| 1345 | Ga0207651_10585963 | |||
| 1346 | Ga0207712_10000686 | |||
| 1347 | Ga0207712_10311058 | |||
| 1348 | Ga0207712_10312215 | |||
| 1349 | Ga0207712_10350845 | |||
| 1350 | Ga0207668_10000242 | |||
| 1351 | Ga0207668_10402756 | |||
| 1352 | Ga0207640_10000833 | |||
| 1353 | Ga0207658_10038939 | |||
| 1354 | Ga0207658_10534530 | |||
| 1355 | Ga0207677_10000710 | |||
| 1356 | Ga0207677_10137387 | |||
| 1357 | Ga0207677_10291402 | |||
| 1358 | Ga0207703_10001559 | |||
| 1359 | Ga0207703_10328847 | |||
| 1360 | Ga0207639_10002260 | |||
| 1361 | Ga0207639_10034012 | |||
| 1362 | Ga0207639_10244107 | |||
| 1363 | Ga0207639_10341664 | |||
| 1364 | Ga0207678_10001079 | |||
| 1365 | Ga0207678_10022723 | |||
| 1366 | Ga0207678_10277698 | |||
| 1367 | Ga0207678_10330331 | |||
| 1368 | Ga0207708_10000805 | |||
| 1369 | Ga0207708_10006143 | |||
| 1370 | Ga0207702_10002121 | |||
| 1371 | Ga0207702_10068858 | |||
| 1372 | Ga0207641_10001766 | |||
| 1373 | Ga0207641_10429122 | |||
| 1374 | Ga0207641_10485171 | |||
| 1375 | Ga0207648_10000731 | |||
| 1376 | Ga0207676_10000361 | |||
| 1377 | Ga0207674_10002121 | |||
| 1378 | Ga0207675_100001489 | |||
| 1379 | Ga0207675_100039410 | |||
| 1380 | Ga0207675_100089221 | |||
| 1381 | Ga0207675_100104037 | |||
| 1382 | Ga0207683_10000034 | |||
| 1383 | Ga0207683_10012741 | |||
| 1384 | Ga0207683_10035186 | |||
| 1385 | Ga0207683_10385217 | |||
| 1386 | Ga0207698_10000304 | |||
| 1387 | Ga0207698_10416859 | |||
| 1388 | Ga0209973_1001485 | |||
| 1389 | Ga0210002_1000561 | |||
| 1390 | Ga0209983_1035728 | |||
| 1391 | Ga0209588_1002483 | |||
| 1392 | Ga0209971_1003397 | |||
| 1393 | Ga0209966_1002652 | |||
| 1394 | Ga0209966_1002767 | |||
| 1395 | Ga0209998_10000861 | |||
| 1396 | Ga0209974_10000830 | |||
| 1397 | Ga0207428_10000082 | |||
| 1398 | Ga0207428_10000352 | |||
| 1399 | Ga0207428_10001078 | |||
| 1400 | Ga0207428_10005810 | |||
| 1401 | Ga0207428_10018670 | |||
| 1402 | Ga0268266_10039033 | |||
| 1403 | Ga0268266_10070689 | |||
| 1404 | Ga0268266_10582685 | |||
| 1405 | Ga0268265_10001338 | |||
| 1406 | Ga0268265_10404695 | |||
| 1407 | Ga0268264_10002557 | |||
| 1408 | Ga0268264_10065013 | |||
| 1409 | Ga0268264_10079082 | |||
| 1410 | Ga0265338_10129337 | |||
| 1411 | Ga0265325_10000141 | |||
| 1412 | Ga0265325_10005121 | |||
| 1413 | Ga0265325_10005810 | |||
| 1414 | Ga0265325_10005829 | |||
| 1415 | Ga0265325_10009631 | |||
| 1416 | Ga0265340_10004172 | |||
| 1417 | Ga0265339_10000067 | |||
| 1418 | Ga0265339_10026535 | |||
| 1419 | Ga0265313_10000008 | |||
| 1420 | Ga0265313_10000054 | |||
| 1421 | Ga0265313_10001334 | |||
| 1422 | Ga0265313_10012192 | |||
| 1423 | Ga0265342_10018860 | |||
| 1424 | Ga0307416_100752666 | |||
| 1425 | Ga0316583_10001247 | |||
| 1426 | Ga0373948_0000353 | |||
| 1427 | Ga0373948_0007550 | |||
| 1428 | Ga0373950_0021975 | |||
| 1429 | Ga0373958_0000098 | |||
| 1430 | Ga0373958_0001694 | |||
| 1431 | Ga0373959_0015032 | |||
| 1432 | Ga0373938_0004446 | |||
| 1433 | Ga0373938_0014150 | |||
| 1434 | Ga0373926_0040529 | |||
| 1435 | Ga0373926_0071092 | |||
| 1436 | Ga0373928_0007197 | |||
| 1437 | Ga0373928_0042926 | |||
| 1438 | Ga0373929_0000124 | |||
| 1439 | Ga0373929_0006484 | |||
| 1440 | Ga0373929_0007906 | |||
| 1441 | Ga0373929_0025379 | |||
| 1442 | Ga0373934_0099392 | |||
| 1443 | Ga0373940_0011652 | |||
| 1444 | Ga0373940_0047469 | |||
| 1445 | Ga0373949_0005140 | |||
| 1446 | Ga0373951_0000233 | |||
| 1447 | Ga0373951_0016081 | |||
| 1448 | Ga0373952_0002094 | |||
| 1449 | Ga0373952_0008590 | |||
| 1450 | Ga0373923_0012453 | |||
| 1451 | Ga0373932_0000369 | |||
| 1452 | Ga0373936_0030358 | |||
| 1453 | Ga0373939_0000589 | |||
| 1454 | Ga0373939_0000999 | |||
| 1455 | Ga0373939_0003749 | |||
| 1456 | Ga0373941_0005015 | |||
| 1457 | Ga0373945_0071501 | |||
| 1458 | Ga0373953_0004850 | |||
| 1459 | Ga0373954_0007712 | |||
| 1460 | Ga0373954_0009461 | |||
| 1461 | Ga0373956_0003621 | |||
| 1462 | Ga0373957_0003018 | |||
| 1463 | Ga0373957_0005217 | |||
| 1464 | Ga0373960_0000741 | |||
| 1465 | Ga0373960_0025402 | |||
| 1466 | Ga0373943_0018589 | |||
| 1467 | Ga0373946_0022964 | |||
| 1468 | Ga0373955_0001226 | |||
| 1469 | Ga0373955_0026941 | |||
| 1470 | Ga0373942_0002793 | |||
| 1471 | Ga0373942_0003759 | |||
| 1472 | Ga0373942_0004850 | |||
| 1473 | Ga0373942_0019599 | |||
| 1474 | Ga0373961_0004509 | |||
| 1475 | Ga0373961_0012391 | |||
| 1476 | Ga0373962_0000152 | |||
| 1477 | Ga0373962_0000699 | |||
| 1478 | Ga0373962_0023858 | |||
| 1479 | Ga0373924_0011339 | |||
| 1480 | Ga0373924_0047181 | |||
| 1481 | Ga0373924_0131175 | |||
| 1482 | Ga0373931_0000179 | |||
| 1483 | Ga0373931_0005009 | |||
| 1484 | Ga0373931_0009136 | |||
| 1485 | Ga0373931_0011482 | |||
| 1486 | Ga0373931_0034856 | |||
| 1487 | Ga0373931_0165942 | |||
| 1488 | Ga0373931_0210897 | |||
| 1489 | Ga0373935_0028870 | |||
| 1490 | Ga0373935_0044071 | |||
| 1491 | Ga0373935_0056098 | |||
| 1492 | Ga0373935_0083897 | |||
| 1493 | Ga0373935_0156754 | |||
| 1494 | Ga0373935_0206077 | |||
| 1495 | Ga0373927_0029934 | |||
| 1496 | Ga0373927_0033369 | |||
| 1497 | Ga0373927_0050999 | |||
| 1498 | Ga0373927_0051352 | |||
| 1499 | Ga0373927_0073060 | |||
| 1500 | Ga0373927_0082831 | |||
| 1501 | Ga0373927_0104838 | |||
| 1502 | Ga0373927_0185770 | |||
| 1503 | Ga0373933_0001753 | |||
| 1504 | Ga0373947_0021159 | |||
| 1505 | Ga0373947_0022989 | |||
| 1506 | Ga0373947_0050332 | |||
| 1507 | Ga0373947_0076121 | |||
| 1508 | Ga0373947_0115820 | |||
| 1509 | Ga0373937_0000879 | |||
| 1510 | Ga0373937_0023251 | |||
| 1511 | Ga0373937_0030498 | |||
| 1512 | Ga0373937_0114376 | |||
| 1513 | Ga0373937_0118016 | |||
| 1514 | Ga0373937_0172835 | |||
| 1515 | Ga0373925_0013172 | |||
| 1516 | Ga0373925_0041837 | |||
| 1517 | Ga0373925_0046184 | |||
| 1518 | Ga0373925_0169925 | |||
| 1519 | Ga0373925_0236231 | |||
| 1520 | Ga0395898_0125956 | |||
| 1521 | Ga0395905_0015104 | |||
| 1522 | Ga0395901_0058034 | |||
| 1523 | Ga0436361_0602366 | |||
| 1524 | Ga0439453_0002256 | |||
| 1525 | Ga0439453_0018346 | |||
| 1526 | Ga0439434_0085432 | |||
| 1527 | Ga0439435_0005924 | |||
| 1528 | Ga0439444_0030390 | |||
| 1529 | Ga0439460_0013337 | |||
| 1530 | Ga0466963_0053385 | |||
| 1531 | Ga0453684_0163789 | |||
| 1532 | Ga0466957_0038975 | |||
| 1533 | Ga0451576_0084542 | |||
| 1534 | Ga0466958_0082777 | |||
| 1535 | Ga0466967_0000948 | |||
| 1536 | Ga0495592_0000513 | |||
| 1537 | Ga0495592_0004552 | |||
| 1538 | Ga0495592_0029018 | |||
| 1539 | Ga0495592_0106118 | |||
| 1540 | Ga0495603_0007105 | |||
| 1541 | Ga0495603_0047882 | |||
| 1542 | Ga0495590_0057575 | |||
| 1543 | Ga0495629_0000062 | |||
| 1544 | Ga0495629_0002976 | |||
| 1545 | Ga0495629_0186305 | |||
| 1546 | Ga0495651_0000910 | |||
| 1547 | Ga0495651_0006020 | |||
| 1548 | Ga0495651_0030341 | |||
| 1549 | Ga0495653_0002622 | |||
| 1550 | Ga0495653_0003316 | |||
| 1551 | Ga0495580_0055899 | |||
| 1552 | Ga0495580_0130748 | |||
| 1553 | Ga0495580_0168882 | |||
| 1554 | Ga0495580_0402650 | |||
| 1555 | Ga0495639_0058896 | |||
| 1556 | Ga0495639_0071772 | |||
| 1557 | Ga0495639_0118000 | |||
| 1558 | Ga0495662_0026233 | |||
| 1559 | Ga0495662_0032498 | |||
| 1560 | Ga0495664_0000434 | |||
| 1561 | Ga0495664_0199514 | |||
| 1562 | Ga0495664_0214078 | |||
| 1563 | Ga0495584_0049211 | |||
| 1564 | Ga0495594_0088820 | |||
| 1565 | Ga0495594_0211177 | |||
| 1566 | Ga0495608_0001525 | |||
| 1567 | Ga0495608_0007060 | |||
| 1568 | Ga0495608_0149567 | |||
| 1569 | Ga0495618_0014292 | |||
| 1570 | Ga0495628_0008936 | |||
| 1571 | Ga0495628_0038743 | |||
| 1572 | Ga0495628_0063040 | |||
| 1573 | Ga0495628_0087887 | |||
| 1574 | Ga0495630_0047958 | |||
| 1575 | Ga0495630_0057021 | |||
| 1576 | Ga0495630_0215911 | |||
| 1577 | Ga0495630_0228151 | |||
| 1578 | Ga0495648_0006759 | |||
| 1579 | Ga0495666_0026964 | |||
| 1580 | Ga0495666_0077515 | |||
| 1581 | Ga0495642_0088866 | |||
| 1582 | Ga0495652_0011195 | |||
| 1583 | Ga0495652_0028653 | |||
| 1584 | Ga0495652_0055382 | |||
| 1585 | Ga0495652_0111242 | |||
| 1586 | Ga0495652_0168606 | |||
| 1587 | Ga0495665_0035362 | |||
| 1588 | Ga0495665_0089448 | |||
| 1589 | Ga0495640_0003016 | |||
| 1590 | Ga0495640_0024844 | |||
| 1591 | Ga0495640_0147263 | |||
| 1592 | Ga0495587_0001060 | |||
| 1593 | Ga0495587_0014613 | |||
| 1594 | Ga0495645_0000746 | |||
| 1595 | Ga0495645_0000974 | |||
| 1596 | Ga0495645_0066570 | |||
| 1597 | Ga0495645_0367647 | |||
| 1598 | Ga0495622_0102534 | |||
| 1599 | Ga0495667_0003474 | |||
| 1600 | Ga0495667_0006015 | |||
| 1601 | Ga0495667_0012221 | |||
| 1602 | Ga0495667_0041577 | |||
| 1603 | Ga0495667_0068049 | |||
| 1604 | Ga0495634_0039270 | |||
| 1605 | Ga0495634_0162669 | |||
| 1606 | Ga0495635_0018303 | |||
| 1607 | Ga0495635_0072101 | |||
| 1608 | Ga0495635_0103107 | |||
| 1609 | Ga0495635_0107294 | |||
| 1610 | Ga0495635_0136865 | |||
| 1611 | Ga0495588_0127935 | |||
| 1612 | Ga0495657_0087975 | |||
| 1613 | Ga0495657_0093258 | |||
| 1614 | Ga0495599_0015965 | |||
| 1615 | Ga0495599_0032589 | |||
| 1616 | Ga0495623_0001158 | |||
| 1617 | Ga0495623_0090844 | |||
| 1618 | Ga0495623_0095398 | |||
| 1619 | Ga0495647_0021743 | |||
| 1620 | Ga0495647_0052913 | |||
| 1621 | Ga0495658_0000718 | |||
| 1622 | Ga0495613_0007258 | |||
| 1623 | Ga0495613_0031576 | |||
| 1624 | Ga0495613_0033647 | |||
| 1625 | Ga0495613_0110546 | |||
| 1626 | Ga0495613_0204308 | |||
| 1627 | Ga0495624_0027104 | |||
| 1628 | Ga0495624_0062901 | |||
| 1629 | Ga0495624_0100157 | |||
| 1630 | Ga0495624_0241521 | |||
| 1631 | Ga0495600_0002131 | |||
| 1632 | Ga0495600_0007139 | |||
| 1633 | Ga0495600_0034255 | |||
| 1634 | Ga0495581_0012167 | |||
| 1635 | Ga0495604_0004590 | |||
| 1636 | Ga0495604_0013622 | |||
| 1637 | Ga0495604_0027286 | |||
| 1638 | Ga0495604_0110595 | |||
| 1639 | Ga0495674_0003969 | |||
| 1640 | Ga0495674_0006778 | |||
| 1641 | Ga0495674_0014686 | |||
| 1642 | Ga0495674_0079153 | |||
| 1643 | Ga0495674_0121575 | |||
| 1644 | Ga0495674_0152639 | |||
| 1645 | Ga0495676_0071454 | |||
| 1646 | Ga0495680_0000483 | |||
| 1647 | Ga0495680_0012821 | |||
| 1648 | Ga0495680_0017319 | |||
| 1649 | Ga0495680_0041448 | |||
| 1650 | Ga0495680_0048920 | |||
| 1651 | Ga0495675_0000190 | |||
| 1652 | Ga0495675_0010552 | |||
| 1653 | Ga0495675_0072610 | |||
| 1654 | Ga0495684_0007568 | |||
| 1655 | Ga0495684_0018874 | |||
| 1656 | Ga0495684_0046954 | |||
| 1657 | Ga0495684_0347791 | |||
| 1658 | Ga0495593_0050779 | |||
| 1659 | Ga0495593_0083724 | |||
| 1660 | Ga0495602_0015694 | |||
| 1661 | Ga0495602_0027846 | |||
| 1662 | Ga0495602_0045776 | |||
| 1663 | Ga0496100_0002755 | |||
| 1664 | Ga0496100_0034175 | |||
| 1665 | Ga0496100_0151684 | |||
| 1666 | Ga0496101_0001110 | |||
| 1667 | Ga0496101_0027634 | |||
| 1668 | Ga0496102_0071501 | |||
| 1669 | Ga0496102_0074399 | |||
| 1670 | Ga0496102_0461045 | |||
| 1671 | Ga0496102_0467254 | |||
| 1672 | Ga0496103_0000582 | |||
| 1673 | Ga0496103_0318700 | |||
| 1674 | Ga0496104_0000067 | |||
| 1675 | Ga0496104_0042201 | |||
| 1676 | Ga0496104_0253100 | |||
| 1677 | Ga0496104_0714322 | |||
| 1678 | Ga0496105_0002048 | |||
| 1679 | Ga0496105_0126452 | |||
| 1680 | Ga0496105_0150300 | |||
| 1681 | Ga0496106_0002855 | |||
| 1682 | Ga0496106_0013139 | |||
| 1683 | Ga0496106_0046743 | |||
| 1684 | Ga0496107_0001812 | |||
| 1685 | Ga0496107_0013359 | |||
| 1686 | Ga0496107_0025580 | |||
| 1687 | Ga0496107_0120043 | |||
| 1688 | Ga0496107_0415043 | |||
| 1689 | Ga0496108_0007050 | |||
| 1690 | Ga0496109_0000384 | |||
| 1691 | Ga0496109_0011720 | |||
| 1692 | Ga0496110_0022806 | |||
| 1693 | Ga0496110_0062149 | |||
| 1694 | Ga0496110_0217776 | |||
| 1695 | Ga0496110_0222035 | |||
| 1696 | Ga0496110_0281809 | |||
| 1697 | Ga0496110_0328726 | |||
| 1698 | Ga0496111_0044821 | |||
| 1699 | Ga0496111_0045761 | |||
| 1700 | Ga0496111_0073964 | |||
| 1701 | Ga0496111_0099066 | |||
| 1702 | Ga0496111_0349424 | |||
| 1703 | Ga0496112_0093115 | |||
| 1704 | Ga0496112_0235700 | |||
| 1705 | Ga0496113_0000688 | |||
| 1706 | Ga0496113_0041084 | |||
| 1707 | Ga0496113_0176908 | |||
| 1708 | Ga0496113_0351627 | |||
| 1709 | Ga0496113_0416634 | |||
| 1710 | Ga0496113_0570320 | |||
| 1711 | Ga0496114_0003688 | |||
| 1712 | Ga0496114_0053456 | |||
| 1713 | Ga0496114_0158427 | |||
| 1714 | Ga0496114_0199098 | |||
| 1715 | Ga0496115_0002409 | |||
| 1716 | Ga0496115_0358420 | |||
| 1717 | Ga0501298_035278 | |||
| 1718 | Ga0501034_0588563 | |||
| 1719 | Ga0501040_0319370 | |||
| 1720 | Ga0501047_0004391 | |||
| 1721 | Ga0501047_0085249 | |||
| 1722 | Ga0501067_0200370 | |||
| 1723 | Ga0501070_0347312 | |||
| 1724 | Ga0501076_0016620 | |||
| 1725 | Ga0501077_0122310 | |||
| 1726 | Ga0501216_030767 | |||
| 1727 | Ga0501083_0187225 | |||
| 1728 | Ga0501044_0022774 | |||
| 1729 | Ga0501044_0084587 | |||
| 1730 | nmdc:mga0yw44_289343_c1 | |||
| 1731 | nmdc:mga0k408_15140_c1 | |||
| 1732 | nmdc:mga0k408_226267_c1 | |||
| 1733 | nmdc:mga06z11_87457_c1 | |||
| 1734 | nmdc:mga05p37_133416_c1 | |||
| 1735 | nmdc:mga05p37_19_c2 | |||
| 1736 | nmdc:mga05p37_219821_c1 | |||
| 1737 | nmdc:mga05p37_5389_c1 | |||
| 1738 | nmdc:mga05p37_93380_c1 | |||
| 1739 | nmdc:mga09592_238_c1 | |||
| 1740 | nmdc:mga09592_27607_c1 | |||
| 1741 | nmdc:mga0qj67_13539_c1 | |||
| 1742 | nmdc:mga0qj67_67254_c1 | |||
| 1743 | nmdc:mga06r32_108717_c1 | |||
| 1744 | nmdc:mga06r32_2023_c1 | |||
| 1745 | nmdc:mga08y16_18813_c1 | |||
| 1746 | nmdc:mga08y16_208_c1 | |||
| 1747 | nmdc:mga08y16_2735_c1 | |||
| 1748 | nmdc:mga08y16_58085_c1 | |||
| 1749 | nmdc:mga08y16_80129_c1 | |||
| 1750 | nmdc:mga08y16_842162_c1 | |||
| 1751 | nmdc:mga08y16_85971_c1 | |||
| 1752 | nmdc:mga0n895_10569_c1 | |||
| 1753 | nmdc:mga0n895_173295_c1 | |||
| 1754 | nmdc:mga0n895_3108_c1 | |||
| 1755 | nmdc:mga0n895_34398_c1 | |||
| 1756 | nmdc:mga0n895_394_c1 | |||
| 1757 | nmdc:mga0n895_7653_c1 | |||
| 1758 | nmdc:mga0rr50_229110_c1 | |||
| 1759 | nmdc:mga0rr50_45215_c1 | |||
| 1760 | nmdc:mga0rr50_5567_c1 | |||
| 1761 | nmdc:mga0rr50_68416_c1 | |||
| 1762 | nmdc:mga0a205_1167_c1 | |||
| 1763 | nmdc:mga0a205_143051_c1 | |||
| 1764 | nmdc:mga0a205_186874_c1 | |||
| 1765 | nmdc:mga0a205_26111_c1 | |||
| 1766 | nmdc:mga0a205_5198_c1 | |||
| 1767 | nmdc:mga0a205_5655_c1 | |||
| 1768 | Ga0495601_0000711 | |||
| 1769 | Ga0495601_0001809 | |||
| 1770 | Ga0495601_0005275 | |||
| 1771 | Ga0495601_0005584 | |||
| 1772 | Ga0495601_0008024 | |||
| 1773 | Ga0495601_0009061 | |||
| 1774 | Ga0495601_0013226 | |||
| 1775 | Ga0495601_0114635 | |||
| 1776 | Ga0495612_0000152 | |||
| 1777 | Ga0495612_0002060 | |||
| 1778 | Ga0495612_0014302 | |||
| 1779 | Ga0495612_0017950 | |||
| 1780 | Ga0495612_0021257 | |||
| 1781 | Ga0495612_0058494 | |||
| 1782 | Ga0495655_0046359 | |||
| 1783 | Ga0495595_0001635 | |||
| 1784 | Ga0495595_0004190 | |||
| 1785 | Ga0495595_0012712 | |||
| 1786 | Ga0495595_0050676 | |||
| 1787 | Ga0495595_0074797 | |||
| 1788 | Ga0495619_0000052 | |||
| 1789 | Ga0495619_0000078 | |||
| 1790 | Ga0495619_0001503 | |||
| 1791 | Ga0495619_0003543 | |||
| 1792 | Ga0495619_0003933 | |||
| 1793 | Ga0495619_0009181 | |||
| 1794 | Ga0495619_0028201 | |||
| 1795 | Ga0500642_0019927 | |||
| 1796 | Ga0501084_0173473 | |||
| 1797 | Ga0530510_0504009 | |||
| 1798 | 2876767338 | |||
| 1799 | 2876816647 | |||
| 1800 | 2879110174 | |||
| 1801 | 2885419104 | |||
| 1802 | 2922361244 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xts-assembly1.cif.gz_C | crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus | 0.856 | 103 | 240 |
| 3hbg-assembly1.cif.gz_A-2 | structure of recombinant chicken liver sulfite oxidase mutant c185s | 0.8463 | 103 | 238 |
| 1sox-assembly1.cif.gz_A | sulfite oxidase from chicken liver | 0.8406 | 103 | 246 |
| 1sox-assembly1.cif.gz_B | sulfite oxidase from chicken liver | 0.8394 | 103 | 246 |
| 3hc2-assembly1.cif.gz_A-2 | crystal structure of chicken sulfite oxidase mutant tyr 322 phe | 0.8354 | 103 | 246 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2xtsA01 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8565 | 103 | 240 | 3.90.420.10 |
| af_P96400_291_442_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8495 | 109 | 240 | 3.90.420.10 |
| 2ca4A01 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8118 | 94 | 251 | 3.90.420.10 |
| 4pw9A01 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.792 | 107 | 245 | 3.90.420.10 |
| af_P11035_116_359_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.7611 | 75 | 246 | 3.90.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I4SVQ0-F1-model_v4 | Molybdopterin-dependent oxidoreductase | 0.9396 | 109 | 219 |
|
| AF-A0A537TEQ0-F1-model_v4 | Molybdopterin-binding protein | 0.9027 | 78 | 257 |
|
| AF-A0A3A8SAX7-F1-model_v4 | Molybdopterin-binding protein | 0.8918 | 78 | 204 |
|
| AF-A0A380AE90-F1-model_v4 | Sulfoxide reductase catalytic subunit yedY (EC 1.8.-.-) | 0.8914 | 80 | 257 |
GO:0016491
|
| AF-A0A537TEQ0-F1-model_v4 | Molybdopterin-binding protein | 0.8885 | 78 | 257 |
|