F485024

General Info

Members Datasets Scaffolds Average Seq Length
896 536 743 202

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0311998|Ga0436360_0311998_103_747
Length 214
Sequence MPYPDRFYPVVDSLAWVERLTRLGVGTIQLRAKNLNDQDALAIVREALAVTEGTGTKLVVNDYWRAAIDANATHLHLGQEDLAEADLKAIRAAGLTLGVSTHDDEELAAALRAKPDYVALGPIFFTTLKSMRFAPQGIPKITEWKRRVGNIPLVAIGGIKLEHAAEIFAAGADSIAVVSDVTQNPDPDARVRSTSTLDKKTSPKPISRRSAKPA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
13 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
14 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
20 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
21 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
22 2791355199
23 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
24 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
25 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
26 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
27 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
28 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
29 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
30 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
31 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
32 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
33 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
34 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
35 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
36 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
37 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
38 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
39 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
40 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
41 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
42 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
43 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
44 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
45 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
46 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
47 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
48 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
49 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
50 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
51 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
52 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
53 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
54 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
55 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
56 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
57 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
58 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
59 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
60 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
61 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
62 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
63 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
64 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
65 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
66 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
67 2922368715
68 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
69 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
70 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
71 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
72 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
73 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
74 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
75 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
76 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
77 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
78 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
79 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
80 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
81 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
82 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
83 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
84 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
85 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
86 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
87 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
88 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
89 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
90 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
91 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
92 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
93 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
94 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
95 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
96 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
97 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
98 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
99 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
100 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
101 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
102 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
103 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
104 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
105 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
106 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
107 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
108 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
109 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
110 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
111 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
112 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
113 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
114 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
115 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
116 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
117 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
118 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
119 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
120 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
121 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
122 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
123 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
124 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
125 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
126 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
127 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
128 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
129 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
130 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
131 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
132 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
133 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
134 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
135 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
136 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
137 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
138 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
139 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
140 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
141 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
142 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
143 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
144 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
145 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
146 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
147 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
148 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
149 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
150 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
151 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
152 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
153 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
154 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
155 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
156 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
157 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
158 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
159 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
160 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
161 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
162 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
163 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
164 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
165 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
166 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
167 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
168 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
169 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
170 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
171 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
172 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
173 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
174 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
175 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
176 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
177 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
178 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
179 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
180 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
181 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
182 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
183 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
184 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
185 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
186 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
187 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
188 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
189 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
190 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
191 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
192 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
193 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
194 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
195 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
196 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
197 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
198 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
199 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
200 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
201 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
202 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
203 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
204 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
205 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
206 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
207 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
208 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
209 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
210 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
211 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
212 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
213 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
214 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
215 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
216 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
217 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
218 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
219 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
223 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
225 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
226 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
227 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
279 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
280 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
281 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
286 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
287 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
288 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
289 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
290 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
291 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
292 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
293 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
294 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
295 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
296 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
297 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
298 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
299 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
300 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
301 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
302 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
303 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
304 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
305 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
306 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
307 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
308 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
309 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
310 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
311 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
312 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
313 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
314 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
315 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
316 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
317 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
318 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
319 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
320 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
321 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
322 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
323 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
324 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
325 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
326 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
327 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
328 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
329 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
330 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
331 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
332 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
333 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
334 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
335 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
336 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
337 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
338 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
339 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
340 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
341 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
342 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
343 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
344 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
345 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
346 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
347 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
348 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
349 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
350 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
351 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
352 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
353 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
354 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
355 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
356 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
357 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
358 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
359 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
360 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
361 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
362 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
363 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
364 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
365 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
366 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
367 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
368 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
369 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
370 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
371 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
372 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
373 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
374 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
375 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
376 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
377 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
378 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
379 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
380 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
381 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
382 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
383 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
384 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
385 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
386 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
387 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
388 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
389 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
390 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
391 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
392 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
393 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
394 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
395 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
396 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
397 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
398 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
399 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
400 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
401 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
402 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
403 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
404 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
405 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
406 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
407 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
408 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
409 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
410 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
411 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
412 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
413 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
414 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
415 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
416 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
417 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
418 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
419 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
420 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
421 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
422 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
423 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
424 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
425 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
426 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
427 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
428 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
444 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
445 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
446 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
447 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
448 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
449 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
450 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
451 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
452 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
453 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
454 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
455 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
458 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
459 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
460 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
461 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
462 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
463 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
464 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
465 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
466 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
467 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
468 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
469 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
470 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
471 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
472 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
473 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
474 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
475 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
476 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
477 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
478 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
479 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
480 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
481 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
482 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
483 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
484 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
485 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
486 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
487 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
488 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
489 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
490 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
491 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
492 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
493 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
494 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
495 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
496 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
497 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
498 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
499 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
500 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
501 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
502 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
503 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
504 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
505 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
506 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
507 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
508 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
509 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
510 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
511 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
512 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
513 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
514 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
515 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
516 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
517 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
518 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
519 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
520 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
521 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
522 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
523 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
524 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
525 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
526 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
527 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
528 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
529 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
530 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
531 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
532 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
533 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
534 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
535 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
536 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83
Metatranscriptomes 0.11
Isolates 16.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.95
Nodule 14.73
Rhizoplane 5.58
Rhizosphere 54.91
Stem 0
Stem Tuber 0
Unclassified 10.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10099732 3300002067 Bacteria 834
2 JGI24742J22300_10061538 3300002244 Bacteria 691
3 JGI25165J46597_1012784 3300003214 Bacteria 1166
4 JGI25153J46596_10002568 3300003215 Bacteria 10405
5 JGI25153J46596_10013493 3300003215 Bacteria 3448
6 JGI25153J46596_10014078 3300003215 Bacteria 3345
7 JGI25160J50197_1003238 3300003354 Bacteria 7344
8 JGI25160J50197_1024080 3300003354 Bacteria 1736
9 JGI25404J52841_10015155 3300003659 Bacteria 1673
10 Ga0055525_1007627 3300003759 Bacteria 913
11 Ga0055526_1035800 3300003771 Bacteria 1330
12 Ga0055531_10026099 3300003794 Bacteria 2096
13 Ga0055543_1002483 3300004625 Bacteria 6074
14 Ga0065165_1000866 3300005262 Bacteria 39512
15 Ga0065165_1022843 3300005262 Bacteria 2133
16 Ga0065165_1023762 3300005262 Bacteria 2071
17 Ga0070658_11123532 3300005327 Bacteria 683
18 Ga0070658_11126514 3300005327 Bacteria 682
19 Ga0070690_100769055 3300005330 Bacteria 745
20 Ga0068869_100054968 3300005334 Bacteria 2900
21 Ga0070680_100155993 3300005336 Bacteria 1918
22 Ga0068868_100114720 3300005338 Bacteria 2192
23 Ga0068868_101101890 3300005338 Bacteria 731
24 Ga0070689_100382480 3300005340 Bacteria 1186
25 Ga0070687_100207237 3300005343 Bacteria 1192
26 Ga0070668_100027110 3300005347 Bacteria 4348
27 Ga0070668_100103345 3300005347 Bacteria 2260
28 Ga0070668_100174359 3300005347 Bacteria 1752
29 Ga0070668_100430126 3300005347 Bacteria 1131
30 Ga0070668_100678005 3300005347 Bacteria 907
31 Ga0070671_100999578 3300005355 Bacteria 733
32 Ga0070674_100036028 3300005356 Bacteria 3318
33 Ga0070673_100256983 3300005364 Bacteria 1525
34 Ga0070688_100369324 3300005365 Bacteria 1055
35 Ga0070659_100228749 3300005366 Bacteria 1536
36 Ga0070667_100891271 3300005367 Bacteria 828
37 Ga0070713_100217909 3300005436 Bacteria 1731
38 Ga0070713_100962118 3300005436 Bacteria 823
39 Ga0070663_100059935 3300005455 Bacteria 2736
40 Ga0070663_100145254 3300005455 Bacteria 1814
41 Ga0070663_100189808 3300005455 Bacteria 1598
42 Ga0070663_100656601 3300005455 Bacteria 887
43 Ga0070662_100083187 3300005457 Bacteria 2388
44 Ga0068867_100595080 3300005459 Bacteria 964
45 Ga0070698_100209554 3300005471 Bacteria 1884
46 Ga0070684_100010999 3300005535 Bacteria 7197
47 Ga0070697_100053717 3300005536 Bacteria 3275
48 Ga0068853_100213069 3300005539 Bacteria 1761
49 Ga0068853_100293683 3300005539 Bacteria 1501
50 Ga0070686_100230778 3300005544 Bacteria 1343
51 Ga0070665_100153179 3300005548 Bacteria 2307
52 Ga0070665_100192952 3300005548 Bacteria 2037
53 Ga0070665_100357422 3300005548 Bacteria 1466
54 Ga0070665_100430484 3300005548 Bacteria 1328
55 Ga0068855_100244299 3300005563 Bacteria 2004
56 Ga0068855_100607703 3300005563 Bacteria 1178
57 Ga0070664_100242698 3300005564 Bacteria 1617
58 Ga0070664_100785845 3300005564 Bacteria 890
59 Ga0068856_100508519 3300005614 Bacteria 1226
60 Ga0068856_100869406 3300005614 Bacteria 921
61 Ga0068852_100391971 3300005616 Bacteria 1364
62 Ga0068852_100993822 3300005616 Bacteria 858
63 Ga0068864_100328139 3300005618 Bacteria 1439
64 Ga0068864_100529912 3300005618 Bacteria 1136
65 Ga0068851_10492948 3300005834 Bacteria 734
66 Ga0068870_10109348 3300005840 Bacteria 1576
67 Ga0068870_10500581 3300005840 Bacteria 810
68 Ga0068863_100279776 3300005841 Bacteria 1616
69 Ga0068863_101535728 3300005841 Bacteria 675
70 Ga0068858_100122372 3300005842 Bacteria 2434
71 Ga0068860_100094368 3300005843 Bacteria 2852
72 Ga0068860_101067413 3300005843 Bacteria 826
73 Ga0068862_100079284 3300005844 Bacteria 2846
74 Ga0068862_100305099 3300005844 Bacteria 1466
75 Ga0068862_100381121 3300005844 Bacteria 1315
76 Ga0068862_100496742 3300005844 Bacteria 1157
77 Ga0068862_100609103 3300005844 Bacteria 1049
78 Ga0081455_10050141 3300005937 Bacteria 3592
79 Ga0081455_10071493 3300005937 Bacteria 2876
80 Ga0081540_1001986 3300005983 Bacteria 17063
81 Ga0081540_1003959 3300005983 Bacteria 11507
82 Ga0081540_1016453 3300005983 Bacteria 4627
83 Ga0081540_1040288 3300005983 Bacteria 2436
84 Ga0070717_10684231 3300006028 Bacteria 932
85 Ga0075365_10081939 3300006038 Bacteria 2187
86 Ga0075365_10097363 3300006038 Bacteria 2011
87 Ga0075365_10107281 3300006038 Bacteria 1917
88 Ga0075363_100072768 3300006048 Bacteria 1869
89 Ga0075363_100336746 3300006048 Bacteria 879
90 Ga0075363_100381484 3300006048 Bacteria 826
91 Ga0075364_10095002 3300006051 Bacteria 1981
92 Ga0075364_10186690 3300006051 Bacteria 1404
93 Ga0070715_10245687 3300006163 Bacteria 933
94 Ga0075362_10027219 3300006177 Bacteria 2446
95 Ga0075367_10042624 3300006178 Bacteria 2656
96 Ga0075367_10391503 3300006178 Bacteria 878
97 Ga0075369_10169657 3300006186 Bacteria 1002
98 Ga0075369_10322537 3300006186 Bacteria 723
99 Ga0075366_10224491 3300006195 Bacteria 1144
100 Ga0075366_10243457 3300006195 Bacteria 1096
101 Ga0075366_10268549 3300006195 Bacteria 1042
102 Ga0097621_100956827 3300006237 Bacteria 800
103 Ga0075370_10177315 3300006353 Bacteria 1254
104 Ga0075370_10220280 3300006353 Bacteria 1121
105 Ga0075370_10223711 3300006353 Bacteria 1112
106 Ga0075428_100196472 3300006844 Bacteria 2181
107 Ga0068865_100101744 3300006881 Bacteria 2105
108 Ga0068865_100373720 3300006881 Bacteria 1161
109 Ga0075436_100777904 3300006914 Bacteria 712
110 Ga0105240_10020447 3300009093 Bacteria 8829
111 Ga0105240_11357177 3300009093 Bacteria 748
112 Ga0105245_11092254 3300009098 Bacteria 844
113 Ga0105247_10063969 3300009101 Bacteria 2285
114 Ga0105247_10206866 3300009101 Bacteria 1322
115 Ga0114129_10527086 3300009147 Bacteria 1539
116 Ga0105243_10031732 3300009148 Bacteria 4075
117 Ga0105243_10432358 3300009148 Bacteria 1231
118 Ga0105243_10457568 3300009148 Bacteria 1199
119 Ga0105243_10473269 3300009148 Bacteria 1181
120 Ga0105241_10049513 3300009174 Bacteria 3200
121 Ga0105241_10140618 3300009174 Bacteria 1965
122 Ga0105241_11195539 3300009174 Bacteria 720
123 Ga0105242_10608441 3300009176 Bacteria 1057
124 Ga0105242_11156961 3300009176 Bacteria 791
125 Ga0105248_10505669 3300009177 Bacteria 1362
126 Ga0105237_10068396 3300009545 Bacteria 3545
127 Ga0105238_10693667 3300009551 Bacteria 1030
128 Ga0105249_10305151 3300009553 Bacteria 1598
129 Ga0105249_11349016 3300009553 Bacteria 785
130 Ga0099796_10148941 3300010159 Bacteria 920
131 Ga0105239_10053578 3300010375 Bacteria 4425
132 Ga0105239_10136576 3300010375 Bacteria 2730
133 Ga0105239_10438457 3300010375 Bacteria 1481
134 Ga0105239_10506257 3300010375 Bacteria 1373
135 Ga0105239_10584380 3300010375 Bacteria 1273
136 Ga0105239_10656958 3300010375 Bacteria 1198
137 Ga0105239_11424524 3300010375 Bacteria 800
138 Ga0157373_10649584 3300013100 Bacteria 770
139 Ga0157370_10248815 3300013104 Bacteria 1644
140 Ga0157374_10514938 3300013296 Bacteria 1202
141 Ga0157374_10787273 3300013296 Bacteria 966
142 Ga0157378_10301137 3300013297 Bacteria 1552
143 Ga0163162_10605859 3300013306 Bacteria 1221
144 Ga0157375_10273504 3300013308 Bacteria 1851
145 Ga0157375_10768747 3300013308 Bacteria 1114
146 Ga0163163_10117591 3300014325 Bacteria 2690
147 Ga0163163_10297644 3300014325 Bacteria 1666
148 Ga0163163_10957050 3300014325 Bacteria 919
149 Ga0163163_11037067 3300014325 Bacteria 883
150 Ga0157379_10389004 3300014968 Bacteria 1280
151 Ga0157376_11212705 3300014969 Bacteria 783
152 Ga0214544_1000001 3300021320 Bacteria 783667
153 Ga0214544_1024413 3300021320 Bacteria 3140
154 Ga0214542_1000005 3300021321 Bacteria 389646
155 Ga0214542_1022513 3300021321 Bacteria 4021
156 Ga0214545_1000003 3300021324 Bacteria 720274
157 Ga0214545_1013953 3300021324 Bacteria 9654
158 Ga0214543_1000002 3300021327 Bacteria 712733
159 Ga0214543_1036318 3300021327 Bacteria 1543
160 Ga0213872_10143744 3300021361 Bacteria 1045
161 Ga0213874_10023666 3300021377 Bacteria 1716
162 Ga0213876_10372511 3300021384 Bacteria 759
163 Ga0213875_10034375 3300021388 Bacteria 2393
164 Ga0213871_10006629 3300021441 Bacteria 2460
165 Ga0209563_112577 3300025230 Bacteria 1152
166 Ga0209677_101244 3300025253 Bacteria 11496
167 Ga0209677_104808 3300025253 Bacteria 3741
168 Ga0209148_1000253 3300025254 Bacteria 84643
169 Ga0209233_1001970 3300025261 Bacteria 7805
170 Ga0209233_1009212 3300025261 Bacteria 3015
171 Ga0209455_1001785 3300025272 Bacteria 9087
172 Ga0209455_1005205 3300025272 Bacteria 4072
173 Ga0209455_1006143 3300025272 Bacteria 3598
174 Ga0209455_1027323 3300025272 Bacteria 1012
175 Ga0209564_1005010 3300025295 Bacteria 7778
176 Ga0209564_1016256 3300025295 Bacteria 2974
177 Ga0209758_1000026 3300025297 Bacteria 582706
178 Ga0209758_1000318 3300025297 Bacteria 92807
179 Ga0209758_1001423 3300025297 Bacteria 28319
180 Ga0209758_1002424 3300025297 Bacteria 19060
181 Ga0209758_1003005 3300025297 Bacteria 16142
182 Ga0209758_1038631 3300025297 Bacteria 1828
183 Ga0207426_1000425 3300025302 Bacteria 69088
184 Ga0207426_1001506 3300025302 Bacteria 19028
185 Ga0207426_1019039 3300025302 Bacteria 2407
186 Ga0207426_1019633 3300025302 Bacteria 2360
187 Ga0209051_1079705 3300025303 Bacteria 950
188 Ga0209051_1103626 3300025303 Bacteria 759
189 Ga0209257_1002846 3300025304 Bacteria 16199
190 Ga0207697_10119290 3300025315 Bacteria 1134
191 Ga0207696_1077826 3300025711 Bacteria 918
192 Ga0207710_10193016 3300025900 Bacteria 1003
193 Ga0207680_10303059 3300025903 Bacteria 1114
194 Ga0207680_10370781 3300025903 Bacteria 1008
195 Ga0207647_10080325 3300025904 Bacteria 1956
196 Ga0207647_10130615 3300025904 Bacteria 1476
197 Ga0207647_10220191 3300025904 Bacteria 1094
198 Ga0207647_10386612 3300025904 Bacteria 789
199 Ga0207699_10075887 3300025906 Bacteria 2069
200 Ga0207645_10218177 3300025907 Bacteria 1257
201 Ga0207643_10011341 3300025908 Bacteria 4813
202 Ga0207643_10067803 3300025908 Bacteria 2049
203 Ga0207654_10016046 3300025911 Bacteria 3896
204 Ga0207654_10502014 3300025911 Bacteria 857
205 Ga0207707_10171584 3300025912 Bacteria 1895
206 Ga0207707_10833602 3300025912 Bacteria 766
207 Ga0207695_10000634 3300025913 Bacteria 70325
208 Ga0207671_10011863 3300025914 Bacteria 7053
209 Ga0207671_10150853 3300025914 Bacteria 1796
210 Ga0207693_10481253 3300025915 Bacteria 969
211 Ga0207693_10622476 3300025915 Bacteria 839
212 Ga0207663_10049899 3300025916 Bacteria 2598
213 Ga0207662_10560122 3300025918 Bacteria 792
214 Ga0207657_10007164 3300025919 Bacteria 11456
215 Ga0207649_10631726 3300025920 Bacteria 826
216 Ga0207646_10222438 3300025922 Bacteria 1705
217 Ga0207681_10908983 3300025923 Bacteria 737
218 Ga0207659_10301607 3300025926 Bacteria 1316
219 Ga0207687_10109786 3300025927 Bacteria 2044
220 Ga0207700_10086666 3300025928 Bacteria 2461
221 Ga0207644_10143966 3300025931 Bacteria 1838
222 Ga0207644_10577049 3300025931 Bacteria 932
223 Ga0207690_10104373 3300025932 Bacteria 2030
224 Ga0207690_10560745 3300025932 Bacteria 929
225 Ga0207706_10027445 3300025933 Bacteria 5090
226 Ga0207706_10280768 3300025933 Bacteria 1452
227 Ga0207706_10436772 3300025933 Bacteria 1133
228 Ga0207709_10033563 3300025935 Bacteria 3015
229 Ga0207669_10017298 3300025937 Bacteria 3693
230 Ga0207704_10079727 3300025938 Bacteria 2111
231 Ga0207691_10172079 3300025940 Bacteria 1896
232 Ga0207711_10758307 3300025941 Bacteria 904
233 Ga0207661_10006721 3300025944 Bacteria 8137
234 Ga0207679_10654677 3300025945 Bacteria 950
235 Ga0207667_10142283 3300025949 Bacteria 2470
236 Ga0207667_10886806 3300025949 Bacteria 884
237 Ga0207667_10894275 3300025949 Bacteria 880
238 Ga0207651_10521423 3300025960 Bacteria 1030
239 Ga0207651_10621345 3300025960 Bacteria 946
240 Ga0207651_10792171 3300025960 Bacteria 840
241 Ga0207668_10024406 3300025972 Bacteria 3901
242 Ga0207668_10087629 3300025972 Bacteria 2277
243 Ga0207668_10245346 3300025972 Bacteria 1451
244 Ga0207668_10253140 3300025972 Bacteria 1431
245 Ga0207668_10319083 3300025972 Bacteria 1288
246 Ga0207668_10769404 3300025972 Bacteria 850
247 Ga0207640_10295965 3300025981 Bacteria 1278
248 Ga0207658_10395367 3300025986 Bacteria 1214
249 Ga0207677_10104387 3300026023 Bacteria 2094
250 Ga0207703_10134202 3300026035 Bacteria 2141
251 Ga0207639_10102083 3300026041 Bacteria 2321
252 Ga0207678_10012307 3300026067 Bacteria 7512
253 Ga0207678_10123704 3300026067 Bacteria 2207
254 Ga0207678_10212311 3300026067 Bacteria 1656
255 Ga0207678_10284104 3300026067 Bacteria 1421
256 Ga0207678_10551168 3300026067 Bacteria 1008
257 Ga0207678_11047033 3300026067 Bacteria 722
258 Ga0207702_10477016 3300026078 Bacteria 1213
259 Ga0207702_11376308 3300026078 Bacteria 699
260 Ga0207641_10837203 3300026088 Bacteria 911
261 Ga0207648_10361808 3300026089 Bacteria 1309
262 Ga0207676_10273967 3300026095 Bacteria 1529
263 Ga0207676_10346204 3300026095 Bacteria 1373
264 Ga0207676_10397436 3300026095 Bacteria 1287
265 Ga0207674_10206443 3300026116 Bacteria 1914
266 Ga0207674_11176811 3300026116 Bacteria 736
267 Ga0207675_100420333 3300026118 Bacteria 1320
268 Ga0207675_100644472 3300026118 Bacteria 1065
269 Ga0207683_10074762 3300026121 Bacteria 2998
270 Ga0207683_10150767 3300026121 Bacteria 2098
271 Ga0207683_10683100 3300026121 Bacteria 951
272 Ga0207698_10044442 3300026142 Bacteria 3338
273 Ga0207698_10078408 3300026142 Bacteria 2652
274 Ga0207698_10100030 3300026142 Bacteria 2400
275 Ga0209389_1000119 3300027296 Bacteria 70614
276 Ga0209589_1000010 3300027357 Bacteria 237657
277 Ga0209489_100011 3300027361 Bacteria 244710
278 Ga0209588_1027398 3300027671 Bacteria 1813
279 Ga0268266_10011601 3300028379 Bacteria 7649
280 Ga0268266_10036772 3300028379 Bacteria 4170
281 Ga0268266_10223403 3300028379 Bacteria 1732
282 Ga0268266_10525109 3300028379 Bacteria 1132
283 Ga0268265_10131182 3300028380 Bacteria 2082
284 Ga0268265_10613252 3300028380 Bacteria 1041
285 Ga0268265_10727174 3300028380 Bacteria 961
286 Ga0268265_10728730 3300028380 Bacteria 960
287 Ga0268264_10283920 3300028381 Bacteria 1552
288 Ga0268264_11063358 3300028381 Bacteria 817
289 Ga0307517_10090077 3300028786 Bacteria 2520
290 Ga0307515_10066890 3300028794 Bacteria 4968
291 Ga0307515_10334080 3300028794 Bacteria 1172
292 Ga0265340_10031864 3300031247 Bacteria 2634
293 Ga0265339_10000560 3300031249 Bacteria 29070
294 Ga0307509_10336075 3300031507 Bacteria 1240
295 Ga0307509_10379289 3300031507 Bacteria 1127
296 Ga0307508_10146942 3300031616 Bacteria 1962
297 Ga0307516_10259187 3300031730 Bacteria 1430
298 Ga0307410_10875830 3300031852 Bacteria 768
299 Ga0307410_10885970 3300031852 Bacteria 764
300 Ga0307407_10325433 3300031903 Bacteria 1080
301 Ga0307409_101535943 3300031995 Bacteria 693
302 Ga0307414_11188442 3300032004 Bacteria 706
303 Ga0307415_101024222 3300032126 Bacteria 769
304 Ga0307510_10024022 3300033180 Bacteria 7052
305 Ga0315911_1000010 3300033442 Bacteria 322197
306 Ga0316215_1006361 3300033544 Bacteria 1146
307 Ga0373926_0141324 3300035083 Bacteria 914
308 Ga0373923_0031344 3300035111 Bacteria 2143
309 Ga0373953_0176796 3300035117 Bacteria 920
310 Ga0373954_0081325 3300035118 Bacteria 1548
311 Ga0373946_0008409 3300035171 Bacteria 3785
312 Ga0373955_0240830 3300035172 Bacteria 1083
313 Ga0373927_0002264 3300035695 Bacteria 14111
314 Ga0373947_0002643 3300035725 Bacteria 10768
315 Ga0373937_0019313 3300036401 Bacteria 6098
316 Ga0372808_001288 3300036459 Bacteria 2538
317 Ga0373925_0003737 3300037068 Bacteria 11690
318 Ga0373925_0279007 3300037068 Bacteria 1345
319 Ga0395899_0059903 3300037312 Bacteria 2806
320 Ga0395899_0244671 3300037312 Bacteria 1233
321 Ga0395900_0048961 3300037418 Bacteria 4353
322 Ga0395900_0088980 3300037418 Bacteria 3174
323 Ga0395898_0017014 3300037466 Bacteria 7425
324 Ga0395898_0065085 3300037466 Bacteria 3535
325 Ga0395898_0268082 3300037466 Bacteria 1628
326 Ga0436364_0061231 3300037853 Bacteria 3861
327 Ga0436364_0519888 3300037853 Bacteria 978
328 Ga0436364_1454126 3300037853 Bacteria 2022
329 Ga0395901_0058832 3300038443 Bacteria 3998
330 Ga0436365_0773004 3300039437 Bacteria 3824
331 Ga0436365_1149951 3300039437 Bacteria 772
332 Ga0436365_1815196 3300039437 Bacteria 2164
333 Ga0436360_0311998 3300039438 Bacteria 930
334 Ga0436360_0328780 3300039438 Bacteria 3141
335 Ga0436361_0069223 3300039447 Bacteria 1591
336 Ga0436361_0510320 3300039447 Bacteria 2081
337 Ga0436363_0834736 3300039450 Bacteria 766
338 Ga0436363_1464422 3300039450 Bacteria 3283
339 Ga0451793_0044027 3300041452 Bacteria 1204
340 Ga0451843_1629634 3300041509 Bacteria 869
341 Ga0466969_0029006 3300044656 Bacteria 2828
342 Ga0466969_0163561 3300044656 Bacteria 1022
343 Ga0466972_0000090 3300044658 Bacteria 82487
344 Ga0466972_0056993 3300044658 Bacteria 1877
345 Ga0466966_0342790 3300044684 Bacteria 898
346 Ga0466961_0000081 3300044693 Bacteria 59450
347 Ga0466963_0416354 3300044694 Bacteria 948
348 Ga0466963_0668589 3300044694 Bacteria 733
349 Ga0466970_0029783 3300044765 Bacteria 2877
350 Ga0466957_0639696 3300044842 Bacteria 747
351 Ga0466960_0197477 3300044901 Bacteria 1098
352 Ga0466959_0004686 3300045049 Bacteria 9205
353 Ga0466959_0162169 3300045049 Bacteria 1571
354 Ga0466967_0212089 3300045976 Bacteria 1837
355 Ga0466967_1178008 3300045976 Bacteria 763
356 Ga0495617_029495 3300046452 Bacteria 1844
357 Ga0495617_078863 3300046452 Bacteria 1079
358 Ga0495603_0002182 3300046455 Bacteria 11513
359 Ga0495603_0106070 3300046455 Bacteria 1639
360 Ga0495590_0047429 3300046457 Bacteria 1498
361 Ga0495629_0000226 3300046459 Bacteria 50363
362 Ga0495629_0024603 3300046459 Bacteria 4287
363 Ga0495629_0076212 3300046459 Bacteria 2342
364 Ga0495638_0009527 3300046460 Bacteria 6809
365 Ga0495638_0196767 3300046460 Bacteria 1140
366 Ga0495638_0224898 3300046460 Bacteria 1047
367 Ga0495641_0082969 3300046461 Bacteria 1435
368 Ga0495651_0170800 3300046462 Bacteria 1548
369 Ga0495653_0245980 3300046463 Bacteria 1189
370 Ga0495650_0045495 3300046471 Bacteria 1848
371 Ga0495580_0002229 3300046472 Bacteria 16931
372 Ga0495582_0000106 3300046473 Bacteria 43588
373 Ga0495605_0085148 3300046474 Bacteria 1473
374 Ga0495639_0000912 3300046475 Bacteria 13341
375 Ga0495639_0072285 3300046475 Bacteria 1595
376 Ga0495662_0000112 3300046476 Bacteria 30326
377 Ga0495662_0060449 3300046476 Bacteria 1830
378 Ga0495664_0013066 3300046477 Bacteria 4708
379 Ga0495585_0024609 3300046492 Bacteria 3451
380 Ga0495594_0025944 3300046499 Bacteria 3151
381 Ga0495594_0249620 3300046499 Bacteria 1011
382 Ga0495596_0100590 3300046500 Bacteria 1122
383 Ga0495583_0132350 3300046506 Bacteria 1043
384 Ga0495606_0110756 3300046507 Bacteria 1656
385 Ga0495606_0110891 3300046507 Bacteria 1655
386 Ga0495606_0289373 3300046507 Bacteria 892
387 Ga0495606_0292020 3300046507 Bacteria 887
388 Ga0495608_0029753 3300046511 Bacteria 3702
389 Ga0495608_0172768 3300046511 Bacteria 1370
390 Ga0495616_0124502 3300046513 Bacteria 1187
391 Ga0495628_0035863 3300046516 Bacteria 3984
392 Ga0495628_0085095 3300046516 Bacteria 2453
393 Ga0495630_0050483 3300046517 Bacteria 3113
394 Ga0495631_0144906 3300046518 Bacteria 1020
395 Ga0495643_0035822 3300046522 Bacteria 2730
396 Ga0495648_0173409 3300046524 Bacteria 1103
397 Ga0495663_0058933 3300046525 Bacteria 1204
398 Ga0495666_0037053 3300046526 Bacteria 2373
399 Ga0495642_0218245 3300046528 Bacteria 832
400 Ga0495642_0259312 3300046528 Bacteria 760
401 Ga0495652_0122765 3300046529 Bacteria 2068
402 Ga0495652_0177443 3300046529 Bacteria 1638
403 Ga0495652_0289271 3300046529 Bacteria 1196
404 Ga0495665_0000254 3300046531 Bacteria 26918
405 Ga0495665_0207098 3300046531 Bacteria 1016
406 Ga0495640_0003800 3300046533 Bacteria 12124
407 Ga0495640_0014514 3300046533 Bacteria 5956
408 Ga0495640_0090953 3300046533 Bacteria 2014
409 Ga0495586_0377784 3300046535 Bacteria 815
410 Ga0495587_0025877 3300046536 Bacteria 3582
411 Ga0495609_0049819 3300046538 Bacteria 1868
412 Ga0495645_0036139 3300046543 Bacteria 3601
413 Ga0495622_0015939 3300046557 Bacteria 3495
414 Ga0495622_0116669 3300046557 Bacteria 1220
415 Ga0495667_0025678 3300046559 Bacteria 3968
416 Ga0495667_0041560 3300046559 Bacteria 3049
417 Ga0495656_0045238 3300046615 Bacteria 1857
418 Ga0495656_0062277 3300046615 Bacteria 1631
419 Ga0495656_0190985 3300046615 Bacteria 1011
420 Ga0495668_0183122 3300046616 Bacteria 1147
421 Ga0495634_0001436 3300046642 Bacteria 21216
422 Ga0495634_0105948 3300046642 Bacteria 1812
423 Ga0495611_0053499 3300046648 Bacteria 1822
424 Ga0495625_0164563 3300046660 Bacteria 1484
425 Ga0495625_0203821 3300046660 Bacteria 1304
426 Ga0495625_0480560 3300046660 Bacteria 763
427 Ga0495635_0003067 3300046663 Bacteria 11493
428 Ga0495635_0007905 3300046663 Bacteria 7430
429 Ga0495659_0064408 3300046664 Bacteria 1361
430 Ga0495588_0053957 3300046674 Bacteria 2073
431 Ga0495588_0058529 3300046674 Bacteria 1992
432 Ga0495657_0069160 3300046675 Bacteria 2311
433 Ga0495657_0178219 3300046675 Bacteria 1306
434 Ga0495599_0118484 3300046678 Bacteria 1646
435 Ga0495646_0014484 3300046680 Bacteria 5014
436 Ga0495646_0202850 3300046680 Bacteria 1079
437 Ga0495646_0364343 3300046680 Bacteria 755
438 Ga0495647_0003957 3300046681 Bacteria 4779
439 Ga0495658_0000964 3300046683 Bacteria 15307
440 Ga0495613_0004538 3300046689 Bacteria 10410
441 Ga0495624_0005560 3300046690 Bacteria 9067
442 Ga0495624_0031167 3300046690 Bacteria 3470
443 Ga0495624_0132644 3300046690 Bacteria 1527
444 Ga0495671_0205245 3300046692 Bacteria 955
445 Ga0495649_0187311 3300046694 Bacteria 1078
446 Ga0495589_0298561 3300046794 Bacteria 747
447 Ga0495589_0314038 3300046794 Bacteria 725
448 Ga0495581_0011778 3300047315 Bacteria 5064
449 Ga0495581_0258984 3300047315 Bacteria 1017
450 Ga0495581_0571888 3300047315 Bacteria 655
451 Ga0495604_0043292 3300047317 Bacteria 3525
452 Ga0495604_0152792 3300047317 Bacteria 1638
453 Ga0495604_0273398 3300047317 Bacteria 1144
454 Ga0495636_0105230 3300047318 Bacteria 1237
455 Ga0495674_0000082 3300047319 Bacteria 65609
456 Ga0495674_0164710 3300047319 Bacteria 1853
457 Ga0495676_0064463 3300047321 Bacteria 2849
458 Ga0495676_0119649 3300047321 Bacteria 1918
459 Ga0495687_125916 3300047443 Bacteria 916
460 Ga0495679_076280 3300047446 Bacteria 958
461 Ga0495673_0096644 3300047469 Bacteria 1200
462 Ga0495673_0126263 3300047469 Bacteria 1009
463 Ga0495673_0174666 3300047469 Bacteria 817
464 Ga0495681_0205167 3300047470 Bacteria 797
465 Ga0495684_0220676 3300047471 Bacteria 1390
466 Ga0495686_0320450 3300047472 Bacteria 850
467 Ga0495593_0000366 3300047673 Bacteria 24885
468 Ga0495593_0151693 3300047673 Bacteria 1172
469 Ga0495615_0091377 3300048090 Bacteria 849
470 Ga0496100_0146404 3300048903 Bacteria 1680
471 Ga0496100_0175206 3300048903 Bacteria 1548
472 Ga0496101_0128387 3300048904 Bacteria 1923
473 Ga0496101_0167983 3300048904 Bacteria 1685
474 Ga0496101_0294557 3300048904 Bacteria 1270
475 Ga0496101_0315838 3300048904 Bacteria 1225
476 Ga0496102_0028006 3300048905 Bacteria 5034
477 Ga0496102_0272253 3300048905 Bacteria 1596
478 Ga0496102_0312772 3300048905 Bacteria 1480
479 Ga0496102_0517080 3300048905 Bacteria 1116
480 Ga0496102_0605122 3300048905 Bacteria 1019
481 Ga0496103_0049599 3300048906 Bacteria 2596
482 Ga0496103_0153197 3300048906 Bacteria 1477
483 Ga0496104_0018741 3300048907 Bacteria 6319
484 Ga0496104_0094155 3300048907 Bacteria 2865
485 Ga0496104_0617018 3300048907 Bacteria 994
486 Ga0496105_0039541 3300048908 Bacteria 3887
487 Ga0496105_0060956 3300048908 Bacteria 3113
488 Ga0496105_0875258 3300048908 Bacteria 678
489 Ga0496106_0063785 3300048909 Bacteria 2801
490 Ga0496106_0075362 3300048909 Bacteria 2584
491 Ga0496106_0427572 3300048909 Bacteria 1064
492 Ga0496108_0225193 3300048911 Bacteria 1630
493 Ga0496109_0377061 3300048912 Bacteria 1340
494 Ga0496109_0434291 3300048912 Bacteria 1240
495 Ga0496110_0302099 3300048913 Bacteria 1458
496 Ga0496110_0319405 3300048913 Bacteria 1414
497 Ga0496111_0129099 3300048914 Bacteria 1870
498 Ga0496111_0200918 3300048914 Bacteria 1482
499 Ga0496112_0056454 3300048915 Bacteria 3864
500 Ga0496112_0111276 3300048915 Bacteria 2708
501 Ga0496112_0135064 3300048915 Bacteria 2437
502 Ga0496112_0177824 3300048915 Bacteria 2092
503 Ga0496112_0312574 3300048915 Bacteria 1516
504 Ga0496113_0167143 3300048916 Bacteria 1741
505 Ga0496113_0251146 3300048916 Bacteria 1412
506 Ga0496113_0432927 3300048916 Bacteria 1057
507 Ga0496113_0518166 3300048916 Bacteria 957
508 Ga0496113_0527634 3300048916 Bacteria 948
509 Ga0496113_0531910 3300048916 Bacteria 943
510 Ga0496114_0080842 3300048917 Bacteria 2745
511 Ga0496114_0309072 3300048917 Bacteria 1396
512 Ga0496114_0377859 3300048917 Bacteria 1254
513 Ga0496114_0630215 3300048917 Bacteria 944
514 Ga0496114_0730982 3300048917 Bacteria 866
515 Ga0496115_0040830 3300048918 Bacteria 3690
516 Ga0496115_0404418 3300048918 Bacteria 1107
517 Ga0496115_0414070 3300048918 Bacteria 1092
518 Ga0496115_0959265 3300048918 Bacteria 656
519 Ga0496116_0052983 3300048919 Bacteria 2683
520 Ga0496116_0185014 3300048919 Bacteria 1110
521 Ga0496117_0062962 3300048920 Bacteria 2538
522 Ga0496118_0115545 3300048921 Bacteria 1766
523 Ga0496118_0131278 3300048921 Bacteria 1608
524 Ga0496118_0248457 3300048921 Bacteria 1012
525 Ga0496118_0268327 3300048921 Bacteria 958
526 Ga0496119_0026612 3300048922 Bacteria 4005
527 Ga0496119_0080598 3300048922 Bacteria 1877
528 Ga0496119_0102232 3300048922 Bacteria 1607
529 Ga0496119_0198660 3300048922 Bacteria 1039
530 Ga0496119_0293466 3300048922 Bacteria 804
531 Ga0496120_0064229 3300048923 Bacteria 2038
532 Ga0496120_0126770 3300048923 Bacteria 1312
533 Ga0496121_0015225 3300048924 Bacteria 8082
534 Ga0496121_0038564 3300048924 Bacteria 4227
535 Ga0496121_0148782 3300048924 Bacteria 1726
536 Ga0496121_0198200 3300048924 Bacteria 1433
537 Ga0496121_0228637 3300048924 Bacteria 1304
538 Ga0496121_0268621 3300048924 Bacteria 1173
539 Ga0496121_0275729 3300048924 Bacteria 1153
540 Ga0496121_0335218 3300048924 Bacteria 1013
541 Ga0496121_0397174 3300048924 Bacteria 904
542 Ga0496121_0419502 3300048924 Bacteria 871
543 Ga0496122_0128139 3300048925 Bacteria 1620
544 Ga0496122_0147775 3300048925 Bacteria 1457
545 Ga0496124_0206840 3300048927 Bacteria 1488
546 Ga0496124_0213561 3300048927 Bacteria 1458
547 Ga0496124_0226758 3300048927 Bacteria 1400
548 Ga0496124_0340109 3300048927 Bacteria 1066
549 Ga0496124_0460478 3300048927 Bacteria 864
550 Ga0496125_0009522 3300048928 Bacteria 9970
551 Ga0496125_0329781 3300048928 Bacteria 921
552 Ga0496125_0431463 3300048928 Bacteria 761
553 Ga0496125_0488078 3300048928 Bacteria 696
554 Ga0496126_0018494 3300048929 Bacteria 6900
555 Ga0496126_0047692 3300048929 Bacteria 3921
556 Ga0496126_0082642 3300048929 Bacteria 2837
557 Ga0496126_0175970 3300048929 Bacteria 1820
558 Ga0496126_0186473 3300048929 Bacteria 1759
559 Ga0496126_0201303 3300048929 Bacteria 1681
560 Ga0496126_0322087 3300048929 Bacteria 1270
561 Ga0496126_0409929 3300048929 Bacteria 1097
562 Ga0495682_0072104 3300049460 Bacteria 1243
563 Ga0495682_0154918 3300049460 Bacteria 817
564 Ga0501031_0026577 3300049568 Bacteria 3773
565 Ga0501031_0089978 3300049568 Bacteria 2001
566 Ga0501031_0121919 3300049568 Bacteria 1703
567 Ga0501031_0365092 3300049568 Bacteria 934
568 Ga0501032_0015059 3300049569 Bacteria 5463
569 Ga0501032_0124575 3300049569 Bacteria 1702
570 Ga0501032_0148800 3300049569 Bacteria 1540
571 Ga0501032_0268621 3300049569 Bacteria 1105
572 Ga0501033_0004699 3300049570 Bacteria 10929
573 Ga0501033_0430804 3300049570 Bacteria 917
574 Ga0501033_0684654 3300049570 Bacteria 698
575 Ga0501034_0095256 3300049571 Bacteria 2973
576 Ga0501034_0203318 3300049571 Bacteria 1938
577 Ga0501034_0276913 3300049571 Bacteria 1618
578 Ga0501034_0392025 3300049571 Bacteria 1313
579 Ga0501034_0465658 3300049571 Bacteria 1180
580 Ga0501036_0046620 3300049572 Bacteria 3670
581 Ga0501036_0104377 3300049572 Bacteria 2396
582 Ga0501036_0124864 3300049572 Bacteria 2173
583 Ga0501036_0329957 3300049572 Bacteria 1275
584 Ga0501036_0392034 3300049572 Bacteria 1158
585 Ga0501037_0000396 3300049573 Bacteria 36209
586 Ga0501037_0021148 3300049573 Bacteria 4807
587 Ga0501037_0032014 3300049573 Bacteria 3882
588 Ga0501037_0060449 3300049573 Bacteria 2763
589 Ga0501037_0151826 3300049573 Bacteria 1655
590 Ga0501038_0002046 3300049574 Bacteria 18655
591 Ga0501038_0004875 3300049574 Bacteria 12463
592 Ga0501038_0017078 3300049574 Bacteria 6564
593 Ga0501038_0124817 3300049574 Bacteria 2119
594 Ga0501038_0162407 3300049574 Bacteria 1814
595 Ga0501038_0185717 3300049574 Bacteria 1675
596 Ga0501039_0006453 3300049575 Bacteria 8914
597 Ga0501039_0094817 3300049575 Bacteria 2326
598 Ga0501039_0173660 3300049575 Bacteria 1694
599 Ga0501040_0059511 3300049576 Bacteria 2624
600 Ga0501041_0115755 3300049577 Bacteria 1664
601 Ga0501041_0124805 3300049577 Bacteria 1602
602 Ga0501042_0010829 3300049578 Bacteria 6132
603 Ga0501042_0306328 3300049578 Bacteria 1147
604 Ga0501042_0609811 3300049578 Bacteria 793
605 Ga0501043_0009493 3300049579 Bacteria 7630
606 Ga0501043_0107537 3300049579 Bacteria 2190
607 Ga0501043_0127453 3300049579 Bacteria 1996
608 Ga0501043_0232314 3300049579 Bacteria 1424
609 Ga0501043_0375178 3300049579 Bacteria 1077
610 Ga0501046_0011234 3300049580 Bacteria 7666
611 Ga0501046_0012369 3300049580 Bacteria 7269
612 Ga0501046_0036451 3300049580 Bacteria 3957
613 Ga0501046_0120977 3300049580 Bacteria 1991
614 Ga0501046_0238617 3300049580 Bacteria 1341
615 Ga0501047_0084506 3300049581 Bacteria 3050
616 Ga0501047_0180578 3300049581 Bacteria 1977
617 Ga0501047_0183263 3300049581 Bacteria 1960
618 Ga0501047_0186509 3300049581 Bacteria 1939
619 Ga0501047_0227279 3300049581 Bacteria 1720
620 Ga0501047_0381294 3300049581 Bacteria 1244
621 Ga0501047_0430356 3300049581 Bacteria 1150
622 Ga0501047_0961988 3300049581 Bacteria 667
623 Ga0501048_0073468 3300049582 Bacteria 2413
624 Ga0501048_0197293 3300049582 Bacteria 1427
625 Ga0501067_0008905 3300049583 Bacteria 5560
626 Ga0501067_0083746 3300049583 Bacteria 1769
627 Ga0501068_0033304 3300049584 Bacteria 3068
628 Ga0501068_0060477 3300049584 Bacteria 2300
629 Ga0501068_0077477 3300049584 Bacteria 2036
630 Ga0501068_0310137 3300049584 Bacteria 1011
631 Ga0501069_0059634 3300049585 Bacteria 2129
632 Ga0501069_0061227 3300049585 Bacteria 2101
633 Ga0501070_0025427 3300049586 Bacteria 4966
634 Ga0501070_0173313 3300049586 Bacteria 1777
635 Ga0501070_0722157 3300049586 Bacteria 787
636 Ga0501070_0997429 3300049586 Bacteria 649
637 Ga0501071_0062939 3300049587 Bacteria 2689
638 Ga0501073_0036008 3300049589 Bacteria 3517
639 Ga0501073_0198639 3300049589 Bacteria 1387
640 Ga0501073_0225265 3300049589 Bacteria 1295
641 Ga0501073_0708173 3300049589 Bacteria 695
642 Ga0501074_0041848 3300049590 Bacteria 3315
643 Ga0501076_0072201 3300049592 Bacteria 2762
644 Ga0501076_0588593 3300049592 Bacteria 918
645 Ga0501079_0055313 3300049741 Bacteria 3062
646 Ga0501080_0079464 3300049742 Bacteria 3049
647 Ga0501080_0241801 3300049742 Bacteria 1647
648 Ga0501080_0323017 3300049742 Bacteria 1397
649 Ga0501080_0356239 3300049742 Bacteria 1321
650 Ga0501080_0588663 3300049742 Bacteria 988
651 Ga0501081_0735241 3300049743 Bacteria 741
652 Ga0501083_0019398 3300049744 Bacteria 4738
653 Ga0501035_0005535 3300049822 Bacteria 11936
654 Ga0501035_0089419 3300049822 Bacteria 2712
655 Ga0501035_0393301 3300049822 Bacteria 1154
656 Ga0501035_0487840 3300049822 Bacteria 1015
657 Ga0501044_0000266 3300049823 Bacteria 66205
658 Ga0501044_0086969 3300049823 Bacteria 3157
659 Ga0501044_0087043 3300049823 Bacteria 3155
660 Ga0501044_0154144 3300049823 Bacteria 2278
661 Ga0501044_0184866 3300049823 Bacteria 2049
662 Ga0501044_0221756 3300049823 Bacteria 1841
663 Ga0501045_0061052 3300049824 Bacteria 2764
664 Ga0501045_0506427 3300049824 Bacteria 897
665 Ga0501045_0654631 3300049824 Bacteria 776
666 nmdc:mga03683_35414_c1 3300050489 Bacteria 2025
667 nmdc:mga03683_59279_c1 3300050489 Bacteria 1614
668 nmdc:mga03n38_184883_c1 3300050490 Bacteria 1070
669 nmdc:mga00v17_181630_c1 3300050491 Bacteria 1357
670 nmdc:mga00v17_212175_c1 3300050491 Bacteria 1253
671 nmdc:mga00v17_63879_c2 3300050491 Bacteria 763
672 nmdc:mga0yw44_152509_c1 3300050492 Bacteria 1508
673 nmdc:mga0yw44_255443_c1 3300050492 Bacteria 1167
674 nmdc:mga0yw44_467598_c1 3300050492 Bacteria 855
675 nmdc:mga0yw44_71145_c1 3300050492 Bacteria 2159
676 nmdc:mga0yw44_7902_c1 3300050492 Bacteria 5268
677 nmdc:mga0k408_588395_c1 3300050493 Bacteria 657
678 nmdc:mga06z11_396588_c1 3300050494 Bacteria 830
679 nmdc:mga06z11_44141_c1 3300050494 Bacteria 2246
680 nmdc:mga06z11_86718_c1 3300050494 Bacteria 989
681 nmdc:mga04h51_70975_c1 3300050495 Bacteria 1216
682 nmdc:mga07m45_45396_c1 3300050496 Bacteria 2467
683 nmdc:mga08x19_723900_c1 3300050514 Bacteria 706
684 nmdc:mga0a205_708126_c1 3300050515 Bacteria 856
685 nmdc:mga0sz30_18667_c1 3300050516 Bacteria 2778
686 nmdc:mga0sz30_220165_c1 3300050516 Bacteria 844
687 nmdc:mga0sz30_296678_c1 3300050516 Bacteria 721
688 Ga0495612_0140110 3300053078 Bacteria 1049
689 Ga0500635_0060880 3300053080 Bacteria 1317
690 Ga0495595_0046790 3300053084 Bacteria 1994
691 Ga0495619_0093254 3300053085 Bacteria 2041
692 Ga0500643_000057 3300053087 Bacteria 131401
693 Ga0500643_036668 3300053087 Bacteria 1464
694 Ga0500651_0041183 3300053093 Bacteria 2911
695 Ga0500566_0001388 3300053094 Bacteria 14164
696 Ga0500566_0109053 3300053094 Bacteria 1507
697 Ga0500641_0076207 3300053096 Bacteria 1418
698 Ga0500641_0095981 3300053096 Bacteria 1269
699 Ga0500555_016297 3300053103 Bacteria 2141
700 Ga0500556_0221039 3300053104 Bacteria 747
701 Ga0500557_000225 3300053105 Bacteria 8786
702 Ga0500562_012723 3300053108 Bacteria 2142
703 Ga0500562_027780 3300053108 Bacteria 1485
704 Ga0500569_124764 3300053109 Bacteria 859
705 Ga0500592_030897 3300053116 Bacteria 864
706 Ga0500595_021149 3300053119 Bacteria 2327
707 Ga0500595_029690 3300053119 Bacteria 1852
708 Ga0500595_040499 3300053119 Bacteria 1502
709 Ga0500597_166784 3300053120 Bacteria 940
710 Ga0500607_055866 3300053121 Bacteria 2086
711 Ga0500614_028299 3300053123 Bacteria 1352
712 Ga0500621_093921 3300053126 Bacteria 1190
713 Ga0500621_210666 3300053126 Bacteria 681
714 Ga0500642_0000740 3300053130 Bacteria 9638
715 Ga0500642_0008396 3300053130 Bacteria 3533
716 Ga0500642_0163182 3300053130 Bacteria 1044
717 Ga0500655_034390 3300053133 Bacteria 983
718 Ga0500658_0245689 3300053134 Bacteria 822
719 Ga0500559_0009353 3300053136 Bacteria 4247
720 Ga0500559_0014510 3300053136 Bacteria 3329
721 Ga0500577_0097649 3300053142 Bacteria 1196
722 Ga0500577_0200872 3300053142 Bacteria 860
723 Ga0500586_001990 3300053145 Bacteria 4483
724 Ga0500588_0025909 3300053146 Bacteria 1635
725 Ga0500589_163993 3300053147 Bacteria 890
726 Ga0500603_001521 3300053150 Bacteria 5266
727 Ga0500620_015387 3300053155 Bacteria 2163
728 Ga0500634_0079239 3300053161 Bacteria 1697
729 Ga0500636_0036112 3300053177 Bacteria 2924
730 Ga0500636_0048443 3300053177 Bacteria 2501
731 Ga0500637_0065890 3300053178 Bacteria 2078
732 Ga0500570_024854 3300053724 Bacteria 3297
733 Ga0500611_023664 3300053727 Bacteria 1198
734 Ga0500625_015449 3300053729 Bacteria 3542
735 Ga0500645_017168 3300053730 Bacteria 2271
736 Ga0500645_073405 3300053730 Bacteria 981
737 Ga0500609_008934 3300053731 Bacteria 1352
738 Ga0500601_001283 3300053737 Bacteria 2785
739 Ga0501084_0071584 3300054114 Bacteria 2903
740 Ga0501084_0137721 3300054114 Bacteria 2055
741 Ga0501082_0094831 3300060353 Bacteria 2578
742 Ga0501082_0212829 3300060353 Bacteria 1681
743 Ga0501082_0446640 3300060353 Bacteria 1130

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047315 Ga0495581_0258984 Ga0495581_0258984_65_625 186
2 3300053130 Ga0500642_0163182 Ga0500642_0163182_11_571 186
3 3300048918 Ga0496115_0959265 Ga0496115_0959265_23_604 193
4 3300049581 Ga0501047_0961988 Ga0501047_0961988_25_606 193
5 3300026142 Ga0207698_10044442 Ga0207698_100444424 196
6 3300053177 Ga0500636_0048443 Ga0500636_0048443_914_1504 196
7 iso_pu_bacteria 2517093001 2517100647 197
8 iso_pu_bacteria 2507262055 2507511077 198
9 iso_pu_bacteria 2508501009 2508544894 198
10 iso_pu_bacteria 2508501042 2508696880 198
11 iso_pu_bacteria 2508501128 2509151818 198
12 iso_pu_bacteria 2511231028 2511400415 198
13 iso_pu_bacteria 2513237094 2513637412 198
14 iso_pu_bacteria 2513237095 2513649740 198
15 iso_pu_bacteria 2513237096 2513655093 198
16 iso_pu_bacteria 2513237101 2513696509 198
17 iso_pu_bacteria 2513237102 2513701148 198
18 iso_pu_bacteria 2513237104 2513716973 198
19 iso_pu_bacteria 2513237141 2513892147 198
20 iso_pu_bacteria 2513237145 2513915884 198
21 iso_pu_bacteria 2513237161 2514010576 198
22 iso_pu_bacteria 2515154112 2515625351 198
23 iso_pu_bacteria 2517572143 2517894811 198
24 iso_pu_bacteria 2528768022 2528857590 198
25 iso_pu_bacteria 2617270741 2617373202 198
26 iso_pu_bacteria 2721755755 2723843017 198
27 iso_pu_bacteria 2791355196 2793066023 198
28 iso_pu_bacteria 2791355199 2793084043 198
29 iso_pu_bacteria 2816332527 2818238212 198
30 iso_pu_bacteria 2824600985 2824607538 198
31 iso_pu_bacteria 2824609381 2824617054 198
32 iso_pu_bacteria 2824653114 2824658769 198
33 iso_pu_bacteria 2824661429 2824667967 198
34 iso_pu_bacteria 2824671348 2824678540 198
35 iso_pu_bacteria 2824679649 2824686654 198
36 iso_pu_bacteria 2824687955 2824694992 198
37 iso_pu_bacteria 2824732956 2824738721 198
38 iso_pu_bacteria 2824746037 2824752398 198
39 iso_pu_bacteria 2824773399 2824780498 198
40 iso_pu_bacteria 2841941048 2841943246 198
41 iso_pu_bacteria 2841974524 2841976677 198
42 iso_pu_bacteria 2842038055 2842042644 198
43 iso_pu_bacteria 2842045827 2842050687 198
44 iso_pu_bacteria 2849076700 2849081593 198
45 iso_pu_bacteria 2857509624 2857512247 198
46 iso_pu_bacteria 2874590934 2874597810 198
47 iso_pu_bacteria 2874628541 2874634209 198
48 iso_pu_bacteria 2874645413 2874651339 198
49 iso_pu_bacteria 2876771140 2876776410 198
50 iso_pu_bacteria 2876818435 2876820978 198
51 iso_pu_bacteria 2879074833 2879081727 198
52 iso_pu_bacteria 2879099564 2879108863 198
53 iso_pu_bacteria 2879127579 2879130441 198
54 iso_pu_bacteria 2879142872 2879146327 198
55 iso_pu_bacteria 2881364244 2881370738 198
56 iso_pu_bacteria 2885366525 2885366879 198
57 iso_pu_bacteria 2885409591 2885411867 198
58 iso_pu_bacteria 2888388044 2888389179 198
59 iso_pu_bacteria 2888419890 2888421869 198
60 iso_pu_bacteria 2889033259 2889033691 198
61 iso_pu_bacteria 2906635258 2906642425 198
62 iso_pu_bacteria 2906660503 2906660732 198
63 iso_pu_bacteria 2908775508 2908781658 198
64 iso_pu_bacteria 2922361189 2922367048 198
65 iso_pu_bacteria 2922368715 2922371120 198
66 iso_pu_bacteria 2922386360 2922390173 198
67 iso_pu_bacteria 2922393267 2922393501 198
68 iso_pu_bacteria 2929615660 2929619517 198
69 iso_pu_bacteria 2929624759 2929628013 198
70 iso_pu_bacteria 2932784394 2932785841 198
71 iso_pu_bacteria 2932809354 2932813593 198
72 iso_pu_bacteria 2932818245 2932826699 198
73 iso_pu_bacteria 2932828146 2932830886 198
74 iso_pu_bacteria 2933577622 2933581438 198
75 iso_pu_bacteria 2935608549 2935612691 198
76 iso_pu_bacteria 2935616580 2935620928 198
77 iso_pu_bacteria 2935638405 2935640012 198
78 iso_pu_bacteria 2935648319 2935655192 198
79 iso_pu_bacteria 2935656913 2935664073 198
80 iso_pu_bacteria 2935665750 2935667134 198
81 iso_pu_bacteria 2935675223 2935677807 198
82 iso_pu_bacteria 2935684952 2935690264 198
83 iso_pu_bacteria 2935694250 2935697401 198
84 iso_pu_bacteria 2935703347 2935704890 198
85 iso_pu_bacteria 2935713505 2935718040 198
86 iso_pu_bacteria 2935722832 2935726810 198
87 iso_pu_bacteria 2935732158 2935735580 198
88 iso_pu_bacteria 2935741537 2935745149 198
89 iso_pu_bacteria 2935750917 2935755274 198
90 iso_pu_bacteria 2935760218 2935762204 198
91 iso_pu_bacteria 2935777560 2935780144 198
92 iso_pu_bacteria 2935801545 2935803708 198
93 iso_pu_bacteria 2935810662 2935811621 198
94 iso_pu_bacteria 2935819856 2935824180 198
95 iso_pu_bacteria 2935827899 2935829495 198
96 iso_pu_bacteria 2935837841 2935842528 198
97 iso_pu_bacteria 2935847175 2935852673 198
98 iso_pu_bacteria 2935855204 2935858736 198
99 iso_pu_bacteria 2935864058 2935866842 198
100 iso_pu_bacteria 2935873716 2935876973 198
101 iso_pu_bacteria 2935908558 2935912176 198
102 iso_pu_bacteria 2935916978 2935922389 198
103 iso_pu_bacteria 2935926038 2935929205 198
104 iso_pu_bacteria 2935934488 2935935836 198
105 iso_pu_bacteria 2935942939 2935947402 198
106 iso_pu_bacteria 2935951376 2935953503 198
107 iso_pu_bacteria 2935959822 2935961983 198
108 iso_pu_bacteria 2935967501 2935968529 198
109 iso_pu_bacteria 2935975950 2935976713 198
110 iso_pu_bacteria 2935984226 2935990664 198
111 iso_pu_bacteria 2935992306 2935993388 198
112 iso_pu_bacteria 2936002035 2936004283 198
113 iso_pu_bacteria 2936011229 2936015429 198
114 iso_pu_bacteria 2936019824 2936024063 198
115 iso_pu_bacteria 2936028420 2936033078 198
116 iso_pu_bacteria 2936037263 2936038203 198
117 iso_pu_bacteria 2936046547 2936051171 198
118 iso_pu_bacteria 2936055302 2936058549 198
119 iso_pu_bacteria 2940556831 2940561445 198
120 iso_pu_bacteria 2941538514 2941544625 198
121 iso_pu_bacteria 3005483717 3005489781 198
122 iso_pu_bacteria 3005587118 3005593031 198
123 iso_pu_bacteria 3005594810 3005596484 198
124 iso_pu_bacteria 8006964411 8006966583 198
125 iso_pu_bacteria 8006984368 8006989429 198
126 iso_pu_bacteria 8006994254 8006997898 198
127 iso_pu_bacteria 8016511872 8016516502 198
128 iso_pu_bacteria 8016522445 8016523913 198
129 iso_pu_bacteria 8016530956 8016537443 198
130 iso_pu_bacteria 8016539877 8016541714 198
131 iso_pu_bacteria 8016548790 8016551559 198
132 iso_pu_bacteria 8016557553 8016559940 198
133 iso_pu_bacteria 8016566248 8016567099 198
134 iso_pu_bacteria 8016575299 8016579818 198
135 iso_pu_bacteria 8016583857 8016589064 198
136 iso_pu_bacteria 8016595262 8016597872 198
137 iso_pu_bacteria 8016603502 8016604010 198
138 iso_pu_bacteria 8016630954 8016633913 198
139 iso_pu_bacteria 8017057580 8017060037 198
140 iso_pu_bacteria 8019530166 8019537127 198
141 iso_pu_bacteria 8019538911 8019542421 198
142 iso_pu_bacteria 8019576017 8019579541 198
143 iso_pu_bacteria 8019586578 8019587252 198
144 iso_pu_bacteria 8019597564 8019604087 198
145 iso_pu_bacteria 8019608314 8019614442 198
146 iso_pu_bacteria 8019619141 8019625072 198
147 iso_pu_bacteria 8019638758 8019642492 198
148 iso_pu_bacteria 8019659431 8019664976 198
149 iso_pu_bacteria 8019678201 8019681592 198
150 iso_pu_bacteria 8019687851 8019694182 198
151 iso_pu_bacteria 8055742211 8055749225 198
152 3300046660 Ga0495625_0480560 Ga0495625_0480560_83_688 199
153 3300053094 Ga0500566_0109053 Ga0500566_0109053_306_914 199
154 3300053108 Ga0500562_012723 Ga0500562_012723_845_1450 199
155 3300053121 Ga0500607_055866 Ga0500607_055866_349_957 199
156 3300053123 Ga0500614_028299 Ga0500614_028299_387_995 199
157 3300053136 Ga0500559_0014510 Ga0500559_0014510_1391_1999 199
158 3300053155 Ga0500620_015387 Ga0500620_015387_704_1312 199
159 3300053177 Ga0500636_0036112 Ga0500636_0036112_966_1574 199
160 3300053727 Ga0500611_023664 Ga0500611_023664_455_1060 199
161 3300053730 Ga0500645_073405 Ga0500645_073405_215_820 199
162 iso_pu_bacteria 2874612657 2874616867 199
163 3300003215 JGI25153J46596_10002568 JGI25153J46596_100025686 201
164 3300003354 JGI25160J50197_1003238 JGI25160J50197_10032388 201
165 3300003771 Ga0055526_1035800 Ga0055526_10358001 201
166 3300004625 Ga0055543_1002483 Ga0055543_10024832 201
167 3300005262 Ga0065165_1000866 Ga0065165_100086611 201
168 3300005262 Ga0065165_1023762 Ga0065165_10237623 201
169 3300006051 Ga0075364_10186690 Ga0075364_101866902 201
170 3300010375 Ga0105239_10584380 Ga0105239_105843802 201
171 3300025261 Ga0209233_1001970 Ga0209233_10019702 201
172 3300025295 Ga0209564_1005010 Ga0209564_10050102 201
173 3300025295 Ga0209564_1016256 Ga0209564_10162562 201
174 3300025297 Ga0209758_1003005 Ga0209758_100300511 201
175 3300025302 Ga0207426_1000425 Ga0207426_10004253 201
176 3300025303 Ga0209051_1103626 Ga0209051_11036262 201
177 3300037853 Ga0436364_0519888 Ga0436364_0519888_202_825 201
178 3300047469 Ga0495673_0174666 Ga0495673_0174666_99_704 201
179 3300048924 Ga0496121_0419502 Ga0496121_0419502_143_751 201
180 3300048925 Ga0496122_0147775 Ga0496122_0147775_785_1393 201
181 3300048927 Ga0496124_0206840 Ga0496124_0206840_606_1214 201
182 3300053119 Ga0500595_040499 Ga0500595_040499_763_1368 201
183 3300053133 Ga0500655_034390 Ga0500655_034390_198_803 201
184 3300053145 Ga0500586_001990 Ga0500586_001990_3230_3838 201
185 iso_pu_bacteria 2824617872 2824625914 201
186 iso_pu_bacteria 2824626560 2824634670 201
187 iso_pu_bacteria 2824635225 2824642728 201
188 iso_pu_bacteria 2824644064 2824650648 201
189 iso_pu_bacteria 2824714736 2824721433 201
190 iso_pu_bacteria 2824723954 2824730743 201
191 3300002067 JGI24735J21928_10099732 JGI24735J21928_100997322 202
192 3300002244 JGI24742J22300_10061538 JGI24742J22300_100615381 202
193 3300003214 JGI25165J46597_1012784 JGI25165J46597_10127842 202
194 3300003215 JGI25153J46596_10013493 JGI25153J46596_100134934 202
195 3300003215 JGI25153J46596_10014078 JGI25153J46596_100140783 202
196 3300003354 JGI25160J50197_1024080 JGI25160J50197_10240802 202
197 3300003659 JGI25404J52841_10015155 JGI25404J52841_100151552 202
198 3300003759 Ga0055525_1007627 Ga0055525_10076272 202
199 3300003794 Ga0055531_10026099 Ga0055531_100260992 202
200 3300005262 Ga0065165_1022843 Ga0065165_10228431 202
201 3300005327 Ga0070658_11123532 Ga0070658_111235321 202
202 3300005327 Ga0070658_11126514 Ga0070658_111265141 202
203 3300005330 Ga0070690_100769055 Ga0070690_1007690551 202
204 3300005334 Ga0068869_100054968 Ga0068869_1000549684 202
205 3300005336 Ga0070680_100155993 Ga0070680_1001559931 202
206 3300005338 Ga0068868_100114720 Ga0068868_1001147201 202
207 3300005338 Ga0068868_101101890 Ga0068868_1011018901 202
208 3300005340 Ga0070689_100382480 Ga0070689_1003824801 202
209 3300005343 Ga0070687_100207237 Ga0070687_1002072372 202
210 3300005347 Ga0070668_100027110 Ga0070668_1000271102 202
211 3300005347 Ga0070668_100103345 Ga0070668_1001033453 202
212 3300005347 Ga0070668_100174359 Ga0070668_1001743592 202
213 3300005347 Ga0070668_100430126 Ga0070668_1004301262 202
214 3300005347 Ga0070668_100678005 Ga0070668_1006780051 202
215 3300005355 Ga0070671_100999578 Ga0070671_1009995781 202
216 3300005356 Ga0070674_100036028 Ga0070674_1000360284 202
217 3300005364 Ga0070673_100256983 Ga0070673_1002569831 202
218 3300005365 Ga0070688_100369324 Ga0070688_1003693241 202
219 3300005366 Ga0070659_100228749 Ga0070659_1002287492 202
220 3300005367 Ga0070667_100891271 Ga0070667_1008912712 202
221 3300005436 Ga0070713_100217909 Ga0070713_1002179091 202
222 3300005436 Ga0070713_100962118 Ga0070713_1009621181 202
223 3300005455 Ga0070663_100059935 Ga0070663_1000599352 202
224 3300005455 Ga0070663_100145254 Ga0070663_1001452541 202
225 3300005455 Ga0070663_100189808 Ga0070663_1001898082 202
226 3300005455 Ga0070663_100656601 Ga0070663_1006566011 202
227 3300005457 Ga0070662_100083187 Ga0070662_1000831871 202
228 3300005459 Ga0068867_100595080 Ga0068867_1005950802 202
229 3300005471 Ga0070698_100209554 Ga0070698_1002095542 202
230 3300005535 Ga0070684_100010999 Ga0070684_1000109994 202
231 3300005536 Ga0070697_100053717 Ga0070697_1000537174 202
232 3300005539 Ga0068853_100213069 Ga0068853_1002130692 202
233 3300005539 Ga0068853_100293683 Ga0068853_1002936832 202
234 3300005544 Ga0070686_100230778 Ga0070686_1002307782 202
235 3300005548 Ga0070665_100153179 Ga0070665_1001531792 202
236 3300005548 Ga0070665_100192952 Ga0070665_1001929522 202
237 3300005548 Ga0070665_100357422 Ga0070665_1003574222 202
238 3300005548 Ga0070665_100430484 Ga0070665_1004304842 202
239 3300005563 Ga0068855_100244299 Ga0068855_1002442992 202
240 3300005563 Ga0068855_100607703 Ga0068855_1006077032 202
241 3300005564 Ga0070664_100242698 Ga0070664_1002426982 202
242 3300005564 Ga0070664_100785845 Ga0070664_1007858452 202
243 3300005614 Ga0068856_100508519 Ga0068856_1005085192 202
244 3300005614 Ga0068856_100869406 Ga0068856_1008694062 202
245 3300005616 Ga0068852_100391971 Ga0068852_1003919711 202
246 3300005616 Ga0068852_100993822 Ga0068852_1009938222 202
247 3300005618 Ga0068864_100328139 Ga0068864_1003281392 202
248 3300005618 Ga0068864_100529912 Ga0068864_1005299122 202
249 3300005834 Ga0068851_10492948 Ga0068851_104929481 202
250 3300005840 Ga0068870_10109348 Ga0068870_101093481 202
251 3300005840 Ga0068870_10500581 Ga0068870_105005811 202
252 3300005841 Ga0068863_100279776 Ga0068863_1002797762 202
253 3300005841 Ga0068863_101535728 Ga0068863_1015357281 202
254 3300005842 Ga0068858_100122372 Ga0068858_1001223724 202
255 3300005843 Ga0068860_100094368 Ga0068860_1000943682 202
256 3300005843 Ga0068860_101067413 Ga0068860_1010674132 202
257 3300005844 Ga0068862_100079284 Ga0068862_1000792844 202
258 3300005844 Ga0068862_100305099 Ga0068862_1003050992 202
259 3300005844 Ga0068862_100381121 Ga0068862_1003811212 202
260 3300005844 Ga0068862_100496742 Ga0068862_1004967422 202
261 3300005844 Ga0068862_100609103 Ga0068862_1006091032 202
262 3300005937 Ga0081455_10050141 Ga0081455_100501415 202
263 3300005937 Ga0081455_10071493 Ga0081455_100714931 202
264 3300005983 Ga0081540_1001986 Ga0081540_100198621 202
265 3300005983 Ga0081540_1003959 Ga0081540_10039594 202
266 3300005983 Ga0081540_1016453 Ga0081540_10164533 202
267 3300005983 Ga0081540_1040288 Ga0081540_10402882 202
268 3300006028 Ga0070717_10684231 Ga0070717_106842312 202
269 3300006038 Ga0075365_10081939 Ga0075365_100819392 202
270 3300006038 Ga0075365_10097363 Ga0075365_100973634 202
271 3300006038 Ga0075365_10107281 Ga0075365_101072812 202
272 3300006048 Ga0075363_100072768 Ga0075363_1000727682 202
273 3300006048 Ga0075363_100336746 Ga0075363_1003367461 202
274 3300006048 Ga0075363_100381484 Ga0075363_1003814841 202
275 3300006051 Ga0075364_10095002 Ga0075364_100950023 202
276 3300006163 Ga0070715_10245687 Ga0070715_102456872 202
277 3300006177 Ga0075362_10027219 Ga0075362_100272194 202
278 3300006178 Ga0075367_10042624 Ga0075367_100426242 202
279 3300006178 Ga0075367_10391503 Ga0075367_103915031 202
280 3300006186 Ga0075369_10169657 Ga0075369_101696572 202
281 3300006186 Ga0075369_10322537 Ga0075369_103225371 202
282 3300006195 Ga0075366_10224491 Ga0075366_102244912 202
283 3300006195 Ga0075366_10243457 Ga0075366_102434572 202
284 3300006195 Ga0075366_10268549 Ga0075366_102685491 202
285 3300006237 Ga0097621_100956827 Ga0097621_1009568272 202
286 3300006353 Ga0075370_10177315 Ga0075370_101773152 202
287 3300006353 Ga0075370_10220280 Ga0075370_102202802 202
288 3300006353 Ga0075370_10223711 Ga0075370_102237112 202
289 3300006844 Ga0075428_100196472 Ga0075428_1001964722 202
290 3300006881 Ga0068865_100101744 Ga0068865_1001017442 202
291 3300006881 Ga0068865_100373720 Ga0068865_1003737201 202
292 3300006914 Ga0075436_100777904 Ga0075436_1007779042 202
293 3300009093 Ga0105240_10020447 Ga0105240_100204474 202
294 3300009093 Ga0105240_11357177 Ga0105240_113571771 202
295 3300009098 Ga0105245_11092254 Ga0105245_110922542 202
296 3300009101 Ga0105247_10063969 Ga0105247_100639692 202
297 3300009101 Ga0105247_10206866 Ga0105247_102068662 202
298 3300009147 Ga0114129_10527086 Ga0114129_105270862 202
299 3300009148 Ga0105243_10031732 Ga0105243_100317324 202
300 3300009148 Ga0105243_10432358 Ga0105243_104323581 202
301 3300009148 Ga0105243_10457568 Ga0105243_104575682 202
302 3300009148 Ga0105243_10473269 Ga0105243_104732692 202
303 3300009174 Ga0105241_10049513 Ga0105241_100495134 202
304 3300009174 Ga0105241_10140618 Ga0105241_101406182 202
305 3300009174 Ga0105241_11195539 Ga0105241_111955392 202
306 3300009176 Ga0105242_10608441 Ga0105242_106084411 202
307 3300009176 Ga0105242_11156961 Ga0105242_111569612 202
308 3300009177 Ga0105248_10505669 Ga0105248_105056692 202
309 3300009545 Ga0105237_10068396 Ga0105237_100683962 202
310 3300009551 Ga0105238_10693667 Ga0105238_106936671 202
311 3300009553 Ga0105249_10305151 Ga0105249_103051512 202
312 3300009553 Ga0105249_11349016 Ga0105249_113490161 202
313 3300010159 Ga0099796_10148941 Ga0099796_101489412 202
314 3300010375 Ga0105239_10053578 Ga0105239_100535781 202
315 3300010375 Ga0105239_10136576 Ga0105239_101365764 202
316 3300010375 Ga0105239_10438457 Ga0105239_104384572 202
317 3300010375 Ga0105239_10506257 Ga0105239_105062572 202
318 3300010375 Ga0105239_10656958 Ga0105239_106569581 202
319 3300010375 Ga0105239_11424524 Ga0105239_114245241 202
320 3300013100 Ga0157373_10649584 Ga0157373_106495841 202
321 3300013104 Ga0157370_10248815 Ga0157370_102488152 202
322 3300013296 Ga0157374_10514938 Ga0157374_105149381 202
323 3300013296 Ga0157374_10787273 Ga0157374_107872732 202
324 3300013297 Ga0157378_10301137 Ga0157378_103011372 202
325 3300013306 Ga0163162_10605859 Ga0163162_106058592 202
326 3300013308 Ga0157375_10273504 Ga0157375_102735042 202
327 3300013308 Ga0157375_10768747 Ga0157375_107687472 202
328 3300014325 Ga0163163_10117591 Ga0163163_101175912 202
329 3300014325 Ga0163163_10297644 Ga0163163_102976442 202
330 3300014325 Ga0163163_10957050 Ga0163163_109570502 202
331 3300014325 Ga0163163_11037067 Ga0163163_110370672 202
332 3300014968 Ga0157379_10389004 Ga0157379_103890042 202
333 3300014969 Ga0157376_11212705 Ga0157376_112127052 202
334 3300021320 Ga0214544_1000001 Ga0214544_1000001276 202
335 3300021320 Ga0214544_1024413 Ga0214544_10244133 202
336 3300021321 Ga0214542_1000005 Ga0214542_1000005276 202
337 3300021321 Ga0214542_1022513 Ga0214542_10225134 202
338 3300021324 Ga0214545_1000003 Ga0214545_1000003488 202
339 3300021324 Ga0214545_1013953 Ga0214545_101395311 202
340 3300021327 Ga0214543_1000002 Ga0214543_1000002277 202
341 3300021327 Ga0214543_1036318 Ga0214543_10363182 202
342 3300021361 Ga0213872_10143744 Ga0213872_101437442 202
343 3300021377 Ga0213874_10023666 Ga0213874_100236662 202
344 3300021384 Ga0213876_10372511 Ga0213876_103725111 202
345 3300021388 Ga0213875_10034375 Ga0213875_100343752 202
346 3300021441 Ga0213871_10006629 Ga0213871_100066292 202
347 3300025230 Ga0209563_112577 Ga0209563_1125772 202
348 3300025253 Ga0209677_101244 Ga0209677_1012444 202
349 3300025253 Ga0209677_104808 Ga0209677_1048082 202
350 3300025254 Ga0209148_1000253 Ga0209148_100025323 202
351 3300025261 Ga0209233_1009212 Ga0209233_10092122 202
352 3300025272 Ga0209455_1001785 Ga0209455_10017852 202
353 3300025272 Ga0209455_1005205 Ga0209455_10052054 202
354 3300025272 Ga0209455_1006143 Ga0209455_10061434 202
355 3300025272 Ga0209455_1027323 Ga0209455_10273232 202
356 3300025297 Ga0209758_1000026 Ga0209758_100002644 202
357 3300025297 Ga0209758_1000318 Ga0209758_100031881 202
358 3300025297 Ga0209758_1001423 Ga0209758_100142314 202
359 3300025297 Ga0209758_1002424 Ga0209758_10024242 202
360 3300025297 Ga0209758_1038631 Ga0209758_10386313 202
361 3300025302 Ga0207426_1001506 Ga0207426_100150622 202
362 3300025302 Ga0207426_1019039 Ga0207426_10190392 202
363 3300025302 Ga0207426_1019633 Ga0207426_10196332 202
364 3300025303 Ga0209051_1079705 Ga0209051_10797052 202
365 3300025304 Ga0209257_1002846 Ga0209257_100284616 202
366 3300025315 Ga0207697_10119290 Ga0207697_101192902 202
367 3300025711 Ga0207696_1077826 Ga0207696_10778261 202
368 3300025900 Ga0207710_10193016 Ga0207710_101930161 202
369 3300025903 Ga0207680_10303059 Ga0207680_103030592 202
370 3300025903 Ga0207680_10370781 Ga0207680_103707812 202
371 3300025904 Ga0207647_10080325 Ga0207647_100803252 202
372 3300025904 Ga0207647_10130615 Ga0207647_101306152 202
373 3300025904 Ga0207647_10220191 Ga0207647_102201911 202
374 3300025904 Ga0207647_10386612 Ga0207647_103866121 202
375 3300025906 Ga0207699_10075887 Ga0207699_100758874 202
376 3300025907 Ga0207645_10218177 Ga0207645_102181772 202
377 3300025908 Ga0207643_10011341 Ga0207643_100113411 202
378 3300025908 Ga0207643_10067803 Ga0207643_100678032 202
379 3300025911 Ga0207654_10016046 Ga0207654_100160462 202
380 3300025911 Ga0207654_10502014 Ga0207654_105020142 202
381 3300025912 Ga0207707_10171584 Ga0207707_101715841 202
382 3300025912 Ga0207707_10833602 Ga0207707_108336021 202
383 3300025913 Ga0207695_10000634 Ga0207695_1000063411 202
384 3300025914 Ga0207671_10011863 Ga0207671_100118637 202
385 3300025914 Ga0207671_10150853 Ga0207671_101508532 202
386 3300025915 Ga0207693_10481253 Ga0207693_104812531 202
387 3300025915 Ga0207693_10622476 Ga0207693_106224762 202
388 3300025916 Ga0207663_10049899 Ga0207663_100498991 202
389 3300025918 Ga0207662_10560122 Ga0207662_105601221 202
390 3300025919 Ga0207657_10007164 Ga0207657_100071642 202
391 3300025920 Ga0207649_10631726 Ga0207649_106317262 202
392 3300025922 Ga0207646_10222438 Ga0207646_102224382 202
393 3300025923 Ga0207681_10908983 Ga0207681_109089831 202
394 3300025926 Ga0207659_10301607 Ga0207659_103016072 202
395 3300025927 Ga0207687_10109786 Ga0207687_101097862 202
396 3300025928 Ga0207700_10086666 Ga0207700_100866662 202
397 3300025931 Ga0207644_10143966 Ga0207644_101439663 202
398 3300025931 Ga0207644_10577049 Ga0207644_105770491 202
399 3300025932 Ga0207690_10104373 Ga0207690_101043732 202
400 3300025932 Ga0207690_10560745 Ga0207690_105607452 202
401 3300025933 Ga0207706_10027445 Ga0207706_100274454 202
402 3300025933 Ga0207706_10280768 Ga0207706_102807681 202
403 3300025933 Ga0207706_10436772 Ga0207706_104367722 202
404 3300025935 Ga0207709_10033563 Ga0207709_100335634 202
405 3300025937 Ga0207669_10017298 Ga0207669_100172982 202
406 3300025938 Ga0207704_10079727 Ga0207704_100797272 202
407 3300025940 Ga0207691_10172079 Ga0207691_101720792 202
408 3300025941 Ga0207711_10758307 Ga0207711_107583071 202
409 3300025944 Ga0207661_10006721 Ga0207661_100067216 202
410 3300025945 Ga0207679_10654677 Ga0207679_106546772 202
411 3300025949 Ga0207667_10142283 Ga0207667_101422832 202
412 3300025949 Ga0207667_10886806 Ga0207667_108868062 202
413 3300025949 Ga0207667_10894275 Ga0207667_108942751 202
414 3300025960 Ga0207651_10521423 Ga0207651_105214231 202
415 3300025960 Ga0207651_10621345 Ga0207651_106213452 202
416 3300025960 Ga0207651_10792171 Ga0207651_107921712 202
417 3300025972 Ga0207668_10024406 Ga0207668_100244064 202
418 3300025972 Ga0207668_10087629 Ga0207668_100876293 202
419 3300025972 Ga0207668_10245346 Ga0207668_102453462 202
420 3300025972 Ga0207668_10253140 Ga0207668_102531402 202
421 3300025972 Ga0207668_10319083 Ga0207668_103190832 202
422 3300025972 Ga0207668_10769404 Ga0207668_107694042 202
423 3300025981 Ga0207640_10295965 Ga0207640_102959652 202
424 3300025986 Ga0207658_10395367 Ga0207658_103953671 202
425 3300026023 Ga0207677_10104387 Ga0207677_101043871 202
426 3300026035 Ga0207703_10134202 Ga0207703_101342021 202
427 3300026041 Ga0207639_10102083 Ga0207639_101020832 202
428 3300026067 Ga0207678_10012307 Ga0207678_1001230710 202
429 3300026067 Ga0207678_10123704 Ga0207678_101237043 202
430 3300026067 Ga0207678_10212311 Ga0207678_102123112 202
431 3300026067 Ga0207678_10284104 Ga0207678_102841042 202
432 3300026067 Ga0207678_10551168 Ga0207678_105511682 202
433 3300026067 Ga0207678_11047033 Ga0207678_110470332 202
434 3300026078 Ga0207702_10477016 Ga0207702_104770162 202
435 3300026078 Ga0207702_11376308 Ga0207702_113763081 202
436 3300026088 Ga0207641_10837203 Ga0207641_108372032 202
437 3300026089 Ga0207648_10361808 Ga0207648_103618082 202
438 3300026095 Ga0207676_10273967 Ga0207676_102739671 202
439 3300026095 Ga0207676_10346204 Ga0207676_103462042 202
440 3300026095 Ga0207676_10397436 Ga0207676_103974362 202
441 3300026116 Ga0207674_10206443 Ga0207674_102064432 202
442 3300026116 Ga0207674_11176811 Ga0207674_111768111 202
443 3300026118 Ga0207675_100420333 Ga0207675_1004203332 202
444 3300026118 Ga0207675_100644472 Ga0207675_1006444721 202
445 3300026121 Ga0207683_10074762 Ga0207683_100747622 202
446 3300026121 Ga0207683_10150767 Ga0207683_101507673 202
447 3300026121 Ga0207683_10683100 Ga0207683_106831002 202
448 3300026142 Ga0207698_10078408 Ga0207698_100784082 202
449 3300026142 Ga0207698_10100030 Ga0207698_101000302 202
450 3300027296 Ga0209389_1000119 Ga0209389_100011943 202
451 3300027357 Ga0209589_1000010 Ga0209589_1000010200 202
452 3300027361 Ga0209489_100011 Ga0209489_10001136 202
453 3300027671 Ga0209588_1027398 Ga0209588_10273982 202
454 3300028379 Ga0268266_10011601 Ga0268266_100116016 202
455 3300028379 Ga0268266_10036772 Ga0268266_100367725 202
456 3300028379 Ga0268266_10223403 Ga0268266_102234032 202
457 3300028379 Ga0268266_10525109 Ga0268266_105251092 202
458 3300028380 Ga0268265_10131182 Ga0268265_101311822 202
459 3300028380 Ga0268265_10613252 Ga0268265_106132522 202
460 3300028380 Ga0268265_10727174 Ga0268265_107271742 202
461 3300028380 Ga0268265_10728730 Ga0268265_107287302 202
462 3300028381 Ga0268264_10283920 Ga0268264_102839202 202
463 3300028381 Ga0268264_11063358 Ga0268264_110633582 202
464 3300028786 Ga0307517_10090077 Ga0307517_100900773 202
465 3300028794 Ga0307515_10066890 Ga0307515_100668907 202
466 3300028794 Ga0307515_10334080 Ga0307515_103340802 202
467 3300031247 Ga0265340_10031864 Ga0265340_100318642 202
468 3300031249 Ga0265339_10000560 Ga0265339_100005603 202
469 3300031507 Ga0307509_10336075 Ga0307509_103360752 202
470 3300031507 Ga0307509_10379289 Ga0307509_103792892 202
471 3300031616 Ga0307508_10146942 Ga0307508_101469422 202
472 3300031730 Ga0307516_10259187 Ga0307516_102591872 202
473 3300031852 Ga0307410_10875830 Ga0307410_108758301 202
474 3300031852 Ga0307410_10885970 Ga0307410_108859702 202
475 3300031903 Ga0307407_10325433 Ga0307407_103254332 202
476 3300031995 Ga0307409_101535943 Ga0307409_1015359431 202
477 3300032004 Ga0307414_11188442 Ga0307414_111884421 202
478 3300032126 Ga0307415_101024222 Ga0307415_1010242221 202
479 3300033180 Ga0307510_10024022 Ga0307510_1002402211 202
480 3300033442 Ga0315911_1000010 Ga0315911_100001081 202
481 3300033544 Ga0316215_1006361 Ga0316215_10063612 202
482 3300035083 Ga0373926_0141324 Ga0373926_0141324_14_622 202
483 3300035111 Ga0373923_0031344 Ga0373923_0031344_881_1489 202
484 3300035117 Ga0373953_0176796 Ga0373953_0176796_161_769 202
485 3300035118 Ga0373954_0081325 Ga0373954_0081325_210_818 202
486 3300035171 Ga0373946_0008409 Ga0373946_0008409_553_1161 202
487 3300035172 Ga0373955_0240830 Ga0373955_0240830_167_775 202
488 3300035695 Ga0373927_0002264 Ga0373927_0002264_970_1578 202
489 3300035725 Ga0373947_0002643 Ga0373947_0002643_6450_7058 202
490 3300036401 Ga0373937_0019313 Ga0373937_0019313_3614_4222 202
491 3300036459 Ga0372808_001288 Ga0372808_001288_874_1482 202
492 3300037068 Ga0373925_0003737 Ga0373925_0003737_950_1558 202
493 3300037068 Ga0373925_0279007 Ga0373925_0279007_568_1176 202
494 3300037312 Ga0395899_0059903 Ga0395899_0059903_1385_1993 202
495 3300037312 Ga0395899_0244671 Ga0395899_0244671_101_709 202
496 3300037418 Ga0395900_0048961 Ga0395900_0048961_2356_2964 202
497 3300037418 Ga0395900_0088980 Ga0395900_0088980_1722_2330 202
498 3300037466 Ga0395898_0017014 Ga0395898_0017014_1502_2110 202
499 3300037466 Ga0395898_0065085 Ga0395898_0065085_160_768 202
500 3300037466 Ga0395898_0268082 Ga0395898_0268082_40_648 202
501 3300037853 Ga0436364_0061231 Ga0436364_0061231_1345_1953 202
502 3300037853 Ga0436364_1454126 Ga0436364_1454126_764_1372 202
503 3300038443 Ga0395901_0058832 Ga0395901_0058832_2601_3209 202
504 3300039437 Ga0436365_0773004 Ga0436365_0773004_146_754 202
505 3300039437 Ga0436365_1149951 Ga0436365_1149951_91_699 202
506 3300039437 Ga0436365_1815196 Ga0436365_1815196_740_1348 202
507 3300039438 Ga0436360_0311998 Ga0436360_0311998_103_747 202
508 3300039438 Ga0436360_0328780 Ga0436360_0328780_2283_2891 202
509 3300039447 Ga0436361_0069223 Ga0436361_0069223_382_990 202
510 3300039447 Ga0436361_0510320 Ga0436361_0510320_236_844 202
511 3300039450 Ga0436363_0834736 Ga0436363_0834736_133_741 202
512 3300039450 Ga0436363_1464422 Ga0436363_1464422_345_953 202
513 3300041452 Ga0451793_0044027 Ga0451793_0044027_529_1137 202
514 3300041509 Ga0451843_1629634 Ga0451843_1629634_202_810 202
515 3300044656 Ga0466969_0029006 Ga0466969_0029006_2088_2696 202
516 3300044656 Ga0466969_0163561 Ga0466969_0163561_300_908 202
517 3300044658 Ga0466972_0000090 Ga0466972_0000090_35437_36045 202
518 3300044658 Ga0466972_0056993 Ga0466972_0056993_394_1002 202
519 3300044684 Ga0466966_0342790 Ga0466966_0342790_14_622 202
520 3300044693 Ga0466961_0000081 Ga0466961_0000081_4452_5060 202
521 3300044694 Ga0466963_0416354 Ga0466963_0416354_42_650 202
522 3300044694 Ga0466963_0668589 Ga0466963_0668589_69_680 202
523 3300044765 Ga0466970_0029783 Ga0466970_0029783_43_651 202
524 3300044842 Ga0466957_0639696 Ga0466957_0639696_87_695 202
525 3300044901 Ga0466960_0197477 Ga0466960_0197477_17_625 202
526 3300045049 Ga0466959_0004686 Ga0466959_0004686_7671_8279 202
527 3300045049 Ga0466959_0162169 Ga0466959_0162169_546_1154 202
528 3300045976 Ga0466967_0212089 Ga0466967_0212089_284_895 202
529 3300045976 Ga0466967_1178008 Ga0466967_1178008_67_675 202
530 3300046452 Ga0495617_029495 Ga0495617_029495_462_1070 202
531 3300046452 Ga0495617_078863 Ga0495617_078863_232_840 202
532 3300046455 Ga0495603_0002182 Ga0495603_0002182_7195_7803 202
533 3300046455 Ga0495603_0106070 Ga0495603_0106070_587_1213 202
534 3300046457 Ga0495590_0047429 Ga0495590_0047429_370_978 202
535 3300046459 Ga0495629_0000226 Ga0495629_0000226_3683_4291 202
536 3300046459 Ga0495629_0024603 Ga0495629_0024603_1505_2131 202
537 3300046459 Ga0495629_0076212 Ga0495629_0076212_333_941 202
538 3300046460 Ga0495638_0009527 Ga0495638_0009527_3596_4204 202
539 3300046460 Ga0495638_0196767 Ga0495638_0196767_41_649 202
540 3300046460 Ga0495638_0224898 Ga0495638_0224898_25_633 202
541 3300046461 Ga0495641_0082969 Ga0495641_0082969_205_813 202
542 3300046462 Ga0495651_0170800 Ga0495651_0170800_91_717 202
543 3300046463 Ga0495653_0245980 Ga0495653_0245980_479_1087 202
544 3300046471 Ga0495650_0045495 Ga0495650_0045495_1051_1659 202
545 3300046472 Ga0495580_0002229 Ga0495580_0002229_15521_16129 202
546 3300046473 Ga0495582_0000106 Ga0495582_0000106_3678_4286 202
547 3300046474 Ga0495605_0085148 Ga0495605_0085148_525_1133 202
548 3300046475 Ga0495639_0000912 Ga0495639_0000912_6979_7587 202
549 3300046475 Ga0495639_0072285 Ga0495639_0072285_902_1510 202
550 3300046476 Ga0495662_0000112 Ga0495662_0000112_1650_2258 202
551 3300046476 Ga0495662_0060449 Ga0495662_0060449_816_1442 202
552 3300046477 Ga0495664_0013066 Ga0495664_0013066_1029_1637 202
553 3300046492 Ga0495585_0024609 Ga0495585_0024609_914_1522 202
554 3300046499 Ga0495594_0025944 Ga0495594_0025944_1731_2339 202
555 3300046499 Ga0495594_0249620 Ga0495594_0249620_18_626 202
556 3300046500 Ga0495596_0100590 Ga0495596_0100590_158_766 202
557 3300046506 Ga0495583_0132350 Ga0495583_0132350_264_872 202
558 3300046507 Ga0495606_0110756 Ga0495606_0110756_269_895 202
559 3300046507 Ga0495606_0110891 Ga0495606_0110891_672_1280 202
560 3300046507 Ga0495606_0289373 Ga0495606_0289373_234_842 202
561 3300046507 Ga0495606_0292020 Ga0495606_0292020_217_825 202
562 3300046511 Ga0495608_0029753 Ga0495608_0029753_91_717 202
563 3300046511 Ga0495608_0172768 Ga0495608_0172768_162_788 202
564 3300046513 Ga0495616_0124502 Ga0495616_0124502_502_1128 202
565 3300046516 Ga0495628_0035863 Ga0495628_0035863_253_879 202
566 3300046516 Ga0495628_0085095 Ga0495628_0085095_584_1192 202
567 3300046517 Ga0495630_0050483 Ga0495630_0050483_967_1575 202
568 3300046518 Ga0495631_0144906 Ga0495631_0144906_18_626 202
569 3300046522 Ga0495643_0035822 Ga0495643_0035822_1262_1888 202
570 3300046524 Ga0495648_0173409 Ga0495648_0173409_411_1019 202
571 3300046525 Ga0495663_0058933 Ga0495663_0058933_131_739 202
572 3300046526 Ga0495666_0037053 Ga0495666_0037053_855_1463 202
573 3300046528 Ga0495642_0218245 Ga0495642_0218245_47_655 202
574 3300046528 Ga0495642_0259312 Ga0495642_0259312_97_705 202
575 3300046529 Ga0495652_0122765 Ga0495652_0122765_1218_1826 202
576 3300046529 Ga0495652_0177443 Ga0495652_0177443_523_1149 202
577 3300046529 Ga0495652_0289271 Ga0495652_0289271_315_941 202
578 3300046531 Ga0495665_0000254 Ga0495665_0000254_3867_4475 202
579 3300046531 Ga0495665_0207098 Ga0495665_0207098_23_649 202
580 3300046533 Ga0495640_0003800 Ga0495640_0003800_3691_4299 202
581 3300046533 Ga0495640_0014514 Ga0495640_0014514_5063_5689 202
582 3300046533 Ga0495640_0090953 Ga0495640_0090953_744_1370 202
583 3300046535 Ga0495586_0377784 Ga0495586_0377784_171_779 202
584 3300046536 Ga0495587_0025877 Ga0495587_0025877_365_991 202
585 3300046538 Ga0495609_0049819 Ga0495609_0049819_285_893 202
586 3300046543 Ga0495645_0036139 Ga0495645_0036139_999_1625 202
587 3300046557 Ga0495622_0015939 Ga0495622_0015939_1272_1880 202
588 3300046557 Ga0495622_0116669 Ga0495622_0116669_528_1154 202
589 3300046559 Ga0495667_0025678 Ga0495667_0025678_818_1426 202
590 3300046559 Ga0495667_0041560 Ga0495667_0041560_869_1495 202
591 3300046615 Ga0495656_0045238 Ga0495656_0045238_771_1397 202
592 3300046615 Ga0495656_0062277 Ga0495656_0062277_198_806 202
593 3300046615 Ga0495656_0190985 Ga0495656_0190985_17_625 202
594 3300046616 Ga0495668_0183122 Ga0495668_0183122_170_778 202
595 3300046642 Ga0495634_0001436 Ga0495634_0001436_19510_20118 202
596 3300046642 Ga0495634_0105948 Ga0495634_0105948_689_1315 202
597 3300046648 Ga0495611_0053499 Ga0495611_0053499_548_1156 202
598 3300046660 Ga0495625_0164563 Ga0495625_0164563_434_1042 202
599 3300046660 Ga0495625_0203821 Ga0495625_0203821_438_1064 202
600 3300046663 Ga0495635_0003067 Ga0495635_0003067_1144_1752 202
601 3300046663 Ga0495635_0007905 Ga0495635_0007905_988_1614 202
602 3300046664 Ga0495659_0064408 Ga0495659_0064408_448_1056 202
603 3300046674 Ga0495588_0053957 Ga0495588_0053957_827_1435 202
604 3300046674 Ga0495588_0058529 Ga0495588_0058529_499_1107 202
605 3300046675 Ga0495657_0069160 Ga0495657_0069160_869_1495 202
606 3300046675 Ga0495657_0178219 Ga0495657_0178219_318_944 202
607 3300046678 Ga0495599_0118484 Ga0495599_0118484_797_1423 202
608 3300046680 Ga0495646_0014484 Ga0495646_0014484_100_708 202
609 3300046680 Ga0495646_0202850 Ga0495646_0202850_53_679 202
610 3300046680 Ga0495646_0364343 Ga0495646_0364343_64_690 202
611 3300046681 Ga0495647_0003957 Ga0495647_0003957_3925_4533 202
612 3300046683 Ga0495658_0000964 Ga0495658_0000964_13420_14028 202
613 3300046689 Ga0495613_0004538 Ga0495613_0004538_1134_1742 202
614 3300046690 Ga0495624_0005560 Ga0495624_0005560_4782_5390 202
615 3300046690 Ga0495624_0031167 Ga0495624_0031167_703_1329 202
616 3300046690 Ga0495624_0132644 Ga0495624_0132644_255_863 202
617 3300046692 Ga0495671_0205245 Ga0495671_0205245_143_751 202
618 3300046694 Ga0495649_0187311 Ga0495649_0187311_434_1060 202
619 3300046794 Ga0495589_0298561 Ga0495589_0298561_89_697 202
620 3300046794 Ga0495589_0314038 Ga0495589_0314038_88_696 202
621 3300047315 Ga0495581_0011778 Ga0495581_0011778_766_1374 202
622 3300047315 Ga0495581_0571888 Ga0495581_0571888_14_640 202
623 3300047317 Ga0495604_0043292 Ga0495604_0043292_680_1306 202
624 3300047317 Ga0495604_0152792 Ga0495604_0152792_676_1302 202
625 3300047317 Ga0495604_0273398 Ga0495604_0273398_148_756 202
626 3300047318 Ga0495636_0105230 Ga0495636_0105230_525_1133 202
627 3300047319 Ga0495674_0000082 Ga0495674_0000082_61334_61942 202
628 3300047319 Ga0495674_0164710 Ga0495674_0164710_752_1378 202
629 3300047321 Ga0495676_0064463 Ga0495676_0064463_2216_2824 202
630 3300047321 Ga0495676_0119649 Ga0495676_0119649_603_1229 202
631 3300047443 Ga0495687_125916 Ga0495687_125916_35_643 202
632 3300047446 Ga0495679_076280 Ga0495679_076280_274_882 202
633 3300047469 Ga0495673_0096644 Ga0495673_0096644_457_1083 202
634 3300047469 Ga0495673_0126263 Ga0495673_0126263_324_950 202
635 3300047470 Ga0495681_0205167 Ga0495681_0205167_76_684 202
636 3300047471 Ga0495684_0220676 Ga0495684_0220676_251_877 202
637 3300047472 Ga0495686_0320450 Ga0495686_0320450_78_686 202
638 3300047673 Ga0495593_0000366 Ga0495593_0000366_20598_21206 202
639 3300047673 Ga0495593_0151693 Ga0495593_0151693_282_890 202
640 3300048090 Ga0495615_0091377 Ga0495615_0091377_59_667 202
641 3300048903 Ga0496100_0146404 Ga0496100_0146404_967_1575 202
642 3300048903 Ga0496100_0175206 Ga0496100_0175206_752_1378 202
643 3300048904 Ga0496101_0128387 Ga0496101_0128387_885_1493 202
644 3300048904 Ga0496101_0167983 Ga0496101_0167983_699_1307 202
645 3300048904 Ga0496101_0294557 Ga0496101_0294557_55_681 202
646 3300048904 Ga0496101_0315838 Ga0496101_0315838_95_703 202
647 3300048905 Ga0496102_0028006 Ga0496102_0028006_675_1283 202
648 3300048905 Ga0496102_0272253 Ga0496102_0272253_795_1403 202
649 3300048905 Ga0496102_0312772 Ga0496102_0312772_193_819 202
650 3300048905 Ga0496102_0517080 Ga0496102_0517080_164_772 202
651 3300048905 Ga0496102_0605122 Ga0496102_0605122_108_734 202
652 3300048906 Ga0496103_0049599 Ga0496103_0049599_1965_2573 202
653 3300048906 Ga0496103_0153197 Ga0496103_0153197_75_683 202
654 3300048907 Ga0496104_0018741 Ga0496104_0018741_4733_5341 202
655 3300048907 Ga0496104_0094155 Ga0496104_0094155_1276_1902 202
656 3300048907 Ga0496104_0617018 Ga0496104_0617018_95_703 202
657 3300048908 Ga0496105_0039541 Ga0496105_0039541_2188_2814 202
658 3300048908 Ga0496105_0060956 Ga0496105_0060956_544_1152 202
659 3300048908 Ga0496105_0875258 Ga0496105_0875258_21_629 202
660 3300048909 Ga0496106_0063785 Ga0496106_0063785_1170_1778 202
661 3300048909 Ga0496106_0075362 Ga0496106_0075362_1883_2491 202
662 3300048909 Ga0496106_0427572 Ga0496106_0427572_326_934 202
663 3300048911 Ga0496108_0225193 Ga0496108_0225193_1011_1619 202
664 3300048912 Ga0496109_0377061 Ga0496109_0377061_666_1274 202
665 3300048912 Ga0496109_0434291 Ga0496109_0434291_303_911 202
666 3300048913 Ga0496110_0302099 Ga0496110_0302099_289_897 202
667 3300048913 Ga0496110_0319405 Ga0496110_0319405_667_1275 202
668 3300048914 Ga0496111_0129099 Ga0496111_0129099_789_1397 202
669 3300048914 Ga0496111_0200918 Ga0496111_0200918_778_1386 202
670 3300048915 Ga0496112_0056454 Ga0496112_0056454_339_1001 202
671 3300048915 Ga0496112_0111276 Ga0496112_0111276_2086_2694 202
672 3300048915 Ga0496112_0135064 Ga0496112_0135064_907_1515 202
673 3300048915 Ga0496112_0177824 Ga0496112_0177824_1116_1724 202
674 3300048915 Ga0496112_0312574 Ga0496112_0312574_291_917 202
675 3300048916 Ga0496113_0167143 Ga0496113_0167143_447_1109 202
676 3300048916 Ga0496113_0251146 Ga0496113_0251146_35_643 202
677 3300048916 Ga0496113_0432927 Ga0496113_0432927_65_673 202
678 3300048916 Ga0496113_0518166 Ga0496113_0518166_277_903 202
679 3300048916 Ga0496113_0527634 Ga0496113_0527634_11_619 202
680 3300048916 Ga0496113_0531910 Ga0496113_0531910_86_694 202
681 3300048917 Ga0496114_0080842 Ga0496114_0080842_1596_2204 202
682 3300048917 Ga0496114_0309072 Ga0496114_0309072_112_738 202
683 3300048917 Ga0496114_0377859 Ga0496114_0377859_106_714 202
684 3300048917 Ga0496114_0630215 Ga0496114_0630215_306_914 202
685 3300048917 Ga0496114_0730982 Ga0496114_0730982_188_796 202
686 3300048918 Ga0496115_0040830 Ga0496115_0040830_2269_2895 202
687 3300048918 Ga0496115_0404418 Ga0496115_0404418_478_1086 202
688 3300048918 Ga0496115_0414070 Ga0496115_0414070_344_952 202
689 3300048919 Ga0496116_0052983 Ga0496116_0052983_1285_1893 202
690 3300048919 Ga0496116_0185014 Ga0496116_0185014_444_1052 202
691 3300048920 Ga0496117_0062962 Ga0496117_0062962_1254_1868 202
692 3300048921 Ga0496118_0115545 Ga0496118_0115545_40_648 202
693 3300048921 Ga0496118_0131278 Ga0496118_0131278_645_1259 202
694 3300048921 Ga0496118_0248457 Ga0496118_0248457_189_797 202
695 3300048921 Ga0496118_0268327 Ga0496118_0268327_270_878 202
696 3300048922 Ga0496119_0026612 Ga0496119_0026612_2190_2816 202
697 3300048922 Ga0496119_0080598 Ga0496119_0080598_516_1124 202
698 3300048922 Ga0496119_0102232 Ga0496119_0102232_316_924 202
699 3300048922 Ga0496119_0198660 Ga0496119_0198660_403_1011 202
700 3300048922 Ga0496119_0293466 Ga0496119_0293466_57_665 202
701 3300048923 Ga0496120_0064229 Ga0496120_0064229_602_1228 202
702 3300048923 Ga0496120_0126770 Ga0496120_0126770_380_994 202
703 3300048924 Ga0496121_0015225 Ga0496121_0015225_5624_6232 202
704 3300048924 Ga0496121_0038564 Ga0496121_0038564_789_1397 202
705 3300048924 Ga0496121_0148782 Ga0496121_0148782_353_961 202
706 3300048924 Ga0496121_0198200 Ga0496121_0198200_303_911 202
707 3300048924 Ga0496121_0228637 Ga0496121_0228637_579_1187 202
708 3300048924 Ga0496121_0268621 Ga0496121_0268621_34_642 202
709 3300048924 Ga0496121_0275729 Ga0496121_0275729_68_694 202
710 3300048924 Ga0496121_0335218 Ga0496121_0335218_197_805 202
711 3300048924 Ga0496121_0397174 Ga0496121_0397174_12_620 202
712 3300048925 Ga0496122_0128139 Ga0496122_0128139_999_1607 202
713 3300048927 Ga0496124_0213561 Ga0496124_0213561_289_897 202
714 3300048927 Ga0496124_0226758 Ga0496124_0226758_716_1330 202
715 3300048927 Ga0496124_0340109 Ga0496124_0340109_91_699 202
716 3300048927 Ga0496124_0460478 Ga0496124_0460478_124_732 202
717 3300048928 Ga0496125_0009522 Ga0496125_0009522_8944_9558 202
718 3300048928 Ga0496125_0329781 Ga0496125_0329781_11_637 202
719 3300048928 Ga0496125_0431463 Ga0496125_0431463_75_683 202
720 3300048928 Ga0496125_0488078 Ga0496125_0488078_52_660 202
721 3300048929 Ga0496126_0018494 Ga0496126_0018494_215_823 202
722 3300048929 Ga0496126_0047692 Ga0496126_0047692_560_1168 202
723 3300048929 Ga0496126_0082642 Ga0496126_0082642_316_942 202
724 3300048929 Ga0496126_0175970 Ga0496126_0175970_487_1095 202
725 3300048929 Ga0496126_0186473 Ga0496126_0186473_128_742 202
726 3300048929 Ga0496126_0201303 Ga0496126_0201303_273_881 202
727 3300048929 Ga0496126_0322087 Ga0496126_0322087_525_1133 202
728 3300048929 Ga0496126_0409929 Ga0496126_0409929_77_685 202
729 3300049460 Ga0495682_0072104 Ga0495682_0072104_240_866 202
730 3300049460 Ga0495682_0154918 Ga0495682_0154918_109_717 202
731 3300049568 Ga0501031_0026577 Ga0501031_0026577_1776_2384 202
732 3300049568 Ga0501031_0089978 Ga0501031_0089978_23_631 202
733 3300049568 Ga0501031_0121919 Ga0501031_0121919_997_1605 202
734 3300049568 Ga0501031_0365092 Ga0501031_0365092_113_721 202
735 3300049569 Ga0501032_0015059 Ga0501032_0015059_4812_5420 202
736 3300049569 Ga0501032_0124575 Ga0501032_0124575_56_664 202
737 3300049569 Ga0501032_0148800 Ga0501032_0148800_165_773 202
738 3300049569 Ga0501032_0268621 Ga0501032_0268621_405_1013 202
739 3300049570 Ga0501033_0004699 Ga0501033_0004699_2613_3221 202
740 3300049570 Ga0501033_0430804 Ga0501033_0430804_72_680 202
741 3300049570 Ga0501033_0684654 Ga0501033_0684654_77_685 202
742 3300049571 Ga0501034_0095256 Ga0501034_0095256_1758_2366 202
743 3300049571 Ga0501034_0203318 Ga0501034_0203318_485_1099 202
744 3300049571 Ga0501034_0276913 Ga0501034_0276913_248_856 202
745 3300049571 Ga0501034_0392025 Ga0501034_0392025_47_655 202
746 3300049571 Ga0501034_0465658 Ga0501034_0465658_71_688 202
747 3300049572 Ga0501036_0046620 Ga0501036_0046620_1768_2376 202
748 3300049572 Ga0501036_0104377 Ga0501036_0104377_1039_1647 202
749 3300049572 Ga0501036_0124864 Ga0501036_0124864_185_793 202
750 3300049572 Ga0501036_0329957 Ga0501036_0329957_84_692 202
751 3300049572 Ga0501036_0392034 Ga0501036_0392034_356_964 202
752 3300049573 Ga0501037_0000396 Ga0501037_0000396_16414_17022 202
753 3300049573 Ga0501037_0021148 Ga0501037_0021148_1300_1908 202
754 3300049573 Ga0501037_0032014 Ga0501037_0032014_869_1477 202
755 3300049573 Ga0501037_0060449 Ga0501037_0060449_2100_2708 202
756 3300049573 Ga0501037_0151826 Ga0501037_0151826_160_768 202
757 3300049574 Ga0501038_0002046 Ga0501038_0002046_7643_8251 202
758 3300049574 Ga0501038_0004875 Ga0501038_0004875_9766_10374 202
759 3300049574 Ga0501038_0017078 Ga0501038_0017078_1971_2579 202
760 3300049574 Ga0501038_0124817 Ga0501038_0124817_1039_1647 202
761 3300049574 Ga0501038_0162407 Ga0501038_0162407_710_1318 202
762 3300049574 Ga0501038_0185717 Ga0501038_0185717_1022_1630 202
763 3300049575 Ga0501039_0006453 Ga0501039_0006453_6480_7088 202
764 3300049575 Ga0501039_0094817 Ga0501039_0094817_1274_1882 202
765 3300049575 Ga0501039_0173660 Ga0501039_0173660_1039_1647 202
766 3300049576 Ga0501040_0059511 Ga0501040_0059511_957_1565 202
767 3300049577 Ga0501041_0115755 Ga0501041_0115755_506_1114 202
768 3300049577 Ga0501041_0124805 Ga0501041_0124805_499_1107 202
769 3300049578 Ga0501042_0010829 Ga0501042_0010829_4108_4716 202
770 3300049578 Ga0501042_0306328 Ga0501042_0306328_528_1136 202
771 3300049578 Ga0501042_0609811 Ga0501042_0609811_45_653 202
772 3300049579 Ga0501043_0009493 Ga0501043_0009493_4789_5397 202
773 3300049579 Ga0501043_0107537 Ga0501043_0107537_1570_2178 202
774 3300049579 Ga0501043_0127453 Ga0501043_0127453_1097_1705 202
775 3300049579 Ga0501043_0232314 Ga0501043_0232314_490_1098 202
776 3300049579 Ga0501043_0375178 Ga0501043_0375178_110_718 202
777 3300049580 Ga0501046_0011234 Ga0501046_0011234_3776_4384 202
778 3300049580 Ga0501046_0012369 Ga0501046_0012369_6553_7161 202
779 3300049580 Ga0501046_0036451 Ga0501046_0036451_1174_1782 202
780 3300049580 Ga0501046_0120977 Ga0501046_0120977_707_1315 202
781 3300049580 Ga0501046_0238617 Ga0501046_0238617_371_979 202
782 3300049581 Ga0501047_0084506 Ga0501047_0084506_215_823 202
783 3300049581 Ga0501047_0180578 Ga0501047_0180578_35_643 202
784 3300049581 Ga0501047_0183263 Ga0501047_0183263_330_938 202
785 3300049581 Ga0501047_0186509 Ga0501047_0186509_229_837 202
786 3300049581 Ga0501047_0227279 Ga0501047_0227279_23_631 202
787 3300049581 Ga0501047_0381294 Ga0501047_0381294_615_1223 202
788 3300049581 Ga0501047_0430356 Ga0501047_0430356_206_814 202
789 3300049582 Ga0501048_0073468 Ga0501048_0073468_436_1044 202
790 3300049582 Ga0501048_0197293 Ga0501048_0197293_608_1216 202
791 3300049583 Ga0501067_0008905 Ga0501067_0008905_2672_3280 202
792 3300049583 Ga0501067_0083746 Ga0501067_0083746_92_700 202
793 3300049584 Ga0501068_0033304 Ga0501068_0033304_1411_2019 202
794 3300049584 Ga0501068_0060477 Ga0501068_0060477_1456_2064 202
795 3300049584 Ga0501068_0077477 Ga0501068_0077477_995_1603 202
796 3300049584 Ga0501068_0310137 Ga0501068_0310137_295_903 202
797 3300049585 Ga0501069_0059634 Ga0501069_0059634_246_854 202
798 3300049585 Ga0501069_0061227 Ga0501069_0061227_1357_1965 202
799 3300049586 Ga0501070_0025427 Ga0501070_0025427_821_1429 202
800 3300049586 Ga0501070_0173313 Ga0501070_0173313_1015_1623 202
801 3300049586 Ga0501070_0722157 Ga0501070_0722157_89_697 202
802 3300049586 Ga0501070_0997429 Ga0501070_0997429_14_622 202
803 3300049587 Ga0501071_0062939 Ga0501071_0062939_1714_2322 202
804 3300049589 Ga0501073_0036008 Ga0501073_0036008_139_747 202
805 3300049589 Ga0501073_0198639 Ga0501073_0198639_485_1099 202
806 3300049589 Ga0501073_0225265 Ga0501073_0225265_354_962 202
807 3300049589 Ga0501073_0708173 Ga0501073_0708173_51_659 202
808 3300049590 Ga0501074_0041848 Ga0501074_0041848_2348_2956 202
809 3300049592 Ga0501076_0072201 Ga0501076_0072201_1053_1661 202
810 3300049592 Ga0501076_0588593 Ga0501076_0588593_110_718 202
811 3300049741 Ga0501079_0055313 Ga0501079_0055313_814_1422 202
812 3300049742 Ga0501080_0079464 Ga0501080_0079464_1692_2300 202
813 3300049742 Ga0501080_0241801 Ga0501080_0241801_51_659 202
814 3300049742 Ga0501080_0323017 Ga0501080_0323017_258_866 202
815 3300049742 Ga0501080_0356239 Ga0501080_0356239_239_847 202
816 3300049742 Ga0501080_0588663 Ga0501080_0588663_218_826 202
817 3300049743 Ga0501081_0735241 Ga0501081_0735241_90_698 202
818 3300049744 Ga0501083_0019398 Ga0501083_0019398_2909_3517 202
819 3300049822 Ga0501035_0005535 Ga0501035_0005535_3576_4184 202
820 3300049822 Ga0501035_0089419 Ga0501035_0089419_2054_2662 202
821 3300049822 Ga0501035_0393301 Ga0501035_0393301_385_993 202
822 3300049822 Ga0501035_0487840 Ga0501035_0487840_360_968 202
823 3300049823 Ga0501044_0000266 Ga0501044_0000266_1465_2082 202
824 3300049823 Ga0501044_0086969 Ga0501044_0086969_198_806 202
825 3300049823 Ga0501044_0087043 Ga0501044_0087043_1798_2406 202
826 3300049823 Ga0501044_0154144 Ga0501044_0154144_991_1599 202
827 3300049823 Ga0501044_0184866 Ga0501044_0184866_658_1266 202
828 3300049823 Ga0501044_0221756 Ga0501044_0221756_93_701 202
829 3300049824 Ga0501045_0061052 Ga0501045_0061052_991_1599 202
830 3300049824 Ga0501045_0506427 Ga0501045_0506427_114_722 202
831 3300049824 Ga0501045_0654631 Ga0501045_0654631_134_742 202
832 3300050489 nmdc:mga03683_35414_c1 nmdc:mga03683_35414_c1_664_1272 202
833 3300050489 nmdc:mga03683_59279_c1 nmdc:mga03683_59279_c1_970_1596 202
834 3300050490 nmdc:mga03n38_184883_c1 nmdc:mga03n38_184883_c1_438_1052 202
835 3300050491 nmdc:mga00v17_181630_c1 nmdc:mga00v17_181630_c1_591_1199 202
836 3300050491 nmdc:mga00v17_212175_c1 nmdc:mga00v17_212175_c1_453_1079 202
837 3300050491 nmdc:mga00v17_63879_c2 nmdc:mga00v17_63879_c2_114_728 202
838 3300050492 nmdc:mga0yw44_152509_c1 nmdc:mga0yw44_152509_c1_502_1116 202
839 3300050492 nmdc:mga0yw44_255443_c1 nmdc:mga0yw44_255443_c1_192_800 202
840 3300050492 nmdc:mga0yw44_467598_c1 nmdc:mga0yw44_467598_c1_84_692 202
841 3300050492 nmdc:mga0yw44_71145_c1 nmdc:mga0yw44_71145_c1_263_871 202
842 3300050492 nmdc:mga0yw44_7902_c1 nmdc:mga0yw44_7902_c1_4282_4890 202
843 3300050493 nmdc:mga0k408_588395_c1 nmdc:mga0k408_588395_c1_17_625 202
844 3300050494 nmdc:mga06z11_396588_c1 nmdc:mga06z11_396588_c1_56_664 202
845 3300050494 nmdc:mga06z11_44141_c1 nmdc:mga06z11_44141_c1_757_1371 202
846 3300050494 nmdc:mga06z11_86718_c1 nmdc:mga06z11_86718_c1_155_763 202
847 3300050495 nmdc:mga04h51_70975_c1 nmdc:mga04h51_70975_c1_413_1039 202
848 3300050496 nmdc:mga07m45_45396_c1 nmdc:mga07m45_45396_c1_840_1454 202
849 3300050514 nmdc:mga08x19_723900_c1 nmdc:mga08x19_723900_c1_74_682 202
850 3300050515 nmdc:mga0a205_708126_c1 nmdc:mga0a205_708126_c1_82_690 202
851 3300050516 nmdc:mga0sz30_18667_c1 nmdc:mga0sz30_18667_c1_1795_2409 202
852 3300050516 nmdc:mga0sz30_220165_c1 nmdc:mga0sz30_220165_c1_71_679 202
853 3300050516 nmdc:mga0sz30_296678_c1 nmdc:mga0sz30_296678_c1_28_654 202
854 3300053078 Ga0495612_0140110 Ga0495612_0140110_291_917 202
855 3300053080 Ga0500635_0060880 Ga0500635_0060880_610_1236 202
856 3300053084 Ga0495595_0046790 Ga0495595_0046790_336_962 202
857 3300053085 Ga0495619_0093254 Ga0495619_0093254_485_1111 202
858 3300053087 Ga0500643_000057 Ga0500643_000057_33286_33894 202
859 3300053087 Ga0500643_036668 Ga0500643_036668_393_1001 202
860 3300053093 Ga0500651_0041183 Ga0500651_0041183_810_1418 202
861 3300053094 Ga0500566_0001388 Ga0500566_0001388_7000_7608 202
862 3300053096 Ga0500641_0076207 Ga0500641_0076207_537_1145 202
863 3300053096 Ga0500641_0095981 Ga0500641_0095981_621_1229 202
864 3300053103 Ga0500555_016297 Ga0500555_016297_1142_1750 202
865 3300053104 Ga0500556_0221039 Ga0500556_0221039_76_684 202
866 3300053105 Ga0500557_000225 Ga0500557_000225_1285_1893 202
867 3300053108 Ga0500562_027780 Ga0500562_027780_672_1280 202
868 3300053109 Ga0500569_124764 Ga0500569_124764_164_772 202
869 3300053116 Ga0500592_030897 Ga0500592_030897_98_706 202
870 3300053119 Ga0500595_021149 Ga0500595_021149_850_1458 202
871 3300053119 Ga0500595_029690 Ga0500595_029690_400_1008 202
872 3300053120 Ga0500597_166784 Ga0500597_166784_13_621 202
873 3300053126 Ga0500621_093921 Ga0500621_093921_31_639 202
874 3300053126 Ga0500621_210666 Ga0500621_210666_33_641 202
875 3300053130 Ga0500642_0000740 Ga0500642_0000740_7985_8593 202
876 3300053130 Ga0500642_0008396 Ga0500642_0008396_2100_2708 202
877 3300053134 Ga0500658_0245689 Ga0500658_0245689_10_618 202
878 3300053136 Ga0500559_0009353 Ga0500559_0009353_321_947 202
879 3300053142 Ga0500577_0097649 Ga0500577_0097649_543_1151 202
880 3300053142 Ga0500577_0200872 Ga0500577_0200872_34_642 202
881 3300053146 Ga0500588_0025909 Ga0500588_0025909_169_777 202
882 3300053147 Ga0500589_163993 Ga0500589_163993_60_668 202
883 3300053150 Ga0500603_001521 Ga0500603_001521_3176_3802 202
884 3300053161 Ga0500634_0079239 Ga0500634_0079239_253_861 202
885 3300053178 Ga0500637_0065890 Ga0500637_0065890_1093_1719 202
886 3300053724 Ga0500570_024854 Ga0500570_024854_1276_1884 202
887 3300053729 Ga0500625_015449 Ga0500625_015449_805_1413 202
888 3300053730 Ga0500645_017168 Ga0500645_017168_1436_2062 202
889 3300053731 Ga0500609_008934 Ga0500609_008934_698_1306 202
890 3300053737 Ga0500601_001283 Ga0500601_001283_872_1498 202
891 3300054114 Ga0501084_0071584 Ga0501084_0071584_1247_1855 202
892 3300054114 Ga0501084_0137721 Ga0501084_0137721_783_1391 202
893 3300060353 Ga0501082_0094831 Ga0501082_0094831_853_1461 202
894 3300060353 Ga0501082_0212829 Ga0501082_0212829_740_1348 202
895 3300060353 Ga0501082_0446640 Ga0501082_0446640_229_837 202
896 iso_pu_bacteria 2874604998 2874612650 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02581

TMP-TENI

Thiamine monophosphate synthase

7

181

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xi3-assembly1.cif.gz_B thiamine phosphate pyrophosphorylase from pyrococcus furiosus pfu-1255191-001 0.8698 6 200
1g67-assembly1.cif.gz_A thiamin phosphate synthase 0.8636 7 200
1g4t-assembly1.cif.gz_A thiamin phosphate synthase 0.86 7 200
1g67-assembly1.cif.gz_A thiamin phosphate synthase 0.8284 7 200
1g4p-assembly1.cif.gz_A thiamin phosphate synthase 0.8252 7 200
ID Description Score Start End Superfamily
af_P30137_10_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9629 7 196 3.20.20.70
af_P30137_10_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.925 7 196 3.20.20.70
af_Q2FWG3_1_212_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8742 6 196 3.20.20.70
1xi3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8698 6 200 3.20.20.70
af_A0A1D6MYJ2_339_548_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.86 7 199 3.20.20.70
ID Description Score Start End GO Terms
AF-H0TEU9-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9964 1 202 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229
AF-H0SSH3-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.996 1 198 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229
AF-A0A1W9ILI2-F1-model_v4 Thiamine-phosphate synthase (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) 0.9951 1 202 GO:0004789
GO:0005737
GO:0009228
GO:0009229
GO:0046872
AF-A0A023XMX1-F1-model_v4 deleted 0.9949 1 196
AF-A0A3S0E386-F1-model_v4 deleted 0.9947 1 198

Feature Viewer

pLDDT pTM Quality
93.6 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map