F485076
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 898 | 372 | 898 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300025908|Ga0207643_10105839|Ga0207643_101058391 |
| Length | 274 |
| Sequence | VNSREKEQYLREYEVMKKKGKPFFPYAILKDSTMAVIVVGVIVFMSIYLGAEQGPKADPTTTTYVPRPEWYFFFLFELLRVIKPPWLVPVATIGVPTIAMVLLLLLPFYDRNPERNPLKRPIASIAGIMTIIAMAFLTFLGANAGSPTDIEMKVAPEFEAGKLVAAQSGCLACHQFGDNGNNGPGPKLTEIGARLNPAAIARSLEIGPGIMPSYASMAEDEPDKFRDLVAFLASLNGEEQSAEPDTGVAGDPGTATPEGSGGDAAAEPAPASGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 173 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 207 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 213 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 214 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 215 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 216 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 217 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 218 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 219 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 220 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 221 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 222 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 223 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 224 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 225 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 304 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 305 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 306 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 307 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 308 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 309 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 310 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 311 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 312 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 338 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 346 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 348 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 349 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 350 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 363 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 364 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 365 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 366 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 367 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 368 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 369 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 370 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 371 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.67 |
| Metatranscriptomes | 0.33 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.12 |
| Nodule | 0 |
| Rhizoplane | 11.8 |
| Rhizosphere | 81.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1014062 | 3300000546 | Bacteria | 853 |
| 2 | LJQas_1001648 | 3300000549 | Bacteria | 3282 |
| 3 | JGI24746J21847_1003604 | 3300001977 | Bacteria | 2439 |
| 4 | JGI24740J21852_10000904 | 3300001979 | Bacteria | 13157 |
| 5 | JGI24748J21848_1000204 | 3300002074 | Bacteria | 7562 |
| 6 | JGI24034J26672_10000150 | 3300002239 | Bacteria | 9967 |
| 7 | JGI24751J29686_10022641 | 3300002459 | Bacteria | 1303 |
| 8 | JGI25407J50210_10001951 | 3300003373 | Bacteria | 4789 |
| 9 | JGI25407J50210_10028901 | 3300003373 | Bacteria | 1437 |
| 10 | JGI25404J52841_10014570 | 3300003659 | Bacteria | 1707 |
| 11 | Ga0058863_10004115 | 3300004799 | Bacteria | 1339 |
| 12 | Ga0070658_10029846 | 3300005327 | Bacteria | 4380 |
| 13 | Ga0070658_10317213 | 3300005327 | Bacteria | 1331 |
| 14 | Ga0070658_10442123 | 3300005327 | Bacteria | 1120 |
| 15 | Ga0070683_100000367 | 3300005329 | Bacteria | 31252 |
| 16 | Ga0070683_100001266 | 3300005329 | Bacteria | 19233 |
| 17 | Ga0070683_100138291 | 3300005329 | Bacteria | 2307 |
| 18 | Ga0070683_100201168 | 3300005329 | Bacteria | 1891 |
| 19 | Ga0070683_100342518 | 3300005329 | Bacteria | 1423 |
| 20 | Ga0070677_10000018 | 3300005333 | Bacteria | 51146 |
| 21 | Ga0068869_100094188 | 3300005334 | Bacteria | 2257 |
| 22 | Ga0068869_100487912 | 3300005334 | Bacteria | 1027 |
| 23 | Ga0070666_10013143 | 3300005335 | Bacteria | 5246 |
| 24 | Ga0070666_10044022 | 3300005335 | Bacteria | 2990 |
| 25 | Ga0070666_10125376 | 3300005335 | Bacteria | 1783 |
| 26 | Ga0070666_10375773 | 3300005335 | Bacteria | 1020 |
| 27 | Ga0070682_100000016 | 3300005337 | Bacteria | 239799 |
| 28 | Ga0070682_100000029 | 3300005337 | Bacteria | 183516 |
| 29 | Ga0070682_100041758 | 3300005337 | Bacteria | 2829 |
| 30 | Ga0068868_100005977 | 3300005338 | Bacteria | 8589 |
| 31 | Ga0068868_100121841 | 3300005338 | Bacteria | 2128 |
| 32 | Ga0068868_100310273 | 3300005338 | Bacteria | 1342 |
| 33 | Ga0068868_100357670 | 3300005338 | Bacteria | 1252 |
| 34 | Ga0070660_100058901 | 3300005339 | Bacteria | 2978 |
| 35 | Ga0070660_100091353 | 3300005339 | Bacteria | 2401 |
| 36 | Ga0070660_100428626 | 3300005339 | Bacteria | 1096 |
| 37 | Ga0070689_100356816 | 3300005340 | Bacteria | 1227 |
| 38 | Ga0070689_100532634 | 3300005340 | Bacteria | 1010 |
| 39 | Ga0070691_10000009 | 3300005341 | Bacteria | 58678 |
| 40 | Ga0070691_10142486 | 3300005341 | Bacteria | 1223 |
| 41 | Ga0070691_10223141 | 3300005341 | Bacteria | 1000 |
| 42 | Ga0070687_100050604 | 3300005343 | Bacteria | 2146 |
| 43 | Ga0070661_100000026 | 3300005344 | Bacteria | 118733 |
| 44 | Ga0070661_100023036 | 3300005344 | Bacteria | 4461 |
| 45 | Ga0070692_10081912 | 3300005345 | Bacteria | 1739 |
| 46 | Ga0070692_10348825 | 3300005345 | Bacteria | 919 |
| 47 | Ga0070668_100002556 | 3300005347 | Bacteria | 13378 |
| 48 | Ga0070675_100000015 | 3300005354 | Bacteria | 201080 |
| 49 | Ga0070675_100020817 | 3300005354 | Bacteria | 5235 |
| 50 | Ga0070671_100075069 | 3300005355 | Bacteria | 2824 |
| 51 | Ga0070674_100000003 | 3300005356 | Bacteria | 258221 |
| 52 | Ga0070674_100000028 | 3300005356 | Bacteria | 69584 |
| 53 | Ga0070674_100059851 | 3300005356 | Bacteria | 2652 |
| 54 | Ga0070673_100031323 | 3300005364 | Bacteria | 3990 |
| 55 | Ga0070673_100307752 | 3300005364 | Bacteria | 1397 |
| 56 | Ga0070688_100000264 | 3300005365 | Bacteria | 27397 |
| 57 | Ga0070688_100001621 | 3300005365 | Bacteria | 11257 |
| 58 | Ga0070688_100084682 | 3300005365 | Bacteria | 2060 |
| 59 | Ga0070659_100001108 | 3300005366 | Bacteria | 19650 |
| 60 | Ga0070659_100066737 | 3300005366 | Bacteria | 2852 |
| 61 | Ga0070667_100105361 | 3300005367 | Bacteria | 2440 |
| 62 | Ga0070667_100136594 | 3300005367 | Bacteria | 2144 |
| 63 | Ga0070713_100000014 | 3300005436 | Bacteria | 124804 |
| 64 | Ga0070713_100191375 | 3300005436 | Bacteria | 1844 |
| 65 | Ga0070710_10077645 | 3300005437 | Bacteria | 1930 |
| 66 | Ga0070711_100018181 | 3300005439 | Bacteria | 4484 |
| 67 | Ga0070711_100023702 | 3300005439 | Bacteria | 3995 |
| 68 | Ga0070711_100190771 | 3300005439 | Bacteria | 1575 |
| 69 | Ga0070711_100341819 | 3300005439 | Bacteria | 1201 |
| 70 | Ga0070700_100232743 | 3300005441 | Bacteria | 1312 |
| 71 | Ga0070663_100005232 | 3300005455 | Bacteria | 7686 |
| 72 | Ga0070663_100032151 | 3300005455 | Bacteria | 3614 |
| 73 | Ga0070663_100186766 | 3300005455 | Bacteria | 1611 |
| 74 | Ga0070678_100011408 | 3300005456 | Bacteria | 5481 |
| 75 | Ga0070678_100425996 | 3300005456 | Bacteria | 1158 |
| 76 | Ga0068867_100001503 | 3300005459 | Bacteria | 16143 |
| 77 | Ga0068867_100048424 | 3300005459 | Bacteria | 3127 |
| 78 | Ga0068867_100075180 | 3300005459 | Bacteria | 2533 |
| 79 | Ga0070685_10000318 | 3300005466 | Bacteria | 29850 |
| 80 | Ga0070685_10000367 | 3300005466 | Bacteria | 27384 |
| 81 | Ga0070685_10111944 | 3300005466 | Bacteria | 1683 |
| 82 | Ga0070685_10148611 | 3300005466 | Bacteria | 1483 |
| 83 | Ga0070685_10255467 | 3300005466 | Bacteria | 1163 |
| 84 | Ga0070707_100767385 | 3300005468 | Bacteria | 928 |
| 85 | Ga0070679_100000507 | 3300005530 | Bacteria | 33181 |
| 86 | Ga0070679_100000674 | 3300005530 | Bacteria | 29110 |
| 87 | Ga0070679_100111875 | 3300005530 | Bacteria | 2717 |
| 88 | Ga0070684_100113625 | 3300005535 | Bacteria | 2430 |
| 89 | Ga0070684_100286941 | 3300005535 | Bacteria | 1508 |
| 90 | Ga0070684_100320678 | 3300005535 | Bacteria | 1423 |
| 91 | Ga0068853_100001814 | 3300005539 | Bacteria | 15699 |
| 92 | Ga0068853_100213023 | 3300005539 | Bacteria | 1762 |
| 93 | Ga0070672_100000129 | 3300005543 | Bacteria | 39624 |
| 94 | Ga0070672_100021385 | 3300005543 | Bacteria | 4732 |
| 95 | Ga0070686_100006320 | 3300005544 | Bacteria | 6578 |
| 96 | Ga0070686_100015412 | 3300005544 | Bacteria | 4428 |
| 97 | Ga0070686_100305834 | 3300005544 | Bacteria | 1181 |
| 98 | Ga0070695_100317649 | 3300005545 | Bacteria | 1157 |
| 99 | Ga0070693_100000093 | 3300005547 | Bacteria | 38785 |
| 100 | Ga0070665_100000120 | 3300005548 | Bacteria | 148340 |
| 101 | Ga0070665_100001016 | 3300005548 | Bacteria | 35289 |
| 102 | Ga0070665_100056914 | 3300005548 | Bacteria | 3921 |
| 103 | Ga0070665_100058921 | 3300005548 | Bacteria | 3849 |
| 104 | Ga0070665_100207262 | 3300005548 | Bacteria | 1961 |
| 105 | Ga0070665_100498869 | 3300005548 | Bacteria | 1228 |
| 106 | Ga0070704_100005253 | 3300005549 | Bacteria | 7541 |
| 107 | Ga0070704_100262978 | 3300005549 | Bacteria | 1422 |
| 108 | Ga0070664_100124553 | 3300005564 | Bacteria | 2259 |
| 109 | Ga0068857_100042206 | 3300005577 | Bacteria | 4045 |
| 110 | Ga0068857_100329172 | 3300005577 | Bacteria | 1412 |
| 111 | Ga0068856_100000186 | 3300005614 | Bacteria | 64970 |
| 112 | Ga0068856_100024148 | 3300005614 | Bacteria | 5915 |
| 113 | Ga0068856_100035899 | 3300005614 | Bacteria | 4859 |
| 114 | Ga0068856_100040557 | 3300005614 | Bacteria | 4573 |
| 115 | Ga0068856_100536155 | 3300005614 | Bacteria | 1192 |
| 116 | Ga0068852_100000013 | 3300005616 | Bacteria | 139537 |
| 117 | Ga0068852_100053917 | 3300005616 | Bacteria | 3464 |
| 118 | Ga0068852_100465595 | 3300005616 | Bacteria | 1254 |
| 119 | Ga0068859_100302845 | 3300005617 | Bacteria | 1692 |
| 120 | Ga0068866_10000002 | 3300005718 | Bacteria | 394090 |
| 121 | Ga0068866_10000045 | 3300005718 | Bacteria | 48372 |
| 122 | Ga0068866_10009088 | 3300005718 | Bacteria | 4212 |
| 123 | Ga0068866_10108405 | 3300005718 | Bacteria | 1545 |
| 124 | Ga0068866_10197009 | 3300005718 | Bacteria | 1201 |
| 125 | Ga0068851_10000504 | 3300005834 | Bacteria | 17049 |
| 126 | Ga0068851_10002068 | 3300005834 | Bacteria | 8847 |
| 127 | Ga0068851_10042721 | 3300005834 | Bacteria | 2283 |
| 128 | Ga0068870_10074052 | 3300005840 | Bacteria | 1865 |
| 129 | Ga0068863_100000080 | 3300005841 | Bacteria | 106670 |
| 130 | Ga0068858_100000035 | 3300005842 | Bacteria | 140466 |
| 131 | Ga0068858_100000042 | 3300005842 | Bacteria | 132482 |
| 132 | Ga0068858_100142936 | 3300005842 | Bacteria | 2247 |
| 133 | Ga0068858_100428298 | 3300005842 | Bacteria | 1273 |
| 134 | Ga0068860_100024481 | 3300005843 | Bacteria | 5832 |
| 135 | Ga0068860_100057058 | 3300005843 | Bacteria | 3711 |
| 136 | Ga0068862_100005926 | 3300005844 | Bacteria | 10177 |
| 137 | Ga0081455_10024603 | 3300005937 | Bacteria | 5571 |
| 138 | Ga0081455_10041169 | 3300005937 | Bacteria | 4067 |
| 139 | Ga0081455_10078445 | 3300005937 | Bacteria | 2714 |
| 140 | Ga0081455_10087095 | 3300005937 | Bacteria | 2542 |
| 141 | Ga0081455_10115990 | 3300005937 | Bacteria | 2119 |
| 142 | Ga0081455_10244128 | 3300005937 | Bacteria | 1318 |
| 143 | Ga0081538_10000027 | 3300005981 | Bacteria | 125924 |
| 144 | Ga0081538_10004074 | 3300005981 | Bacteria | 13596 |
| 145 | Ga0081538_10008139 | 3300005981 | Bacteria | 8944 |
| 146 | Ga0081538_10022193 | 3300005981 | Bacteria | 4608 |
| 147 | Ga0081538_10028800 | 3300005981 | Bacteria | 3810 |
| 148 | Ga0081538_10054595 | 3300005981 | Bacteria | 2361 |
| 149 | Ga0081540_1000115 | 3300005983 | Bacteria | 84188 |
| 150 | Ga0081540_1002095 | 3300005983 | Bacteria | 16600 |
| 151 | Ga0081540_1052162 | 3300005983 | Bacteria | 2016 |
| 152 | Ga0081540_1084450 | 3300005983 | Bacteria | 1417 |
| 153 | Ga0081539_10000674 | 3300005985 | Bacteria | 68446 |
| 154 | Ga0081539_10059310 | 3300005985 | Bacteria | 2107 |
| 155 | Ga0070717_10582793 | 3300006028 | Bacteria | 1014 |
| 156 | Ga0075365_10000105 | 3300006038 | Bacteria | 24752 |
| 157 | Ga0075365_10000307 | 3300006038 | Bacteria | 17163 |
| 158 | Ga0075365_10003397 | 3300006038 | Bacteria | 8187 |
| 159 | Ga0075365_10138665 | 3300006038 | Bacteria | 1687 |
| 160 | Ga0075365_10139112 | 3300006038 | Bacteria | 1685 |
| 161 | Ga0075365_10143142 | 3300006038 | Bacteria | 1660 |
| 162 | Ga0075365_10292401 | 3300006038 | Bacteria | 1146 |
| 163 | Ga0075365_10317648 | 3300006038 | Bacteria | 1097 |
| 164 | Ga0075368_10024362 | 3300006042 | Bacteria | 2318 |
| 165 | Ga0075363_100008638 | 3300006048 | Bacteria | 4754 |
| 166 | Ga0075363_100011382 | 3300006048 | Bacteria | 4257 |
| 167 | Ga0075364_10056764 | 3300006051 | Bacteria | 2564 |
| 168 | Ga0075432_10059704 | 3300006058 | Bacteria | 1356 |
| 169 | Ga0070715_10000015 | 3300006163 | Bacteria | 152816 |
| 170 | Ga0070716_100039189 | 3300006173 | Bacteria | 2629 |
| 171 | Ga0070716_100089913 | 3300006173 | Bacteria | 1856 |
| 172 | Ga0070712_100001399 | 3300006175 | Bacteria | 14660 |
| 173 | Ga0070712_100003967 | 3300006175 | Bacteria | 9101 |
| 174 | Ga0075367_10218999 | 3300006178 | Bacteria | 1191 |
| 175 | Ga0068871_100900107 | 3300006358 | Bacteria | 820 |
| 176 | Ga0075428_100159666 | 3300006844 | Bacteria | 2447 |
| 177 | Ga0075430_100054701 | 3300006846 | Bacteria | 3358 |
| 178 | Ga0075430_100082115 | 3300006846 | Bacteria | 2700 |
| 179 | Ga0075431_100002644 | 3300006847 | Bacteria | 17334 |
| 180 | Ga0075431_100009078 | 3300006847 | Bacteria | 9968 |
| 181 | Ga0075431_100027253 | 3300006847 | Bacteria | 5861 |
| 182 | Ga0075431_100039934 | 3300006847 | Bacteria | 4834 |
| 183 | Ga0075431_100570514 | 3300006847 | Bacteria | 1118 |
| 184 | Ga0075433_10000058 | 3300006852 | Bacteria | 48106 |
| 185 | Ga0075433_10034643 | 3300006852 | Bacteria | 4338 |
| 186 | Ga0075433_10128496 | 3300006852 | Bacteria | 2251 |
| 187 | Ga0075434_100004732 | 3300006871 | Bacteria | 12308 |
| 188 | Ga0075429_100465033 | 3300006880 | Bacteria | 1108 |
| 189 | Ga0068865_100000001 | 3300006881 | Bacteria | 288199 |
| 190 | Ga0097620_100302849 | 3300006931 | Bacteria | 1692 |
| 191 | Ga0075435_100006389 | 3300007076 | Bacteria | 8331 |
| 192 | Ga0105240_10139224 | 3300009093 | Bacteria | 2903 |
| 193 | Ga0105240_10349079 | 3300009093 | Bacteria | 1679 |
| 194 | Ga0105240_10453049 | 3300009093 | Bacteria | 1435 |
| 195 | Ga0111539_10005245 | 3300009094 | Bacteria | 16790 |
| 196 | Ga0111539_10015210 | 3300009094 | Bacteria | 9587 |
| 197 | Ga0111539_10651362 | 3300009094 | Bacteria | 1227 |
| 198 | Ga0111539_10727435 | 3300009094 | Bacteria | 1155 |
| 199 | Ga0111539_11369247 | 3300009094 | Bacteria | 821 |
| 200 | Ga0105245_10000045 | 3300009098 | Bacteria | 134057 |
| 201 | Ga0105245_10000053 | 3300009098 | Bacteria | 125678 |
| 202 | Ga0105245_10000488 | 3300009098 | Bacteria | 36321 |
| 203 | Ga0105245_10005617 | 3300009098 | Bacteria | 11016 |
| 204 | Ga0105245_10045611 | 3300009098 | Bacteria | 3915 |
| 205 | Ga0105245_10286282 | 3300009098 | Bacteria | 1612 |
| 206 | Ga0105245_10855879 | 3300009098 | Bacteria | 949 |
| 207 | Ga0105247_10000169 | 3300009101 | Bacteria | 64387 |
| 208 | Ga0105247_10488801 | 3300009101 | Bacteria | 895 |
| 209 | Ga0105247_10523310 | 3300009101 | Bacteria | 868 |
| 210 | Ga0114129_10003258 | 3300009147 | Bacteria | 22793 |
| 211 | Ga0114129_10142177 | 3300009147 | Bacteria | 3288 |
| 212 | Ga0114129_10412604 | 3300009147 | Bacteria | 1778 |
| 213 | Ga0114129_10572763 | 3300009147 | Bacteria | 1466 |
| 214 | Ga0114129_10704543 | 3300009147 | Bacteria | 1297 |
| 215 | Ga0105243_10012944 | 3300009148 | Bacteria | 6304 |
| 216 | Ga0105243_10145553 | 3300009148 | Bacteria | 2027 |
| 217 | Ga0105243_10498383 | 3300009148 | Bacteria | 1153 |
| 218 | Ga0105241_10153158 | 3300009174 | Bacteria | 1888 |
| 219 | Ga0105241_10253210 | 3300009174 | Bacteria | 1494 |
| 220 | Ga0105242_10234392 | 3300009176 | Bacteria | 1647 |
| 221 | Ga0105242_10400811 | 3300009176 | Bacteria | 1280 |
| 222 | Ga0105242_10431535 | 3300009176 | Bacteria | 1237 |
| 223 | Ga0105248_10000089 | 3300009177 | Bacteria | 102101 |
| 224 | Ga0105248_10053950 | 3300009177 | Bacteria | 4509 |
| 225 | Ga0105248_10214980 | 3300009177 | Bacteria | 2166 |
| 226 | Ga0105237_10379347 | 3300009545 | Bacteria | 1418 |
| 227 | Ga0105237_10602770 | 3300009545 | Bacteria | 1105 |
| 228 | Ga0105238_10001238 | 3300009551 | Bacteria | 25694 |
| 229 | Ga0105238_10132032 | 3300009551 | Bacteria | 2475 |
| 230 | Ga0105238_10472876 | 3300009551 | Bacteria | 1252 |
| 231 | Ga0105249_10000095 | 3300009553 | Bacteria | 121300 |
| 232 | Ga0105249_10008240 | 3300009553 | Bacteria | 9076 |
| 233 | Ga0105249_10264829 | 3300009553 | Bacteria | 1709 |
| 234 | Ga0105249_10469042 | 3300009553 | Bacteria | 1300 |
| 235 | Ga0105249_11088247 | 3300009553 | Bacteria | 869 |
| 236 | Ga0105239_10481126 | 3300010375 | Bacteria | 1410 |
| 237 | Ga0105246_10129262 | 3300011119 | Bacteria | 1884 |
| 238 | Ga0105246_10778118 | 3300011119 | Bacteria | 847 |
| 239 | Ga0157371_10001481 | 3300013102 | Bacteria | 24297 |
| 240 | Ga0157370_10061195 | 3300013104 | Bacteria | 3573 |
| 241 | Ga0157370_10154130 | 3300013104 | Bacteria | 2138 |
| 242 | Ga0157369_10000037 | 3300013105 | Bacteria | 190395 |
| 243 | Ga0157374_10001474 | 3300013296 | Bacteria | 19873 |
| 244 | Ga0157374_10645656 | 3300013296 | Bacteria | 1070 |
| 245 | Ga0157378_10007402 | 3300013297 | Bacteria | 9589 |
| 246 | Ga0157378_10051856 | 3300013297 | Bacteria | 3650 |
| 247 | Ga0157372_10000064 | 3300013307 | Bacteria | 114648 |
| 248 | Ga0157375_10000076 | 3300013308 | Bacteria | 101715 |
| 249 | Ga0157375_10033964 | 3300013308 | Bacteria | 4854 |
| 250 | Ga0163163_10615823 | 3300014325 | Bacteria | 1149 |
| 251 | Ga0157380_10000118 | 3300014326 | Bacteria | 43745 |
| 252 | Ga0157380_10000163 | 3300014326 | Bacteria | 38484 |
| 253 | Ga0157379_10021283 | 3300014968 | Bacteria | 5739 |
| 254 | Ga0157379_10027803 | 3300014968 | Bacteria | 5034 |
| 255 | Ga0157376_10134222 | 3300014969 | Bacteria | 2213 |
| 256 | Ga0157376_10513409 | 3300014969 | Bacteria | 1180 |
| 257 | Ga0163161_10031651 | 3300017792 | Bacteria | 3770 |
| 258 | Ga0206354_10841384 | 3300020081 | Bacteria | 1042 |
| 259 | Ga0224712_10011362 | 3300022467 | Bacteria | 2761 |
| 260 | Ga0207656_10055490 | 3300025321 | Bacteria | 1725 |
| 261 | Ga0207682_10000047 | 3300025893 | Bacteria | 51208 |
| 262 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 263 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 264 | Ga0207642_10000050 | 3300025899 | Bacteria | 34402 |
| 265 | Ga0207642_10009299 | 3300025899 | Bacteria | 3414 |
| 266 | Ga0207642_10130246 | 3300025899 | Bacteria | 1312 |
| 267 | Ga0207710_10000103 | 3300025900 | Bacteria | 109033 |
| 268 | Ga0207710_10180331 | 3300025900 | Bacteria | 1036 |
| 269 | Ga0207688_10013921 | 3300025901 | Bacteria | 4373 |
| 270 | Ga0207680_10007643 | 3300025903 | Bacteria | 5279 |
| 271 | Ga0207680_10066138 | 3300025903 | Bacteria | 2222 |
| 272 | Ga0207680_10134296 | 3300025903 | Bacteria | 1634 |
| 273 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 274 | Ga0207643_10105839 | 3300025908 | Bacteria | 1653 |
| 275 | Ga0207705_10020753 | 3300025909 | Bacteria | 4688 |
| 276 | Ga0207654_10075338 | 3300025911 | Bacteria | 2016 |
| 277 | Ga0207695_10076324 | 3300025913 | Bacteria | 3407 |
| 278 | Ga0207695_10249829 | 3300025913 | Bacteria | 1673 |
| 279 | Ga0207671_10395457 | 3300025914 | Bacteria | 1099 |
| 280 | Ga0207693_10002071 | 3300025915 | Bacteria | 17531 |
| 281 | Ga0207693_10002610 | 3300025915 | Bacteria | 15668 |
| 282 | Ga0207693_10229939 | 3300025915 | Bacteria | 1456 |
| 283 | Ga0207693_10243461 | 3300025915 | Bacteria | 1412 |
| 284 | Ga0207663_10004253 | 3300025916 | Bacteria | 7103 |
| 285 | Ga0207663_10013387 | 3300025916 | Bacteria | 4458 |
| 286 | Ga0207663_10033361 | 3300025916 | Bacteria | 3066 |
| 287 | Ga0207660_10011227 | 3300025917 | Bacteria | 5826 |
| 288 | Ga0207657_10018050 | 3300025919 | Bacteria | 6749 |
| 289 | Ga0207657_10038267 | 3300025919 | Bacteria | 4272 |
| 290 | Ga0207649_10000025 | 3300025920 | Bacteria | 177532 |
| 291 | Ga0207649_10343893 | 3300025920 | Bacteria | 1102 |
| 292 | Ga0207652_10000177 | 3300025921 | Bacteria | 67555 |
| 293 | Ga0207652_10007489 | 3300025921 | Bacteria | 8794 |
| 294 | Ga0207652_10079126 | 3300025921 | Bacteria | 2871 |
| 295 | Ga0207652_10382933 | 3300025921 | Bacteria | 1269 |
| 296 | Ga0207694_10000067 | 3300025924 | Bacteria | 128108 |
| 297 | Ga0207659_10000032 | 3300025926 | Bacteria | 119492 |
| 298 | Ga0207659_10063498 | 3300025926 | Bacteria | 2670 |
| 299 | Ga0207687_10000021 | 3300025927 | Bacteria | 226396 |
| 300 | Ga0207687_10000023 | 3300025927 | Bacteria | 217098 |
| 301 | Ga0207687_10000241 | 3300025927 | Bacteria | 37298 |
| 302 | Ga0207687_10007909 | 3300025927 | Bacteria | 6966 |
| 303 | Ga0207687_10126338 | 3300025927 | Bacteria | 1920 |
| 304 | Ga0207687_10560356 | 3300025927 | Bacteria | 959 |
| 305 | Ga0207700_10000009 | 3300025928 | Bacteria | 314953 |
| 306 | Ga0207700_10078468 | 3300025928 | Bacteria | 2569 |
| 307 | Ga0207664_10068604 | 3300025929 | Bacteria | 2849 |
| 308 | Ga0207644_10092831 | 3300025931 | Bacteria | 2253 |
| 309 | Ga0207690_10024415 | 3300025932 | Bacteria | 3787 |
| 310 | Ga0207706_10000016 | 3300025933 | Bacteria | 170697 |
| 311 | Ga0207706_10515013 | 3300025933 | Bacteria | 1032 |
| 312 | Ga0207686_10000189 | 3300025934 | Bacteria | 47718 |
| 313 | Ga0207686_10049883 | 3300025934 | Bacteria | 2600 |
| 314 | Ga0207670_10212522 | 3300025936 | Bacteria | 1476 |
| 315 | Ga0207669_10000014 | 3300025937 | Bacteria | 129145 |
| 316 | Ga0207669_10000024 | 3300025937 | Bacteria | 96123 |
| 317 | Ga0207669_10033870 | 3300025937 | Bacteria | 2889 |
| 318 | Ga0207704_10000004 | 3300025938 | Bacteria | 239295 |
| 319 | Ga0207665_10047236 | 3300025939 | Bacteria | 2886 |
| 320 | Ga0207665_10111064 | 3300025939 | Bacteria | 1926 |
| 321 | Ga0207691_10000062 | 3300025940 | Bacteria | 85448 |
| 322 | Ga0207691_10025351 | 3300025940 | Bacteria | 5569 |
| 323 | Ga0207691_10134861 | 3300025940 | Bacteria | 2178 |
| 324 | Ga0207711_10000083 | 3300025941 | Bacteria | 102109 |
| 325 | Ga0207711_10243172 | 3300025941 | Bacteria | 1650 |
| 326 | Ga0207661_10000064 | 3300025944 | Bacteria | 75730 |
| 327 | Ga0207661_10000086 | 3300025944 | Bacteria | 64501 |
| 328 | Ga0207661_10009721 | 3300025944 | Bacteria | 6905 |
| 329 | Ga0207661_10065981 | 3300025944 | Bacteria | 2939 |
| 330 | Ga0207661_10091820 | 3300025944 | Bacteria | 2530 |
| 331 | Ga0207661_10323741 | 3300025944 | Bacteria | 1386 |
| 332 | Ga0207661_10486172 | 3300025944 | Bacteria | 1127 |
| 333 | Ga0207679_10014261 | 3300025945 | Bacteria | 5220 |
| 334 | Ga0207679_10082159 | 3300025945 | Bacteria | 2466 |
| 335 | Ga0207667_10690121 | 3300025949 | Bacteria | 1024 |
| 336 | Ga0207651_10251754 | 3300025960 | Bacteria | 1445 |
| 337 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 338 | Ga0207712_10011344 | 3300025961 | Bacteria | 5676 |
| 339 | Ga0207668_10007542 | 3300025972 | Bacteria | 6476 |
| 340 | Ga0207640_10047658 | 3300025981 | Bacteria | 2766 |
| 341 | Ga0207658_10104664 | 3300025986 | Bacteria | 2224 |
| 342 | Ga0207658_10214169 | 3300025986 | Bacteria | 1616 |
| 343 | Ga0207677_10000429 | 3300026023 | Bacteria | 28292 |
| 344 | Ga0207677_10029377 | 3300026023 | Bacteria | 3493 |
| 345 | Ga0207677_10137623 | 3300026023 | Bacteria | 1864 |
| 346 | Ga0207677_10343730 | 3300026023 | Bacteria | 1248 |
| 347 | Ga0207703_10000060 | 3300026035 | Bacteria | 134334 |
| 348 | Ga0207703_10000067 | 3300026035 | Bacteria | 125623 |
| 349 | Ga0207703_10124069 | 3300026035 | Bacteria | 2221 |
| 350 | Ga0207703_10652941 | 3300026035 | Bacteria | 998 |
| 351 | Ga0207639_10018969 | 3300026041 | Bacteria | 4897 |
| 352 | Ga0207639_10386455 | 3300026041 | Bacteria | 1258 |
| 353 | Ga0207678_10012641 | 3300026067 | Bacteria | 7416 |
| 354 | Ga0207678_10038380 | 3300026067 | Bacteria | 4161 |
| 355 | Ga0207678_10165577 | 3300026067 | Bacteria | 1888 |
| 356 | Ga0207708_10001660 | 3300026075 | Bacteria | 16551 |
| 357 | Ga0207708_10211074 | 3300026075 | Bacteria | 1552 |
| 358 | Ga0207708_10216904 | 3300026075 | Bacteria | 1531 |
| 359 | Ga0207708_10334348 | 3300026075 | Bacteria | 1239 |
| 360 | Ga0207708_10376245 | 3300026075 | Bacteria | 1170 |
| 361 | Ga0207702_10000134 | 3300026078 | Bacteria | 88324 |
| 362 | Ga0207702_10010610 | 3300026078 | Bacteria | 7699 |
| 363 | Ga0207702_10060363 | 3300026078 | Bacteria | 3233 |
| 364 | Ga0207702_10367380 | 3300026078 | Bacteria | 1380 |
| 365 | Ga0207702_10427999 | 3300026078 | Bacteria | 1281 |
| 366 | Ga0207702_10659340 | 3300026078 | Bacteria | 1029 |
| 367 | Ga0207702_10955698 | 3300026078 | Bacteria | 850 |
| 368 | Ga0207641_10000304 | 3300026088 | Bacteria | 61194 |
| 369 | Ga0207648_10000230 | 3300026089 | Bacteria | 59713 |
| 370 | Ga0207648_10093083 | 3300026089 | Bacteria | 2636 |
| 371 | Ga0207648_10182069 | 3300026089 | Bacteria | 1860 |
| 372 | Ga0207648_10361418 | 3300026089 | Bacteria | 1310 |
| 373 | Ga0207676_10000043 | 3300026095 | Bacteria | 161948 |
| 374 | Ga0207676_10621381 | 3300026095 | Bacteria | 1040 |
| 375 | Ga0207674_10053480 | 3300026116 | Bacteria | 4116 |
| 376 | Ga0207674_10229232 | 3300026116 | Bacteria | 1805 |
| 377 | Ga0207683_10019153 | 3300026121 | Bacteria | 5843 |
| 378 | Ga0207683_10141493 | 3300026121 | Bacteria | 2168 |
| 379 | Ga0207698_10000002 | 3300026142 | Bacteria | 404991 |
| 380 | Ga0207698_10089841 | 3300026142 | Bacteria | 2510 |
| 381 | Ga0207698_10488148 | 3300026142 | Bacteria | 1196 |
| 382 | Ga0207428_10152890 | 3300027907 | Bacteria | 1756 |
| 383 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 384 | Ga0268266_10000748 | 3300028379 | Bacteria | 43458 |
| 385 | Ga0268266_10000985 | 3300028379 | Bacteria | 35931 |
| 386 | Ga0268266_10069579 | 3300028379 | Bacteria | 3050 |
| 387 | Ga0268266_10961281 | 3300028379 | Bacteria | 826 |
| 388 | Ga0268265_10008034 | 3300028380 | Bacteria | 7124 |
| 389 | Ga0268265_10989870 | 3300028380 | Bacteria | 830 |
| 390 | Ga0268264_10032479 | 3300028381 | Bacteria | 4283 |
| 391 | Ga0265337_1000013 | 3300028556 | Bacteria | 82926 |
| 392 | Ga0265326_10000012 | 3300028558 | Bacteria | 175352 |
| 393 | Ga0265322_10000003 | 3300028654 | Bacteria | 468671 |
| 394 | Ga0265336_10011220 | 3300028666 | Bacteria | 3053 |
| 395 | Ga0265338_10170778 | 3300028800 | Bacteria | 1668 |
| 396 | Ga0265324_10000226 | 3300029957 | Bacteria | 42741 |
| 397 | Ga0265332_10019734 | 3300031238 | Bacteria | 2976 |
| 398 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 399 | Ga0265329_10046129 | 3300031242 | Bacteria | 1392 |
| 400 | Ga0265339_10029303 | 3300031249 | Bacteria | 3123 |
| 401 | Ga0265331_10005677 | 3300031250 | Bacteria | 7494 |
| 402 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 403 | Ga0265316_10022290 | 3300031344 | Bacteria | 5344 |
| 404 | Ga0307408_100107200 | 3300031548 | Bacteria | 2139 |
| 405 | Ga0307408_100417984 | 3300031548 | Bacteria | 1155 |
| 406 | Ga0265314_10000044 | 3300031711 | Bacteria | 207337 |
| 407 | Ga0316576_10210483 | 3300031727 | Bacteria | 1463 |
| 408 | Ga0307405_10135434 | 3300031731 | Bacteria | 1709 |
| 409 | Ga0307413_10021380 | 3300031824 | Bacteria | 3463 |
| 410 | Ga0307413_10100971 | 3300031824 | Bacteria | 1906 |
| 411 | Ga0307410_10034475 | 3300031852 | Bacteria | 3279 |
| 412 | Ga0307410_10050454 | 3300031852 | Bacteria | 2798 |
| 413 | Ga0307410_10213171 | 3300031852 | Bacteria | 1481 |
| 414 | Ga0307406_10074772 | 3300031901 | Bacteria | 2232 |
| 415 | Ga0307407_10103790 | 3300031903 | Bacteria | 1770 |
| 416 | Ga0307407_10204315 | 3300031903 | Bacteria | 1326 |
| 417 | Ga0307407_10608240 | 3300031903 | Bacteria | 814 |
| 418 | Ga0307412_10160170 | 3300031911 | Bacteria | 1671 |
| 419 | Ga0307409_100005794 | 3300031995 | Bacteria | 7166 |
| 420 | Ga0307409_100006101 | 3300031995 | Bacteria | 7043 |
| 421 | Ga0307409_100056297 | 3300031995 | Bacteria | 3040 |
| 422 | Ga0307409_100090221 | 3300031995 | Bacteria | 2508 |
| 423 | Ga0307409_100259625 | 3300031995 | Bacteria | 1593 |
| 424 | Ga0307409_100658524 | 3300031995 | Bacteria | 1042 |
| 425 | Ga0307416_100080867 | 3300032002 | Bacteria | 2745 |
| 426 | Ga0307416_100096347 | 3300032002 | Bacteria | 2558 |
| 427 | Ga0307416_100158487 | 3300032002 | Bacteria | 2088 |
| 428 | Ga0307416_100221361 | 3300032002 | Bacteria | 1815 |
| 429 | Ga0307416_100675122 | 3300032002 | Bacteria | 1120 |
| 430 | Ga0307416_100684614 | 3300032002 | Bacteria | 1113 |
| 431 | Ga0307415_100051745 | 3300032126 | Bacteria | 2789 |
| 432 | Ga0307415_100056531 | 3300032126 | Bacteria | 2691 |
| 433 | Ga0307415_100058664 | 3300032126 | Bacteria | 2650 |
| 434 | Ga0307415_100331673 | 3300032126 | Bacteria | 1273 |
| 435 | Ga0307415_100369425 | 3300032126 | Bacteria | 1214 |
| 436 | Ga0307415_100545849 | 3300032126 | Bacteria | 1022 |
| 437 | Ga0307415_100546724 | 3300032126 | Bacteria | 1021 |
| 438 | Ga0373941_0013194 | 3300035115 | Bacteria | 2178 |
| 439 | Ga0373955_0179137 | 3300035172 | Bacteria | 1257 |
| 440 | Ga0316574_0009515 | 3300035398 | Bacteria | 5445 |
| 441 | Ga0316574_0118176 | 3300035398 | Bacteria | 1701 |
| 442 | Ga0373937_0193371 | 3300036401 | Bacteria | 1912 |
| 443 | Ga0316584_0000905 | 3300036712 | Bacteria | 16895 |
| 444 | Ga0395899_0054834 | 3300037312 | Bacteria | 2949 |
| 445 | Ga0395900_0013545 | 3300037418 | Bacteria | 8330 |
| 446 | Ga0395900_0037958 | 3300037418 | Bacteria | 4966 |
| 447 | Ga0395900_0313987 | 3300037418 | Bacteria | 1550 |
| 448 | Ga0395898_0002611 | 3300037466 | Bacteria | 21002 |
| 449 | Ga0395898_0052768 | 3300037466 | Bacteria | 3972 |
| 450 | Ga0395898_0054915 | 3300037466 | Bacteria | 3885 |
| 451 | Ga0395898_0095502 | 3300037466 | Bacteria | 2856 |
| 452 | Ga0395898_0316397 | 3300037466 | Bacteria | 1489 |
| 453 | Ga0395898_0519810 | 3300037466 | Bacteria | 1132 |
| 454 | Ga0395898_0631366 | 3300037466 | Bacteria | 1014 |
| 455 | Ga0395905_0052194 | 3300037471 | Bacteria | 3828 |
| 456 | Ga0395905_0095615 | 3300037471 | Bacteria | 2788 |
| 457 | Ga0395905_0116453 | 3300037471 | Bacteria | 2512 |
| 458 | Ga0395905_0155588 | 3300037471 | Bacteria | 2150 |
| 459 | Ga0395905_0281334 | 3300037471 | Bacteria | 1550 |
| 460 | Ga0395905_0424899 | 3300037471 | Bacteria | 1225 |
| 461 | Ga0395901_0006182 | 3300038443 | Bacteria | 12133 |
| 462 | Ga0395901_0027180 | 3300038443 | Bacteria | 5878 |
| 463 | Ga0395901_0032062 | 3300038443 | Bacteria | 5422 |
| 464 | Ga0395901_0077287 | 3300038443 | Bacteria | 3474 |
| 465 | Ga0395901_0098579 | 3300038443 | Bacteria | 3064 |
| 466 | Ga0395901_0162877 | 3300038443 | Bacteria | 2342 |
| 467 | Ga0395901_0205081 | 3300038443 | Bacteria | 2066 |
| 468 | Ga0395901_1200185 | 3300038443 | Bacteria | 725 |
| 469 | Ga0436362_1063066 | 3300039453 | Bacteria | 2280 |
| 470 | Ga0451791_1493391 | 3300041451 | Bacteria | 1359 |
| 471 | Ga0451798_0455538 | 3300041458 | Bacteria | 1130 |
| 472 | Ga0451800_1364888 | 3300041459 | Bacteria | 799 |
| 473 | Ga0451837_0621418 | 3300041494 | Bacteria | 1110 |
| 474 | Ga0451853_2225693 | 3300041512 | Bacteria | 2063 |
| 475 | Ga0439448_0071202 | 3300042005 | Bacteria | 1159 |
| 476 | Ga0439450_010931 | 3300042008 | Bacteria | 1764 |
| 477 | Ga0439455_0032307 | 3300042012 | Bacteria | 1308 |
| 478 | Ga0439463_054919 | 3300042016 | Bacteria | 1017 |
| 479 | Ga0450914_007778 | 3300042118 | Bacteria | 977 |
| 480 | Ga0439444_0003839 | 3300042437 | Bacteria | 2149 |
| 481 | Ga0439464_0017246 | 3300042439 | Bacteria | 1957 |
| 482 | Ga0439460_0022516 | 3300042461 | Bacteria | 1729 |
| 483 | Ga0466972_0110165 | 3300044658 | Bacteria | 1301 |
| 484 | Ga0466963_0000021 | 3300044694 | Bacteria | 53432 |
| 485 | Ga0466968_0099173 | 3300044735 | Bacteria | 1299 |
| 486 | Ga0466957_0016840 | 3300044842 | Bacteria | 4276 |
| 487 | Ga0466960_0005260 | 3300044901 | Bacteria | 5112 |
| 488 | Ga0466960_0014374 | 3300044901 | Bacteria | 3387 |
| 489 | Ga0466960_0081905 | 3300044901 | Bacteria | 1628 |
| 490 | Ga0466960_0238999 | 3300044901 | Bacteria | 1005 |
| 491 | Ga0466958_0320949 | 3300045836 | Bacteria | 995 |
| 492 | Ga0466967_0000004 | 3300045976 | Bacteria | 155664 |
| 493 | Ga0466967_0017023 | 3300045976 | Bacteria | 5753 |
| 494 | Ga0466967_0046359 | 3300045976 | Bacteria | 3784 |
| 495 | Ga0466967_0088526 | 3300045976 | Bacteria | 2810 |
| 496 | Ga0466967_0104298 | 3300045976 | Bacteria | 2595 |
| 497 | Ga0466967_0110416 | 3300045976 | Bacteria | 2526 |
| 498 | Ga0466967_0284580 | 3300045976 | Bacteria | 1587 |
| 499 | Ga0466967_0310859 | 3300045976 | Bacteria | 1518 |
| 500 | Ga0466967_0344613 | 3300045976 | Bacteria | 1441 |
| 501 | Ga0495592_0116807 | 3300046454 | Bacteria | 1882 |
| 502 | Ga0495592_0231998 | 3300046454 | Bacteria | 1228 |
| 503 | Ga0495603_0000554 | 3300046455 | Bacteria | 20910 |
| 504 | Ga0495603_0011655 | 3300046455 | Bacteria | 5321 |
| 505 | Ga0495603_0110010 | 3300046455 | Bacteria | 1608 |
| 506 | Ga0495629_0000014 | 3300046459 | Bacteria | 201801 |
| 507 | Ga0495629_0009501 | 3300046459 | Bacteria | 7109 |
| 508 | Ga0495629_0067785 | 3300046459 | Bacteria | 2490 |
| 509 | Ga0495641_0000001 | 3300046461 | Bacteria | 485224 |
| 510 | Ga0495641_0001824 | 3300046461 | Bacteria | 17564 |
| 511 | Ga0495641_0058073 | 3300046461 | Bacteria | 1752 |
| 512 | Ga0495641_0062929 | 3300046461 | Bacteria | 1673 |
| 513 | Ga0495653_0046662 | 3300046463 | Bacteria | 3354 |
| 514 | Ga0495650_0000049 | 3300046471 | Bacteria | 325092 |
| 515 | Ga0495582_0014026 | 3300046473 | Bacteria | 4413 |
| 516 | Ga0495639_0125296 | 3300046475 | Bacteria | 1227 |
| 517 | Ga0495662_0003775 | 3300046476 | Bacteria | 7638 |
| 518 | Ga0495664_0000051 | 3300046477 | Bacteria | 59070 |
| 519 | Ga0495664_0157673 | 3300046477 | Bacteria | 1377 |
| 520 | Ga0495584_0082444 | 3300046491 | Bacteria | 1619 |
| 521 | Ga0495584_0328296 | 3300046491 | Bacteria | 777 |
| 522 | Ga0495594_0000004 | 3300046499 | Bacteria | 195881 |
| 523 | Ga0495596_0081313 | 3300046500 | Bacteria | 1258 |
| 524 | Ga0495596_0091561 | 3300046500 | Bacteria | 1180 |
| 525 | Ga0495606_0000045 | 3300046507 | Bacteria | 212105 |
| 526 | Ga0495608_0000001 | 3300046511 | Bacteria | 411278 |
| 527 | Ga0495608_0005626 | 3300046511 | Bacteria | 8951 |
| 528 | Ga0495608_0059240 | 3300046511 | Bacteria | 2523 |
| 529 | Ga0495610_0190712 | 3300046512 | Bacteria | 846 |
| 530 | Ga0495616_0066582 | 3300046513 | Bacteria | 1752 |
| 531 | Ga0495620_0000119 | 3300046515 | Bacteria | 63487 |
| 532 | Ga0495628_0000070 | 3300046516 | Bacteria | 80592 |
| 533 | Ga0495628_0036831 | 3300046516 | Bacteria | 3924 |
| 534 | Ga0495628_0039459 | 3300046516 | Bacteria | 3777 |
| 535 | Ga0495628_0116419 | 3300046516 | Bacteria | 2053 |
| 536 | Ga0495628_0382782 | 3300046516 | Bacteria | 1030 |
| 537 | Ga0495630_0000007 | 3300046517 | Bacteria | 376915 |
| 538 | Ga0495630_0048552 | 3300046517 | Bacteria | 3177 |
| 539 | Ga0495631_0019394 | 3300046518 | Bacteria | 3189 |
| 540 | Ga0495643_0096732 | 3300046522 | Bacteria | 1518 |
| 541 | Ga0495644_0000296 | 3300046523 | Bacteria | 23051 |
| 542 | Ga0495644_0012275 | 3300046523 | Bacteria | 3293 |
| 543 | Ga0495652_0000066 | 3300046529 | Bacteria | 109895 |
| 544 | Ga0495652_0002702 | 3300046529 | Bacteria | 18014 |
| 545 | Ga0495586_0000338 | 3300046535 | Bacteria | 29347 |
| 546 | Ga0495587_0000446 | 3300046536 | Bacteria | 28865 |
| 547 | Ga0495598_0000768 | 3300046537 | Bacteria | 6117 |
| 548 | Ga0495621_0056296 | 3300046539 | Bacteria | 1418 |
| 549 | Ga0495645_0029053 | 3300046543 | Bacteria | 4018 |
| 550 | Ga0495645_0029487 | 3300046543 | Bacteria | 3991 |
| 551 | Ga0495645_0057815 | 3300046543 | Bacteria | 2814 |
| 552 | Ga0495622_0000016 | 3300046557 | Bacteria | 177089 |
| 553 | Ga0495667_0000015 | 3300046559 | Bacteria | 200377 |
| 554 | Ga0495667_0086197 | 3300046559 | Bacteria | 2037 |
| 555 | Ga0495656_0000226 | 3300046615 | Bacteria | 19944 |
| 556 | Ga0495656_0023676 | 3300046615 | Bacteria | 2419 |
| 557 | Ga0495656_0027084 | 3300046615 | Bacteria | 2287 |
| 558 | Ga0495656_0127748 | 3300046615 | Bacteria | 1207 |
| 559 | Ga0495634_0000187 | 3300046642 | Bacteria | 57203 |
| 560 | Ga0495634_0000755 | 3300046642 | Bacteria | 31302 |
| 561 | Ga0495634_0028471 | 3300046642 | Bacteria | 3877 |
| 562 | Ga0495625_0000020 | 3300046660 | Bacteria | 290440 |
| 563 | Ga0495588_0000217 | 3300046674 | Bacteria | 54461 |
| 564 | Ga0495657_0000002 | 3300046675 | Bacteria | 411958 |
| 565 | Ga0495657_0024794 | 3300046675 | Bacteria | 4266 |
| 566 | Ga0495599_0007160 | 3300046678 | Bacteria | 6754 |
| 567 | Ga0495647_0000013 | 3300046681 | Bacteria | 88029 |
| 568 | Ga0495658_0015152 | 3300046683 | Bacteria | 3952 |
| 569 | Ga0495658_0030522 | 3300046683 | Bacteria | 2927 |
| 570 | Ga0495669_0000251 | 3300046684 | Bacteria | 31256 |
| 571 | Ga0495613_0000040 | 3300046689 | Bacteria | 131633 |
| 572 | Ga0495613_0000159 | 3300046689 | Bacteria | 65969 |
| 573 | Ga0495624_0000013 | 3300046690 | Bacteria | 115278 |
| 574 | Ga0495624_0146803 | 3300046690 | Bacteria | 1443 |
| 575 | Ga0495670_0003761 | 3300046691 | Bacteria | 7462 |
| 576 | Ga0495670_0364273 | 3300046691 | Bacteria | 779 |
| 577 | Ga0495649_0001084 | 3300046694 | Bacteria | 21240 |
| 578 | Ga0495589_0066440 | 3300046794 | Bacteria | 1766 |
| 579 | Ga0495600_0026502 | 3300046809 | Bacteria | 3741 |
| 580 | Ga0495600_0079645 | 3300046809 | Bacteria | 2138 |
| 581 | Ga0495604_0001037 | 3300047317 | Bacteria | 23128 |
| 582 | Ga0495604_0003372 | 3300047317 | Bacteria | 12743 |
| 583 | Ga0495604_0063409 | 3300047317 | Bacteria | 2819 |
| 584 | Ga0495674_0351796 | 3300047319 | Bacteria | 1196 |
| 585 | Ga0495672_0172686 | 3300047320 | Bacteria | 1101 |
| 586 | Ga0495676_0000091 | 3300047321 | Bacteria | 66575 |
| 587 | Ga0495676_0000252 | 3300047321 | Bacteria | 43212 |
| 588 | Ga0495676_0007581 | 3300047321 | Bacteria | 9947 |
| 589 | Ga0495676_0183690 | 3300047321 | Bacteria | 1464 |
| 590 | Ga0495680_0000286 | 3300047322 | Bacteria | 56839 |
| 591 | Ga0495680_0000741 | 3300047322 | Bacteria | 36581 |
| 592 | Ga0495675_0000019 | 3300047444 | Bacteria | 113641 |
| 593 | Ga0495679_010847 | 3300047446 | Bacteria | 3554 |
| 594 | Ga0495673_0007712 | 3300047469 | Bacteria | 6145 |
| 595 | Ga0495681_0032267 | 3300047470 | Bacteria | 2639 |
| 596 | Ga0495684_0443834 | 3300047471 | Bacteria | 903 |
| 597 | Ga0495686_0000003 | 3300047472 | Bacteria | 899502 |
| 598 | Ga0495686_0004470 | 3300047472 | Bacteria | 11507 |
| 599 | Ga0495686_0011364 | 3300047472 | Bacteria | 6275 |
| 600 | Ga0495686_0014186 | 3300047472 | Bacteria | 5494 |
| 601 | Ga0495686_0107760 | 3300047472 | Bacteria | 1674 |
| 602 | Ga0495686_0144355 | 3300047472 | Bacteria | 1402 |
| 603 | Ga0495593_0052858 | 3300047673 | Bacteria | 2145 |
| 604 | Ga0495593_0083840 | 3300047673 | Bacteria | 1646 |
| 605 | Ga0495602_0000010 | 3300048088 | Bacteria | 212121 |
| 606 | Ga0495602_0001188 | 3300048088 | Bacteria | 25566 |
| 607 | Ga0495626_0150215 | 3300048091 | Bacteria | 983 |
| 608 | Ga0496100_0000003 | 3300048903 | Bacteria | 360802 |
| 609 | Ga0496100_0000008 | 3300048903 | Bacteria | 231974 |
| 610 | Ga0496100_0010310 | 3300048903 | Bacteria | 5287 |
| 611 | Ga0496100_0466239 | 3300048903 | Bacteria | 970 |
| 612 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 613 | Ga0496101_0000016 | 3300048904 | Bacteria | 240753 |
| 614 | Ga0496101_0020700 | 3300048904 | Bacteria | 4510 |
| 615 | Ga0496101_0434786 | 3300048904 | Bacteria | 1035 |
| 616 | Ga0496102_0000087 | 3300048905 | Bacteria | 130138 |
| 617 | Ga0496102_0004436 | 3300048905 | Bacteria | 11850 |
| 618 | Ga0496102_0181834 | 3300048905 | Bacteria | 1981 |
| 619 | Ga0496102_0326333 | 3300048905 | Bacteria | 1446 |
| 620 | Ga0496102_0492919 | 3300048905 | Bacteria | 1147 |
| 621 | Ga0496102_0640133 | 3300048905 | Bacteria | 986 |
| 622 | Ga0496102_0704280 | 3300048905 | Bacteria | 933 |
| 623 | Ga0496103_0000016 | 3300048906 | Bacteria | 266127 |
| 624 | Ga0496103_0008154 | 3300048906 | Bacteria | 6219 |
| 625 | Ga0496103_0043658 | 3300048906 | Bacteria | 2760 |
| 626 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 627 | Ga0496104_0000063 | 3300048907 | Bacteria | 116618 |
| 628 | Ga0496104_0005819 | 3300048907 | Bacteria | 10798 |
| 629 | Ga0496104_0006122 | 3300048907 | Bacteria | 10561 |
| 630 | Ga0496104_0016537 | 3300048907 | Bacteria | 6703 |
| 631 | Ga0496104_0080749 | 3300048907 | Bacteria | 3100 |
| 632 | Ga0496104_0114551 | 3300048907 | Bacteria | 2586 |
| 633 | Ga0496105_0000031 | 3300048908 | Bacteria | 137220 |
| 634 | Ga0496105_0000041 | 3300048908 | Bacteria | 116618 |
| 635 | Ga0496105_0010380 | 3300048908 | Bacteria | 7323 |
| 636 | Ga0496105_0014248 | 3300048908 | Bacteria | 6326 |
| 637 | Ga0496105_0017248 | 3300048908 | Bacteria | 5783 |
| 638 | Ga0496106_0000048 | 3300048909 | Bacteria | 98233 |
| 639 | Ga0496106_0000052 | 3300048909 | Bacteria | 94849 |
| 640 | Ga0496106_0000086 | 3300048909 | Bacteria | 73933 |
| 641 | Ga0496106_0019334 | 3300048909 | Bacteria | 5050 |
| 642 | Ga0496107_0000008 | 3300048910 | Bacteria | 251874 |
| 643 | Ga0496107_0000009 | 3300048910 | Bacteria | 231682 |
| 644 | Ga0496107_0099380 | 3300048910 | Bacteria | 2132 |
| 645 | Ga0496107_0254877 | 3300048910 | Bacteria | 1306 |
| 646 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 647 | Ga0496108_0000024 | 3300048911 | Bacteria | 183389 |
| 648 | Ga0496108_0000153 | 3300048911 | Bacteria | 66080 |
| 649 | Ga0496108_0001032 | 3300048911 | Bacteria | 21718 |
| 650 | Ga0496108_0003084 | 3300048911 | Bacteria | 13393 |
| 651 | Ga0496108_0029103 | 3300048911 | Bacteria | 4572 |
| 652 | Ga0496108_0162580 | 3300048911 | Bacteria | 1930 |
| 653 | Ga0496108_0300905 | 3300048911 | Bacteria | 1397 |
| 654 | Ga0496108_0615011 | 3300048911 | Bacteria | 946 |
| 655 | Ga0496108_0631675 | 3300048911 | Bacteria | 932 |
| 656 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 657 | Ga0496109_0000033 | 3300048912 | Bacteria | 160496 |
| 658 | Ga0496109_0000146 | 3300048912 | Bacteria | 69777 |
| 659 | Ga0496109_0000300 | 3300048912 | Bacteria | 46637 |
| 660 | Ga0496109_0000385 | 3300048912 | Bacteria | 40032 |
| 661 | Ga0496109_0011389 | 3300048912 | Bacteria | 7643 |
| 662 | Ga0496109_0012295 | 3300048912 | Bacteria | 7389 |
| 663 | Ga0496109_0052036 | 3300048912 | Bacteria | 3732 |
| 664 | Ga0496109_0066111 | 3300048912 | Bacteria | 3310 |
| 665 | Ga0496109_0240672 | 3300048912 | Bacteria | 1703 |
| 666 | Ga0496109_0319497 | 3300048912 | Unclassified | 1465 |
| 667 | Ga0496109_0424952 | 3300048912 | Bacteria | 1255 |
| 668 | Ga0496109_0657775 | 3300048912 | Bacteria | 985 |
| 669 | Ga0496110_0000008 | 3300048913 | Bacteria | 113408 |
| 670 | Ga0496110_0003088 | 3300048913 | Bacteria | 12630 |
| 671 | Ga0496110_0015770 | 3300048913 | Bacteria | 6298 |
| 672 | Ga0496110_0042351 | 3300048913 | Bacteria | 3974 |
| 673 | Ga0496110_0116576 | 3300048913 | Bacteria | 2404 |
| 674 | Ga0496110_0138177 | 3300048913 | Bacteria | 2203 |
| 675 | Ga0496110_0178161 | 3300048913 | Bacteria | 1930 |
| 676 | Ga0496110_0190242 | 3300048913 | Bacteria | 1864 |
| 677 | Ga0496110_0377143 | 3300048913 | Bacteria | 1292 |
| 678 | Ga0496111_0000004 | 3300048914 | Bacteria | 116115 |
| 679 | Ga0496111_0045340 | 3300048914 | Bacteria | 3163 |
| 680 | Ga0496111_0059397 | 3300048914 | Bacteria | 2770 |
| 681 | Ga0496111_0061425 | 3300048914 | Bacteria | 2724 |
| 682 | Ga0496111_0141389 | 3300048914 | Bacteria | 1783 |
| 683 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 684 | Ga0496112_0003642 | 3300048915 | Bacteria | 12833 |
| 685 | Ga0496112_0006668 | 3300048915 | Bacteria | 10162 |
| 686 | Ga0496112_0007211 | 3300048915 | Bacteria | 9853 |
| 687 | Ga0496112_0010040 | 3300048915 | Bacteria | 8571 |
| 688 | Ga0496112_0068735 | 3300048915 | Bacteria | 3498 |
| 689 | Ga0496112_0171160 | 3300048915 | Bacteria | 2137 |
| 690 | Ga0496112_0208546 | 3300048915 | Bacteria | 1912 |
| 691 | Ga0496112_0613706 | 3300048915 | Bacteria | 1019 |
| 692 | Ga0496112_0757664 | 3300048915 | Bacteria | 897 |
| 693 | Ga0496113_0000003 | 3300048916 | Bacteria | 123519 |
| 694 | Ga0496113_0001303 | 3300048916 | Bacteria | 13799 |
| 695 | Ga0496113_0006959 | 3300048916 | Bacteria | 7228 |
| 696 | Ga0496113_0011846 | 3300048916 | Bacteria | 5843 |
| 697 | Ga0496113_0059817 | 3300048916 | Bacteria | 2871 |
| 698 | Ga0496113_0120353 | 3300048916 | Bacteria | 2052 |
| 699 | Ga0496113_0308628 | 3300048916 | Bacteria | 1267 |
| 700 | Ga0496114_0000010 | 3300048917 | Bacteria | 363396 |
| 701 | Ga0496114_0007417 | 3300048917 | Bacteria | 8668 |
| 702 | Ga0496114_0026192 | 3300048917 | Bacteria | 4773 |
| 703 | Ga0496114_0100129 | 3300048917 | Bacteria | 2473 |
| 704 | Ga0496114_0305978 | 3300048917 | Bacteria | 1404 |
| 705 | Ga0496114_0322108 | 3300048917 | Bacteria | 1366 |
| 706 | Ga0496114_0787634 | 3300048917 | Bacteria | 829 |
| 707 | Ga0496115_0000212 | 3300048918 | Bacteria | 53976 |
| 708 | Ga0496115_0001537 | 3300048918 | Bacteria | 16551 |
| 709 | Ga0496115_0006044 | 3300048918 | Bacteria | 8839 |
| 710 | Ga0496115_0101261 | 3300048918 | Bacteria | 2362 |
| 711 | Ga0496116_0000014 | 3300048919 | Bacteria | 569049 |
| 712 | Ga0496117_0001369 | 3300048920 | Bacteria | 35534 |
| 713 | Ga0496118_0000389 | 3300048921 | Bacteria | 74298 |
| 714 | Ga0496118_0111189 | 3300048921 | Bacteria | 1817 |
| 715 | Ga0496119_0000937 | 3300048922 | Bacteria | 37582 |
| 716 | Ga0496119_0004788 | 3300048922 | Bacteria | 13285 |
| 717 | Ga0496119_0072208 | 3300048922 | Bacteria | 2017 |
| 718 | Ga0496119_0092775 | 3300048922 | Bacteria | 1712 |
| 719 | Ga0496119_0263167 | 3300048922 | Bacteria | 864 |
| 720 | Ga0496120_0013512 | 3300048923 | Bacteria | 5495 |
| 721 | Ga0496121_0030447 | 3300048924 | Bacteria | 4956 |
| 722 | Ga0496121_0090143 | 3300048924 | Bacteria | 2398 |
| 723 | Ga0496124_0071588 | 3300048927 | Bacteria | 2873 |
| 724 | Ga0496124_0261022 | 3300048927 | Bacteria | 1275 |
| 725 | Ga0496125_0105470 | 3300048928 | Bacteria | 2060 |
| 726 | Ga0496125_0283605 | 3300048928 | Bacteria | 1024 |
| 727 | Ga0496126_0022931 | 3300048929 | Bacteria | 6060 |
| 728 | Ga0496126_0072478 | 3300048929 | Bacteria | 3064 |
| 729 | Ga0501031_0000172 | 3300049568 | Bacteria | 36896 |
| 730 | Ga0501031_0015145 | 3300049568 | Bacteria | 5007 |
| 731 | Ga0501032_0000902 | 3300049569 | Bacteria | 24083 |
| 732 | Ga0501032_0010389 | 3300049569 | Bacteria | 6714 |
| 733 | Ga0501032_0216731 | 3300049569 | Bacteria | 1247 |
| 734 | Ga0501033_0000211 | 3300049570 | Bacteria | 55768 |
| 735 | Ga0501034_0003939 | 3300049571 | Bacteria | 16683 |
| 736 | Ga0501034_0081350 | 3300049571 | Bacteria | 3241 |
| 737 | Ga0501034_0092323 | 3300049571 | Bacteria | 3024 |
| 738 | Ga0501036_0000841 | 3300049572 | Bacteria | 22831 |
| 739 | Ga0501037_0000120 | 3300049573 | Bacteria | 73352 |
| 740 | Ga0501037_0047950 | 3300049573 | Bacteria | 3130 |
| 741 | Ga0501038_0000139 | 3300049574 | Bacteria | 62162 |
| 742 | Ga0501038_0007284 | 3300049574 | Bacteria | 10211 |
| 743 | Ga0501038_0189798 | 3300049574 | Bacteria | 1654 |
| 744 | Ga0501039_0006697 | 3300049575 | Bacteria | 8762 |
| 745 | Ga0501039_0061758 | 3300049575 | Bacteria | 2902 |
| 746 | Ga0501039_0067117 | 3300049575 | Bacteria | 2786 |
| 747 | Ga0501039_0087124 | 3300049575 | Bacteria | 2432 |
| 748 | Ga0501040_0095431 | 3300049576 | Bacteria | 2070 |
| 749 | Ga0501040_0198213 | 3300049576 | Bacteria | 1425 |
| 750 | Ga0501041_0026073 | 3300049577 | Bacteria | 3514 |
| 751 | Ga0501042_0023236 | 3300049578 | Bacteria | 4337 |
| 752 | Ga0501042_0109782 | 3300049578 | Bacteria | 1986 |
| 753 | Ga0501042_0110459 | 3300049578 | Bacteria | 1980 |
| 754 | Ga0501042_0178739 | 3300049578 | Bacteria | 1531 |
| 755 | Ga0501042_0237986 | 3300049578 | Bacteria | 1313 |
| 756 | Ga0501042_0264273 | 3300049578 | Bacteria | 1242 |
| 757 | Ga0501042_0275243 | 3300049578 | Bacteria | 1215 |
| 758 | Ga0501042_0358094 | 3300049578 | Bacteria | 1056 |
| 759 | Ga0501043_0000203 | 3300049579 | Bacteria | 54330 |
| 760 | Ga0501043_0115045 | 3300049579 | Bacteria | 2111 |
| 761 | Ga0501046_0000194 | 3300049580 | Bacteria | 62330 |
| 762 | Ga0501046_0006659 | 3300049580 | Bacteria | 10202 |
| 763 | Ga0501047_0000287 | 3300049581 | Bacteria | 58087 |
| 764 | Ga0501047_0083987 | 3300049581 | Bacteria | 3061 |
| 765 | Ga0501047_0155750 | 3300049581 | Bacteria | 2158 |
| 766 | Ga0501047_0167887 | 3300049581 | Bacteria | 2064 |
| 767 | Ga0501048_0000004 | 3300049582 | Bacteria | 100672 |
| 768 | Ga0501048_0101618 | 3300049582 | Bacteria | 2028 |
| 769 | Ga0501048_0162961 | 3300049582 | Bacteria | 1578 |
| 770 | Ga0501048_0171015 | 3300049582 | Bacteria | 1539 |
| 771 | Ga0501048_0199154 | 3300049582 | Bacteria | 1419 |
| 772 | Ga0501048_0428411 | 3300049582 | Bacteria | 947 |
| 773 | Ga0501067_0004060 | 3300049583 | Bacteria | 8075 |
| 774 | Ga0501068_0003838 | 3300049584 | Bacteria | 8153 |
| 775 | Ga0501068_0006798 | 3300049584 | Bacteria | 6325 |
| 776 | Ga0501068_0054469 | 3300049584 | Bacteria | 2423 |
| 777 | Ga0501068_0187098 | 3300049584 | Bacteria | 1311 |
| 778 | Ga0501069_0054695 | 3300049585 | Bacteria | 2222 |
| 779 | Ga0501069_0057879 | 3300049585 | Bacteria | 2162 |
| 780 | Ga0501069_0134867 | 3300049585 | Bacteria | 1415 |
| 781 | Ga0501069_0207237 | 3300049585 | Bacteria | 1137 |
| 782 | Ga0501070_0000079 | 3300049586 | Bacteria | 82054 |
| 783 | Ga0501070_0005006 | 3300049586 | Bacteria | 11305 |
| 784 | Ga0501070_0022040 | 3300049586 | Bacteria | 5336 |
| 785 | Ga0501070_0156923 | 3300049586 | Bacteria | 1876 |
| 786 | Ga0501070_0219921 | 3300049586 | Bacteria | 1558 |
| 787 | Ga0501070_0228671 | 3300049586 | Bacteria | 1524 |
| 788 | Ga0501071_0025386 | 3300049587 | Bacteria | 4151 |
| 789 | Ga0501071_0072775 | 3300049587 | Bacteria | 2507 |
| 790 | Ga0501071_0155521 | 3300049587 | Bacteria | 1707 |
| 791 | Ga0501072_0008915 | 3300049588 | Bacteria | 7623 |
| 792 | Ga0501072_0011185 | 3300049588 | Bacteria | 6850 |
| 793 | Ga0501072_0135702 | 3300049588 | Bacteria | 1962 |
| 794 | Ga0501073_0000837 | 3300049589 | Bacteria | 21883 |
| 795 | Ga0501073_0004618 | 3300049589 | Bacteria | 10347 |
| 796 | Ga0501073_0416131 | 3300049589 | Bacteria | 929 |
| 797 | Ga0501074_0005099 | 3300049590 | Bacteria | 9433 |
| 798 | Ga0501074_0035779 | 3300049590 | Bacteria | 3598 |
| 799 | Ga0501074_0060546 | 3300049590 | Bacteria | 2728 |
| 800 | Ga0501074_0191622 | 3300049590 | Bacteria | 1457 |
| 801 | Ga0501075_0000598 | 3300049591 | Bacteria | 22031 |
| 802 | Ga0501075_0149001 | 3300049591 | Bacteria | 1783 |
| 803 | Ga0501075_0734696 | 3300049591 | Bacteria | 752 |
| 804 | Ga0501076_0325521 | 3300049592 | Bacteria | 1261 |
| 805 | Ga0501209_052068 | 3300049656 | Bacteria | 1120 |
| 806 | Ga0501079_0000318 | 3300049741 | Bacteria | 30235 |
| 807 | Ga0501079_0033296 | 3300049741 | Bacteria | 3964 |
| 808 | Ga0501079_0081047 | 3300049741 | Bacteria | 2509 |
| 809 | Ga0501079_0216005 | 3300049741 | Bacteria | 1498 |
| 810 | Ga0501080_0004716 | 3300049742 | Bacteria | 12163 |
| 811 | Ga0501080_0012592 | 3300049742 | Bacteria | 7756 |
| 812 | Ga0501080_0039515 | 3300049742 | Bacteria | 4403 |
| 813 | Ga0501080_0053734 | 3300049742 | Bacteria | 3751 |
| 814 | Ga0501080_0252844 | 3300049742 | Bacteria | 1607 |
| 815 | Ga0501081_0054678 | 3300049743 | Bacteria | 2758 |
| 816 | Ga0501083_0008391 | 3300049744 | Bacteria | 7305 |
| 817 | Ga0501083_0010952 | 3300049744 | Bacteria | 6376 |
| 818 | Ga0501083_0019756 | 3300049744 | Bacteria | 4688 |
| 819 | Ga0501083_0189462 | 3300049744 | Bacteria | 1342 |
| 820 | Ga0501035_0000059 | 3300049822 | Bacteria | 134506 |
| 821 | Ga0501035_0010845 | 3300049822 | Bacteria | 8440 |
| 822 | Ga0501035_0189013 | 3300049822 | Bacteria | 1771 |
| 823 | Ga0501044_0001354 | 3300049823 | Bacteria | 28756 |
| 824 | Ga0501044_0065596 | 3300049823 | Bacteria | 3702 |
| 825 | Ga0501044_0117169 | 3300049823 | Bacteria | 2668 |
| 826 | Ga0501045_0185462 | 3300049824 | Bacteria | 1550 |
| 827 | nmdc:mga03n38_20290_c1 | 3300050490 | Bacteria | 2657 |
| 828 | nmdc:mga00v17_398398_c1 | 3300050491 | Bacteria | 894 |
| 829 | nmdc:mga00v17_413931_c1 | 3300050491 | Bacteria | 876 |
| 830 | nmdc:mga00v17_485167_c1 | 3300050491 | Bacteria | 802 |
| 831 | nmdc:mga0yw44_110598_c1 | 3300050492 | Bacteria | 1760 |
| 832 | nmdc:mga0yw44_112690_c1 | 3300050492 | Bacteria | 1745 |
| 833 | nmdc:mga0yw44_194453_c1 | 3300050492 | Bacteria | 1338 |
| 834 | nmdc:mga0yw44_231_c1 | 3300050492 | Bacteria | 19110 |
| 835 | nmdc:mga0yw44_23608_c1 | 3300050492 | Bacteria | 3468 |
| 836 | nmdc:mga0yw44_356908_c1 | 3300050492 | Bacteria | 985 |
| 837 | nmdc:mga0yw44_58162_c1 | 3300050492 | Bacteria | 2361 |
| 838 | nmdc:mga06z11_127962_c1 | 3300050494 | Bacteria | 1423 |
| 839 | nmdc:mga06z11_204999_c1 | 3300050494 | Bacteria | 1147 |
| 840 | nmdc:mga04h51_289388_c1 | 3300050495 | Bacteria | 665 |
| 841 | nmdc:mga05p37_179704_c1 | 3300050507 | Bacteria | 2575 |
| 842 | nmdc:mga05p37_7822_c1 | 3300050507 | Bacteria | 12620 |
| 843 | nmdc:mga09592_354075_c1 | 3300050508 | Bacteria | 1270 |
| 844 | nmdc:mga09592_422117_c1 | 3300050508 | Bacteria | 1152 |
| 845 | nmdc:mga0qj67_142718_c1 | 3300050509 | Bacteria | 1942 |
| 846 | nmdc:mga0qj67_32858_c1 | 3300050509 | Bacteria | 4047 |
| 847 | nmdc:mga0qj67_4318_c1 | 3300050509 | Bacteria | 10302 |
| 848 | nmdc:mga06r32_21838_c1 | 3300050510 | Bacteria | 5910 |
| 849 | nmdc:mga06r32_40822_c1 | 3300050510 | Bacteria | 4407 |
| 850 | nmdc:mga06r32_70499_c1 | 3300050510 | Bacteria | 3380 |
| 851 | nmdc:mga08y16_27710_c1 | 3300050511 | Bacteria | 5969 |
| 852 | nmdc:mga08y16_399242_c1 | 3300050511 | Bacteria | 1407 |
| 853 | nmdc:mga08y16_4538_c1 | 3300050511 | Bacteria | 14468 |
| 854 | nmdc:mga08y16_55997_c1 | 3300050511 | Bacteria | 4121 |
| 855 | nmdc:mga0n895_4098_c1 | 3300050512 | Bacteria | 11868 |
| 856 | nmdc:mga0a205_1040650_c1 | 3300050515 | Bacteria | 666 |
| 857 | nmdc:mga0a205_30889_c1 | 3300050515 | Bacteria | 5131 |
| 858 | nmdc:mga0a205_4209_c1 | 3300050515 | Bacteria | 12901 |
| 859 | nmdc:mga0a205_47748_c1 | 3300050515 | Bacteria | 4131 |
| 860 | nmdc:mga0a205_9_c2 | 3300050515 | Bacteria | 69167 |
| 861 | Ga0495601_0000012 | 3300053077 | Bacteria | 227853 |
| 862 | Ga0495601_0000344 | 3300053077 | Bacteria | 24491 |
| 863 | Ga0495601_0021121 | 3300053077 | Bacteria | 3984 |
| 864 | Ga0495601_0382019 | 3300053077 | Bacteria | 914 |
| 865 | Ga0495612_0000100 | 3300053078 | Bacteria | 37132 |
| 866 | Ga0495612_0000403 | 3300053078 | Bacteria | 17309 |
| 867 | Ga0495612_0009103 | 3300053078 | Bacteria | 4028 |
| 868 | Ga0495612_0032013 | 3300053078 | Bacteria | 2124 |
| 869 | Ga0495655_0054760 | 3300053083 | Bacteria | 1068 |
| 870 | Ga0495595_0000001 | 3300053084 | Bacteria | 495226 |
| 871 | Ga0495595_0004192 | 3300053084 | Bacteria | 5798 |
| 872 | Ga0495595_0070074 | 3300053084 | Bacteria | 1656 |
| 873 | Ga0495595_0142576 | 3300053084 | Bacteria | 1176 |
| 874 | Ga0495619_0000015 | 3300053085 | Bacteria | 252787 |
| 875 | Ga0495619_0000020 | 3300053085 | Bacteria | 201556 |
| 876 | Ga0495619_0000046 | 3300053085 | Bacteria | 104451 |
| 877 | Ga0495619_0000626 | 3300053085 | Bacteria | 23392 |
| 878 | Ga0495619_0000749 | 3300053085 | Bacteria | 21180 |
| 879 | Ga0495619_0003303 | 3300053085 | Bacteria | 10425 |
| 880 | Ga0495619_0062854 | 3300053085 | Bacteria | 2472 |
| 881 | Ga0495619_0151253 | 3300053085 | Bacteria | 1601 |
| 882 | Ga0500566_0001971 | 3300053094 | Bacteria | 12098 |
| 883 | Ga0500641_0009337 | 3300053096 | Bacteria | 3527 |
| 884 | Ga0500650_0174227 | 3300053098 | Bacteria | 988 |
| 885 | Ga0500554_020941 | 3300053102 | Bacteria | 1805 |
| 886 | Ga0500556_0000372 | 3300053104 | Bacteria | 32618 |
| 887 | Ga0500595_028754 | 3300053119 | Bacteria | 1893 |
| 888 | Ga0500614_000039 | 3300053123 | Bacteria | 28194 |
| 889 | Ga0500628_033660 | 3300053129 | Bacteria | 1128 |
| 890 | Ga0500616_0009143 | 3300053153 | Bacteria | 6053 |
| 891 | Ga0500616_0013344 | 3300053153 | Bacteria | 4774 |
| 892 | Ga0501084_0048779 | 3300054114 | Bacteria | 3544 |
| 893 | Ga0501084_0142773 | 3300054114 | Bacteria | 2016 |
| 894 | Ga0501084_0629911 | 3300054114 | Bacteria | 906 |
| 895 | Ga0501082_0004892 | 3300060353 | Bacteria | 11685 |
| 896 | Ga0501082_0027284 | 3300060353 | Bacteria | 4917 |
| 897 | Ga0501082_0065863 | 3300060353 | Bacteria | 3120 |
| 898 | Ga0501082_0345949 | 3300060353 | Bacteria | 1296 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046491 | Ga0495584_0328296 | Ga0495584_0328296_170_757 | 177 |
| 2 | 3300046691 | Ga0495670_0364273 | Ga0495670_0364273_20_607 | 177 |
| 3 | 3300048903 | Ga0496100_0466239 | Ga0496100_0466239_13_582 | 179 |
| 4 | 3300050515 | nmdc:mga0a205_1040650_c1 | nmdc:mga0a205_1040650_c1_36_656 | 180 |
| 5 | 3300048929 | Ga0496126_0072478 | Ga0496126_0072478_2484_3053 | 181 |
| 6 | 3300045976 | Ga0466967_0344613 | Ga0466967_0344613_742_1413 | 184 |
| 7 | 3300049741 | Ga0501079_0216005 | Ga0501079_0216005_28_654 | 186 |
| 8 | 3300048910 | Ga0496107_0099380 | Ga0496107_0099380_16_618 | 190 |
| 9 | 3300049571 | Ga0501034_0081350 | Ga0501034_0081350_345_941 | 190 |
| 10 | 3300037466 | Ga0395898_0519810 | Ga0395898_0519810_299_1006 | 191 |
| 11 | 3300038443 | Ga0395901_1200185 | Ga0395901_1200185_13_615 | 192 |
| 12 | 3300048921 | Ga0496118_0111189 | Ga0496118_0111189_19_621 | 192 |
| 13 | 3300048928 | Ga0496125_0105470 | Ga0496125_0105470_19_621 | 192 |
| 14 | 3300048905 | Ga0496102_0704280 | Ga0496102_0704280_128_877 | 193 |
| 15 | 3300005334 | Ga0068869_100487912 | Ga0068869_1004879122 | 195 |
| 16 | 3300048912 | Ga0496109_0657775 | Ga0496109_0657775_357_974 | 196 |
| 17 | 3300048916 | Ga0496113_0059817 | Ga0496113_0059817_23_640 | 196 |
| 18 | 3300050495 | nmdc:mga04h51_289388_c1 | nmdc:mga04h51_289388_c1_11_643 | 196 |
| 19 | 3300050491 | nmdc:mga00v17_413931_c1 | nmdc:mga00v17_413931_c1_249_866 | 197 |
| 20 | 3300049582 | Ga0501048_0428411 | Ga0501048_0428411_109_819 | 199 |
| 21 | 3300003373 | JGI25407J50210_10001951 | JGI25407J50210_100019514 | 200 |
| 22 | 3300005614 | Ga0068856_100040557 | Ga0068856_1000405572 | 200 |
| 23 | 3300005981 | Ga0081538_10004074 | Ga0081538_100040748 | 200 |
| 24 | 3300009551 | Ga0105238_10472876 | Ga0105238_104728762 | 200 |
| 25 | 3300020081 | Ga0206354_10841384 | Ga0206354_108413841 | 200 |
| 26 | 3300048904 | Ga0496101_0434786 | Ga0496101_0434786_152_901 | 200 |
| 27 | 3300048905 | Ga0496102_0181834 | Ga0496102_0181834_328_1077 | 200 |
| 28 | 3300048908 | Ga0496105_0010380 | Ga0496105_0010380_4334_5083 | 200 |
| 29 | 3300048911 | Ga0496108_0001032 | Ga0496108_0001032_3749_4498 | 200 |
| 30 | 3300048912 | Ga0496109_0000385 | Ga0496109_0000385_21665_22414 | 200 |
| 31 | 3300048913 | Ga0496110_0015770 | Ga0496110_0015770_4920_5669 | 200 |
| 32 | 3300048914 | Ga0496111_0045340 | Ga0496111_0045340_1791_2540 | 200 |
| 33 | 3300048915 | Ga0496112_0007211 | Ga0496112_0007211_6897_7646 | 200 |
| 34 | 3300048916 | Ga0496113_0001303 | Ga0496113_0001303_4893_5642 | 200 |
| 35 | 3300026078 | Ga0207702_10367380 | Ga0207702_103673802 | 201 |
| 36 | 3300053153 | Ga0500616_0013344 | Ga0500616_0013344_2452_3210 | 201 |
| 37 | 3300005337 | Ga0070682_100041758 | Ga0070682_1000417584 | 202 |
| 38 | 3300005338 | Ga0068868_100310273 | Ga0068868_1003102731 | 202 |
| 39 | 3300005355 | Ga0070671_100075069 | Ga0070671_1000750693 | 202 |
| 40 | 3300005364 | Ga0070673_100031323 | Ga0070673_1000313234 | 202 |
| 41 | 3300005437 | Ga0070710_10077645 | Ga0070710_100776451 | 202 |
| 42 | 3300005439 | Ga0070711_100023702 | Ga0070711_1000237025 | 202 |
| 43 | 3300005441 | Ga0070700_100232743 | Ga0070700_1002327432 | 202 |
| 44 | 3300005459 | Ga0068867_100048424 | Ga0068867_1000484244 | 202 |
| 45 | 3300005468 | Ga0070707_100767385 | Ga0070707_1007673851 | 202 |
| 46 | 3300005544 | Ga0070686_100006320 | Ga0070686_1000063208 | 202 |
| 47 | 3300005548 | Ga0070665_100207262 | Ga0070665_1002072623 | 202 |
| 48 | 3300005549 | Ga0070704_100005253 | Ga0070704_1000052534 | 202 |
| 49 | 3300005842 | Ga0068858_100142936 | Ga0068858_1001429362 | 202 |
| 50 | 3300006038 | Ga0075365_10000307 | Ga0075365_100003073 | 202 |
| 51 | 3300006173 | Ga0070716_100089913 | Ga0070716_1000899132 | 202 |
| 52 | 3300006175 | Ga0070712_100003967 | Ga0070712_1000039676 | 202 |
| 53 | 3300006178 | Ga0075367_10218999 | Ga0075367_102189992 | 202 |
| 54 | 3300006358 | Ga0068871_100900107 | Ga0068871_1009001072 | 202 |
| 55 | 3300009098 | Ga0105245_10005617 | Ga0105245_100056175 | 202 |
| 56 | 3300009177 | Ga0105248_10053950 | Ga0105248_100539505 | 202 |
| 57 | 3300009545 | Ga0105237_10602770 | Ga0105237_106027702 | 202 |
| 58 | 3300010375 | Ga0105239_10481126 | Ga0105239_104811262 | 202 |
| 59 | 3300013296 | Ga0157374_10645656 | Ga0157374_106456562 | 202 |
| 60 | 3300013297 | Ga0157378_10051856 | Ga0157378_100518564 | 202 |
| 61 | 3300025915 | Ga0207693_10002071 | Ga0207693_100020718 | 202 |
| 62 | 3300025916 | Ga0207663_10013387 | Ga0207663_100133875 | 202 |
| 63 | 3300025927 | Ga0207687_10007909 | Ga0207687_100079094 | 202 |
| 64 | 3300025931 | Ga0207644_10092831 | Ga0207644_100928313 | 202 |
| 65 | 3300025934 | Ga0207686_10049883 | Ga0207686_100498831 | 202 |
| 66 | 3300025939 | Ga0207665_10111064 | Ga0207665_101110642 | 202 |
| 67 | 3300025941 | Ga0207711_10243172 | Ga0207711_102431722 | 202 |
| 68 | 3300026023 | Ga0207677_10137623 | Ga0207677_101376233 | 202 |
| 69 | 3300026035 | Ga0207703_10124069 | Ga0207703_101240692 | 202 |
| 70 | 3300026075 | Ga0207708_10376245 | Ga0207708_103762452 | 202 |
| 71 | 3300026089 | Ga0207648_10182069 | Ga0207648_101820692 | 202 |
| 72 | 3300041451 | Ga0451791_1493391 | Ga0451791_1493391_148_906 | 202 |
| 73 | 3300046455 | Ga0495603_0011655 | Ga0495603_0011655_276_977 | 202 |
| 74 | 3300046473 | Ga0495582_0014026 | Ga0495582_0014026_2605_3306 | 202 |
| 75 | 3300048903 | Ga0496100_0010310 | Ga0496100_0010310_325_1026 | 202 |
| 76 | 3300048904 | Ga0496101_0020700 | Ga0496101_0020700_2440_3141 | 202 |
| 77 | 3300048905 | Ga0496102_0004436 | Ga0496102_0004436_5811_6512 | 202 |
| 78 | 3300048906 | Ga0496103_0008154 | Ga0496103_0008154_4359_5060 | 202 |
| 79 | 3300048907 | Ga0496104_0080749 | Ga0496104_0080749_2119_2820 | 202 |
| 80 | 3300048908 | Ga0496105_0017248 | Ga0496105_0017248_4714_5415 | 202 |
| 81 | 3300048909 | Ga0496106_0019334 | Ga0496106_0019334_1000_1701 | 202 |
| 82 | 3300048911 | Ga0496108_0029103 | Ga0496108_0029103_2744_3445 | 202 |
| 83 | 3300048912 | Ga0496109_0052036 | Ga0496109_0052036_2553_3254 | 202 |
| 84 | 3300048913 | Ga0496110_0116576 | Ga0496110_0116576_898_1599 | 202 |
| 85 | 3300048914 | Ga0496111_0059397 | Ga0496111_0059397_1573_2274 | 202 |
| 86 | 3300048915 | Ga0496112_0068735 | Ga0496112_0068735_848_1549 | 202 |
| 87 | 3300048917 | Ga0496114_0007417 | Ga0496114_0007417_7633_8334 | 202 |
| 88 | 3300048918 | Ga0496115_0006044 | Ga0496115_0006044_6848_7549 | 202 |
| 89 | 3300048924 | Ga0496121_0030447 | Ga0496121_0030447_1988_2743 | 202 |
| 90 | 3300050491 | nmdc:mga00v17_485167_c1 | nmdc:mga00v17_485167_c1_120_791 | 202 |
| 91 | 3300050492 | nmdc:mga0yw44_231_c1 | nmdc:mga0yw44_231_c1_12230_12931 | 202 |
| 92 | 3300050494 | nmdc:mga06z11_204999_c1 | nmdc:mga06z11_204999_c1_343_1092 | 202 |
| 93 | 3300037418 | Ga0395900_0037958 | Ga0395900_0037958_2444_3145 | 203 |
| 94 | 3300037466 | Ga0395898_0002611 | Ga0395898_0002611_4390_5091 | 203 |
| 95 | 3300037471 | Ga0395905_0095615 | Ga0395905_0095615_198_899 | 203 |
| 96 | 3300038443 | Ga0395901_0098579 | Ga0395901_0098579_1844_2545 | 203 |
| 97 | 3300048911 | Ga0496108_0631675 | Ga0496108_0631675_37_837 | 203 |
| 98 | 3300048915 | Ga0496112_0010040 | Ga0496112_0010040_5377_6177 | 203 |
| 99 | 3300005329 | Ga0070683_100342518 | Ga0070683_1003425182 | 204 |
| 100 | 3300025944 | Ga0207661_10323741 | Ga0207661_103237412 | 204 |
| 101 | 3300031548 | Ga0307408_100107200 | Ga0307408_1001072003 | 204 |
| 102 | 3300031824 | Ga0307413_10100971 | Ga0307413_101009713 | 204 |
| 103 | 3300031852 | Ga0307410_10213171 | Ga0307410_102131712 | 204 |
| 104 | 3300046471 | Ga0495650_0000049 | Ga0495650_0000049_72760_73518 | 204 |
| 105 | 3300004799 | Ga0058863_10004115 | Ga0058863_100041151 | 205 |
| 106 | 3300031901 | Ga0307406_10074772 | Ga0307406_100747722 | 205 |
| 107 | 3300031903 | Ga0307407_10103790 | Ga0307407_101037902 | 205 |
| 108 | 3300031995 | Ga0307409_100006101 | Ga0307409_1000061013 | 205 |
| 109 | 3300032002 | Ga0307416_100080867 | Ga0307416_1000808673 | 205 |
| 110 | 3300005981 | Ga0081538_10054595 | Ga0081538_100545953 | 206 |
| 111 | 3300049584 | Ga0501068_0187098 | Ga0501068_0187098_342_1094 | 207 |
| 112 | 3300026116 | Ga0207674_10229232 | Ga0207674_102292322 | 208 |
| 113 | 3300044735 | Ga0466968_0099173 | Ga0466968_0099173_162_896 | 208 |
| 114 | 3300006847 | Ga0075431_100027253 | Ga0075431_1000272534 | 209 |
| 115 | 3300011119 | Ga0105246_10129262 | Ga0105246_101292623 | 209 |
| 116 | 3300025933 | Ga0207706_10515013 | Ga0207706_105150131 | 209 |
| 117 | 3300037471 | Ga0395905_0424899 | Ga0395905_0424899_56_766 | 209 |
| 118 | 3300041458 | Ga0451798_0455538 | Ga0451798_0455538_274_1008 | 209 |
| 119 | 3300046455 | Ga0495603_0110010 | Ga0495603_0110010_721_1422 | 209 |
| 120 | 3300050509 | nmdc:mga0qj67_4318_c1 | nmdc:mga0qj67_4318_c1_463_1176 | 209 |
| 121 | 3300050510 | nmdc:mga06r32_21838_c1 | nmdc:mga06r32_21838_c1_140_853 | 209 |
| 122 | 3300031731 | Ga0307405_10135434 | Ga0307405_101354342 | 210 |
| 123 | 3300031852 | Ga0307410_10050454 | Ga0307410_100504543 | 210 |
| 124 | 3300031911 | Ga0307412_10160170 | Ga0307412_101601702 | 210 |
| 125 | 3300031995 | Ga0307409_100259625 | Ga0307409_1002596251 | 210 |
| 126 | 3300032126 | Ga0307415_100058664 | Ga0307415_1000586642 | 210 |
| 127 | 3300005577 | Ga0068857_100329172 | Ga0068857_1003291722 | 211 |
| 128 | 3300009098 | Ga0105245_10045611 | Ga0105245_100456113 | 211 |
| 129 | 3300044901 | Ga0466960_0014374 | Ga0466960_0014374_365_1099 | 211 |
| 130 | 3300048907 | Ga0496104_0016537 | Ga0496104_0016537_2906_3640 | 211 |
| 131 | 3300048911 | Ga0496108_0615011 | Ga0496108_0615011_14_748 | 211 |
| 132 | 3300048912 | Ga0496109_0011389 | Ga0496109_0011389_132_866 | 211 |
| 133 | 3300048912 | Ga0496109_0240672 | Ga0496109_0240672_544_1278 | 211 |
| 134 | 3300048912 | Ga0496109_0424952 | Ga0496109_0424952_259_993 | 211 |
| 135 | 3300048915 | Ga0496112_0003642 | Ga0496112_0003642_4434_5168 | 211 |
| 136 | 3300048916 | Ga0496113_0011846 | Ga0496113_0011846_1645_2379 | 211 |
| 137 | 3300048917 | Ga0496114_0322108 | Ga0496114_0322108_323_1057 | 211 |
| 138 | 3300005364 | Ga0070673_100307752 | Ga0070673_1003077522 | 212 |
| 139 | 3300005466 | Ga0070685_10255467 | Ga0070685_102554671 | 212 |
| 140 | 3300005543 | Ga0070672_100000129 | Ga0070672_10000012912 | 212 |
| 141 | 3300005983 | Ga0081540_1052162 | Ga0081540_10521622 | 212 |
| 142 | 3300025940 | Ga0207691_10000062 | Ga0207691_1000006232 | 212 |
| 143 | 3300025960 | Ga0207651_10251754 | Ga0207651_102517542 | 212 |
| 144 | 3300028380 | Ga0268265_10989870 | Ga0268265_109898702 | 212 |
| 145 | 3300045976 | Ga0466967_0310859 | Ga0466967_0310859_701_1459 | 212 |
| 146 | 3300046689 | Ga0495613_0000159 | Ga0495613_0000159_41563_42264 | 212 |
| 147 | 3300050508 | nmdc:mga09592_354075_c1 | nmdc:mga09592_354075_c1_267_980 | 212 |
| 148 | 3300001977 | JGI24746J21847_1003604 | JGI24746J21847_10036043 | 213 |
| 149 | 3300005339 | Ga0070660_100428626 | Ga0070660_1004286262 | 213 |
| 150 | 3300005347 | Ga0070668_100002556 | Ga0070668_1000025568 | 213 |
| 151 | 3300005356 | Ga0070674_100000003 | Ga0070674_100000003260 | 213 |
| 152 | 3300005544 | Ga0070686_100305834 | Ga0070686_1003058342 | 213 |
| 153 | 3300005548 | Ga0070665_100056914 | Ga0070665_1000569143 | 213 |
| 154 | 3300005718 | Ga0068866_10000002 | Ga0068866_10000002147 | 213 |
| 155 | 3300005842 | Ga0068858_100428298 | Ga0068858_1004282982 | 213 |
| 156 | 3300005843 | Ga0068860_100057058 | Ga0068860_1000570585 | 213 |
| 157 | 3300005844 | Ga0068862_100005926 | Ga0068862_1000059266 | 213 |
| 158 | 3300005937 | Ga0081455_10024603 | Ga0081455_100246035 | 213 |
| 159 | 3300009553 | Ga0105249_10008240 | Ga0105249_100082408 | 213 |
| 160 | 3300014968 | Ga0157379_10027803 | Ga0157379_100278033 | 213 |
| 161 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001462 | 213 |
| 162 | 3300025899 | Ga0207642_10000003 | Ga0207642_10000003462 | 213 |
| 163 | 3300025921 | Ga0207652_10382933 | Ga0207652_103829332 | 213 |
| 164 | 3300025937 | Ga0207669_10000024 | Ga0207669_1000002442 | 213 |
| 165 | 3300025961 | Ga0207712_10011344 | Ga0207712_100113447 | 213 |
| 166 | 3300025972 | Ga0207668_10007542 | Ga0207668_100075424 | 213 |
| 167 | 3300026035 | Ga0207703_10652941 | Ga0207703_106529412 | 213 |
| 168 | 3300028379 | Ga0268266_10961281 | Ga0268266_109612811 | 213 |
| 169 | 3300028380 | Ga0268265_10008034 | Ga0268265_100080348 | 213 |
| 170 | 3300028381 | Ga0268264_10032479 | Ga0268264_100324793 | 213 |
| 171 | 3300045976 | Ga0466967_0284580 | Ga0466967_0284580_549_1283 | 213 |
| 172 | 3300046491 | Ga0495584_0082444 | Ga0495584_0082444_90_842 | 213 |
| 173 | 3300046539 | Ga0495621_0056296 | Ga0495621_0056296_185_937 | 213 |
| 174 | 3300046615 | Ga0495656_0023676 | Ga0495656_0023676_292_1044 | 213 |
| 175 | 3300048913 | Ga0496110_0178161 | Ga0496110_0178161_1147_1848 | 213 |
| 176 | 3300049575 | Ga0501039_0067117 | Ga0501039_0067117_448_1149 | 213 |
| 177 | 3300049576 | Ga0501040_0095431 | Ga0501040_0095431_320_1021 | 213 |
| 178 | 3300049578 | Ga0501042_0264273 | Ga0501042_0264273_262_963 | 213 |
| 179 | 3300049582 | Ga0501048_0171015 | Ga0501048_0171015_41_742 | 213 |
| 180 | 3300053078 | Ga0495612_0009103 | Ga0495612_0009103_2973_3674 | 213 |
| 181 | 3300060353 | Ga0501082_0345949 | Ga0501082_0345949_57_758 | 213 |
| 182 | 3300003373 | JGI25407J50210_10028901 | JGI25407J50210_100289012 | 214 |
| 183 | 3300005937 | Ga0081455_10244128 | Ga0081455_102441282 | 214 |
| 184 | 3300005981 | Ga0081538_10000027 | Ga0081538_100000278 | 214 |
| 185 | 3300006846 | Ga0075430_100082115 | Ga0075430_1000821153 | 214 |
| 186 | 3300006847 | Ga0075431_100039934 | Ga0075431_1000399345 | 214 |
| 187 | 3300009147 | Ga0114129_10704543 | Ga0114129_107045432 | 214 |
| 188 | 3300026095 | Ga0207676_10621381 | Ga0207676_106213811 | 214 |
| 189 | 3300047673 | Ga0495593_0083840 | Ga0495593_0083840_574_1275 | 214 |
| 190 | 3300048909 | Ga0496106_0000052 | Ga0496106_0000052_37234_37935 | 214 |
| 191 | 3300050509 | nmdc:mga0qj67_32858_c1 | nmdc:mga0qj67_32858_c1_1116_1817 | 214 |
| 192 | 3300053085 | Ga0495619_0062854 | Ga0495619_0062854_339_1040 | 214 |
| 193 | 3300005985 | Ga0081539_10059310 | Ga0081539_100593101 | 215 |
| 194 | 3300026078 | Ga0207702_10955698 | Ga0207702_109556981 | 215 |
| 195 | 3300032126 | Ga0307415_100369425 | Ga0307415_1003694252 | 215 |
| 196 | 3300044658 | Ga0466972_0110165 | Ga0466972_0110165_373_1098 | 215 |
| 197 | 3300044901 | Ga0466960_0238999 | Ga0466960_0238999_13_747 | 215 |
| 198 | 3300049578 | Ga0501042_0358094 | Ga0501042_0358094_178_879 | 215 |
| 199 | 3300005338 | Ga0068868_100357670 | Ga0068868_1003576701 | 216 |
| 200 | 3300005614 | Ga0068856_100536155 | Ga0068856_1005361552 | 216 |
| 201 | 3300009098 | Ga0105245_10855879 | Ga0105245_108558792 | 216 |
| 202 | 3300025927 | Ga0207687_10560356 | Ga0207687_105603562 | 216 |
| 203 | 3300025936 | Ga0207670_10212522 | Ga0207670_102125222 | 216 |
| 204 | 3300026023 | Ga0207677_10343730 | Ga0207677_103437302 | 216 |
| 205 | 3300026078 | Ga0207702_10427999 | Ga0207702_104279992 | 216 |
| 206 | 3300037466 | Ga0395898_0631366 | Ga0395898_0631366_90_803 | 216 |
| 207 | 3300046537 | Ga0495598_0000768 | Ga0495598_0000768_4523_5221 | 216 |
| 208 | 3300048911 | Ga0496108_0300905 | Ga0496108_0300905_456_1226 | 216 |
| 209 | 3300049574 | Ga0501038_0189798 | Ga0501038_0189798_316_1071 | 216 |
| 210 | 3300049578 | Ga0501042_0178739 | Ga0501042_0178739_214_915 | 216 |
| 211 | 3300049586 | Ga0501070_0228671 | Ga0501070_0228671_19_720 | 216 |
| 212 | 3300002459 | JGI24751J29686_10022641 | JGI24751J29686_100226412 | 217 |
| 213 | 3300005338 | Ga0068868_100121841 | Ga0068868_1001218413 | 217 |
| 214 | 3300006038 | Ga0075365_10143142 | Ga0075365_101431422 | 217 |
| 215 | 3300006042 | Ga0075368_10024362 | Ga0075368_100243623 | 217 |
| 216 | 3300009551 | Ga0105238_10001238 | Ga0105238_1000123811 | 217 |
| 217 | 3300025924 | Ga0207694_10000067 | Ga0207694_1000006747 | 217 |
| 218 | 3300026023 | Ga0207677_10000429 | Ga0207677_1000042913 | 217 |
| 219 | 3300044901 | Ga0466960_0005260 | Ga0466960_0005260_1030_1815 | 217 |
| 220 | 3300046477 | Ga0495664_0000051 | Ga0495664_0000051_52100_52834 | 217 |
| 221 | 3300046500 | Ga0495596_0081313 | Ga0495596_0081313_505_1206 | 217 |
| 222 | 3300048905 | Ga0496102_0000087 | Ga0496102_0000087_118319_119053 | 217 |
| 223 | 3300048906 | Ga0496103_0000016 | Ga0496103_0000016_109374_110108 | 217 |
| 224 | 3300050492 | nmdc:mga0yw44_112690_c1 | nmdc:mga0yw44_112690_c1_834_1550 | 217 |
| 225 | 3300050494 | nmdc:mga06z11_127962_c1 | nmdc:mga06z11_127962_c1_308_1024 | 217 |
| 226 | 3300005334 | Ga0068869_100094188 | Ga0068869_1000941882 | 218 |
| 227 | 3300006175 | Ga0070712_100001399 | Ga0070712_10000139917 | 218 |
| 228 | 3300006852 | Ga0075433_10034643 | Ga0075433_100346432 | 218 |
| 229 | 3300006871 | Ga0075434_100004732 | Ga0075434_1000047324 | 218 |
| 230 | 3300007076 | Ga0075435_100006389 | Ga0075435_1000063893 | 218 |
| 231 | 3300009094 | Ga0111539_10727435 | Ga0111539_107274352 | 218 |
| 232 | 3300009098 | Ga0105245_10286282 | Ga0105245_102862822 | 218 |
| 233 | 3300009147 | Ga0114129_10003258 | Ga0114129_1000325817 | 218 |
| 234 | 3300009553 | Ga0105249_11088247 | Ga0105249_110882471 | 218 |
| 235 | 3300025915 | Ga0207693_10002610 | Ga0207693_1000261017 | 218 |
| 236 | 3300025927 | Ga0207687_10126338 | Ga0207687_101263382 | 218 |
| 237 | 3300025940 | Ga0207691_10134861 | Ga0207691_101348613 | 218 |
| 238 | 3300048912 | Ga0496109_0319497 | Ga0496109_0319497_690_1394 | 218 |
| 239 | 3300048913 | Ga0496110_0190242 | Ga0496110_0190242_963_1667 | 218 |
| 240 | 3300048915 | Ga0496112_0613706 | Ga0496112_0613706_263_967 | 218 |
| 241 | 3300048917 | Ga0496114_0305978 | Ga0496114_0305978_21_770 | 218 |
| 242 | 3300049591 | Ga0501075_0000598 | Ga0501075_0000598_7337_8038 | 218 |
| 243 | 3300050507 | nmdc:mga05p37_7822_c1 | nmdc:mga05p37_7822_c1_9016_9720 | 218 |
| 244 | 3300050512 | nmdc:mga0n895_4098_c1 | nmdc:mga0n895_4098_c1_9397_10101 | 218 |
| 245 | 3300050515 | nmdc:mga0a205_30889_c1 | nmdc:mga0a205_30889_c1_2359_3063 | 218 |
| 246 | 3300005329 | Ga0070683_100000367 | Ga0070683_10000036716 | 219 |
| 247 | 3300005329 | Ga0070683_100001266 | Ga0070683_10000126610 | 219 |
| 248 | 3300005335 | Ga0070666_10013143 | Ga0070666_100131432 | 219 |
| 249 | 3300005338 | Ga0068868_100005977 | Ga0068868_10000597711 | 219 |
| 250 | 3300005341 | Ga0070691_10223141 | Ga0070691_102231411 | 219 |
| 251 | 3300005344 | Ga0070661_100000026 | Ga0070661_100000026112 | 219 |
| 252 | 3300005354 | Ga0070675_100000015 | Ga0070675_10000001549 | 219 |
| 253 | 3300005365 | Ga0070688_100000264 | Ga0070688_10000026428 | 219 |
| 254 | 3300005456 | Ga0070678_100011408 | Ga0070678_1000114082 | 219 |
| 255 | 3300005466 | Ga0070685_10000367 | Ga0070685_100003672 | 219 |
| 256 | 3300005535 | Ga0070684_100286941 | Ga0070684_1002869412 | 219 |
| 257 | 3300005548 | Ga0070665_100001016 | Ga0070665_1000010166 | 219 |
| 258 | 3300005614 | Ga0068856_100000186 | Ga0068856_10000018616 | 219 |
| 259 | 3300005834 | Ga0068851_10002068 | Ga0068851_1000206811 | 219 |
| 260 | 3300006028 | Ga0070717_10582793 | Ga0070717_105827931 | 219 |
| 261 | 3300006038 | Ga0075365_10139112 | Ga0075365_101391122 | 219 |
| 262 | 3300009101 | Ga0105247_10488801 | Ga0105247_104888011 | 219 |
| 263 | 3300009177 | Ga0105248_10214980 | Ga0105248_102149803 | 219 |
| 264 | 3300013102 | Ga0157371_10001481 | Ga0157371_1000148110 | 219 |
| 265 | 3300013297 | Ga0157378_10007402 | Ga0157378_100074022 | 219 |
| 266 | 3300022467 | Ga0224712_10011362 | Ga0224712_100113623 | 219 |
| 267 | 3300025903 | Ga0207680_10007643 | Ga0207680_100076436 | 219 |
| 268 | 3300025920 | Ga0207649_10000025 | Ga0207649_10000025123 | 219 |
| 269 | 3300025926 | Ga0207659_10000032 | Ga0207659_1000003228 | 219 |
| 270 | 3300025944 | Ga0207661_10000064 | Ga0207661_1000006416 | 219 |
| 271 | 3300025944 | Ga0207661_10000086 | Ga0207661_1000008622 | 219 |
| 272 | 3300026023 | Ga0207677_10029377 | Ga0207677_100293773 | 219 |
| 273 | 3300026078 | Ga0207702_10000134 | Ga0207702_1000013424 | 219 |
| 274 | 3300026121 | Ga0207683_10019153 | Ga0207683_100191533 | 219 |
| 275 | 3300028379 | Ga0268266_10000985 | Ga0268266_1000098536 | 219 |
| 276 | 3300044842 | Ga0466957_0016840 | Ga0466957_0016840_733_1434 | 219 |
| 277 | 3300046459 | Ga0495629_0000014 | Ga0495629_0000014_51569_52270 | 219 |
| 278 | 3300046507 | Ga0495606_0000045 | Ga0495606_0000045_143607_144308 | 219 |
| 279 | 3300046512 | Ga0495610_0190712 | Ga0495610_0190712_76_777 | 219 |
| 280 | 3300046517 | Ga0495630_0000007 | Ga0495630_0000007_337351_338052 | 219 |
| 281 | 3300046674 | Ga0495588_0000217 | Ga0495588_0000217_52813_53514 | 219 |
| 282 | 3300046690 | Ga0495624_0146803 | Ga0495624_0146803_320_1021 | 219 |
| 283 | 3300048912 | Ga0496109_0000146 | Ga0496109_0000146_57661_58362 | 219 |
| 284 | 3300048914 | Ga0496111_0061425 | Ga0496111_0061425_1004_1705 | 219 |
| 285 | 3300048917 | Ga0496114_0100129 | Ga0496114_0100129_679_1380 | 219 |
| 286 | 3300049656 | Ga0501209_052068 | Ga0501209_052068_173_883 | 219 |
| 287 | 3300053078 | Ga0495612_0000403 | Ga0495612_0000403_11845_12546 | 219 |
| 288 | 3300005439 | Ga0070711_100190771 | Ga0070711_1001907712 | 220 |
| 289 | 3300005439 | Ga0070711_100341819 | Ga0070711_1003418191 | 220 |
| 290 | 3300025915 | Ga0207693_10229939 | Ga0207693_102299392 | 220 |
| 291 | 3300025915 | Ga0207693_10243461 | Ga0207693_102434612 | 220 |
| 292 | 3300005937 | Ga0081455_10078445 | Ga0081455_100784452 | 221 |
| 293 | 3300005981 | Ga0081538_10008139 | Ga0081538_1000813913 | 221 |
| 294 | 3300005981 | Ga0081538_10022193 | Ga0081538_100221933 | 221 |
| 295 | 3300042016 | Ga0439463_054919 | Ga0439463_054919_58_774 | 221 |
| 296 | 3300042437 | Ga0439444_0003839 | Ga0439444_0003839_318_1034 | 221 |
| 297 | 3300042461 | Ga0439460_0022516 | Ga0439460_0022516_235_951 | 221 |
| 298 | 3300046615 | Ga0495656_0127748 | Ga0495656_0127748_74_793 | 221 |
| 299 | 3300046794 | Ga0495589_0066440 | Ga0495589_0066440_297_1016 | 221 |
| 300 | 3300048091 | Ga0495626_0150215 | Ga0495626_0150215_56_772 | 221 |
| 301 | 3300042005 | Ga0439448_0071202 | Ga0439448_0071202_365_1090 | 222 |
| 302 | 3300042008 | Ga0439450_010931 | Ga0439450_010931_293_1018 | 222 |
| 303 | 3300042012 | Ga0439455_0032307 | Ga0439455_0032307_413_1138 | 222 |
| 304 | 3300042118 | Ga0450914_007778 | Ga0450914_007778_126_851 | 222 |
| 305 | 3300042439 | Ga0439464_0017246 | Ga0439464_0017246_827_1552 | 222 |
| 306 | 3300044901 | Ga0466960_0081905 | Ga0466960_0081905_456_1226 | 222 |
| 307 | 3300045976 | Ga0466967_0104298 | Ga0466967_0104298_287_1057 | 222 |
| 308 | 3300053102 | Ga0500554_020941 | Ga0500554_020941_102_803 | 222 |
| 309 | 3300000549 | LJQas_1001648 | LJQas_10016482 | 223 |
| 310 | 3300005549 | Ga0070704_100262978 | Ga0070704_1002629782 | 223 |
| 311 | 3300005840 | Ga0068870_10074052 | Ga0068870_100740523 | 223 |
| 312 | 3300005937 | Ga0081455_10087095 | Ga0081455_100870952 | 223 |
| 313 | 3300006852 | Ga0075433_10000058 | Ga0075433_1000005845 | 223 |
| 314 | 3300009094 | Ga0111539_10651362 | Ga0111539_106513622 | 223 |
| 315 | 3300009147 | Ga0114129_10412604 | Ga0114129_104126041 | 223 |
| 316 | 3300025981 | Ga0207640_10047658 | Ga0207640_100476582 | 223 |
| 317 | 3300032002 | Ga0307416_100158487 | Ga0307416_1001584872 | 223 |
| 318 | 3300046461 | Ga0495641_0001824 | Ga0495641_0001824_14785_15486 | 223 |
| 319 | 3300046500 | Ga0495596_0091561 | Ga0495596_0091561_213_914 | 223 |
| 320 | 3300046513 | Ga0495616_0066582 | Ga0495616_0066582_153_854 | 223 |
| 321 | 3300046518 | Ga0495631_0019394 | Ga0495631_0019394_2160_2861 | 223 |
| 322 | 3300046523 | Ga0495644_0012275 | Ga0495644_0012275_2288_2989 | 223 |
| 323 | 3300046615 | Ga0495656_0027084 | Ga0495656_0027084_1012_1713 | 223 |
| 324 | 3300046683 | Ga0495658_0015152 | Ga0495658_0015152_1016_1717 | 223 |
| 325 | 3300047321 | Ga0495676_0183690 | Ga0495676_0183690_149_850 | 223 |
| 326 | 3300047469 | Ga0495673_0007712 | Ga0495673_0007712_3762_4463 | 223 |
| 327 | 3300047470 | Ga0495681_0032267 | Ga0495681_0032267_320_1021 | 223 |
| 328 | 3300047472 | Ga0495686_0000003 | Ga0495686_0000003_802856_803557 | 223 |
| 329 | 3300047472 | Ga0495686_0004470 | Ga0495686_0004470_5598_6299 | 223 |
| 330 | 3300047472 | Ga0495686_0011364 | Ga0495686_0011364_4135_4836 | 223 |
| 331 | 3300048912 | Ga0496109_0066111 | Ga0496109_0066111_1642_2343 | 223 |
| 332 | 3300048913 | Ga0496110_0042351 | Ga0496110_0042351_1590_2291 | 223 |
| 333 | 3300048915 | Ga0496112_0171160 | Ga0496112_0171160_166_867 | 223 |
| 334 | 3300049588 | Ga0501072_0135702 | Ga0501072_0135702_672_1388 | 223 |
| 335 | 3300050515 | nmdc:mga0a205_9_c2 | nmdc:mga0a205_9_c2_4874_5575 | 223 |
| 336 | 3300053104 | Ga0500556_0000372 | Ga0500556_0000372_19884_20618 | 223 |
| 337 | 3300053129 | Ga0500628_033660 | Ga0500628_033660_15_716 | 223 |
| 338 | 3300053153 | Ga0500616_0009143 | Ga0500616_0009143_112_846 | 223 |
| 339 | 3300002074 | JGI24748J21848_1000204 | JGI24748J21848_10002042 | 224 |
| 340 | 3300002239 | JGI24034J26672_10000150 | JGI24034J26672_1000015013 | 224 |
| 341 | 3300005327 | Ga0070658_10317213 | Ga0070658_103172132 | 224 |
| 342 | 3300005327 | Ga0070658_10442123 | Ga0070658_104421231 | 224 |
| 343 | 3300005329 | Ga0070683_100201168 | Ga0070683_1002011682 | 224 |
| 344 | 3300005335 | Ga0070666_10044022 | Ga0070666_100440223 | 224 |
| 345 | 3300005335 | Ga0070666_10125376 | Ga0070666_101253762 | 224 |
| 346 | 3300005335 | Ga0070666_10375773 | Ga0070666_103757731 | 224 |
| 347 | 3300005339 | Ga0070660_100091353 | Ga0070660_1000913533 | 224 |
| 348 | 3300005340 | Ga0070689_100356816 | Ga0070689_1003568162 | 224 |
| 349 | 3300005343 | Ga0070687_100050604 | Ga0070687_1000506043 | 224 |
| 350 | 3300005345 | Ga0070692_10081912 | Ga0070692_100819121 | 224 |
| 351 | 3300005345 | Ga0070692_10348825 | Ga0070692_103488251 | 224 |
| 352 | 3300005365 | Ga0070688_100001621 | Ga0070688_10000162112 | 224 |
| 353 | 3300005365 | Ga0070688_100084682 | Ga0070688_1000846823 | 224 |
| 354 | 3300005366 | Ga0070659_100066737 | Ga0070659_1000667372 | 224 |
| 355 | 3300005367 | Ga0070667_100105361 | Ga0070667_1001053613 | 224 |
| 356 | 3300005436 | Ga0070713_100000014 | Ga0070713_10000001450 | 224 |
| 357 | 3300005436 | Ga0070713_100191375 | Ga0070713_1001913752 | 224 |
| 358 | 3300005439 | Ga0070711_100018181 | Ga0070711_1000181813 | 224 |
| 359 | 3300005466 | Ga0070685_10000318 | Ga0070685_100003182 | 224 |
| 360 | 3300005466 | Ga0070685_10148611 | Ga0070685_101486112 | 224 |
| 361 | 3300005530 | Ga0070679_100111875 | Ga0070679_1001118753 | 224 |
| 362 | 3300005539 | Ga0068853_100213023 | Ga0068853_1002130232 | 224 |
| 363 | 3300005545 | Ga0070695_100317649 | Ga0070695_1003176492 | 224 |
| 364 | 3300005548 | Ga0070665_100058921 | Ga0070665_1000589215 | 224 |
| 365 | 3300005548 | Ga0070665_100498869 | Ga0070665_1004988692 | 224 |
| 366 | 3300005564 | Ga0070664_100124553 | Ga0070664_1001245533 | 224 |
| 367 | 3300005614 | Ga0068856_100035899 | Ga0068856_1000358996 | 224 |
| 368 | 3300005616 | Ga0068852_100000013 | Ga0068852_10000001348 | 224 |
| 369 | 3300005616 | Ga0068852_100465595 | Ga0068852_1004655952 | 224 |
| 370 | 3300005718 | Ga0068866_10108405 | Ga0068866_101084052 | 224 |
| 371 | 3300005834 | Ga0068851_10000504 | Ga0068851_100005042 | 224 |
| 372 | 3300005937 | Ga0081455_10115990 | Ga0081455_101159902 | 224 |
| 373 | 3300005981 | Ga0081538_10028800 | Ga0081538_100288003 | 224 |
| 374 | 3300005983 | Ga0081540_1084450 | Ga0081540_10844502 | 224 |
| 375 | 3300005985 | Ga0081539_10000674 | Ga0081539_1000067459 | 224 |
| 376 | 3300006038 | Ga0075365_10317648 | Ga0075365_103176482 | 224 |
| 377 | 3300006058 | Ga0075432_10059704 | Ga0075432_100597042 | 224 |
| 378 | 3300006844 | Ga0075428_100159666 | Ga0075428_1001596662 | 224 |
| 379 | 3300006846 | Ga0075430_100054701 | Ga0075430_1000547012 | 224 |
| 380 | 3300006847 | Ga0075431_100002644 | Ga0075431_10000264417 | 224 |
| 381 | 3300006847 | Ga0075431_100009078 | Ga0075431_10000907810 | 224 |
| 382 | 3300006847 | Ga0075431_100570514 | Ga0075431_1005705141 | 224 |
| 383 | 3300006852 | Ga0075433_10128496 | Ga0075433_101284963 | 224 |
| 384 | 3300006880 | Ga0075429_100465033 | Ga0075429_1004650332 | 224 |
| 385 | 3300006881 | Ga0068865_100000001 | Ga0068865_100000001230 | 224 |
| 386 | 3300009093 | Ga0105240_10139224 | Ga0105240_101392242 | 224 |
| 387 | 3300009093 | Ga0105240_10349079 | Ga0105240_103490792 | 224 |
| 388 | 3300009093 | Ga0105240_10453049 | Ga0105240_104530492 | 224 |
| 389 | 3300009094 | Ga0111539_10005245 | Ga0111539_100052459 | 224 |
| 390 | 3300009094 | Ga0111539_10015210 | Ga0111539_100152106 | 224 |
| 391 | 3300009094 | Ga0111539_11369247 | Ga0111539_113692471 | 224 |
| 392 | 3300009098 | Ga0105245_10000045 | Ga0105245_1000004582 | 224 |
| 393 | 3300009147 | Ga0114129_10142177 | Ga0114129_101421773 | 224 |
| 394 | 3300009147 | Ga0114129_10572763 | Ga0114129_105727632 | 224 |
| 395 | 3300009148 | Ga0105243_10145553 | Ga0105243_101455532 | 224 |
| 396 | 3300009174 | Ga0105241_10153158 | Ga0105241_101531582 | 224 |
| 397 | 3300009174 | Ga0105241_10253210 | Ga0105241_102532101 | 224 |
| 398 | 3300009176 | Ga0105242_10400811 | Ga0105242_104008112 | 224 |
| 399 | 3300009177 | Ga0105248_10000089 | Ga0105248_1000008957 | 224 |
| 400 | 3300009545 | Ga0105237_10379347 | Ga0105237_103793471 | 224 |
| 401 | 3300009551 | Ga0105238_10132032 | Ga0105238_101320321 | 224 |
| 402 | 3300009553 | Ga0105249_10264829 | Ga0105249_102648293 | 224 |
| 403 | 3300013104 | Ga0157370_10061195 | Ga0157370_100611952 | 224 |
| 404 | 3300013105 | Ga0157369_10000037 | Ga0157369_1000003799 | 224 |
| 405 | 3300013307 | Ga0157372_10000064 | Ga0157372_1000006468 | 224 |
| 406 | 3300014325 | Ga0163163_10615823 | Ga0163163_106158232 | 224 |
| 407 | 3300014326 | Ga0157380_10000118 | Ga0157380_1000011810 | 224 |
| 408 | 3300014326 | Ga0157380_10000163 | Ga0157380_1000016313 | 224 |
| 409 | 3300014969 | Ga0157376_10134222 | Ga0157376_101342223 | 224 |
| 410 | 3300025899 | Ga0207642_10009299 | Ga0207642_100092992 | 224 |
| 411 | 3300025903 | Ga0207680_10066138 | Ga0207680_100661383 | 224 |
| 412 | 3300025903 | Ga0207680_10134296 | Ga0207680_101342962 | 224 |
| 413 | 3300025911 | Ga0207654_10075338 | Ga0207654_100753382 | 224 |
| 414 | 3300025913 | Ga0207695_10076324 | Ga0207695_100763244 | 224 |
| 415 | 3300025913 | Ga0207695_10249829 | Ga0207695_102498292 | 224 |
| 416 | 3300025914 | Ga0207671_10395457 | Ga0207671_103954571 | 224 |
| 417 | 3300025916 | Ga0207663_10033361 | Ga0207663_100333612 | 224 |
| 418 | 3300025919 | Ga0207657_10038267 | Ga0207657_100382672 | 224 |
| 419 | 3300025920 | Ga0207649_10343893 | Ga0207649_103438932 | 224 |
| 420 | 3300025921 | Ga0207652_10079126 | Ga0207652_100791263 | 224 |
| 421 | 3300025927 | Ga0207687_10000023 | Ga0207687_1000002382 | 224 |
| 422 | 3300025928 | Ga0207700_10000009 | Ga0207700_1000000977 | 224 |
| 423 | 3300025928 | Ga0207700_10078468 | Ga0207700_100784683 | 224 |
| 424 | 3300025932 | Ga0207690_10024415 | Ga0207690_100244153 | 224 |
| 425 | 3300025938 | Ga0207704_10000004 | Ga0207704_1000000417 | 224 |
| 426 | 3300025941 | Ga0207711_10000083 | Ga0207711_1000008357 | 224 |
| 427 | 3300025944 | Ga0207661_10091820 | Ga0207661_100918202 | 224 |
| 428 | 3300025944 | Ga0207661_10486172 | Ga0207661_104861722 | 224 |
| 429 | 3300025945 | Ga0207679_10014261 | Ga0207679_100142612 | 224 |
| 430 | 3300025945 | Ga0207679_10082159 | Ga0207679_100821592 | 224 |
| 431 | 3300025949 | Ga0207667_10690121 | Ga0207667_106901211 | 224 |
| 432 | 3300025986 | Ga0207658_10214169 | Ga0207658_102141692 | 224 |
| 433 | 3300026075 | Ga0207708_10211074 | Ga0207708_102110742 | 224 |
| 434 | 3300026075 | Ga0207708_10216904 | Ga0207708_102169042 | 224 |
| 435 | 3300026078 | Ga0207702_10010610 | Ga0207702_100106104 | 224 |
| 436 | 3300026078 | Ga0207702_10659340 | Ga0207702_106593402 | 224 |
| 437 | 3300026142 | Ga0207698_10000002 | Ga0207698_10000002315 | 224 |
| 438 | 3300027907 | Ga0207428_10152890 | Ga0207428_101528902 | 224 |
| 439 | 3300028379 | Ga0268266_10000748 | Ga0268266_1000074815 | 224 |
| 440 | 3300031824 | Ga0307413_10021380 | Ga0307413_100213803 | 224 |
| 441 | 3300031852 | Ga0307410_10034475 | Ga0307410_100344754 | 224 |
| 442 | 3300031903 | Ga0307407_10204315 | Ga0307407_102043152 | 224 |
| 443 | 3300031903 | Ga0307407_10608240 | Ga0307407_106082401 | 224 |
| 444 | 3300031995 | Ga0307409_100005794 | Ga0307409_1000057943 | 224 |
| 445 | 3300031995 | Ga0307409_100056297 | Ga0307409_1000562974 | 224 |
| 446 | 3300031995 | Ga0307409_100090221 | Ga0307409_1000902211 | 224 |
| 447 | 3300031995 | Ga0307409_100658524 | Ga0307409_1006585242 | 224 |
| 448 | 3300032002 | Ga0307416_100096347 | Ga0307416_1000963473 | 224 |
| 449 | 3300032002 | Ga0307416_100221361 | Ga0307416_1002213612 | 224 |
| 450 | 3300032002 | Ga0307416_100675122 | Ga0307416_1006751221 | 224 |
| 451 | 3300032126 | Ga0307415_100051745 | Ga0307415_1000517453 | 224 |
| 452 | 3300032126 | Ga0307415_100056531 | Ga0307415_1000565312 | 224 |
| 453 | 3300032126 | Ga0307415_100331673 | Ga0307415_1003316732 | 224 |
| 454 | 3300032126 | Ga0307415_100545849 | Ga0307415_1005458492 | 224 |
| 455 | 3300032126 | Ga0307415_100546724 | Ga0307415_1005467242 | 224 |
| 456 | 3300035115 | Ga0373941_0013194 | Ga0373941_0013194_1333_2034 | 224 |
| 457 | 3300035172 | Ga0373955_0179137 | Ga0373955_0179137_545_1246 | 224 |
| 458 | 3300037418 | Ga0395900_0013545 | Ga0395900_0013545_6275_6985 | 224 |
| 459 | 3300037466 | Ga0395898_0052768 | Ga0395898_0052768_1571_2305 | 224 |
| 460 | 3300037466 | Ga0395898_0054915 | Ga0395898_0054915_1385_2095 | 224 |
| 461 | 3300037466 | Ga0395898_0316397 | Ga0395898_0316397_546_1262 | 224 |
| 462 | 3300037471 | Ga0395905_0052194 | Ga0395905_0052194_1770_2480 | 224 |
| 463 | 3300037471 | Ga0395905_0116453 | Ga0395905_0116453_233_967 | 224 |
| 464 | 3300038443 | Ga0395901_0006182 | Ga0395901_0006182_10284_10994 | 224 |
| 465 | 3300038443 | Ga0395901_0027180 | Ga0395901_0027180_608_1342 | 224 |
| 466 | 3300039453 | Ga0436362_1063066 | Ga0436362_1063066_1097_1807 | 224 |
| 467 | 3300041459 | Ga0451800_1364888 | Ga0451800_1364888_29_763 | 224 |
| 468 | 3300041494 | Ga0451837_0621418 | Ga0451837_0621418_216_926 | 224 |
| 469 | 3300045836 | Ga0466958_0320949 | Ga0466958_0320949_36_737 | 224 |
| 470 | 3300045976 | Ga0466967_0000004 | Ga0466967_0000004_97656_98357 | 224 |
| 471 | 3300045976 | Ga0466967_0046359 | Ga0466967_0046359_1979_2689 | 224 |
| 472 | 3300045976 | Ga0466967_0088526 | Ga0466967_0088526_39_740 | 224 |
| 473 | 3300046454 | Ga0495592_0116807 | Ga0495592_0116807_23_724 | 224 |
| 474 | 3300046476 | Ga0495662_0003775 | Ga0495662_0003775_1794_2495 | 224 |
| 475 | 3300046511 | Ga0495608_0000001 | Ga0495608_0000001_88162_88863 | 224 |
| 476 | 3300046515 | Ga0495620_0000119 | Ga0495620_0000119_3481_4179 | 224 |
| 477 | 3300046516 | Ga0495628_0000070 | Ga0495628_0000070_11144_11845 | 224 |
| 478 | 3300046522 | Ga0495643_0096732 | Ga0495643_0096732_324_1034 | 224 |
| 479 | 3300046523 | Ga0495644_0000296 | Ga0495644_0000296_20621_21319 | 224 |
| 480 | 3300046529 | Ga0495652_0000066 | Ga0495652_0000066_2686_3387 | 224 |
| 481 | 3300046642 | Ga0495634_0028471 | Ga0495634_0028471_3024_3722 | 224 |
| 482 | 3300046660 | Ga0495625_0000020 | Ga0495625_0000020_158889_159590 | 224 |
| 483 | 3300046675 | Ga0495657_0000002 | Ga0495657_0000002_88842_89543 | 224 |
| 484 | 3300046675 | Ga0495657_0024794 | Ga0495657_0024794_2272_2973 | 224 |
| 485 | 3300046683 | Ga0495658_0030522 | Ga0495658_0030522_1409_2110 | 224 |
| 486 | 3300046689 | Ga0495613_0000040 | Ga0495613_0000040_111345_112046 | 224 |
| 487 | 3300046809 | Ga0495600_0026502 | Ga0495600_0026502_821_1522 | 224 |
| 488 | 3300047317 | Ga0495604_0001037 | Ga0495604_0001037_12831_13532 | 224 |
| 489 | 3300047317 | Ga0495604_0003372 | Ga0495604_0003372_10779_11480 | 224 |
| 490 | 3300047320 | Ga0495672_0172686 | Ga0495672_0172686_333_1034 | 224 |
| 491 | 3300047444 | Ga0495675_0000019 | Ga0495675_0000019_24099_24800 | 224 |
| 492 | 3300047471 | Ga0495684_0443834 | Ga0495684_0443834_129_830 | 224 |
| 493 | 3300047472 | Ga0495686_0014186 | Ga0495686_0014186_2419_3120 | 224 |
| 494 | 3300047472 | Ga0495686_0107760 | Ga0495686_0107760_266_967 | 224 |
| 495 | 3300047472 | Ga0495686_0144355 | Ga0495686_0144355_186_887 | 224 |
| 496 | 3300047673 | Ga0495593_0052858 | Ga0495593_0052858_1099_1800 | 224 |
| 497 | 3300048088 | Ga0495602_0000010 | Ga0495602_0000010_46367_47068 | 224 |
| 498 | 3300048088 | Ga0495602_0001188 | Ga0495602_0001188_12773_13474 | 224 |
| 499 | 3300048905 | Ga0496102_0326333 | Ga0496102_0326333_355_1056 | 224 |
| 500 | 3300048905 | Ga0496102_0492919 | Ga0496102_0492919_403_1119 | 224 |
| 501 | 3300048905 | Ga0496102_0640133 | Ga0496102_0640133_106_804 | 224 |
| 502 | 3300048906 | Ga0496103_0043658 | Ga0496103_0043658_1031_1729 | 224 |
| 503 | 3300048907 | Ga0496104_0005819 | Ga0496104_0005819_5038_5739 | 224 |
| 504 | 3300048907 | Ga0496104_0114551 | Ga0496104_0114551_365_1066 | 224 |
| 505 | 3300048908 | Ga0496105_0014248 | Ga0496105_0014248_93_794 | 224 |
| 506 | 3300048911 | Ga0496108_0000024 | Ga0496108_0000024_129493_130194 | 224 |
| 507 | 3300048911 | Ga0496108_0162580 | Ga0496108_0162580_743_1453 | 224 |
| 508 | 3300048912 | Ga0496109_0000033 | Ga0496109_0000033_106600_107301 | 224 |
| 509 | 3300048912 | Ga0496109_0012295 | Ga0496109_0012295_3878_4588 | 224 |
| 510 | 3300048913 | Ga0496110_0000008 | Ga0496110_0000008_17792_18493 | 224 |
| 511 | 3300048913 | Ga0496110_0377143 | Ga0496110_0377143_427_1128 | 224 |
| 512 | 3300048914 | Ga0496111_0000004 | Ga0496111_0000004_90032_90733 | 224 |
| 513 | 3300048914 | Ga0496111_0141389 | Ga0496111_0141389_472_1182 | 224 |
| 514 | 3300048915 | Ga0496112_0006668 | Ga0496112_0006668_385_1086 | 224 |
| 515 | 3300048915 | Ga0496112_0208546 | Ga0496112_0208546_889_1590 | 224 |
| 516 | 3300048916 | Ga0496113_0000003 | Ga0496113_0000003_10247_10948 | 224 |
| 517 | 3300048916 | Ga0496113_0120353 | Ga0496113_0120353_962_1672 | 224 |
| 518 | 3300048917 | Ga0496114_0787634 | Ga0496114_0787634_77_778 | 224 |
| 519 | 3300048918 | Ga0496115_0101261 | Ga0496115_0101261_1538_2254 | 224 |
| 520 | 3300048920 | Ga0496117_0001369 | Ga0496117_0001369_22935_23633 | 224 |
| 521 | 3300048921 | Ga0496118_0000389 | Ga0496118_0000389_24762_25460 | 224 |
| 522 | 3300048922 | Ga0496119_0072208 | Ga0496119_0072208_1037_1735 | 224 |
| 523 | 3300048923 | Ga0496120_0013512 | Ga0496120_0013512_4480_5178 | 224 |
| 524 | 3300048924 | Ga0496121_0090143 | Ga0496121_0090143_857_1558 | 224 |
| 525 | 3300048927 | Ga0496124_0071588 | Ga0496124_0071588_1758_2459 | 224 |
| 526 | 3300048927 | Ga0496124_0261022 | Ga0496124_0261022_549_1250 | 224 |
| 527 | 3300048929 | Ga0496126_0022931 | Ga0496126_0022931_4862_5563 | 224 |
| 528 | 3300049568 | Ga0501031_0015145 | Ga0501031_0015145_552_1286 | 224 |
| 529 | 3300049569 | Ga0501032_0010389 | Ga0501032_0010389_5003_5737 | 224 |
| 530 | 3300049569 | Ga0501032_0216731 | Ga0501032_0216731_395_1150 | 224 |
| 531 | 3300049571 | Ga0501034_0092323 | Ga0501034_0092323_1738_2472 | 224 |
| 532 | 3300049573 | Ga0501037_0047950 | Ga0501037_0047950_756_1490 | 224 |
| 533 | 3300049574 | Ga0501038_0007284 | Ga0501038_0007284_2153_2887 | 224 |
| 534 | 3300049575 | Ga0501039_0061758 | Ga0501039_0061758_778_1512 | 224 |
| 535 | 3300049575 | Ga0501039_0087124 | Ga0501039_0087124_438_1193 | 224 |
| 536 | 3300049576 | Ga0501040_0198213 | Ga0501040_0198213_86_841 | 224 |
| 537 | 3300049577 | Ga0501041_0026073 | Ga0501041_0026073_2214_2969 | 224 |
| 538 | 3300049578 | Ga0501042_0023236 | Ga0501042_0023236_2477_3211 | 224 |
| 539 | 3300049578 | Ga0501042_0109782 | Ga0501042_0109782_297_998 | 224 |
| 540 | 3300049578 | Ga0501042_0110459 | Ga0501042_0110459_882_1583 | 224 |
| 541 | 3300049578 | Ga0501042_0237986 | Ga0501042_0237986_115_870 | 224 |
| 542 | 3300049578 | Ga0501042_0275243 | Ga0501042_0275243_402_1157 | 224 |
| 543 | 3300049579 | Ga0501043_0115045 | Ga0501043_0115045_961_1662 | 224 |
| 544 | 3300049580 | Ga0501046_0006659 | Ga0501046_0006659_9365_10099 | 224 |
| 545 | 3300049581 | Ga0501047_0083987 | Ga0501047_0083987_272_970 | 224 |
| 546 | 3300049581 | Ga0501047_0155750 | Ga0501047_0155750_553_1287 | 224 |
| 547 | 3300049581 | Ga0501047_0167887 | Ga0501047_0167887_525_1226 | 224 |
| 548 | 3300049582 | Ga0501048_0101618 | Ga0501048_0101618_1184_1885 | 224 |
| 549 | 3300049582 | Ga0501048_0162961 | Ga0501048_0162961_307_1062 | 224 |
| 550 | 3300049582 | Ga0501048_0199154 | Ga0501048_0199154_412_1146 | 224 |
| 551 | 3300049583 | Ga0501067_0004060 | Ga0501067_0004060_2280_3014 | 224 |
| 552 | 3300049584 | Ga0501068_0006798 | Ga0501068_0006798_426_1160 | 224 |
| 553 | 3300049584 | Ga0501068_0054469 | Ga0501068_0054469_1276_1977 | 224 |
| 554 | 3300049585 | Ga0501069_0057879 | Ga0501069_0057879_269_1003 | 224 |
| 555 | 3300049585 | Ga0501069_0134867 | Ga0501069_0134867_572_1327 | 224 |
| 556 | 3300049585 | Ga0501069_0207237 | Ga0501069_0207237_236_976 | 224 |
| 557 | 3300049586 | Ga0501070_0022040 | Ga0501070_0022040_3345_4046 | 224 |
| 558 | 3300049586 | Ga0501070_0156923 | Ga0501070_0156923_1041_1742 | 224 |
| 559 | 3300049586 | Ga0501070_0219921 | Ga0501070_0219921_383_1138 | 224 |
| 560 | 3300049587 | Ga0501071_0072775 | Ga0501071_0072775_1226_1981 | 224 |
| 561 | 3300049587 | Ga0501071_0155521 | Ga0501071_0155521_688_1389 | 224 |
| 562 | 3300049588 | Ga0501072_0008915 | Ga0501072_0008915_4744_5499 | 224 |
| 563 | 3300049588 | Ga0501072_0011185 | Ga0501072_0011185_4246_4980 | 224 |
| 564 | 3300049589 | Ga0501073_0004618 | Ga0501073_0004618_6978_7712 | 224 |
| 565 | 3300049589 | Ga0501073_0416131 | Ga0501073_0416131_30_785 | 224 |
| 566 | 3300049590 | Ga0501074_0035779 | Ga0501074_0035779_675_1409 | 224 |
| 567 | 3300049590 | Ga0501074_0060546 | Ga0501074_0060546_863_1618 | 224 |
| 568 | 3300049590 | Ga0501074_0191622 | Ga0501074_0191622_721_1422 | 224 |
| 569 | 3300049591 | Ga0501075_0149001 | Ga0501075_0149001_584_1339 | 224 |
| 570 | 3300049592 | Ga0501076_0325521 | Ga0501076_0325521_130_864 | 224 |
| 571 | 3300049741 | Ga0501079_0033296 | Ga0501079_0033296_1702_2403 | 224 |
| 572 | 3300049741 | Ga0501079_0081047 | Ga0501079_0081047_816_1550 | 224 |
| 573 | 3300049742 | Ga0501080_0012592 | Ga0501080_0012592_1418_2152 | 224 |
| 574 | 3300049742 | Ga0501080_0039515 | Ga0501080_0039515_1222_1923 | 224 |
| 575 | 3300049742 | Ga0501080_0053734 | Ga0501080_0053734_543_1283 | 224 |
| 576 | 3300049742 | Ga0501080_0252844 | Ga0501080_0252844_730_1428 | 224 |
| 577 | 3300049743 | Ga0501081_0054678 | Ga0501081_0054678_438_1193 | 224 |
| 578 | 3300049744 | Ga0501083_0010952 | Ga0501083_0010952_5439_6140 | 224 |
| 579 | 3300049744 | Ga0501083_0019756 | Ga0501083_0019756_980_1678 | 224 |
| 580 | 3300049744 | Ga0501083_0189462 | Ga0501083_0189462_477_1211 | 224 |
| 581 | 3300049822 | Ga0501035_0010845 | Ga0501035_0010845_7154_7888 | 224 |
| 582 | 3300049822 | Ga0501035_0189013 | Ga0501035_0189013_547_1302 | 224 |
| 583 | 3300049823 | Ga0501044_0065596 | Ga0501044_0065596_2054_2755 | 224 |
| 584 | 3300049823 | Ga0501044_0117169 | Ga0501044_0117169_1534_2232 | 224 |
| 585 | 3300049824 | Ga0501045_0185462 | Ga0501045_0185462_352_1086 | 224 |
| 586 | 3300050492 | nmdc:mga0yw44_194453_c1 | nmdc:mga0yw44_194453_c1_305_1012 | 224 |
| 587 | 3300050507 | nmdc:mga05p37_179704_c1 | nmdc:mga05p37_179704_c1_543_1244 | 224 |
| 588 | 3300050508 | nmdc:mga09592_422117_c1 | nmdc:mga09592_422117_c1_358_1071 | 224 |
| 589 | 3300050509 | nmdc:mga0qj67_142718_c1 | nmdc:mga0qj67_142718_c1_485_1186 | 224 |
| 590 | 3300050510 | nmdc:mga06r32_40822_c1 | nmdc:mga06r32_40822_c1_152_853 | 224 |
| 591 | 3300050510 | nmdc:mga06r32_70499_c1 | nmdc:mga06r32_70499_c1_1202_1903 | 224 |
| 592 | 3300050511 | nmdc:mga08y16_27710_c1 | nmdc:mga08y16_27710_c1_2647_3348 | 224 |
| 593 | 3300050511 | nmdc:mga08y16_399242_c1 | nmdc:mga08y16_399242_c1_281_994 | 224 |
| 594 | 3300050511 | nmdc:mga08y16_4538_c1 | nmdc:mga08y16_4538_c1_5208_5921 | 224 |
| 595 | 3300050511 | nmdc:mga08y16_55997_c1 | nmdc:mga08y16_55997_c1_3111_3824 | 224 |
| 596 | 3300050515 | nmdc:mga0a205_47748_c1 | nmdc:mga0a205_47748_c1_2047_2748 | 224 |
| 597 | 3300053077 | Ga0495601_0000012 | Ga0495601_0000012_44137_44838 | 224 |
| 598 | 3300053077 | Ga0495601_0021121 | Ga0495601_0021121_605_1306 | 224 |
| 599 | 3300053083 | Ga0495655_0054760 | Ga0495655_0054760_116_841 | 224 |
| 600 | 3300053084 | Ga0495595_0000001 | Ga0495595_0000001_322416_323117 | 224 |
| 601 | 3300053084 | Ga0495595_0004192 | Ga0495595_0004192_393_1094 | 224 |
| 602 | 3300053085 | Ga0495619_0000020 | Ga0495619_0000020_104471_105172 | 224 |
| 603 | 3300053085 | Ga0495619_0000046 | Ga0495619_0000046_64671_65372 | 224 |
| 604 | 3300053098 | Ga0500650_0174227 | Ga0500650_0174227_241_942 | 224 |
| 605 | 3300054114 | Ga0501084_0048779 | Ga0501084_0048779_875_1630 | 224 |
| 606 | 3300054114 | Ga0501084_0142773 | Ga0501084_0142773_909_1664 | 224 |
| 607 | 3300054114 | Ga0501084_0629911 | Ga0501084_0629911_123_824 | 224 |
| 608 | 3300060353 | Ga0501082_0027284 | Ga0501082_0027284_3116_3850 | 224 |
| 609 | 3300060353 | Ga0501082_0065863 | Ga0501082_0065863_1912_2667 | 224 |
| 610 | 3300000546 | LJNas_1014062 | LJNas_10140621 | 225 |
| 611 | 3300001979 | JGI24740J21852_10000904 | JGI24740J21852_1000090412 | 225 |
| 612 | 3300003659 | JGI25404J52841_10014570 | JGI25404J52841_100145702 | 225 |
| 613 | 3300005327 | Ga0070658_10029846 | Ga0070658_100298462 | 225 |
| 614 | 3300005329 | Ga0070683_100138291 | Ga0070683_1001382912 | 225 |
| 615 | 3300005333 | Ga0070677_10000018 | Ga0070677_1000001813 | 225 |
| 616 | 3300005337 | Ga0070682_100000016 | Ga0070682_100000016149 | 225 |
| 617 | 3300005337 | Ga0070682_100000029 | Ga0070682_10000002995 | 225 |
| 618 | 3300005339 | Ga0070660_100058901 | Ga0070660_1000589014 | 225 |
| 619 | 3300005340 | Ga0070689_100532634 | Ga0070689_1005326341 | 225 |
| 620 | 3300005341 | Ga0070691_10000009 | Ga0070691_1000000935 | 225 |
| 621 | 3300005341 | Ga0070691_10142486 | Ga0070691_101424862 | 225 |
| 622 | 3300005344 | Ga0070661_100023036 | Ga0070661_1000230362 | 225 |
| 623 | 3300005354 | Ga0070675_100020817 | Ga0070675_1000208172 | 225 |
| 624 | 3300005356 | Ga0070674_100000028 | Ga0070674_10000002853 | 225 |
| 625 | 3300005356 | Ga0070674_100059851 | Ga0070674_1000598512 | 225 |
| 626 | 3300005366 | Ga0070659_100001108 | Ga0070659_10000110815 | 225 |
| 627 | 3300005367 | Ga0070667_100136594 | Ga0070667_1001365943 | 225 |
| 628 | 3300005455 | Ga0070663_100005232 | Ga0070663_1000052325 | 225 |
| 629 | 3300005455 | Ga0070663_100032151 | Ga0070663_1000321513 | 225 |
| 630 | 3300005455 | Ga0070663_100186766 | Ga0070663_1001867662 | 225 |
| 631 | 3300005456 | Ga0070678_100425996 | Ga0070678_1004259962 | 225 |
| 632 | 3300005459 | Ga0068867_100001503 | Ga0068867_10000150315 | 225 |
| 633 | 3300005459 | Ga0068867_100075180 | Ga0068867_1000751803 | 225 |
| 634 | 3300005466 | Ga0070685_10111944 | Ga0070685_101119441 | 225 |
| 635 | 3300005530 | Ga0070679_100000507 | Ga0070679_1000005079 | 225 |
| 636 | 3300005530 | Ga0070679_100000674 | Ga0070679_10000067428 | 225 |
| 637 | 3300005535 | Ga0070684_100113625 | Ga0070684_1001136252 | 225 |
| 638 | 3300005535 | Ga0070684_100320678 | Ga0070684_1003206781 | 225 |
| 639 | 3300005539 | Ga0068853_100001814 | Ga0068853_1000018143 | 225 |
| 640 | 3300005543 | Ga0070672_100021385 | Ga0070672_1000213853 | 225 |
| 641 | 3300005544 | Ga0070686_100015412 | Ga0070686_1000154121 | 225 |
| 642 | 3300005547 | Ga0070693_100000093 | Ga0070693_10000009335 | 225 |
| 643 | 3300005548 | Ga0070665_100000120 | Ga0070665_10000012080 | 225 |
| 644 | 3300005577 | Ga0068857_100042206 | Ga0068857_1000422063 | 225 |
| 645 | 3300005614 | Ga0068856_100024148 | Ga0068856_1000241487 | 225 |
| 646 | 3300005616 | Ga0068852_100053917 | Ga0068852_1000539173 | 225 |
| 647 | 3300005617 | Ga0068859_100302845 | Ga0068859_1003028452 | 225 |
| 648 | 3300005718 | Ga0068866_10000045 | Ga0068866_1000004511 | 225 |
| 649 | 3300005718 | Ga0068866_10009088 | Ga0068866_100090882 | 225 |
| 650 | 3300005718 | Ga0068866_10197009 | Ga0068866_101970092 | 225 |
| 651 | 3300005834 | Ga0068851_10042721 | Ga0068851_100427212 | 225 |
| 652 | 3300005841 | Ga0068863_100000080 | Ga0068863_10000008062 | 225 |
| 653 | 3300005842 | Ga0068858_100000035 | Ga0068858_10000003578 | 225 |
| 654 | 3300005842 | Ga0068858_100000042 | Ga0068858_10000004250 | 225 |
| 655 | 3300005843 | Ga0068860_100024481 | Ga0068860_1000244819 | 225 |
| 656 | 3300005937 | Ga0081455_10041169 | Ga0081455_100411695 | 225 |
| 657 | 3300005983 | Ga0081540_1000115 | Ga0081540_10001152 | 225 |
| 658 | 3300005983 | Ga0081540_1002095 | Ga0081540_10020957 | 225 |
| 659 | 3300006038 | Ga0075365_10000105 | Ga0075365_1000010528 | 225 |
| 660 | 3300006038 | Ga0075365_10003397 | Ga0075365_100033972 | 225 |
| 661 | 3300006038 | Ga0075365_10138665 | Ga0075365_101386652 | 225 |
| 662 | 3300006038 | Ga0075365_10292401 | Ga0075365_102924012 | 225 |
| 663 | 3300006048 | Ga0075363_100008638 | Ga0075363_1000086385 | 225 |
| 664 | 3300006048 | Ga0075363_100011382 | Ga0075363_1000113823 | 225 |
| 665 | 3300006051 | Ga0075364_10056764 | Ga0075364_100567643 | 225 |
| 666 | 3300006163 | Ga0070715_10000015 | Ga0070715_1000001525 | 225 |
| 667 | 3300006173 | Ga0070716_100039189 | Ga0070716_1000391893 | 225 |
| 668 | 3300006931 | Ga0097620_100302849 | Ga0097620_1003028492 | 225 |
| 669 | 3300009098 | Ga0105245_10000053 | Ga0105245_1000005332 | 225 |
| 670 | 3300009098 | Ga0105245_10000488 | Ga0105245_1000048830 | 225 |
| 671 | 3300009101 | Ga0105247_10000169 | Ga0105247_1000016943 | 225 |
| 672 | 3300009101 | Ga0105247_10523310 | Ga0105247_105233101 | 225 |
| 673 | 3300009148 | Ga0105243_10012944 | Ga0105243_100129445 | 225 |
| 674 | 3300009148 | Ga0105243_10498383 | Ga0105243_104983832 | 225 |
| 675 | 3300009176 | Ga0105242_10234392 | Ga0105242_102343923 | 225 |
| 676 | 3300009176 | Ga0105242_10431535 | Ga0105242_104315351 | 225 |
| 677 | 3300009553 | Ga0105249_10000095 | Ga0105249_1000009571 | 225 |
| 678 | 3300009553 | Ga0105249_10469042 | Ga0105249_104690422 | 225 |
| 679 | 3300011119 | Ga0105246_10778118 | Ga0105246_107781181 | 225 |
| 680 | 3300013104 | Ga0157370_10154130 | Ga0157370_101541302 | 225 |
| 681 | 3300013296 | Ga0157374_10001474 | Ga0157374_100014742 | 225 |
| 682 | 3300013308 | Ga0157375_10000076 | Ga0157375_1000007655 | 225 |
| 683 | 3300013308 | Ga0157375_10033964 | Ga0157375_100339642 | 225 |
| 684 | 3300014968 | Ga0157379_10021283 | Ga0157379_100212839 | 225 |
| 685 | 3300014969 | Ga0157376_10513409 | Ga0157376_105134091 | 225 |
| 686 | 3300017792 | Ga0163161_10031651 | Ga0163161_100316516 | 225 |
| 687 | 3300025321 | Ga0207656_10055490 | Ga0207656_100554903 | 225 |
| 688 | 3300025893 | Ga0207682_10000047 | Ga0207682_1000004713 | 225 |
| 689 | 3300025899 | Ga0207642_10000050 | Ga0207642_1000005024 | 225 |
| 690 | 3300025899 | Ga0207642_10130246 | Ga0207642_101302461 | 225 |
| 691 | 3300025900 | Ga0207710_10000103 | Ga0207710_1000010366 | 225 |
| 692 | 3300025900 | Ga0207710_10180331 | Ga0207710_101803311 | 225 |
| 693 | 3300025901 | Ga0207688_10013921 | Ga0207688_100139213 | 225 |
| 694 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001399 | 225 |
| 695 | 3300025908 | Ga0207643_10105839 | Ga0207643_101058391 | 225 |
| 696 | 3300025909 | Ga0207705_10020753 | Ga0207705_100207535 | 225 |
| 697 | 3300025916 | Ga0207663_10004253 | Ga0207663_100042538 | 225 |
| 698 | 3300025917 | Ga0207660_10011227 | Ga0207660_100112275 | 225 |
| 699 | 3300025919 | Ga0207657_10018050 | Ga0207657_100180506 | 225 |
| 700 | 3300025921 | Ga0207652_10000177 | Ga0207652_1000017713 | 225 |
| 701 | 3300025921 | Ga0207652_10007489 | Ga0207652_100074895 | 225 |
| 702 | 3300025926 | Ga0207659_10063498 | Ga0207659_100634983 | 225 |
| 703 | 3300025927 | Ga0207687_10000021 | Ga0207687_1000002170 | 225 |
| 704 | 3300025927 | Ga0207687_10000241 | Ga0207687_1000024130 | 225 |
| 705 | 3300025929 | Ga0207664_10068604 | Ga0207664_100686043 | 225 |
| 706 | 3300025933 | Ga0207706_10000016 | Ga0207706_100000168 | 225 |
| 707 | 3300025934 | Ga0207686_10000189 | Ga0207686_1000018948 | 225 |
| 708 | 3300025937 | Ga0207669_10000014 | Ga0207669_1000001451 | 225 |
| 709 | 3300025937 | Ga0207669_10033870 | Ga0207669_100338702 | 225 |
| 710 | 3300025939 | Ga0207665_10047236 | Ga0207665_100472363 | 225 |
| 711 | 3300025940 | Ga0207691_10025351 | Ga0207691_100253513 | 225 |
| 712 | 3300025944 | Ga0207661_10009721 | Ga0207661_100097216 | 225 |
| 713 | 3300025944 | Ga0207661_10065981 | Ga0207661_100659813 | 225 |
| 714 | 3300025961 | Ga0207712_10000003 | Ga0207712_10000003565 | 225 |
| 715 | 3300025986 | Ga0207658_10104664 | Ga0207658_101046642 | 225 |
| 716 | 3300026035 | Ga0207703_10000060 | Ga0207703_1000006082 | 225 |
| 717 | 3300026035 | Ga0207703_10000067 | Ga0207703_10000067111 | 225 |
| 718 | 3300026041 | Ga0207639_10018969 | Ga0207639_100189693 | 225 |
| 719 | 3300026041 | Ga0207639_10386455 | Ga0207639_103864552 | 225 |
| 720 | 3300026067 | Ga0207678_10012641 | Ga0207678_100126414 | 225 |
| 721 | 3300026067 | Ga0207678_10038380 | Ga0207678_100383804 | 225 |
| 722 | 3300026067 | Ga0207678_10165577 | Ga0207678_101655773 | 225 |
| 723 | 3300026075 | Ga0207708_10001660 | Ga0207708_1000166013 | 225 |
| 724 | 3300026075 | Ga0207708_10334348 | Ga0207708_103343482 | 225 |
| 725 | 3300026078 | Ga0207702_10060363 | Ga0207702_100603635 | 225 |
| 726 | 3300026088 | Ga0207641_10000304 | Ga0207641_1000030444 | 225 |
| 727 | 3300026089 | Ga0207648_10000230 | Ga0207648_1000023058 | 225 |
| 728 | 3300026089 | Ga0207648_10093083 | Ga0207648_100930833 | 225 |
| 729 | 3300026089 | Ga0207648_10361418 | Ga0207648_103614182 | 225 |
| 730 | 3300026095 | Ga0207676_10000043 | Ga0207676_1000004351 | 225 |
| 731 | 3300026116 | Ga0207674_10053480 | Ga0207674_100534803 | 225 |
| 732 | 3300026121 | Ga0207683_10141493 | Ga0207683_101414933 | 225 |
| 733 | 3300026142 | Ga0207698_10089841 | Ga0207698_100898413 | 225 |
| 734 | 3300026142 | Ga0207698_10488148 | Ga0207698_104881482 | 225 |
| 735 | 3300028379 | Ga0268266_10000023 | Ga0268266_10000023440 | 225 |
| 736 | 3300028379 | Ga0268266_10069579 | Ga0268266_100695793 | 225 |
| 737 | 3300028556 | Ga0265337_1000013 | Ga0265337_10000133 | 225 |
| 738 | 3300028558 | Ga0265326_10000012 | Ga0265326_10000012166 | 225 |
| 739 | 3300028654 | Ga0265322_10000003 | Ga0265322_10000003453 | 225 |
| 740 | 3300028666 | Ga0265336_10011220 | Ga0265336_100112204 | 225 |
| 741 | 3300028800 | Ga0265338_10170778 | Ga0265338_101707782 | 225 |
| 742 | 3300029957 | Ga0265324_10000226 | Ga0265324_1000022629 | 225 |
| 743 | 3300031238 | Ga0265332_10019734 | Ga0265332_100197342 | 225 |
| 744 | 3300031240 | Ga0265320_10000001 | Ga0265320_10000001453 | 225 |
| 745 | 3300031242 | Ga0265329_10046129 | Ga0265329_100461292 | 225 |
| 746 | 3300031249 | Ga0265339_10029303 | Ga0265339_100293035 | 225 |
| 747 | 3300031250 | Ga0265331_10005677 | Ga0265331_100056776 | 225 |
| 748 | 3300031251 | Ga0265327_10000003 | Ga0265327_10000003453 | 225 |
| 749 | 3300031344 | Ga0265316_10022290 | Ga0265316_100222906 | 225 |
| 750 | 3300031548 | Ga0307408_100417984 | Ga0307408_1004179842 | 225 |
| 751 | 3300031711 | Ga0265314_10000044 | Ga0265314_1000004414 | 225 |
| 752 | 3300031727 | Ga0316576_10210483 | Ga0316576_102104832 | 225 |
| 753 | 3300032002 | Ga0307416_100684614 | Ga0307416_1006846141 | 225 |
| 754 | 3300035398 | Ga0316574_0009515 | Ga0316574_0009515_1724_2428 | 225 |
| 755 | 3300035398 | Ga0316574_0118176 | Ga0316574_0118176_485_1189 | 225 |
| 756 | 3300036401 | Ga0373937_0193371 | Ga0373937_0193371_185_886 | 225 |
| 757 | 3300036712 | Ga0316584_0000905 | Ga0316584_0000905_839_1543 | 225 |
| 758 | 3300037312 | Ga0395899_0054834 | Ga0395899_0054834_1678_2379 | 225 |
| 759 | 3300037418 | Ga0395900_0313987 | Ga0395900_0313987_421_1122 | 225 |
| 760 | 3300037466 | Ga0395898_0095502 | Ga0395898_0095502_1734_2435 | 225 |
| 761 | 3300037471 | Ga0395905_0155588 | Ga0395905_0155588_1058_1759 | 225 |
| 762 | 3300037471 | Ga0395905_0281334 | Ga0395905_0281334_425_1126 | 225 |
| 763 | 3300038443 | Ga0395901_0032062 | Ga0395901_0032062_257_958 | 225 |
| 764 | 3300038443 | Ga0395901_0077287 | Ga0395901_0077287_403_1104 | 225 |
| 765 | 3300038443 | Ga0395901_0162877 | Ga0395901_0162877_156_857 | 225 |
| 766 | 3300038443 | Ga0395901_0205081 | Ga0395901_0205081_937_1638 | 225 |
| 767 | 3300041512 | Ga0451853_2225693 | Ga0451853_2225693_471_1172 | 225 |
| 768 | 3300044694 | Ga0466963_0000021 | Ga0466963_0000021_5578_6279 | 225 |
| 769 | 3300045976 | Ga0466967_0017023 | Ga0466967_0017023_3087_3788 | 225 |
| 770 | 3300045976 | Ga0466967_0110416 | Ga0466967_0110416_78_779 | 225 |
| 771 | 3300046454 | Ga0495592_0231998 | Ga0495592_0231998_398_1099 | 225 |
| 772 | 3300046455 | Ga0495603_0000554 | Ga0495603_0000554_18204_18905 | 225 |
| 773 | 3300046459 | Ga0495629_0009501 | Ga0495629_0009501_5464_6165 | 225 |
| 774 | 3300046459 | Ga0495629_0067785 | Ga0495629_0067785_1064_1765 | 225 |
| 775 | 3300046461 | Ga0495641_0000001 | Ga0495641_0000001_49286_49987 | 225 |
| 776 | 3300046461 | Ga0495641_0058073 | Ga0495641_0058073_504_1205 | 225 |
| 777 | 3300046461 | Ga0495641_0062929 | Ga0495641_0062929_469_1170 | 225 |
| 778 | 3300046463 | Ga0495653_0046662 | Ga0495653_0046662_689_1390 | 225 |
| 779 | 3300046475 | Ga0495639_0125296 | Ga0495639_0125296_389_1090 | 225 |
| 780 | 3300046477 | Ga0495664_0157673 | Ga0495664_0157673_338_1039 | 225 |
| 781 | 3300046499 | Ga0495594_0000004 | Ga0495594_0000004_156549_157250 | 225 |
| 782 | 3300046511 | Ga0495608_0005626 | Ga0495608_0005626_8015_8716 | 225 |
| 783 | 3300046511 | Ga0495608_0059240 | Ga0495608_0059240_1089_1790 | 225 |
| 784 | 3300046516 | Ga0495628_0036831 | Ga0495628_0036831_469_1170 | 225 |
| 785 | 3300046516 | Ga0495628_0039459 | Ga0495628_0039459_219_920 | 225 |
| 786 | 3300046516 | Ga0495628_0116419 | Ga0495628_0116419_653_1354 | 225 |
| 787 | 3300046516 | Ga0495628_0382782 | Ga0495628_0382782_197_898 | 225 |
| 788 | 3300046517 | Ga0495630_0048552 | Ga0495630_0048552_1129_1830 | 225 |
| 789 | 3300046529 | Ga0495652_0002702 | Ga0495652_0002702_9347_10048 | 225 |
| 790 | 3300046535 | Ga0495586_0000338 | Ga0495586_0000338_23036_23737 | 225 |
| 791 | 3300046536 | Ga0495587_0000446 | Ga0495587_0000446_8829_9530 | 225 |
| 792 | 3300046543 | Ga0495645_0029053 | Ga0495645_0029053_396_1097 | 225 |
| 793 | 3300046543 | Ga0495645_0029487 | Ga0495645_0029487_2351_3052 | 225 |
| 794 | 3300046543 | Ga0495645_0057815 | Ga0495645_0057815_1311_2012 | 225 |
| 795 | 3300046557 | Ga0495622_0000016 | Ga0495622_0000016_128678_129379 | 225 |
| 796 | 3300046559 | Ga0495667_0000015 | Ga0495667_0000015_161673_162374 | 225 |
| 797 | 3300046559 | Ga0495667_0086197 | Ga0495667_0086197_358_1059 | 225 |
| 798 | 3300046615 | Ga0495656_0000226 | Ga0495656_0000226_17641_18342 | 225 |
| 799 | 3300046642 | Ga0495634_0000187 | Ga0495634_0000187_38044_38745 | 225 |
| 800 | 3300046642 | Ga0495634_0000755 | Ga0495634_0000755_12755_13456 | 225 |
| 801 | 3300046678 | Ga0495599_0007160 | Ga0495599_0007160_2605_3306 | 225 |
| 802 | 3300046681 | Ga0495647_0000013 | Ga0495647_0000013_34781_35482 | 225 |
| 803 | 3300046684 | Ga0495669_0000251 | Ga0495669_0000251_4393_5094 | 225 |
| 804 | 3300046690 | Ga0495624_0000013 | Ga0495624_0000013_40826_41527 | 225 |
| 805 | 3300046691 | Ga0495670_0003761 | Ga0495670_0003761_4719_5420 | 225 |
| 806 | 3300046694 | Ga0495649_0001084 | Ga0495649_0001084_3404_4105 | 225 |
| 807 | 3300046809 | Ga0495600_0079645 | Ga0495600_0079645_434_1135 | 225 |
| 808 | 3300047317 | Ga0495604_0063409 | Ga0495604_0063409_29_730 | 225 |
| 809 | 3300047319 | Ga0495674_0351796 | Ga0495674_0351796_86_787 | 225 |
| 810 | 3300047321 | Ga0495676_0000091 | Ga0495676_0000091_64081_64782 | 225 |
| 811 | 3300047321 | Ga0495676_0000252 | Ga0495676_0000252_24846_25547 | 225 |
| 812 | 3300047321 | Ga0495676_0007581 | Ga0495676_0007581_218_919 | 225 |
| 813 | 3300047322 | Ga0495680_0000286 | Ga0495680_0000286_28486_29187 | 225 |
| 814 | 3300047322 | Ga0495680_0000741 | Ga0495680_0000741_27786_28487 | 225 |
| 815 | 3300047446 | Ga0495679_010847 | Ga0495679_010847_163_864 | 225 |
| 816 | 3300048903 | Ga0496100_0000003 | Ga0496100_0000003_300499_301200 | 225 |
| 817 | 3300048903 | Ga0496100_0000008 | Ga0496100_0000008_52741_53442 | 225 |
| 818 | 3300048904 | Ga0496101_0000003 | Ga0496101_0000003_300499_301200 | 225 |
| 819 | 3300048904 | Ga0496101_0000016 | Ga0496101_0000016_61523_62224 | 225 |
| 820 | 3300048907 | Ga0496104_0000003 | Ga0496104_0000003_76130_76831 | 225 |
| 821 | 3300048907 | Ga0496104_0000063 | Ga0496104_0000063_76440_77141 | 225 |
| 822 | 3300048907 | Ga0496104_0006122 | Ga0496104_0006122_253_954 | 225 |
| 823 | 3300048908 | Ga0496105_0000031 | Ga0496105_0000031_60390_61091 | 225 |
| 824 | 3300048908 | Ga0496105_0000041 | Ga0496105_0000041_39478_40179 | 225 |
| 825 | 3300048909 | Ga0496106_0000048 | Ga0496106_0000048_59606_60307 | 225 |
| 826 | 3300048909 | Ga0496106_0000086 | Ga0496106_0000086_20720_21421 | 225 |
| 827 | 3300048910 | Ga0496107_0000008 | Ga0496107_0000008_191559_192260 | 225 |
| 828 | 3300048910 | Ga0496107_0000009 | Ga0496107_0000009_52455_53156 | 225 |
| 829 | 3300048910 | Ga0496107_0254877 | Ga0496107_0254877_426_1127 | 225 |
| 830 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_164213_164914 | 225 |
| 831 | 3300048911 | Ga0496108_0000153 | Ga0496108_0000153_29484_30185 | 225 |
| 832 | 3300048911 | Ga0496108_0003084 | Ga0496108_0003084_12607_13308 | 225 |
| 833 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_164175_164876 | 225 |
| 834 | 3300048912 | Ga0496109_0000300 | Ga0496109_0000300_36051_36752 | 225 |
| 835 | 3300048913 | Ga0496110_0003088 | Ga0496110_0003088_9477_10178 | 225 |
| 836 | 3300048913 | Ga0496110_0138177 | Ga0496110_0138177_181_1020 | 225 |
| 837 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_724465_725166 | 225 |
| 838 | 3300048915 | Ga0496112_0757664 | Ga0496112_0757664_54_755 | 225 |
| 839 | 3300048916 | Ga0496113_0006959 | Ga0496113_0006959_1106_2035 | 225 |
| 840 | 3300048916 | Ga0496113_0308628 | Ga0496113_0308628_143_844 | 225 |
| 841 | 3300048917 | Ga0496114_0000010 | Ga0496114_0000010_207028_207729 | 225 |
| 842 | 3300048917 | Ga0496114_0026192 | Ga0496114_0026192_1196_1897 | 225 |
| 843 | 3300048918 | Ga0496115_0000212 | Ga0496115_0000212_25143_25844 | 225 |
| 844 | 3300048918 | Ga0496115_0001537 | Ga0496115_0001537_4792_5493 | 225 |
| 845 | 3300048919 | Ga0496116_0000014 | Ga0496116_0000014_409516_410217 | 225 |
| 846 | 3300048922 | Ga0496119_0000937 | Ga0496119_0000937_3615_4316 | 225 |
| 847 | 3300048922 | Ga0496119_0004788 | Ga0496119_0004788_11740_12441 | 225 |
| 848 | 3300048922 | Ga0496119_0092775 | Ga0496119_0092775_234_935 | 225 |
| 849 | 3300048922 | Ga0496119_0263167 | Ga0496119_0263167_48_749 | 225 |
| 850 | 3300048928 | Ga0496125_0283605 | Ga0496125_0283605_289_990 | 225 |
| 851 | 3300049568 | Ga0501031_0000172 | Ga0501031_0000172_25124_25825 | 225 |
| 852 | 3300049569 | Ga0501032_0000902 | Ga0501032_0000902_19988_20689 | 225 |
| 853 | 3300049570 | Ga0501033_0000211 | Ga0501033_0000211_43978_44679 | 225 |
| 854 | 3300049571 | Ga0501034_0003939 | Ga0501034_0003939_4893_5594 | 225 |
| 855 | 3300049572 | Ga0501036_0000841 | Ga0501036_0000841_11087_11788 | 225 |
| 856 | 3300049573 | Ga0501037_0000120 | Ga0501037_0000120_22255_22956 | 225 |
| 857 | 3300049574 | Ga0501038_0000139 | Ga0501038_0000139_50414_51115 | 225 |
| 858 | 3300049575 | Ga0501039_0006697 | Ga0501039_0006697_4342_5043 | 225 |
| 859 | 3300049579 | Ga0501043_0000203 | Ga0501043_0000203_50541_51242 | 225 |
| 860 | 3300049580 | Ga0501046_0000194 | Ga0501046_0000194_50413_51114 | 225 |
| 861 | 3300049581 | Ga0501047_0000287 | Ga0501047_0000287_46297_46998 | 225 |
| 862 | 3300049582 | Ga0501048_0000004 | Ga0501048_0000004_49524_50225 | 225 |
| 863 | 3300049584 | Ga0501068_0003838 | Ga0501068_0003838_1111_1812 | 225 |
| 864 | 3300049585 | Ga0501069_0054695 | Ga0501069_0054695_387_1088 | 225 |
| 865 | 3300049586 | Ga0501070_0000079 | Ga0501070_0000079_247_948 | 225 |
| 866 | 3300049586 | Ga0501070_0005006 | Ga0501070_0005006_509_1210 | 225 |
| 867 | 3300049587 | Ga0501071_0025386 | Ga0501071_0025386_3255_3956 | 225 |
| 868 | 3300049589 | Ga0501073_0000837 | Ga0501073_0000837_20626_21327 | 225 |
| 869 | 3300049590 | Ga0501074_0005099 | Ga0501074_0005099_3830_4531 | 225 |
| 870 | 3300049591 | Ga0501075_0734696 | Ga0501075_0734696_35_736 | 225 |
| 871 | 3300049741 | Ga0501079_0000318 | Ga0501079_0000318_18479_19180 | 225 |
| 872 | 3300049742 | Ga0501080_0004716 | Ga0501080_0004716_2670_3371 | 225 |
| 873 | 3300049744 | Ga0501083_0008391 | Ga0501083_0008391_4122_4823 | 225 |
| 874 | 3300049822 | Ga0501035_0000059 | Ga0501035_0000059_11090_11791 | 225 |
| 875 | 3300049823 | Ga0501044_0001354 | Ga0501044_0001354_11172_11873 | 225 |
| 876 | 3300050490 | nmdc:mga03n38_20290_c1 | nmdc:mga03n38_20290_c1_341_1180 | 225 |
| 877 | 3300050491 | nmdc:mga00v17_398398_c1 | nmdc:mga00v17_398398_c1_93_797 | 225 |
| 878 | 3300050492 | nmdc:mga0yw44_110598_c1 | nmdc:mga0yw44_110598_c1_247_951 | 225 |
| 879 | 3300050492 | nmdc:mga0yw44_23608_c1 | nmdc:mga0yw44_23608_c1_2148_2849 | 225 |
| 880 | 3300050492 | nmdc:mga0yw44_356908_c1 | nmdc:mga0yw44_356908_c1_65_769 | 225 |
| 881 | 3300050492 | nmdc:mga0yw44_58162_c1 | nmdc:mga0yw44_58162_c1_952_1755 | 225 |
| 882 | 3300050515 | nmdc:mga0a205_4209_c1 | nmdc:mga0a205_4209_c1_1155_1856 | 225 |
| 883 | 3300053077 | Ga0495601_0000344 | Ga0495601_0000344_5628_6329 | 225 |
| 884 | 3300053077 | Ga0495601_0382019 | Ga0495601_0382019_194_895 | 225 |
| 885 | 3300053078 | Ga0495612_0000100 | Ga0495612_0000100_26198_26899 | 225 |
| 886 | 3300053078 | Ga0495612_0032013 | Ga0495612_0032013_677_1378 | 225 |
| 887 | 3300053084 | Ga0495595_0070074 | Ga0495595_0070074_268_969 | 225 |
| 888 | 3300053084 | Ga0495595_0142576 | Ga0495595_0142576_366_1067 | 225 |
| 889 | 3300053085 | Ga0495619_0000015 | Ga0495619_0000015_6334_7035 | 225 |
| 890 | 3300053085 | Ga0495619_0000626 | Ga0495619_0000626_4854_5555 | 225 |
| 891 | 3300053085 | Ga0495619_0000749 | Ga0495619_0000749_4593_5294 | 225 |
| 892 | 3300053085 | Ga0495619_0003303 | Ga0495619_0003303_429_1130 | 225 |
| 893 | 3300053085 | Ga0495619_0151253 | Ga0495619_0151253_663_1364 | 225 |
| 894 | 3300053094 | Ga0500566_0001971 | Ga0500566_0001971_1948_2649 | 225 |
| 895 | 3300053096 | Ga0500641_0009337 | Ga0500641_0009337_874_1575 | 225 |
| 896 | 3300053119 | Ga0500595_028754 | Ga0500595_028754_899_1600 | 225 |
| 897 | 3300053123 | Ga0500614_000039 | Ga0500614_000039_11701_12402 | 225 |
| 898 | 3300060353 | Ga0501082_0004892 | Ga0501082_0004892_9696_10397 | 225 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1k3g-assembly1.cif.gz_A | nmr solution structure of oxidized cytochrome c-553 from bacillus pasteurii | 0.8478 | 175 | 225 |
| 7o38-assembly1.cif.gz_A | cytochrome c kustc0562 from kuenenia stuttgartiensis | 0.8385 | 177 | 225 |
| 2yev-assembly2.cif.gz_B | structure of caa3-type cytochrome oxidase | 0.8299 | 151 | 225 |
| 4pwa-assembly2.cif.gz_D | crystal structure of the c-type cytochrome soru from sinorhizobium meliloti | 0.8169 | 149 | 224 |
| 7zs0-assembly1.cif.gz_A | diheme cytochrome c kustd1711 from kuenenia stuttgartiensis | 0.811 | 150 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1k3gA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8478 | 175 | 225 | 1.10.760.10 |
| 2yevE02 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8299 | 151 | 225 | 2.60.40.420 |
| 4pwaC00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7926 | 145 | 224 | 1.10.760.10 |
| 3mk7E02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7576 | 139 | 224 | 1.10.760.10 |
| 4kmgA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7491 | 189 | 222 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0LIM6-F1-model_v4 | Cytochrome c | 0.9652 | 139 | 224 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A536AX08-F1-model_v4 | C-type cytochrome | 0.9265 | 160 | 225 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A350KJC2-F1-model_v4 | deleted | 0.9122 | 149 | 224 |
|
| AF-A0A7J9Z080-F1-model_v4 | C-type cytochrome | 0.9032 | 125 | 225 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A2N9L793-F1-model_v4 | Cytochrome c domain-containing protein | 0.9003 | 149 | 224 |
GO:0009055
GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar