F485162

General Info

Members Datasets Scaffolds Average Seq Length
901 383 1802 257

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100130590|Ga0070713_1001305902
Length 247
Sequence MPRPRKPIPGVDGKALIGDAGKLLPEPSRRLFLRGAASVGALATLTGCDIIDGPTAENALRVVSNFNDWVQARLFSSHTLAPTFSESEVTRPFPFNAYYQQDEAPDIEGDKYQLEIGGLVDNKKSWSLPELYVCVEGWSAIGSWQGVRLSDFLKLIGADTRAKYVWFQCAEGYSNTIDMPTALHPQTQLTLKFDHKILPQAYGFPIRIRIPTKLGFKNPKYVTAMWVQNNDAGGYWENQGYNWFSGL

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
20 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
99 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
115 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
132 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
148 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
149 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
227 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
228 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
229 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
230 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
231 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
234 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
235 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
236 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
237 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
238 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
239 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
240 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
241 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
242 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
243 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
244 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
245 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
246 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
247 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
251 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
252 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
253 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
254 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
255 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
256 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
257 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
262 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
263 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
264 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
269 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
277 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
278 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
279 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
280 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
283 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
284 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
285 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
286 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
287 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
288 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
289 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
290 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
291 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
292 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
293 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
294 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
295 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
296 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
297 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
298 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
299 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
300 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
301 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
302 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
303 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
306 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
307 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
308 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
309 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
310 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
311 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
312 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
313 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
314 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
317 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
318 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
319 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
320 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
324 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
325 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
326 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
327 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
328 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
329 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
330 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
334 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
335 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
336 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
337 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
338 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
342 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
343 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
344 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
345 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
346 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
347 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
348 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
349 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
350 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
355 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
356 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
357 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
358 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
362 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
363 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
364 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
365 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
366 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
369 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
372 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
373 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
374 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
379 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
380 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
381 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
382 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
383 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.66
Nodule 0.33
Rhizoplane 5.99
Rhizosphere 91.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100130590 3300005436 Bacteria 2215
2 2214628267 2209111006 Bacteria 5188
3 ARcpr5oldR_c000007 3300000041 Bacteria 41749
4 ARcpr5yngRDRAFT_c000456 3300000043 Bacteria 5288
5 ARSoilOldRDRAFT_c000004 3300000044 Bacteria 62556
6 ARCol0oldRDRAFT_c00335 3300000045 Bacteria 4570
7 ARCol0yngRDRAFT_1000002 3300000652 Bacteria 55259
8 JGI24746J21847_1001973 3300001977 Bacteria 3270
9 JGI24740J21852_10024717 3300001979 Bacteria 2035
10 JGI24737J22298_10001147 3300001990 Bacteria 9321
11 JGI24750J21931_1000100 3300002070 Bacteria 13291
12 JGI24745J21846_1002936 3300002073 Bacteria 1764
13 JGI24738J21930_10000155 3300002075 Bacteria 17211
14 JGI24749J21850_1000093 3300002076 Bacteria 15913
15 JGI24744J21845_10000499 3300002077 Bacteria 6981
16 JGI24742J22300_10000079 3300002244 Bacteria 14048
17 JGI25153J46596_10013295 3300003215 Bacteria 3486
18 JGI25153J46596_10015068 3300003215 Bacteria 3173
19 JGI25405J52794_10013204 3300003911 Bacteria 1599
20 JGI25405J52794_10031827 3300003911 Bacteria 1097
21 Ga0065717_1002392 3300005276 Bacteria 2056
22 Ga0065716_1000034 3300005277 Bacteria 4261
23 Ga0065704_10102560 3300005289 Bacteria 2200
24 Ga0065715_10000599 3300005293 Bacteria 9975
25 Ga0065715_10088946 3300005293 Bacteria 21692
26 Ga0070676_10000514 3300005328 Bacteria 18558
27 Ga0070676_10084468 3300005328 Bacteria 1933
28 Ga0070683_100000931 3300005329 Bacteria 21734
29 Ga0070683_100109638 3300005329 Bacteria 2604
30 Ga0070690_100002803 3300005330 Bacteria 9405
31 Ga0070690_100024319 3300005330 Bacteria 3724
32 Ga0070690_100426610 3300005330 Bacteria 979
33 Ga0070670_100013151 3300005331 Bacteria 7087
34 Ga0068869_100000153 3300005334 Bacteria 34191
35 Ga0068869_100267360 3300005334 Bacteria 1371
36 Ga0070666_10013476 3300005335 Bacteria 5188
37 Ga0070680_100000814 3300005336 Bacteria 21982
38 Ga0070680_100061445 3300005336 Bacteria 3075
39 Ga0070680_100152901 3300005336 Bacteria 1938
40 Ga0070682_100000445 3300005337 Bacteria 26505
41 Ga0070682_100002065 3300005337 Bacteria 11183
42 Ga0070682_100107042 3300005337 Bacteria 1856
43 Ga0068868_100000148 3300005338 Bacteria 45833
44 Ga0068868_100246395 3300005338 Bacteria 1503
45 Ga0070660_100001480 3300005339 Bacteria 16083
46 Ga0070660_100076309 3300005339 Bacteria 2625
47 Ga0070660_100237325 3300005339 Bacteria 1484
48 Ga0070689_100000880 3300005340 Bacteria 18718
49 Ga0070689_100008335 3300005340 Bacteria 7297
50 Ga0070689_100014989 3300005340 Bacteria 5644
51 Ga0070689_100072547 3300005340 Bacteria 2691
52 Ga0070689_100086333 3300005340 Bacteria 2468
53 Ga0070691_10002726 3300005341 Bacteria 7865
54 Ga0070691_10153385 3300005341 Bacteria 1182
55 Ga0070687_100000187 3300005343 Bacteria 21513
56 Ga0070687_100000759 3300005343 Bacteria 10700
57 Ga0070687_100022132 3300005343 Bacteria 3000
58 Ga0070661_100004477 3300005344 Bacteria 9635
59 Ga0070661_100139005 3300005344 Bacteria 1829
60 Ga0070692_10001230 3300005345 Bacteria 9128
61 Ga0070692_10056825 3300005345 Bacteria 2050
62 Ga0070668_100100592 3300005347 Bacteria 2290
63 Ga0070668_100220924 3300005347 Bacteria 1563
64 Ga0070669_100000501 3300005353 Bacteria 29467
65 Ga0070669_100157391 3300005353 Bacteria 1763
66 Ga0070669_100204113 3300005353 Bacteria 1557
67 Ga0070675_100027368 3300005354 Bacteria 4580
68 Ga0070675_100086697 3300005354 Bacteria 2617
69 Ga0070675_100231393 3300005354 Bacteria 1612
70 Ga0070675_100410630 3300005354 Bacteria 1209
71 Ga0070671_100000595 3300005355 Bacteria 25844
72 Ga0070671_100015975 3300005355 Bacteria 6064
73 Ga0070671_100017211 3300005355 Bacteria 5851
74 Ga0070671_100135240 3300005355 Bacteria 2078
75 Ga0070674_100000249 3300005356 Bacteria 26766
76 Ga0070673_100000233 3300005364 Bacteria 27866
77 Ga0070673_100353400 3300005364 Bacteria 1305
78 Ga0070688_100000432 3300005365 Bacteria 21144
79 Ga0070688_100011750 3300005365 Bacteria 4880
80 Ga0070688_100044365 3300005365 Bacteria 2744
81 Ga0070688_100137683 3300005365 Bacteria 1655
82 Ga0070659_100000746 3300005366 Bacteria 23656
83 Ga0070659_100031480 3300005366 Bacteria 4109
84 Ga0070659_100203184 3300005366 Bacteria 1631
85 Ga0070659_100420286 3300005366 Bacteria 1130
86 Ga0070667_100001881 3300005367 Bacteria 18641
87 Ga0070667_100091596 3300005367 Bacteria 2614
88 Ga0070709_10332630 3300005434 Bacteria 1118
89 Ga0070714_100034213 3300005435 Bacteria 4254
90 Ga0070714_100286953 3300005435 Bacteria 1531
91 Ga0070714_100543427 3300005435 Bacteria 1112
92 Ga0070714_100562348 3300005435 Bacteria 1093
93 Ga0070713_100008986 3300005436 Bacteria 7121
94 Ga0070713_100049334 3300005436 Bacteria 3472
95 Ga0070713_100370313 3300005436 Bacteria 1333
96 Ga0070710_10008769 3300005437 Bacteria 4931
97 Ga0070710_10048777 3300005437 Bacteria 2366
98 Ga0070701_10000164 3300005438 Bacteria 20655
99 Ga0070701_10023111 3300005438 Bacteria 2990
100 Ga0070711_100024101 3300005439 Bacteria 3965
101 Ga0070711_100045468 3300005439 Bacteria 2987
102 Ga0070711_100047217 3300005439 Bacteria 2938
103 Ga0070711_100579964 3300005439 Bacteria 933
104 Ga0070705_100000361 3300005440 Bacteria 26716
105 Ga0070705_100046519 3300005440 Bacteria 2502
106 Ga0070705_100199445 3300005440 Bacteria 1371
107 Ga0070700_100000357 3300005441 Bacteria 23494
108 Ga0070700_100097542 3300005441 Bacteria 1930
109 Ga0070694_100006390 3300005444 Bacteria 7149
110 Ga0070708_100075489 3300005445 Bacteria 3043
111 Ga0070708_100181371 3300005445 Bacteria 1968
112 Ga0070708_100194207 3300005445 Bacteria 1899
113 Ga0070663_100000582 3300005455 Bacteria 19491
114 Ga0070663_100055944 3300005455 Bacteria 2825
115 Ga0070678_100001403 3300005456 Bacteria 12829
116 Ga0070678_100018262 3300005456 Bacteria 4545
117 Ga0070662_100067944 3300005457 Bacteria 2618
118 Ga0070662_100217534 3300005457 Bacteria 1523
119 Ga0070662_100249064 3300005457 Bacteria 1427
120 Ga0070681_10004898 3300005458 Bacteria 12850
121 Ga0070681_10119251 3300005458 Bacteria 2574
122 Ga0070681_10341154 3300005458 Bacteria 1408
123 Ga0068867_100001099 3300005459 Bacteria 18474
124 Ga0068867_100230617 3300005459 Bacteria 1496
125 Ga0070685_10003380 3300005466 Bacteria 8119
126 Ga0070685_10011632 3300005466 Bacteria 4611
127 Ga0070685_10036784 3300005466 Bacteria 2769
128 Ga0070685_10258981 3300005466 Bacteria 1156
129 Ga0070706_100007863 3300005467 Bacteria 9965
130 Ga0070698_100001449 3300005471 Bacteria 26331
131 Ga0070698_100418283 3300005471 Bacteria 1275
132 Ga0070699_100063915 3300005518 Bacteria 3192
133 Ga0070679_100002583 3300005530 Bacteria 16455
134 Ga0070679_100021338 3300005530 Bacteria 6321
135 Ga0070679_100054026 3300005530 Bacteria 3998
136 Ga0070679_100250784 3300005530 Bacteria 1726
137 Ga0070684_100000101 3300005535 Bacteria 55960
138 Ga0070684_100114837 3300005535 Bacteria 2417
139 Ga0070697_100092376 3300005536 Bacteria 2504
140 Ga0070697_100094047 3300005536 Bacteria 2483
141 Ga0070697_100275893 3300005536 Bacteria 1442
142 Ga0068853_100003127 3300005539 Bacteria 12655
143 Ga0068853_100009271 3300005539 Bacteria 7937
144 Ga0068853_100021629 3300005539 Bacteria 5365
145 Ga0070672_100001273 3300005543 Bacteria 15485
146 Ga0070672_100081337 3300005543 Bacteria 2597
147 Ga0070686_100000532 3300005544 Bacteria 22792
148 Ga0070686_100120629 3300005544 Bacteria 1800
149 Ga0070695_100002491 3300005545 Bacteria 10599
150 Ga0070695_100015081 3300005545 Bacteria 4664
151 Ga0070696_100014847 3300005546 Bacteria 5228
152 Ga0070693_100000138 3300005547 Bacteria 32988
153 Ga0070693_100004377 3300005547 Bacteria 6668
154 Ga0070665_100027794 3300005548 Bacteria 5696
155 Ga0070665_100169759 3300005548 Bacteria 2183
156 Ga0070665_100218608 3300005548 Bacteria 1906
157 Ga0070665_100587568 3300005548 Bacteria 1127
158 Ga0070704_100003765 3300005549 Bacteria 8733
159 Ga0070704_100087143 3300005549 Bacteria 2316
160 Ga0070704_100096936 3300005549 Bacteria 2212
161 Ga0068855_100020794 3300005563 Bacteria 7868
162 Ga0068855_100052371 3300005563 Bacteria 4805
163 Ga0068855_100301574 3300005563 Bacteria 1774
164 Ga0070664_100000614 3300005564 Bacteria 27230
165 Ga0070664_100161850 3300005564 Bacteria 1980
166 Ga0070664_100229707 3300005564 Bacteria 1663
167 Ga0070664_100327166 3300005564 Bacteria 1390
168 Ga0070664_100649104 3300005564 Bacteria 981
169 Ga0068857_100001072 3300005577 Bacteria 21170
170 Ga0068854_100000909 3300005578 Bacteria 17803
171 Ga0068856_100017822 3300005614 Bacteria 6888
172 Ga0068856_100100018 3300005614 Bacteria 2892
173 Ga0068856_100524182 3300005614 Bacteria 1206
174 Ga0070702_100212642 3300005615 Bacteria 1288
175 Ga0068852_100000713 3300005616 Bacteria 21734
176 Ga0068859_100001523 3300005617 Bacteria 23646
177 Ga0068859_100075587 3300005617 Bacteria 3409
178 Ga0068859_100171343 3300005617 Bacteria 2251
179 Ga0068864_100000715 3300005618 Bacteria 27854
180 Ga0068864_100150463 3300005618 Bacteria 2108
181 Ga0068866_10000861 3300005718 Bacteria 13443
182 Ga0068861_100000574 3300005719 Bacteria 21775
183 Ga0068861_100060575 3300005719 Bacteria 2901
184 Ga0068861_100307059 3300005719 Bacteria 1376
185 Ga0068870_10000009 3300005840 Bacteria 70353
186 Ga0068870_10009685 3300005840 Bacteria 4392
187 Ga0068863_100001272 3300005841 Bacteria 25149
188 Ga0068863_100346092 3300005841 Bacteria 1447
189 Ga0068858_100048713 3300005842 Bacteria 3925
190 Ga0068858_100048887 3300005842 Bacteria 3917
191 Ga0068858_100124860 3300005842 Bacteria 2409
192 Ga0068860_100001758 3300005843 Bacteria 23120
193 Ga0068860_100045883 3300005843 Bacteria 4167
194 Ga0068860_100053056 3300005843 Bacteria 3855
195 Ga0068860_100281328 3300005843 Bacteria 1626
196 Ga0068862_100005607 3300005844 Bacteria 10490
197 Ga0068862_100070041 3300005844 Bacteria 3028
198 Ga0081455_10000002 3300005937 Bacteria 460472
199 Ga0081455_10075087 3300005937 Bacteria 2790
200 Ga0081455_10263365 3300005937 Bacteria 1255
201 Ga0070717_10060654 3300006028 Bacteria 3132
202 Ga0070717_10205797 3300006028 Bacteria 1725
203 Ga0075363_100191467 3300006048 Bacteria 1167
204 Ga0075432_10003208 3300006058 Bacteria 5518
205 Ga0070716_100021278 3300006173 Bacteria 3415
206 Ga0070712_100050502 3300006175 Bacteria 2893
207 Ga0070712_100136022 3300006175 Bacteria 1869
208 Ga0075367_10111970 3300006178 Bacteria 1676
209 Ga0075369_10018049 3300006186 Bacteria 2869
210 Ga0075366_10033744 3300006195 Bacteria 3015
211 Ga0075366_10107721 3300006195 Bacteria 1675
212 Ga0097621_100001018 3300006237 Bacteria 19728
213 Ga0075370_10145685 3300006353 Bacteria 1386
214 Ga0068871_100000012 3300006358 Bacteria 105267
215 Ga0068871_100148471 3300006358 Bacteria 1998
216 Ga0075428_100001200 3300006844 Bacteria 27756
217 Ga0075428_100170370 3300006844 Bacteria 2360
218 Ga0075428_100245014 3300006844 Bacteria 1933
219 Ga0075430_100000032 3300006846 Bacteria 72679
220 Ga0075430_100024887 3300006846 Bacteria 5092
221 Ga0075431_100000462 3300006847 Bacteria 33505
222 Ga0075431_100148619 3300006847 Bacteria 2413
223 Ga0075433_10000072 3300006852 Bacteria 45390
224 Ga0075433_10001122 3300006852 Bacteria 19376
225 Ga0075433_10023300 3300006852 Bacteria 5210
226 Ga0075433_10033971 3300006852 Bacteria 4376
227 Ga0075433_10038289 3300006852 Bacteria 4141
228 Ga0075434_100000341 3300006871 Bacteria 33666
229 Ga0075434_100001564 3300006871 Bacteria 19411
230 Ga0075434_100001937 3300006871 Bacteria 17946
231 Ga0075434_100013026 3300006871 Bacteria 7896
232 Ga0075434_100023536 3300006871 Bacteria 6004
233 Ga0075434_100026026 3300006871 Bacteria 5728
234 Ga0075434_100050267 3300006871 Bacteria 4141
235 Ga0075434_100192179 3300006871 Bacteria 2062
236 Ga0075434_100269253 3300006871 Bacteria 1723
237 Ga0075429_100000631 3300006880 Bacteria 27160
238 Ga0075429_100111563 3300006880 Bacteria 2390
239 Ga0075429_100692360 3300006880 Bacteria 893
240 Ga0068865_100000328 3300006881 Bacteria 26279
241 Ga0075436_100471206 3300006914 Bacteria 916
242 Ga0097620_100001523 3300006931 Bacteria 23646
243 Ga0097620_100075588 3300006931 Bacteria 3409
244 Ga0097620_100171336 3300006931 Bacteria 2251
245 Ga0075435_100007539 3300007076 Bacteria 7767
246 Ga0075435_100018432 3300007076 Bacteria 5309
247 Ga0075435_100033377 3300007076 Bacteria 4069
248 Ga0075435_100096198 3300007076 Bacteria 2450
249 Ga0075435_100199808 3300007076 Bacteria 1694
250 Ga0099795_10051916 3300007788 Bacteria 1496
251 Ga0099795_10116589 3300007788 Bacteria 1064
252 Ga0105251_10051946 3300009011 Bacteria 1953
253 Ga0105240_10016810 3300009093 Bacteria 9893
254 Ga0111539_10000915 3300009094 Bacteria 38573
255 Ga0111539_10001908 3300009094 Bacteria 27756
256 Ga0111539_10002936 3300009094 Bacteria 22607
257 Ga0111539_10033531 3300009094 Bacteria 6234
258 Ga0111539_10041767 3300009094 Bacteria 5512
259 Ga0111539_10041772 3300009094 Bacteria 5511
260 Ga0111539_10129768 3300009094 Bacteria 2952
261 Ga0105245_10001404 3300009098 Bacteria 21834
262 Ga0105245_10200346 3300009098 Bacteria 1917
263 Ga0105247_10020951 3300009101 Bacteria 3933
264 Ga0105247_10087657 3300009101 Bacteria 1971
265 Ga0105247_10167039 3300009101 Bacteria 1461
266 Ga0105247_10314403 3300009101 Bacteria 1091
267 Ga0114129_10001035 3300009147 Bacteria 36374
268 Ga0114129_10001551 3300009147 Bacteria 31169
269 Ga0114129_10232960 3300009147 Bacteria 2479
270 Ga0114129_10264205 3300009147 Bacteria 2305
271 Ga0114129_10686897 3300009147 Bacteria 1317
272 Ga0105243_10001028 3300009148 Bacteria 25704
273 Ga0105243_10100290 3300009148 Bacteria 2402
274 Ga0105243_10139703 3300009148 Bacteria 2065
275 Ga0105243_10408260 3300009148 Bacteria 1263
276 Ga0105241_10000720 3300009174 Bacteria 25072
277 Ga0105241_10028053 3300009174 Bacteria 4192
278 Ga0105242_10000607 3300009176 Bacteria 28041
279 Ga0105242_10131222 3300009176 Bacteria 2163
280 Ga0105242_10147864 3300009176 Bacteria 2046
281 Ga0105248_10000309 3300009177 Bacteria 58008
282 Ga0105248_10019080 3300009177 Bacteria 7583
283 Ga0105248_10099089 3300009177 Bacteria 3284
284 Ga0105248_10522825 3300009177 Bacteria 1338
285 Ga0105237_10004962 3300009545 Bacteria 15190
286 Ga0105237_10266048 3300009545 Bacteria 1717
287 Ga0105238_10281483 3300009551 Bacteria 1644
288 Ga0105238_10377742 3300009551 Bacteria 1408
289 Ga0105249_10000486 3300009553 Bacteria 36821
290 Ga0105249_10053545 3300009553 Bacteria 3688
291 Ga0105249_10111857 3300009553 Bacteria 2582
292 Ga0105249_10190487 3300009553 Bacteria 2001
293 Ga0105249_10554833 3300009553 Bacteria 1200
294 Ga0099796_10002137 3300010159 Bacteria 4255
295 Ga0099796_10050021 3300010159 Bacteria 1447
296 Ga0105239_10039493 3300010375 Bacteria 5171
297 Ga0105239_10165990 3300010375 Bacteria 2469
298 Ga0105239_10230457 3300010375 Bacteria 2078
299 Ga0105239_10328480 3300010375 Bacteria 1725
300 Ga0105246_10000696 3300011119 Bacteria 18957
301 Ga0105246_10192445 3300011119 Bacteria 1580
302 Ga0105246_10386840 3300011119 Bacteria 1158
303 Ga0157328_1000562 3300012478 Bacteria 1378
304 Ga0157339_1000408 3300012505 Bacteria 2205
305 Ga0157373_10004002 3300013100 Bacteria 11114
306 Ga0157370_10026919 3300013104 Bacteria 5672
307 Ga0157374_10001864 3300013296 Bacteria 17741
308 Ga0157374_10046182 3300013296 Bacteria 4032
309 Ga0157378_10000872 3300013297 Bacteria 27839
310 Ga0157378_10052559 3300013297 Bacteria 3625
311 Ga0157378_10261242 3300013297 Bacteria 1661
312 Ga0157378_10397902 3300013297 Bacteria 1356
313 Ga0157378_10770705 3300013297 Bacteria 986
314 Ga0163162_10000992 3300013306 Bacteria 26439
315 Ga0163162_10031909 3300013306 Bacteria 5228
316 Ga0163162_10094359 3300013306 Bacteria 3078
317 Ga0163162_10829707 3300013306 Bacteria 1040
318 Ga0157372_10010113 3300013307 Bacteria 10021
319 Ga0157372_10017064 3300013307 Bacteria 7794
320 Ga0157372_10593453 3300013307 Bacteria 1291
321 Ga0157375_10002320 3300013308 Bacteria 16428
322 Ga0157375_10101463 3300013308 Bacteria 2961
323 Ga0157375_10192104 3300013308 Bacteria 2197
324 Ga0163163_10010760 3300014325 Bacteria 8252
325 Ga0163163_10079007 3300014325 Bacteria 3288
326 Ga0163163_10129460 3300014325 Bacteria 2564
327 Ga0163163_10695674 3300014325 Bacteria 1080
328 Ga0157380_10000711 3300014326 Bacteria 20809
329 Ga0157380_10621602 3300014326 Bacteria 1072
330 Ga0182008_10045970 3300014497 Bacteria 2171
331 Ga0157377_10000336 3300014745 Bacteria 21014
332 Ga0157377_10184741 3300014745 Bacteria 1314
333 Ga0157379_10000678 3300014968 Bacteria 27608
334 Ga0157379_10002722 3300014968 Bacteria 14925
335 Ga0157379_10219614 3300014968 Bacteria 1722
336 Ga0157379_10443863 3300014968 Bacteria 1197
337 Ga0157376_10002160 3300014969 Bacteria 13240
338 Ga0157376_10035957 3300014969 Bacteria 4009
339 Ga0163161_10000534 3300017792 Bacteria 31044
340 Ga0163161_10216521 3300017792 Bacteria 1481
341 Ga0224572_1005870 3300024225 Bacteria 2205
342 Ga0228598_1000172 3300024227 Bacteria 11396
343 Ga0207666_1000066 3300025271 Bacteria 18185
344 Ga0207673_1000028 3300025290 Bacteria 11640
345 Ga0209758_1001049 3300025297 Bacteria 36203
346 Ga0209758_1034288 3300025297 Bacteria 2022
347 Ga0207697_10000374 3300025315 Bacteria 25123
348 Ga0207682_10000011 3300025893 Bacteria 85533
349 Ga0207692_10092178 3300025898 Bacteria 1645
350 Ga0207642_10027213 3300025899 Bacteria 2338
351 Ga0207642_10056394 3300025899 Bacteria 1802
352 Ga0207642_10153813 3300025899 Bacteria 1228
353 Ga0207710_10000805 3300025900 Bacteria 16991
354 Ga0207688_10000020 3300025901 Bacteria 51200
355 Ga0207688_10117233 3300025901 Bacteria 1551
356 Ga0207688_10137384 3300025901 Bacteria 1436
357 Ga0207680_10009400 3300025903 Bacteria 4850
358 Ga0207647_10002391 3300025904 Bacteria 14250
359 Ga0207647_10006919 3300025904 Bacteria 8222
360 Ga0207699_10037402 3300025906 Bacteria 2774
361 Ga0207645_10000108 3300025907 Bacteria 61630
362 Ga0207645_10025122 3300025907 Bacteria 3858
363 Ga0207645_10151095 3300025907 Bacteria 1516
364 Ga0207645_10237533 3300025907 Bacteria 1204
365 Ga0207643_10000685 3300025908 Bacteria 21167
366 Ga0207643_10055619 3300025908 Bacteria 2250
367 Ga0207643_10261948 3300025908 Bacteria 1068
368 Ga0207684_10059283 3300025910 Bacteria 3250
369 Ga0207654_10000818 3300025911 Bacteria 17142
370 Ga0207707_10000689 3300025912 Bacteria 33589
371 Ga0207707_10081183 3300025912 Bacteria 2831
372 Ga0207695_10094120 3300025913 Bacteria 3004
373 Ga0207671_10138505 3300025914 Bacteria 1873
374 Ga0207693_10004461 3300025915 Bacteria 11827
375 Ga0207693_10027984 3300025915 Bacteria 4456
376 Ga0207693_10121826 3300025915 Bacteria 2048
377 Ga0207693_10282649 3300025915 Bacteria 1300
378 Ga0207663_10156566 3300025916 Bacteria 1603
379 Ga0207660_10000442 3300025917 Bacteria 27342
380 Ga0207660_10089954 3300025917 Bacteria 2273
381 Ga0207662_10000249 3300025918 Bacteria 24950
382 Ga0207662_10007168 3300025918 Bacteria 6064
383 Ga0207662_10018925 3300025918 Bacteria 3912
384 Ga0207657_10002726 3300025919 Bacteria 19014
385 Ga0207657_10013158 3300025919 Bacteria 8123
386 Ga0207657_10085746 3300025919 Bacteria 2637
387 Ga0207657_10130560 3300025919 Bacteria 2059
388 Ga0207649_10000057 3300025920 Bacteria 102314
389 Ga0207652_10008629 3300025921 Bacteria 8201
390 Ga0207652_10051097 3300025921 Bacteria 3543
391 Ga0207652_10065099 3300025921 Bacteria 3155
392 Ga0207652_10360595 3300025921 Bacteria 1312
393 Ga0207681_10000181 3300025923 Bacteria 51755
394 Ga0207681_10222391 3300025923 Bacteria 1461
395 Ga0207650_10858233 3300025925 Bacteria 770
396 Ga0207659_10000028 3300025926 Bacteria 130804
397 Ga0207659_10158633 3300025926 Bacteria 1774
398 Ga0207659_10583772 3300025926 Bacteria 952
399 Ga0207687_10000061 3300025927 Bacteria 84113
400 Ga0207687_10020754 3300025927 Bacteria 4358
401 Ga0207700_10197568 3300025928 Bacteria 1693
402 Ga0207664_10279995 3300025929 Bacteria 1463
403 Ga0207664_10311099 3300025929 Bacteria 1388
404 Ga0207664_10463745 3300025929 Bacteria 1132
405 Ga0207644_10000315 3300025931 Bacteria 31527
406 Ga0207644_10016933 3300025931 Bacteria 4911
407 Ga0207644_10186172 3300025931 Bacteria 1630
408 Ga0207690_10000445 3300025932 Bacteria 26765
409 Ga0207690_10130945 3300025932 Bacteria 1836
410 Ga0207706_10002206 3300025933 Bacteria 18992
411 Ga0207706_10114274 3300025933 Bacteria 2375
412 Ga0207706_10625085 3300025933 Bacteria 924
413 Ga0207686_10000972 3300025934 Bacteria 17055
414 Ga0207686_10487425 3300025934 Bacteria 954
415 Ga0207709_10006278 3300025935 Bacteria 6674
416 Ga0207709_10040817 3300025935 Bacteria 2781
417 Ga0207709_10074263 3300025935 Bacteria 2169
418 Ga0207709_10149497 3300025935 Bacteria 1616
419 Ga0207670_10000217 3300025936 Bacteria 37598
420 Ga0207670_10007204 3300025936 Bacteria 6198
421 Ga0207670_10173914 3300025936 Bacteria 1617
422 Ga0207670_10270672 3300025936 Bacteria 1320
423 Ga0207669_10000147 3300025937 Bacteria 34031
424 Ga0207669_10145634 3300025937 Bacteria 1651
425 Ga0207669_10213218 3300025937 Bacteria 1411
426 Ga0207704_10000357 3300025938 Bacteria 21286
427 Ga0207665_10040718 3300025939 Bacteria 3101
428 Ga0207665_10275759 3300025939 Bacteria 1250
429 Ga0207691_10002033 3300025940 Bacteria 19787
430 Ga0207691_10028531 3300025940 Bacteria 5224
431 Ga0207691_10116407 3300025940 Bacteria 2372
432 Ga0207711_10006377 3300025941 Bacteria 9942
433 Ga0207711_10008129 3300025941 Bacteria 8782
434 Ga0207711_10046325 3300025941 Bacteria 3715
435 Ga0207711_10244504 3300025941 Bacteria 1646
436 Ga0207689_10001029 3300025942 Bacteria 26794
437 Ga0207661_10000126 3300025944 Bacteria 48665
438 Ga0207679_10000026 3300025945 Bacteria 200073
439 Ga0207679_10108366 3300025945 Bacteria 2187
440 Ga0207679_10126255 3300025945 Bacteria 2045
441 Ga0207679_10222819 3300025945 Bacteria 1588
442 Ga0207667_10010420 3300025949 Bacteria 10867
443 Ga0207651_10000342 3300025960 Bacteria 19828
444 Ga0207651_10585963 3300025960 Bacteria 973
445 Ga0207712_10000686 3300025961 Bacteria 26195
446 Ga0207712_10311058 3300025961 Bacteria 1296
447 Ga0207712_10312215 3300025961 Bacteria 1294
448 Ga0207712_10350845 3300025961 Bacteria 1227
449 Ga0207668_10000242 3300025972 Bacteria 36700
450 Ga0207668_10402756 3300025972 Bacteria 1157
451 Ga0207640_10000833 3300025981 Bacteria 17545
452 Ga0207658_10038939 3300025986 Bacteria 3428
453 Ga0207658_10534530 3300025986 Bacteria 1048
454 Ga0207677_10000710 3300026023 Bacteria 19646
455 Ga0207677_10137387 3300026023 Bacteria 1866
456 Ga0207677_10291402 3300026023 Bacteria 1344
457 Ga0207703_10001559 3300026035 Bacteria 20767
458 Ga0207703_10328847 3300026035 Bacteria 1402
459 Ga0207639_10002260 3300026041 Bacteria 12939
460 Ga0207639_10034012 3300026041 Bacteria 3764
461 Ga0207639_10244107 3300026041 Bacteria 1563
462 Ga0207639_10341664 3300026041 Bacteria 1335
463 Ga0207678_10001079 3300026067 Bacteria 24988
464 Ga0207678_10022723 3300026067 Bacteria 5492
465 Ga0207678_10277698 3300026067 Bacteria 1437
466 Ga0207678_10330331 3300026067 Bacteria 1312
467 Ga0207708_10000805 3300026075 Bacteria 23614
468 Ga0207708_10006143 3300026075 Bacteria 8905
469 Ga0207702_10002121 3300026078 Bacteria 19082
470 Ga0207702_10068858 3300026078 Bacteria 3041
471 Ga0207641_10001766 3300026088 Bacteria 20843
472 Ga0207641_10429122 3300026088 Bacteria 1274
473 Ga0207641_10485171 3300026088 Bacteria 1198
474 Ga0207648_10000731 3300026089 Bacteria 36792
475 Ga0207676_10000361 3300026095 Bacteria 38795
476 Ga0207674_10002121 3300026116 Bacteria 25067
477 Ga0207675_100001489 3300026118 Bacteria 23488
478 Ga0207675_100039410 3300026118 Bacteria 4409
479 Ga0207675_100089221 3300026118 Bacteria 2897
480 Ga0207675_100104037 3300026118 Bacteria 2676
481 Ga0207683_10000034 3300026121 Bacteria 101817
482 Ga0207683_10012741 3300026121 Bacteria 7176
483 Ga0207683_10035186 3300026121 Bacteria 4356
484 Ga0207683_10385217 3300026121 Bacteria 1289
485 Ga0207698_10000304 3300026142 Bacteria 29523
486 Ga0207698_10416859 3300026142 Bacteria 1287
487 Ga0209973_1001485 3300027252 Bacteria 2059
488 Ga0210002_1000561 3300027617 Bacteria 5031
489 Ga0209983_1035728 3300027665 Bacteria 1067
490 Ga0209588_1002483 3300027671 Bacteria 5001
491 Ga0209971_1003397 3300027682 Bacteria 3777
492 Ga0209966_1002652 3300027695 Bacteria 2993
493 Ga0209966_1002767 3300027695 Bacteria 2936
494 Ga0209998_10000861 3300027717 Bacteria 7800
495 Ga0209974_10000830 3300027876 Bacteria 10632
496 Ga0207428_10000082 3300027907 Bacteria 133684
497 Ga0207428_10000352 3300027907 Bacteria 59444
498 Ga0207428_10001078 3300027907 Bacteria 29769
499 Ga0207428_10005810 3300027907 Bacteria 11441
500 Ga0207428_10018670 3300027907 Bacteria 5920
501 Ga0268266_10039033 3300028379 Bacteria 4044
502 Ga0268266_10070689 3300028379 Bacteria 3025
503 Ga0268266_10582685 3300028379 Bacteria 1074
504 Ga0268265_10001338 3300028380 Bacteria 21019
505 Ga0268265_10404695 3300028380 Bacteria 1262
506 Ga0268264_10002557 3300028381 Bacteria 15953
507 Ga0268264_10065013 3300028381 Bacteria 3072
508 Ga0268264_10079082 3300028381 Bacteria 2805
509 Ga0265338_10129337 3300028800 Bacteria 1997
510 Ga0265325_10000141 3300031241 Bacteria 50291
511 Ga0265325_10005121 3300031241 Bacteria 8154
512 Ga0265325_10005810 3300031241 Bacteria 7563
513 Ga0265325_10005829 3300031241 Bacteria 7546
514 Ga0265325_10009631 3300031241 Bacteria 5635
515 Ga0265340_10004172 3300031247 Bacteria 8112
516 Ga0265339_10000067 3300031249 Bacteria 91730
517 Ga0265339_10026535 3300031249 Bacteria 3316
518 Ga0265313_10000008 3300031595 Bacteria 173405
519 Ga0265313_10000054 3300031595 Bacteria 110199
520 Ga0265313_10001334 3300031595 Bacteria 23230
521 Ga0265313_10012192 3300031595 Bacteria 5276
522 Ga0265342_10018860 3300031712 Bacteria 4460
523 Ga0307416_100752666 3300032002 Bacteria 1067
524 Ga0316583_10001247 3300032133 Bacteria 8383
525 Ga0373948_0000353 3300034817 Bacteria 5653
526 Ga0373948_0007550 3300034817 Bacteria 1832
527 Ga0373950_0021975 3300034818 Bacteria 1132
528 Ga0373958_0000098 3300034819 Bacteria 9234
529 Ga0373958_0001694 3300034819 Bacteria 2990
530 Ga0373959_0015032 3300034820 Bacteria 1417
531 Ga0373938_0004446 3300034957 Bacteria 2345
532 Ga0373938_0014150 3300034957 Bacteria 1527
533 Ga0373926_0040529 3300035083 Bacteria 1663
534 Ga0373926_0071092 3300035083 Bacteria 1279
535 Ga0373928_0007197 3300035084 Bacteria 2146
536 Ga0373928_0042926 3300035084 Bacteria 1045
537 Ga0373929_0000124 3300035085 Bacteria 12765
538 Ga0373929_0006484 3300035085 Bacteria 2116
539 Ga0373929_0007906 3300035085 Bacteria 1953
540 Ga0373929_0025379 3300035085 Bacteria 1230
541 Ga0373934_0099392 3300035086 Bacteria 1176
542 Ga0373940_0011652 3300035088 Bacteria 2093
543 Ga0373940_0047469 3300035088 Bacteria 1197
544 Ga0373949_0005140 3300035090 Bacteria 2938
545 Ga0373951_0000233 3300035091 Bacteria 18990
546 Ga0373951_0016081 3300035091 Bacteria 1687
547 Ga0373952_0002094 3300035092 Bacteria 3588
548 Ga0373952_0008590 3300035092 Bacteria 1940
549 Ga0373923_0012453 3300035111 Bacteria 3144
550 Ga0373932_0000369 3300035112 Bacteria 13870
551 Ga0373936_0030358 3300035113 Bacteria 2131
552 Ga0373939_0000589 3300035114 Bacteria 9057
553 Ga0373939_0000999 3300035114 Bacteria 7003
554 Ga0373939_0003749 3300035114 Bacteria 3581
555 Ga0373941_0005015 3300035115 Bacteria 3087
556 Ga0373945_0071501 3300035116 Bacteria 1314
557 Ga0373953_0004850 3300035117 Bacteria 4323
558 Ga0373954_0007712 3300035118 Bacteria 4710
559 Ga0373954_0009461 3300035118 Bacteria 4287
560 Ga0373956_0003621 3300035119 Bacteria 6234
561 Ga0373957_0003018 3300035120 Bacteria 4890
562 Ga0373957_0005217 3300035120 Bacteria 4018
563 Ga0373960_0000741 3300035121 Bacteria 6816
564 Ga0373960_0025402 3300035121 Bacteria 1610
565 Ga0373943_0018589 3300035170 Bacteria 3195
566 Ga0373946_0022964 3300035171 Bacteria 2433
567 Ga0373955_0001226 3300035172 Bacteria 10903
568 Ga0373955_0026941 3300035172 Bacteria 2966
569 Ga0373942_0002793 3300035207 Bacteria 4158
570 Ga0373942_0003759 3300035207 Bacteria 3555
571 Ga0373942_0004850 3300035207 Bacteria 3123
572 Ga0373942_0019599 3300035207 Bacteria 1690
573 Ga0373961_0004509 3300035241 Bacteria 3367
574 Ga0373961_0012391 3300035241 Bacteria 2134
575 Ga0373962_0000152 3300035242 Bacteria 14343
576 Ga0373962_0000699 3300035242 Bacteria 7580
577 Ga0373962_0023858 3300035242 Bacteria 1632
578 Ga0373924_0011339 3300035410 Bacteria 3309
579 Ga0373924_0047181 3300035410 Bacteria 1777
580 Ga0373924_0131175 3300035410 Bacteria 1090
581 Ga0373931_0000179 3300035691 Bacteria 27558
582 Ga0373931_0005009 3300035691 Bacteria 6094
583 Ga0373931_0009136 3300035691 Bacteria 4730
584 Ga0373931_0011482 3300035691 Bacteria 4281
585 Ga0373931_0034856 3300035691 Bacteria 2614
586 Ga0373931_0165942 3300035691 Bacteria 1298
587 Ga0373931_0210897 3300035691 Bacteria 1165
588 Ga0373935_0028870 3300035692 Bacteria 3429
589 Ga0373935_0044071 3300035692 Bacteria 2810
590 Ga0373935_0056098 3300035692 Bacteria 2511
591 Ga0373935_0083897 3300035692 Bacteria 2075
592 Ga0373935_0156754 3300035692 Bacteria 1549
593 Ga0373935_0206077 3300035692 Bacteria 1361
594 Ga0373927_0029934 3300035695 Bacteria 3551
595 Ga0373927_0033369 3300035695 Bacteria 3352
596 Ga0373927_0050999 3300035695 Bacteria 2676
597 Ga0373927_0051352 3300035695 Bacteria 2666
598 Ga0373927_0073060 3300035695 Bacteria 2221
599 Ga0373927_0082831 3300035695 Bacteria 2080
600 Ga0373927_0104838 3300035695 Bacteria 1841
601 Ga0373927_0185770 3300035695 Bacteria 1363
602 Ga0373933_0001753 3300035724 Bacteria 12585
603 Ga0373947_0021159 3300035725 Bacteria 3763
604 Ga0373947_0022989 3300035725 Bacteria 3623
605 Ga0373947_0050332 3300035725 Bacteria 2505
606 Ga0373947_0076121 3300035725 Bacteria 2068
607 Ga0373947_0115820 3300035725 Bacteria 1699
608 Ga0373937_0000879 3300036401 Bacteria 25733
609 Ga0373937_0023251 3300036401 Bacteria 5579
610 Ga0373937_0030498 3300036401 Bacteria 4883
611 Ga0373937_0114376 3300036401 Bacteria 2512
612 Ga0373937_0118016 3300036401 Bacteria 2471
613 Ga0373937_0172835 3300036401 Bacteria 2027
614 Ga0373925_0013172 3300037068 Bacteria 5986
615 Ga0373925_0041837 3300037068 Bacteria 3398
616 Ga0373925_0046184 3300037068 Bacteria 3238
617 Ga0373925_0169925 3300037068 Bacteria 1721
618 Ga0373925_0236231 3300037068 Bacteria 1463
619 Ga0395898_0125956 3300037466 Bacteria 2454
620 Ga0395905_0015104 3300037471 Bacteria 7351
621 Ga0395901_0058034 3300038443 Bacteria 4026
622 Ga0436361_0602366 3300039447 Bacteria 1020
623 Ga0439453_0002256 3300041408 Bacteria 2632
624 Ga0439453_0018346 3300041408 Bacteria 1236
625 Ga0439434_0085432 3300042435 Bacteria 1005
626 Ga0439435_0005924 3300042436 Bacteria 2718
627 Ga0439444_0030390 3300042437 Bacteria 1011
628 Ga0439460_0013337 3300042461 Bacteria 2148
629 Ga0466963_0053385 3300044694 Bacteria 2683
630 Ga0453684_0163789 3300044712 Bacteria 2627
631 Ga0466957_0038975 3300044842 Bacteria 2866
632 Ga0451576_0084542 3300045051 Bacteria 3301
633 Ga0466958_0082777 3300045836 Bacteria 1977
634 Ga0466967_0000948 3300045976 Bacteria 15662
635 Ga0495592_0000513 3300046454 Bacteria 28143
636 Ga0495592_0004552 3300046454 Bacteria 10152
637 Ga0495592_0029018 3300046454 Bacteria 4188
638 Ga0495592_0106118 3300046454 Bacteria 1994
639 Ga0495603_0007105 3300046455 Bacteria 6720
640 Ga0495603_0047882 3300046455 Bacteria 2545
641 Ga0495590_0057575 3300046457 Bacteria 1359
642 Ga0495629_0000062 3300046459 Bacteria 97169
643 Ga0495629_0002976 3300046459 Bacteria 12894
644 Ga0495629_0186305 3300046459 Bacteria 1437
645 Ga0495651_0000910 3300046462 Bacteria 22944
646 Ga0495651_0006020 3300046462 Bacteria 9260
647 Ga0495651_0030341 3300046462 Bacteria 4216
648 Ga0495653_0002622 3300046463 Bacteria 14311
649 Ga0495653_0003316 3300046463 Bacteria 12926
650 Ga0495580_0055899 3300046472 Bacteria 2780
651 Ga0495580_0130748 3300046472 Bacteria 1742
652 Ga0495580_0168882 3300046472 Bacteria 1513
653 Ga0495580_0402650 3300046472 Bacteria 922
654 Ga0495639_0058896 3300046475 Bacteria 1758
655 Ga0495639_0071772 3300046475 Bacteria 1600
656 Ga0495639_0118000 3300046475 Bacteria 1264
657 Ga0495662_0026233 3300046476 Bacteria 2814
658 Ga0495662_0032498 3300046476 Bacteria 2521
659 Ga0495664_0000434 3300046477 Bacteria 20493
660 Ga0495664_0199514 3300046477 Bacteria 1212
661 Ga0495664_0214078 3300046477 Bacteria 1167
662 Ga0495584_0049211 3300046491 Bacteria 2124
663 Ga0495594_0088820 3300046499 Bacteria 1730
664 Ga0495594_0211177 3300046499 Bacteria 1107
665 Ga0495608_0001525 3300046511 Bacteria 16483
666 Ga0495608_0007060 3300046511 Bacteria 7950
667 Ga0495608_0149567 3300046511 Bacteria 1488
668 Ga0495618_0014292 3300046514 Bacteria 4834
669 Ga0495628_0008936 3300046516 Bacteria 8568
670 Ga0495628_0038743 3300046516 Bacteria 3813
671 Ga0495628_0063040 3300046516 Bacteria 2904
672 Ga0495628_0087887 3300046516 Bacteria 2409
673 Ga0495630_0047958 3300046517 Bacteria 3196
674 Ga0495630_0057021 3300046517 Bacteria 2927
675 Ga0495630_0215911 3300046517 Bacteria 1464
676 Ga0495630_0228151 3300046517 Bacteria 1422
677 Ga0495648_0006759 3300046524 Bacteria 9274
678 Ga0495666_0026964 3300046526 Bacteria 2828
679 Ga0495666_0077515 3300046526 Bacteria 1575
680 Ga0495642_0088866 3300046528 Bacteria 1307
681 Ga0495652_0011195 3300046529 Bacteria 8123
682 Ga0495652_0028653 3300046529 Bacteria 4898
683 Ga0495652_0055382 3300046529 Bacteria 3372
684 Ga0495652_0111242 3300046529 Bacteria 2202
685 Ga0495652_0168606 3300046529 Bacteria 1692
686 Ga0495665_0035362 3300046531 Bacteria 2669
687 Ga0495665_0089448 3300046531 Bacteria 1618
688 Ga0495640_0003016 3300046533 Bacteria 13550
689 Ga0495640_0024844 3300046533 Bacteria 4353
690 Ga0495640_0147263 3300046533 Bacteria 1514
691 Ga0495587_0001060 3300046536 Bacteria 18094
692 Ga0495587_0014613 3300046536 Bacteria 4918
693 Ga0495645_0000746 3300046543 Bacteria 22248
694 Ga0495645_0000974 3300046543 Bacteria 19495
695 Ga0495645_0066570 3300046543 Bacteria 2603
696 Ga0495645_0367647 3300046543 Bacteria 923
697 Ga0495622_0102534 3300046557 Bacteria 1311
698 Ga0495667_0003474 3300046559 Bacteria 10559
699 Ga0495667_0006015 3300046559 Bacteria 8208
700 Ga0495667_0012221 3300046559 Bacteria 5817
701 Ga0495667_0041577 3300046559 Bacteria 3048
702 Ga0495667_0068049 3300046559 Bacteria 2326
703 Ga0495634_0039270 3300046642 Bacteria 3223
704 Ga0495634_0162669 3300046642 Bacteria 1406
705 Ga0495635_0018303 3300046663 Bacteria 4888
706 Ga0495635_0072101 3300046663 Bacteria 2367
707 Ga0495635_0103107 3300046663 Bacteria 1950
708 Ga0495635_0107294 3300046663 Bacteria 1907
709 Ga0495635_0136865 3300046663 Bacteria 1669
710 Ga0495588_0127935 3300046674 Bacteria 1340
711 Ga0495657_0087975 3300046675 Bacteria 1998
712 Ga0495657_0093258 3300046675 Bacteria 1928
713 Ga0495599_0015965 3300046678 Bacteria 4661
714 Ga0495599_0032589 3300046678 Bacteria 3270
715 Ga0495623_0001158 3300046679 Bacteria 17853
716 Ga0495623_0090844 3300046679 Bacteria 1874
717 Ga0495623_0095398 3300046679 Bacteria 1818
718 Ga0495647_0021743 3300046681 Bacteria 2312
719 Ga0495647_0052913 3300046681 Bacteria 1582
720 Ga0495658_0000718 3300046683 Bacteria 17919
721 Ga0495613_0007258 3300046689 Bacteria 8249
722 Ga0495613_0031576 3300046689 Bacteria 3935
723 Ga0495613_0033647 3300046689 Bacteria 3808
724 Ga0495613_0110546 3300046689 Bacteria 1980
725 Ga0495613_0204308 3300046689 Bacteria 1392
726 Ga0495624_0027104 3300046690 Bacteria 3754
727 Ga0495624_0062901 3300046690 Bacteria 2321
728 Ga0495624_0100157 3300046690 Bacteria 1784
729 Ga0495624_0241521 3300046690 Bacteria 1093
730 Ga0495600_0002131 3300046809 Bacteria 11199
731 Ga0495600_0007139 3300046809 Bacteria 6821
732 Ga0495600_0034255 3300046809 Bacteria 3296
733 Ga0495581_0012167 3300047315 Bacteria 4982
734 Ga0495604_0004590 3300047317 Bacteria 10940
735 Ga0495604_0013622 3300047317 Bacteria 6484
736 Ga0495604_0027286 3300047317 Bacteria 4543
737 Ga0495604_0110595 3300047317 Bacteria 2004
738 Ga0495674_0003969 3300047319 Bacteria 14347
739 Ga0495674_0006778 3300047319 Bacteria 10968
740 Ga0495674_0014686 3300047319 Bacteria 7328
741 Ga0495674_0079153 3300047319 Bacteria 2823
742 Ga0495674_0121575 3300047319 Bacteria 2205
743 Ga0495674_0152639 3300047319 Bacteria 1936
744 Ga0495676_0071454 3300047321 Bacteria 2668
745 Ga0495680_0000483 3300047322 Bacteria 44818
746 Ga0495680_0012821 3300047322 Bacteria 7347
747 Ga0495680_0017319 3300047322 Bacteria 6157
748 Ga0495680_0041448 3300047322 Bacteria 3661
749 Ga0495680_0048920 3300047322 Bacteria 3317
750 Ga0495675_0000190 3300047444 Bacteria 44968
751 Ga0495675_0010552 3300047444 Bacteria 5774
752 Ga0495675_0072610 3300047444 Bacteria 2171
753 Ga0495684_0007568 3300047471 Bacteria 8404
754 Ga0495684_0018874 3300047471 Bacteria 5310
755 Ga0495684_0046954 3300047471 Bacteria 3303
756 Ga0495684_0347791 3300047471 Bacteria 1053
757 Ga0495593_0050779 3300047673 Bacteria 2196
758 Ga0495593_0083724 3300047673 Bacteria 1647
759 Ga0495602_0015694 3300048088 Bacteria 7636
760 Ga0495602_0027846 3300048088 Bacteria 5420
761 Ga0495602_0045776 3300048088 Bacteria 3957
762 Ga0496100_0002755 3300048903 Bacteria 8989
763 Ga0496100_0034175 3300048903 Bacteria 3188
764 Ga0496100_0151684 3300048903 Bacteria 1654
765 Ga0496101_0001110 3300048904 Bacteria 16020
766 Ga0496101_0027634 3300048904 Bacteria 3954
767 Ga0496102_0071501 3300048905 Bacteria 3185
768 Ga0496102_0074399 3300048905 Bacteria 3122
769 Ga0496102_0461045 3300048905 Bacteria 1192
770 Ga0496102_0467254 3300048905 Bacteria 1182
771 Ga0496103_0000582 3300048906 Bacteria 28897
772 Ga0496103_0318700 3300048906 Bacteria 1000
773 Ga0496104_0000067 3300048907 Bacteria 108556
774 Ga0496104_0042201 3300048907 Bacteria 4280
775 Ga0496104_0253100 3300048907 Bacteria 1674
776 Ga0496104_0714322 3300048907 Bacteria 910
777 Ga0496105_0002048 3300048908 Bacteria 14575
778 Ga0496105_0126452 3300048908 Bacteria 2107
779 Ga0496105_0150300 3300048908 Bacteria 1914
780 Ga0496106_0002855 3300048909 Bacteria 12833
781 Ga0496106_0013139 3300048909 Bacteria 6110
782 Ga0496106_0046743 3300048909 Bacteria 3255
783 Ga0496107_0001812 3300048910 Bacteria 13471
784 Ga0496107_0013359 3300048910 Bacteria 5737
785 Ga0496107_0025580 3300048910 Bacteria 4179
786 Ga0496107_0120043 3300048910 Bacteria 1936
787 Ga0496107_0415043 3300048910 Bacteria 1001
788 Ga0496108_0007050 3300048911 Bacteria 9098
789 Ga0496109_0000384 3300048912 Bacteria 40091
790 Ga0496109_0011720 3300048912 Bacteria 7541
791 Ga0496110_0022806 3300048913 Bacteria 5319
792 Ga0496110_0062149 3300048913 Bacteria 3298
793 Ga0496110_0217776 3300048913 Bacteria 1736
794 Ga0496110_0222035 3300048913 Bacteria 1718
795 Ga0496110_0281809 3300048913 Bacteria 1513
796 Ga0496110_0328726 3300048913 Bacteria 1393
797 Ga0496111_0044821 3300048914 Bacteria 3180
798 Ga0496111_0045761 3300048914 Bacteria 3149
799 Ga0496111_0073964 3300048914 Bacteria 2481
800 Ga0496111_0099066 3300048914 Bacteria 2141
801 Ga0496111_0349424 3300048914 Bacteria 1095
802 Ga0496112_0093115 3300048915 Bacteria 2983
803 Ga0496112_0235700 3300048915 Bacteria 1784
804 Ga0496113_0000688 3300048916 Bacteria 17242
805 Ga0496113_0041084 3300048916 Bacteria 3411
806 Ga0496113_0176908 3300048916 Bacteria 1691
807 Ga0496113_0351627 3300048916 Bacteria 1182
808 Ga0496113_0416634 3300048916 Bacteria 1079
809 Ga0496113_0570320 3300048916 Bacteria 907
810 Ga0496114_0003688 3300048917 Bacteria 11784
811 Ga0496114_0053456 3300048917 Bacteria 3366
812 Ga0496114_0158427 3300048917 Bacteria 1967
813 Ga0496114_0199098 3300048917 Bacteria 1754
814 Ga0496115_0002409 3300048918 Bacteria 13422
815 Ga0496115_0358420 3300048918 Bacteria 1189
816 Ga0501298_035278 3300049521 Bacteria 997
817 Ga0501034_0588563 3300049571 Bacteria 1019
818 Ga0501040_0319370 3300049576 Bacteria 1111
819 Ga0501047_0004391 3300049581 Bacteria 13273
820 Ga0501047_0085249 3300049581 Bacteria 3035
821 Ga0501067_0200370 3300049583 Bacteria 1112
822 Ga0501070_0347312 3300049586 Bacteria 1205
823 Ga0501076_0016620 3300049592 Bacteria 5579
824 Ga0501077_0122310 3300049593 Bacteria 1650
825 Ga0501216_030767 3300049660 Bacteria 990
826 Ga0501083_0187225 3300049744 Bacteria 1351
827 Ga0501044_0022774 3300049823 Bacteria 6671
828 Ga0501044_0084587 3300049823 Bacteria 3206
829 nmdc:mga0yw44_289343_c1 3300050492 Bacteria 1096
830 nmdc:mga0k408_15140_c1 3300050493 Bacteria 4263
831 nmdc:mga0k408_226267_c1 3300050493 Bacteria 1117
832 nmdc:mga06z11_87457_c1 3300050494 Bacteria 1685
833 nmdc:mga05p37_133416_c1 3300050507 Bacteria 3046
834 nmdc:mga05p37_19_c2 3300050507 Bacteria 99994
835 nmdc:mga05p37_219821_c1 3300050507 Bacteria 2293
836 nmdc:mga05p37_5389_c1 3300050507 Bacteria 15038
837 nmdc:mga05p37_93380_c1 3300050507 Bacteria 3708
838 nmdc:mga09592_238_c1 3300050508 Bacteria 40013
839 nmdc:mga09592_27607_c1 3300050508 Bacteria 4712
840 nmdc:mga0qj67_13539_c1 3300050509 Bacteria 6153
841 nmdc:mga0qj67_67254_c1 3300050509 Bacteria 2855
842 nmdc:mga06r32_108717_c1 3300050510 Bacteria 2727
843 nmdc:mga06r32_2023_c1 3300050510 Bacteria 18128
844 nmdc:mga08y16_18813_c1 3300050511 Bacteria 7278
845 nmdc:mga08y16_208_c1 3300050511 Bacteria 52742
846 nmdc:mga08y16_2735_c1 3300050511 Bacteria 18090
847 nmdc:mga08y16_58085_c1 3300050511 Bacteria 4042
848 nmdc:mga08y16_80129_c1 3300050511 Bacteria 3404
849 nmdc:mga08y16_842162_c1 3300050511 Bacteria 907
850 nmdc:mga08y16_85971_c1 3300050511 Bacteria 3278
851 nmdc:mga0n895_10569_c1 3300050512 Bacteria 8167
852 nmdc:mga0n895_173295_c1 3300050512 Bacteria 2189
853 nmdc:mga0n895_3108_c1 3300050512 Bacteria 13226
854 nmdc:mga0n895_34398_c1 3300050512 Bacteria 4877
855 nmdc:mga0n895_394_c1 3300050512 Bacteria 29311
856 nmdc:mga0n895_7653_c1 3300050512 Bacteria 9289
857 nmdc:mga0rr50_229110_c1 3300050513 Bacteria 1537
858 nmdc:mga0rr50_45215_c1 3300050513 Bacteria 3234
859 nmdc:mga0rr50_5567_c1 3300050513 Bacteria 7534
860 nmdc:mga0rr50_68416_c1 3300050513 Bacteria 2700
861 nmdc:mga0a205_1167_c1 3300050515 Bacteria 5965
862 nmdc:mga0a205_143051_c1 3300050515 Bacteria 2292
863 nmdc:mga0a205_186874_c1 3300050515 Bacteria 1965
864 nmdc:mga0a205_26111_c1 3300050515 Bacteria 5565
865 nmdc:mga0a205_5198_c1 3300050515 Bacteria 11710
866 nmdc:mga0a205_5655_c1 3300050515 Bacteria 11262
867 Ga0495601_0000711 3300053077 Bacteria 17861
868 Ga0495601_0001809 3300053077 Bacteria 11873
869 Ga0495601_0005275 3300053077 Bacteria 7517
870 Ga0495601_0005584 3300053077 Bacteria 7335
871 Ga0495601_0008024 3300053077 Bacteria 6221
872 Ga0495601_0009061 3300053077 Bacteria 5877
873 Ga0495601_0013226 3300053077 Bacteria 4962
874 Ga0495601_0114635 3300053077 Bacteria 1747
875 Ga0495612_0000152 3300053078 Bacteria 29021
876 Ga0495612_0002060 3300053078 Bacteria 8276
877 Ga0495612_0014302 3300053078 Bacteria 3192
878 Ga0495612_0017950 3300053078 Bacteria 2832
879 Ga0495612_0021257 3300053078 Bacteria 2603
880 Ga0495612_0058494 3300053078 Bacteria 1593
881 Ga0495655_0046359 3300053083 Bacteria 1133
882 Ga0495595_0001635 3300053084 Bacteria 8761
883 Ga0495595_0004190 3300053084 Bacteria 5800
884 Ga0495595_0012712 3300053084 Bacteria 3545
885 Ga0495595_0050676 3300053084 Bacteria 1923
886 Ga0495595_0074797 3300053084 Bacteria 1606
887 Ga0495619_0000052 3300053085 Bacteria 98882
888 Ga0495619_0000078 3300053085 Bacteria 72749
889 Ga0495619_0001503 3300053085 Bacteria 15362
890 Ga0495619_0003543 3300053085 Bacteria 10077
891 Ga0495619_0003933 3300053085 Bacteria 9547
892 Ga0495619_0009181 3300053085 Bacteria 6245
893 Ga0495619_0028201 3300053085 Bacteria 3620
894 Ga0500642_0019927 3300053130 Bacteria 2626
895 Ga0501084_0173473 3300054114 Bacteria 1820
896 Ga0530510_0504009 3300061734 Bacteria 918
897 2876767338 2876761206 Bacteria 10111113
898 2876816647 2876808645 Bacteria 8824342
899 2879110174 2879110137 Bacteria 8907982
900 2885419104 2885409591 Bacteria 9235467
901 2922361244 2922361189 Bacteria 7436256
902 Ga0070713_100130590
903 2214628267
904 ARcpr5oldR_c000007
905 ARcpr5yngRDRAFT_c000456
906 ARSoilOldRDRAFT_c000004
907 ARCol0oldRDRAFT_c00335
908 ARCol0yngRDRAFT_1000002
909 JGI24746J21847_1001973
910 JGI24740J21852_10024717
911 JGI24737J22298_10001147
912 JGI24750J21931_1000100
913 JGI24745J21846_1002936
914 JGI24738J21930_10000155
915 JGI24749J21850_1000093
916 JGI24744J21845_10000499
917 JGI24742J22300_10000079
918 JGI25153J46596_10013295
919 JGI25153J46596_10015068
920 JGI25405J52794_10013204
921 JGI25405J52794_10031827
922 Ga0065717_1002392
923 Ga0065716_1000034
924 Ga0065704_10102560
925 Ga0065715_10000599
926 Ga0065715_10088946
927 Ga0070676_10000514
928 Ga0070676_10084468
929 Ga0070683_100000931
930 Ga0070683_100109638
931 Ga0070690_100002803
932 Ga0070690_100024319
933 Ga0070690_100426610
934 Ga0070670_100013151
935 Ga0068869_100000153
936 Ga0068869_100267360
937 Ga0070666_10013476
938 Ga0070680_100000814
939 Ga0070680_100061445
940 Ga0070680_100152901
941 Ga0070682_100000445
942 Ga0070682_100002065
943 Ga0070682_100107042
944 Ga0068868_100000148
945 Ga0068868_100246395
946 Ga0070660_100001480
947 Ga0070660_100076309
948 Ga0070660_100237325
949 Ga0070689_100000880
950 Ga0070689_100008335
951 Ga0070689_100014989
952 Ga0070689_100072547
953 Ga0070689_100086333
954 Ga0070691_10002726
955 Ga0070691_10153385
956 Ga0070687_100000187
957 Ga0070687_100000759
958 Ga0070687_100022132
959 Ga0070661_100004477
960 Ga0070661_100139005
961 Ga0070692_10001230
962 Ga0070692_10056825
963 Ga0070668_100100592
964 Ga0070668_100220924
965 Ga0070669_100000501
966 Ga0070669_100157391
967 Ga0070669_100204113
968 Ga0070675_100027368
969 Ga0070675_100086697
970 Ga0070675_100231393
971 Ga0070675_100410630
972 Ga0070671_100000595
973 Ga0070671_100015975
974 Ga0070671_100017211
975 Ga0070671_100135240
976 Ga0070674_100000249
977 Ga0070673_100000233
978 Ga0070673_100353400
979 Ga0070688_100000432
980 Ga0070688_100011750
981 Ga0070688_100044365
982 Ga0070688_100137683
983 Ga0070659_100000746
984 Ga0070659_100031480
985 Ga0070659_100203184
986 Ga0070659_100420286
987 Ga0070667_100001881
988 Ga0070667_100091596
989 Ga0070709_10332630
990 Ga0070714_100034213
991 Ga0070714_100286953
992 Ga0070714_100543427
993 Ga0070714_100562348
994 Ga0070713_100008986
995 Ga0070713_100049334
996 Ga0070713_100370313
997 Ga0070710_10008769
998 Ga0070710_10048777
999 Ga0070701_10000164
1000 Ga0070701_10023111
1001 Ga0070711_100024101
1002 Ga0070711_100045468
1003 Ga0070711_100047217
1004 Ga0070711_100579964
1005 Ga0070705_100000361
1006 Ga0070705_100046519
1007 Ga0070705_100199445
1008 Ga0070700_100000357
1009 Ga0070700_100097542
1010 Ga0070694_100006390
1011 Ga0070708_100075489
1012 Ga0070708_100181371
1013 Ga0070708_100194207
1014 Ga0070663_100000582
1015 Ga0070663_100055944
1016 Ga0070678_100001403
1017 Ga0070678_100018262
1018 Ga0070662_100067944
1019 Ga0070662_100217534
1020 Ga0070662_100249064
1021 Ga0070681_10004898
1022 Ga0070681_10119251
1023 Ga0070681_10341154
1024 Ga0068867_100001099
1025 Ga0068867_100230617
1026 Ga0070685_10003380
1027 Ga0070685_10011632
1028 Ga0070685_10036784
1029 Ga0070685_10258981
1030 Ga0070706_100007863
1031 Ga0070698_100001449
1032 Ga0070698_100418283
1033 Ga0070699_100063915
1034 Ga0070679_100002583
1035 Ga0070679_100021338
1036 Ga0070679_100054026
1037 Ga0070679_100250784
1038 Ga0070684_100000101
1039 Ga0070684_100114837
1040 Ga0070697_100092376
1041 Ga0070697_100094047
1042 Ga0070697_100275893
1043 Ga0068853_100003127
1044 Ga0068853_100009271
1045 Ga0068853_100021629
1046 Ga0070672_100001273
1047 Ga0070672_100081337
1048 Ga0070686_100000532
1049 Ga0070686_100120629
1050 Ga0070695_100002491
1051 Ga0070695_100015081
1052 Ga0070696_100014847
1053 Ga0070693_100000138
1054 Ga0070693_100004377
1055 Ga0070665_100027794
1056 Ga0070665_100169759
1057 Ga0070665_100218608
1058 Ga0070665_100587568
1059 Ga0070704_100003765
1060 Ga0070704_100087143
1061 Ga0070704_100096936
1062 Ga0068855_100020794
1063 Ga0068855_100052371
1064 Ga0068855_100301574
1065 Ga0070664_100000614
1066 Ga0070664_100161850
1067 Ga0070664_100229707
1068 Ga0070664_100327166
1069 Ga0070664_100649104
1070 Ga0068857_100001072
1071 Ga0068854_100000909
1072 Ga0068856_100017822
1073 Ga0068856_100100018
1074 Ga0068856_100524182
1075 Ga0070702_100212642
1076 Ga0068852_100000713
1077 Ga0068859_100001523
1078 Ga0068859_100075587
1079 Ga0068859_100171343
1080 Ga0068864_100000715
1081 Ga0068864_100150463
1082 Ga0068866_10000861
1083 Ga0068861_100000574
1084 Ga0068861_100060575
1085 Ga0068861_100307059
1086 Ga0068870_10000009
1087 Ga0068870_10009685
1088 Ga0068863_100001272
1089 Ga0068863_100346092
1090 Ga0068858_100048713
1091 Ga0068858_100048887
1092 Ga0068858_100124860
1093 Ga0068860_100001758
1094 Ga0068860_100045883
1095 Ga0068860_100053056
1096 Ga0068860_100281328
1097 Ga0068862_100005607
1098 Ga0068862_100070041
1099 Ga0081455_10000002
1100 Ga0081455_10075087
1101 Ga0081455_10263365
1102 Ga0070717_10060654
1103 Ga0070717_10205797
1104 Ga0075363_100191467
1105 Ga0075432_10003208
1106 Ga0070716_100021278
1107 Ga0070712_100050502
1108 Ga0070712_100136022
1109 Ga0075367_10111970
1110 Ga0075369_10018049
1111 Ga0075366_10033744
1112 Ga0075366_10107721
1113 Ga0097621_100001018
1114 Ga0075370_10145685
1115 Ga0068871_100000012
1116 Ga0068871_100148471
1117 Ga0075428_100001200
1118 Ga0075428_100170370
1119 Ga0075428_100245014
1120 Ga0075430_100000032
1121 Ga0075430_100024887
1122 Ga0075431_100000462
1123 Ga0075431_100148619
1124 Ga0075433_10000072
1125 Ga0075433_10001122
1126 Ga0075433_10023300
1127 Ga0075433_10033971
1128 Ga0075433_10038289
1129 Ga0075434_100000341
1130 Ga0075434_100001564
1131 Ga0075434_100001937
1132 Ga0075434_100013026
1133 Ga0075434_100023536
1134 Ga0075434_100026026
1135 Ga0075434_100050267
1136 Ga0075434_100192179
1137 Ga0075434_100269253
1138 Ga0075429_100000631
1139 Ga0075429_100111563
1140 Ga0075429_100692360
1141 Ga0068865_100000328
1142 Ga0075436_100471206
1143 Ga0097620_100001523
1144 Ga0097620_100075588
1145 Ga0097620_100171336
1146 Ga0075435_100007539
1147 Ga0075435_100018432
1148 Ga0075435_100033377
1149 Ga0075435_100096198
1150 Ga0075435_100199808
1151 Ga0099795_10051916
1152 Ga0099795_10116589
1153 Ga0105251_10051946
1154 Ga0105240_10016810
1155 Ga0111539_10000915
1156 Ga0111539_10001908
1157 Ga0111539_10002936
1158 Ga0111539_10033531
1159 Ga0111539_10041767
1160 Ga0111539_10041772
1161 Ga0111539_10129768
1162 Ga0105245_10001404
1163 Ga0105245_10200346
1164 Ga0105247_10020951
1165 Ga0105247_10087657
1166 Ga0105247_10167039
1167 Ga0105247_10314403
1168 Ga0114129_10001035
1169 Ga0114129_10001551
1170 Ga0114129_10232960
1171 Ga0114129_10264205
1172 Ga0114129_10686897
1173 Ga0105243_10001028
1174 Ga0105243_10100290
1175 Ga0105243_10139703
1176 Ga0105243_10408260
1177 Ga0105241_10000720
1178 Ga0105241_10028053
1179 Ga0105242_10000607
1180 Ga0105242_10131222
1181 Ga0105242_10147864
1182 Ga0105248_10000309
1183 Ga0105248_10019080
1184 Ga0105248_10099089
1185 Ga0105248_10522825
1186 Ga0105237_10004962
1187 Ga0105237_10266048
1188 Ga0105238_10281483
1189 Ga0105238_10377742
1190 Ga0105249_10000486
1191 Ga0105249_10053545
1192 Ga0105249_10111857
1193 Ga0105249_10190487
1194 Ga0105249_10554833
1195 Ga0099796_10002137
1196 Ga0099796_10050021
1197 Ga0105239_10039493
1198 Ga0105239_10165990
1199 Ga0105239_10230457
1200 Ga0105239_10328480
1201 Ga0105246_10000696
1202 Ga0105246_10192445
1203 Ga0105246_10386840
1204 Ga0157328_1000562
1205 Ga0157339_1000408
1206 Ga0157373_10004002
1207 Ga0157370_10026919
1208 Ga0157374_10001864
1209 Ga0157374_10046182
1210 Ga0157378_10000872
1211 Ga0157378_10052559
1212 Ga0157378_10261242
1213 Ga0157378_10397902
1214 Ga0157378_10770705
1215 Ga0163162_10000992
1216 Ga0163162_10031909
1217 Ga0163162_10094359
1218 Ga0163162_10829707
1219 Ga0157372_10010113
1220 Ga0157372_10017064
1221 Ga0157372_10593453
1222 Ga0157375_10002320
1223 Ga0157375_10101463
1224 Ga0157375_10192104
1225 Ga0163163_10010760
1226 Ga0163163_10079007
1227 Ga0163163_10129460
1228 Ga0163163_10695674
1229 Ga0157380_10000711
1230 Ga0157380_10621602
1231 Ga0182008_10045970
1232 Ga0157377_10000336
1233 Ga0157377_10184741
1234 Ga0157379_10000678
1235 Ga0157379_10002722
1236 Ga0157379_10219614
1237 Ga0157379_10443863
1238 Ga0157376_10002160
1239 Ga0157376_10035957
1240 Ga0163161_10000534
1241 Ga0163161_10216521
1242 Ga0224572_1005870
1243 Ga0228598_1000172
1244 Ga0207666_1000066
1245 Ga0207673_1000028
1246 Ga0209758_1001049
1247 Ga0209758_1034288
1248 Ga0207697_10000374
1249 Ga0207682_10000011
1250 Ga0207692_10092178
1251 Ga0207642_10027213
1252 Ga0207642_10056394
1253 Ga0207642_10153813
1254 Ga0207710_10000805
1255 Ga0207688_10000020
1256 Ga0207688_10117233
1257 Ga0207688_10137384
1258 Ga0207680_10009400
1259 Ga0207647_10002391
1260 Ga0207647_10006919
1261 Ga0207699_10037402
1262 Ga0207645_10000108
1263 Ga0207645_10025122
1264 Ga0207645_10151095
1265 Ga0207645_10237533
1266 Ga0207643_10000685
1267 Ga0207643_10055619
1268 Ga0207643_10261948
1269 Ga0207684_10059283
1270 Ga0207654_10000818
1271 Ga0207707_10000689
1272 Ga0207707_10081183
1273 Ga0207695_10094120
1274 Ga0207671_10138505
1275 Ga0207693_10004461
1276 Ga0207693_10027984
1277 Ga0207693_10121826
1278 Ga0207693_10282649
1279 Ga0207663_10156566
1280 Ga0207660_10000442
1281 Ga0207660_10089954
1282 Ga0207662_10000249
1283 Ga0207662_10007168
1284 Ga0207662_10018925
1285 Ga0207657_10002726
1286 Ga0207657_10013158
1287 Ga0207657_10085746
1288 Ga0207657_10130560
1289 Ga0207649_10000057
1290 Ga0207652_10008629
1291 Ga0207652_10051097
1292 Ga0207652_10065099
1293 Ga0207652_10360595
1294 Ga0207681_10000181
1295 Ga0207681_10222391
1296 Ga0207650_10858233
1297 Ga0207659_10000028
1298 Ga0207659_10158633
1299 Ga0207659_10583772
1300 Ga0207687_10000061
1301 Ga0207687_10020754
1302 Ga0207700_10197568
1303 Ga0207664_10279995
1304 Ga0207664_10311099
1305 Ga0207664_10463745
1306 Ga0207644_10000315
1307 Ga0207644_10016933
1308 Ga0207644_10186172
1309 Ga0207690_10000445
1310 Ga0207690_10130945
1311 Ga0207706_10002206
1312 Ga0207706_10114274
1313 Ga0207706_10625085
1314 Ga0207686_10000972
1315 Ga0207686_10487425
1316 Ga0207709_10006278
1317 Ga0207709_10040817
1318 Ga0207709_10074263
1319 Ga0207709_10149497
1320 Ga0207670_10000217
1321 Ga0207670_10007204
1322 Ga0207670_10173914
1323 Ga0207670_10270672
1324 Ga0207669_10000147
1325 Ga0207669_10145634
1326 Ga0207669_10213218
1327 Ga0207704_10000357
1328 Ga0207665_10040718
1329 Ga0207665_10275759
1330 Ga0207691_10002033
1331 Ga0207691_10028531
1332 Ga0207691_10116407
1333 Ga0207711_10006377
1334 Ga0207711_10008129
1335 Ga0207711_10046325
1336 Ga0207711_10244504
1337 Ga0207689_10001029
1338 Ga0207661_10000126
1339 Ga0207679_10000026
1340 Ga0207679_10108366
1341 Ga0207679_10126255
1342 Ga0207679_10222819
1343 Ga0207667_10010420
1344 Ga0207651_10000342
1345 Ga0207651_10585963
1346 Ga0207712_10000686
1347 Ga0207712_10311058
1348 Ga0207712_10312215
1349 Ga0207712_10350845
1350 Ga0207668_10000242
1351 Ga0207668_10402756
1352 Ga0207640_10000833
1353 Ga0207658_10038939
1354 Ga0207658_10534530
1355 Ga0207677_10000710
1356 Ga0207677_10137387
1357 Ga0207677_10291402
1358 Ga0207703_10001559
1359 Ga0207703_10328847
1360 Ga0207639_10002260
1361 Ga0207639_10034012
1362 Ga0207639_10244107
1363 Ga0207639_10341664
1364 Ga0207678_10001079
1365 Ga0207678_10022723
1366 Ga0207678_10277698
1367 Ga0207678_10330331
1368 Ga0207708_10000805
1369 Ga0207708_10006143
1370 Ga0207702_10002121
1371 Ga0207702_10068858
1372 Ga0207641_10001766
1373 Ga0207641_10429122
1374 Ga0207641_10485171
1375 Ga0207648_10000731
1376 Ga0207676_10000361
1377 Ga0207674_10002121
1378 Ga0207675_100001489
1379 Ga0207675_100039410
1380 Ga0207675_100089221
1381 Ga0207675_100104037
1382 Ga0207683_10000034
1383 Ga0207683_10012741
1384 Ga0207683_10035186
1385 Ga0207683_10385217
1386 Ga0207698_10000304
1387 Ga0207698_10416859
1388 Ga0209973_1001485
1389 Ga0210002_1000561
1390 Ga0209983_1035728
1391 Ga0209588_1002483
1392 Ga0209971_1003397
1393 Ga0209966_1002652
1394 Ga0209966_1002767
1395 Ga0209998_10000861
1396 Ga0209974_10000830
1397 Ga0207428_10000082
1398 Ga0207428_10000352
1399 Ga0207428_10001078
1400 Ga0207428_10005810
1401 Ga0207428_10018670
1402 Ga0268266_10039033
1403 Ga0268266_10070689
1404 Ga0268266_10582685
1405 Ga0268265_10001338
1406 Ga0268265_10404695
1407 Ga0268264_10002557
1408 Ga0268264_10065013
1409 Ga0268264_10079082
1410 Ga0265338_10129337
1411 Ga0265325_10000141
1412 Ga0265325_10005121
1413 Ga0265325_10005810
1414 Ga0265325_10005829
1415 Ga0265325_10009631
1416 Ga0265340_10004172
1417 Ga0265339_10000067
1418 Ga0265339_10026535
1419 Ga0265313_10000008
1420 Ga0265313_10000054
1421 Ga0265313_10001334
1422 Ga0265313_10012192
1423 Ga0265342_10018860
1424 Ga0307416_100752666
1425 Ga0316583_10001247
1426 Ga0373948_0000353
1427 Ga0373948_0007550
1428 Ga0373950_0021975
1429 Ga0373958_0000098
1430 Ga0373958_0001694
1431 Ga0373959_0015032
1432 Ga0373938_0004446
1433 Ga0373938_0014150
1434 Ga0373926_0040529
1435 Ga0373926_0071092
1436 Ga0373928_0007197
1437 Ga0373928_0042926
1438 Ga0373929_0000124
1439 Ga0373929_0006484
1440 Ga0373929_0007906
1441 Ga0373929_0025379
1442 Ga0373934_0099392
1443 Ga0373940_0011652
1444 Ga0373940_0047469
1445 Ga0373949_0005140
1446 Ga0373951_0000233
1447 Ga0373951_0016081
1448 Ga0373952_0002094
1449 Ga0373952_0008590
1450 Ga0373923_0012453
1451 Ga0373932_0000369
1452 Ga0373936_0030358
1453 Ga0373939_0000589
1454 Ga0373939_0000999
1455 Ga0373939_0003749
1456 Ga0373941_0005015
1457 Ga0373945_0071501
1458 Ga0373953_0004850
1459 Ga0373954_0007712
1460 Ga0373954_0009461
1461 Ga0373956_0003621
1462 Ga0373957_0003018
1463 Ga0373957_0005217
1464 Ga0373960_0000741
1465 Ga0373960_0025402
1466 Ga0373943_0018589
1467 Ga0373946_0022964
1468 Ga0373955_0001226
1469 Ga0373955_0026941
1470 Ga0373942_0002793
1471 Ga0373942_0003759
1472 Ga0373942_0004850
1473 Ga0373942_0019599
1474 Ga0373961_0004509
1475 Ga0373961_0012391
1476 Ga0373962_0000152
1477 Ga0373962_0000699
1478 Ga0373962_0023858
1479 Ga0373924_0011339
1480 Ga0373924_0047181
1481 Ga0373924_0131175
1482 Ga0373931_0000179
1483 Ga0373931_0005009
1484 Ga0373931_0009136
1485 Ga0373931_0011482
1486 Ga0373931_0034856
1487 Ga0373931_0165942
1488 Ga0373931_0210897
1489 Ga0373935_0028870
1490 Ga0373935_0044071
1491 Ga0373935_0056098
1492 Ga0373935_0083897
1493 Ga0373935_0156754
1494 Ga0373935_0206077
1495 Ga0373927_0029934
1496 Ga0373927_0033369
1497 Ga0373927_0050999
1498 Ga0373927_0051352
1499 Ga0373927_0073060
1500 Ga0373927_0082831
1501 Ga0373927_0104838
1502 Ga0373927_0185770
1503 Ga0373933_0001753
1504 Ga0373947_0021159
1505 Ga0373947_0022989
1506 Ga0373947_0050332
1507 Ga0373947_0076121
1508 Ga0373947_0115820
1509 Ga0373937_0000879
1510 Ga0373937_0023251
1511 Ga0373937_0030498
1512 Ga0373937_0114376
1513 Ga0373937_0118016
1514 Ga0373937_0172835
1515 Ga0373925_0013172
1516 Ga0373925_0041837
1517 Ga0373925_0046184
1518 Ga0373925_0169925
1519 Ga0373925_0236231
1520 Ga0395898_0125956
1521 Ga0395905_0015104
1522 Ga0395901_0058034
1523 Ga0436361_0602366
1524 Ga0439453_0002256
1525 Ga0439453_0018346
1526 Ga0439434_0085432
1527 Ga0439435_0005924
1528 Ga0439444_0030390
1529 Ga0439460_0013337
1530 Ga0466963_0053385
1531 Ga0453684_0163789
1532 Ga0466957_0038975
1533 Ga0451576_0084542
1534 Ga0466958_0082777
1535 Ga0466967_0000948
1536 Ga0495592_0000513
1537 Ga0495592_0004552
1538 Ga0495592_0029018
1539 Ga0495592_0106118
1540 Ga0495603_0007105
1541 Ga0495603_0047882
1542 Ga0495590_0057575
1543 Ga0495629_0000062
1544 Ga0495629_0002976
1545 Ga0495629_0186305
1546 Ga0495651_0000910
1547 Ga0495651_0006020
1548 Ga0495651_0030341
1549 Ga0495653_0002622
1550 Ga0495653_0003316
1551 Ga0495580_0055899
1552 Ga0495580_0130748
1553 Ga0495580_0168882
1554 Ga0495580_0402650
1555 Ga0495639_0058896
1556 Ga0495639_0071772
1557 Ga0495639_0118000
1558 Ga0495662_0026233
1559 Ga0495662_0032498
1560 Ga0495664_0000434
1561 Ga0495664_0199514
1562 Ga0495664_0214078
1563 Ga0495584_0049211
1564 Ga0495594_0088820
1565 Ga0495594_0211177
1566 Ga0495608_0001525
1567 Ga0495608_0007060
1568 Ga0495608_0149567
1569 Ga0495618_0014292
1570 Ga0495628_0008936
1571 Ga0495628_0038743
1572 Ga0495628_0063040
1573 Ga0495628_0087887
1574 Ga0495630_0047958
1575 Ga0495630_0057021
1576 Ga0495630_0215911
1577 Ga0495630_0228151
1578 Ga0495648_0006759
1579 Ga0495666_0026964
1580 Ga0495666_0077515
1581 Ga0495642_0088866
1582 Ga0495652_0011195
1583 Ga0495652_0028653
1584 Ga0495652_0055382
1585 Ga0495652_0111242
1586 Ga0495652_0168606
1587 Ga0495665_0035362
1588 Ga0495665_0089448
1589 Ga0495640_0003016
1590 Ga0495640_0024844
1591 Ga0495640_0147263
1592 Ga0495587_0001060
1593 Ga0495587_0014613
1594 Ga0495645_0000746
1595 Ga0495645_0000974
1596 Ga0495645_0066570
1597 Ga0495645_0367647
1598 Ga0495622_0102534
1599 Ga0495667_0003474
1600 Ga0495667_0006015
1601 Ga0495667_0012221
1602 Ga0495667_0041577
1603 Ga0495667_0068049
1604 Ga0495634_0039270
1605 Ga0495634_0162669
1606 Ga0495635_0018303
1607 Ga0495635_0072101
1608 Ga0495635_0103107
1609 Ga0495635_0107294
1610 Ga0495635_0136865
1611 Ga0495588_0127935
1612 Ga0495657_0087975
1613 Ga0495657_0093258
1614 Ga0495599_0015965
1615 Ga0495599_0032589
1616 Ga0495623_0001158
1617 Ga0495623_0090844
1618 Ga0495623_0095398
1619 Ga0495647_0021743
1620 Ga0495647_0052913
1621 Ga0495658_0000718
1622 Ga0495613_0007258
1623 Ga0495613_0031576
1624 Ga0495613_0033647
1625 Ga0495613_0110546
1626 Ga0495613_0204308
1627 Ga0495624_0027104
1628 Ga0495624_0062901
1629 Ga0495624_0100157
1630 Ga0495624_0241521
1631 Ga0495600_0002131
1632 Ga0495600_0007139
1633 Ga0495600_0034255
1634 Ga0495581_0012167
1635 Ga0495604_0004590
1636 Ga0495604_0013622
1637 Ga0495604_0027286
1638 Ga0495604_0110595
1639 Ga0495674_0003969
1640 Ga0495674_0006778
1641 Ga0495674_0014686
1642 Ga0495674_0079153
1643 Ga0495674_0121575
1644 Ga0495674_0152639
1645 Ga0495676_0071454
1646 Ga0495680_0000483
1647 Ga0495680_0012821
1648 Ga0495680_0017319
1649 Ga0495680_0041448
1650 Ga0495680_0048920
1651 Ga0495675_0000190
1652 Ga0495675_0010552
1653 Ga0495675_0072610
1654 Ga0495684_0007568
1655 Ga0495684_0018874
1656 Ga0495684_0046954
1657 Ga0495684_0347791
1658 Ga0495593_0050779
1659 Ga0495593_0083724
1660 Ga0495602_0015694
1661 Ga0495602_0027846
1662 Ga0495602_0045776
1663 Ga0496100_0002755
1664 Ga0496100_0034175
1665 Ga0496100_0151684
1666 Ga0496101_0001110
1667 Ga0496101_0027634
1668 Ga0496102_0071501
1669 Ga0496102_0074399
1670 Ga0496102_0461045
1671 Ga0496102_0467254
1672 Ga0496103_0000582
1673 Ga0496103_0318700
1674 Ga0496104_0000067
1675 Ga0496104_0042201
1676 Ga0496104_0253100
1677 Ga0496104_0714322
1678 Ga0496105_0002048
1679 Ga0496105_0126452
1680 Ga0496105_0150300
1681 Ga0496106_0002855
1682 Ga0496106_0013139
1683 Ga0496106_0046743
1684 Ga0496107_0001812
1685 Ga0496107_0013359
1686 Ga0496107_0025580
1687 Ga0496107_0120043
1688 Ga0496107_0415043
1689 Ga0496108_0007050
1690 Ga0496109_0000384
1691 Ga0496109_0011720
1692 Ga0496110_0022806
1693 Ga0496110_0062149
1694 Ga0496110_0217776
1695 Ga0496110_0222035
1696 Ga0496110_0281809
1697 Ga0496110_0328726
1698 Ga0496111_0044821
1699 Ga0496111_0045761
1700 Ga0496111_0073964
1701 Ga0496111_0099066
1702 Ga0496111_0349424
1703 Ga0496112_0093115
1704 Ga0496112_0235700
1705 Ga0496113_0000688
1706 Ga0496113_0041084
1707 Ga0496113_0176908
1708 Ga0496113_0351627
1709 Ga0496113_0416634
1710 Ga0496113_0570320
1711 Ga0496114_0003688
1712 Ga0496114_0053456
1713 Ga0496114_0158427
1714 Ga0496114_0199098
1715 Ga0496115_0002409
1716 Ga0496115_0358420
1717 Ga0501298_035278
1718 Ga0501034_0588563
1719 Ga0501040_0319370
1720 Ga0501047_0004391
1721 Ga0501047_0085249
1722 Ga0501067_0200370
1723 Ga0501070_0347312
1724 Ga0501076_0016620
1725 Ga0501077_0122310
1726 Ga0501216_030767
1727 Ga0501083_0187225
1728 Ga0501044_0022774
1729 Ga0501044_0084587
1730 nmdc:mga0yw44_289343_c1
1731 nmdc:mga0k408_15140_c1
1732 nmdc:mga0k408_226267_c1
1733 nmdc:mga06z11_87457_c1
1734 nmdc:mga05p37_133416_c1
1735 nmdc:mga05p37_19_c2
1736 nmdc:mga05p37_219821_c1
1737 nmdc:mga05p37_5389_c1
1738 nmdc:mga05p37_93380_c1
1739 nmdc:mga09592_238_c1
1740 nmdc:mga09592_27607_c1
1741 nmdc:mga0qj67_13539_c1
1742 nmdc:mga0qj67_67254_c1
1743 nmdc:mga06r32_108717_c1
1744 nmdc:mga06r32_2023_c1
1745 nmdc:mga08y16_18813_c1
1746 nmdc:mga08y16_208_c1
1747 nmdc:mga08y16_2735_c1
1748 nmdc:mga08y16_58085_c1
1749 nmdc:mga08y16_80129_c1
1750 nmdc:mga08y16_842162_c1
1751 nmdc:mga08y16_85971_c1
1752 nmdc:mga0n895_10569_c1
1753 nmdc:mga0n895_173295_c1
1754 nmdc:mga0n895_3108_c1
1755 nmdc:mga0n895_34398_c1
1756 nmdc:mga0n895_394_c1
1757 nmdc:mga0n895_7653_c1
1758 nmdc:mga0rr50_229110_c1
1759 nmdc:mga0rr50_45215_c1
1760 nmdc:mga0rr50_5567_c1
1761 nmdc:mga0rr50_68416_c1
1762 nmdc:mga0a205_1167_c1
1763 nmdc:mga0a205_143051_c1
1764 nmdc:mga0a205_186874_c1
1765 nmdc:mga0a205_26111_c1
1766 nmdc:mga0a205_5198_c1
1767 nmdc:mga0a205_5655_c1
1768 Ga0495601_0000711
1769 Ga0495601_0001809
1770 Ga0495601_0005275
1771 Ga0495601_0005584
1772 Ga0495601_0008024
1773 Ga0495601_0009061
1774 Ga0495601_0013226
1775 Ga0495601_0114635
1776 Ga0495612_0000152
1777 Ga0495612_0002060
1778 Ga0495612_0014302
1779 Ga0495612_0017950
1780 Ga0495612_0021257
1781 Ga0495612_0058494
1782 Ga0495655_0046359
1783 Ga0495595_0001635
1784 Ga0495595_0004190
1785 Ga0495595_0012712
1786 Ga0495595_0050676
1787 Ga0495595_0074797
1788 Ga0495619_0000052
1789 Ga0495619_0000078
1790 Ga0495619_0001503
1791 Ga0495619_0003543
1792 Ga0495619_0003933
1793 Ga0495619_0009181
1794 Ga0495619_0028201
1795 Ga0500642_0019927
1796 Ga0501084_0173473
1797 Ga0530510_0504009
1798 2876767338
1799 2876816647
1800 2879110174
1801 2885419104
1802 2922361244

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

101

236

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xts-assembly1.cif.gz_C crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.856 103 240
3hbg-assembly1.cif.gz_A-2 structure of recombinant chicken liver sulfite oxidase mutant c185s 0.8463 103 238
1sox-assembly1.cif.gz_A sulfite oxidase from chicken liver 0.8406 103 246
1sox-assembly1.cif.gz_B sulfite oxidase from chicken liver 0.8394 103 246
3hc2-assembly1.cif.gz_A-2 crystal structure of chicken sulfite oxidase mutant tyr 322 phe 0.8354 103 246
ID Description Score Start End Superfamily
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8565 103 240 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8495 109 240 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8118 94 251 3.90.420.10
4pw9A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.792 107 245 3.90.420.10
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.7611 75 246 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A6I4SVQ0-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9396 109 219
AF-A0A537TEQ0-F1-model_v4 Molybdopterin-binding protein 0.9027 78 257
AF-A0A3A8SAX7-F1-model_v4 Molybdopterin-binding protein 0.8918 78 204
AF-A0A380AE90-F1-model_v4 Sulfoxide reductase catalytic subunit yedY (EC 1.8.-.-) 0.8914 80 257 GO:0016491
AF-A0A537TEQ0-F1-model_v4 Molybdopterin-binding protein 0.8885 78 257

Map