F485024
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 896 | 536 | 743 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300039438|Ga0436360_0311998|Ga0436360_0311998_103_747 |
| Length | 214 |
| Sequence | MPYPDRFYPVVDSLAWVERLTRLGVGTIQLRAKNLNDQDALAIVREALAVTEGTGTKLVVNDYWRAAIDANATHLHLGQEDLAEADLKAIRAAGLTLGVSTHDDEELAAALRAKPDYVALGPIFFTTLKSMRFAPQGIPKITEWKRRVGNIPLVAIGGIKLEHAAEIFAAGADSIAVVSDVTQNPDPDARVRSTSTLDKKTSPKPISRRSAKPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 13 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 14 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 15 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 16 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 17 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 18 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 19 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 20 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 21 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 22 | 2791355199 | |||
| 23 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 24 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 25 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 26 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 27 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 28 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 29 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 30 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 31 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 32 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 33 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 34 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 35 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 36 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 37 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 38 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 39 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 40 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 41 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 42 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 43 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 44 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 45 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 46 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 47 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 48 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 49 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 50 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 51 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 52 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 53 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 54 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 55 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 56 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 57 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 58 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 59 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 60 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 61 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 62 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 63 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 64 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 65 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 66 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 67 | 2922368715 | |||
| 68 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 69 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 70 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 71 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 72 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 73 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 74 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 75 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 76 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 77 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 78 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 79 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 80 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 81 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 82 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 83 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 84 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 85 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 86 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 87 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 88 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 89 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 90 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 91 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 92 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 93 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 94 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 95 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 96 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 97 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 98 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 99 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 100 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 101 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 102 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 103 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 104 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 105 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 106 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 107 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 108 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 109 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 110 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 111 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 112 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 113 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 114 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 115 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 116 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 117 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 118 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 119 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 120 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 121 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 122 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 123 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 124 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 125 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 126 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 127 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 128 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 129 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 130 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 131 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 132 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 133 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 134 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 135 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 136 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 137 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 139 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 140 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 141 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 142 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 143 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 144 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 149 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 152 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 155 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 156 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 157 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 158 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 159 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 160 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 162 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 164 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 165 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 166 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 167 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 168 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 169 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 170 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 171 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 172 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 173 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 174 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 176 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 177 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 178 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 179 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 180 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 181 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 182 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 183 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 185 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 186 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 187 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 188 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 200 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 211 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 212 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 213 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 214 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 215 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 216 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 217 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 218 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 219 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 225 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 279 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 280 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 281 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 286 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 287 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 288 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 289 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 290 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 291 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 292 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 293 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 294 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 295 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 296 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 297 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 298 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 299 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 300 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 301 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 302 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 303 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 304 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 305 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 306 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 307 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 308 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 309 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 310 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 311 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 312 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 313 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 314 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 315 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 316 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 317 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 318 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 319 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 320 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 322 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 323 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 324 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 325 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 326 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 327 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 328 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 329 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 330 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 331 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 332 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 405 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 406 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 407 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 408 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 409 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 412 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 413 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 414 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 415 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 416 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 417 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 418 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 419 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 420 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 421 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 422 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 423 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 424 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 425 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 426 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 427 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 459 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 460 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 461 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 462 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 463 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 464 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 465 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 466 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 469 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 471 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 474 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 475 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 476 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 477 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 478 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 479 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 480 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 481 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 482 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 483 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 484 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 485 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 486 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 487 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 488 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 489 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 490 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 491 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 492 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 493 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 494 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 495 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 496 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 497 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 498 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 499 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 500 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 501 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 502 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 503 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 504 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 505 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 506 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 507 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 509 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 510 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 511 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 512 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 513 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 514 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 515 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 516 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 517 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 518 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 519 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 520 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 521 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 522 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 523 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 524 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 525 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 526 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 527 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 528 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 529 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 530 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 531 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 532 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 533 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 534 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 535 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 536 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83 |
| Metatranscriptomes | 0.11 |
| Isolates | 16.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.95 |
| Nodule | 14.73 |
| Rhizoplane | 5.58 |
| Rhizosphere | 54.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10099732 | 3300002067 | Bacteria | 834 |
| 2 | JGI24742J22300_10061538 | 3300002244 | Bacteria | 691 |
| 3 | JGI25165J46597_1012784 | 3300003214 | Bacteria | 1166 |
| 4 | JGI25153J46596_10002568 | 3300003215 | Bacteria | 10405 |
| 5 | JGI25153J46596_10013493 | 3300003215 | Bacteria | 3448 |
| 6 | JGI25153J46596_10014078 | 3300003215 | Bacteria | 3345 |
| 7 | JGI25160J50197_1003238 | 3300003354 | Bacteria | 7344 |
| 8 | JGI25160J50197_1024080 | 3300003354 | Bacteria | 1736 |
| 9 | JGI25404J52841_10015155 | 3300003659 | Bacteria | 1673 |
| 10 | Ga0055525_1007627 | 3300003759 | Bacteria | 913 |
| 11 | Ga0055526_1035800 | 3300003771 | Bacteria | 1330 |
| 12 | Ga0055531_10026099 | 3300003794 | Bacteria | 2096 |
| 13 | Ga0055543_1002483 | 3300004625 | Bacteria | 6074 |
| 14 | Ga0065165_1000866 | 3300005262 | Bacteria | 39512 |
| 15 | Ga0065165_1022843 | 3300005262 | Bacteria | 2133 |
| 16 | Ga0065165_1023762 | 3300005262 | Bacteria | 2071 |
| 17 | Ga0070658_11123532 | 3300005327 | Bacteria | 683 |
| 18 | Ga0070658_11126514 | 3300005327 | Bacteria | 682 |
| 19 | Ga0070690_100769055 | 3300005330 | Bacteria | 745 |
| 20 | Ga0068869_100054968 | 3300005334 | Bacteria | 2900 |
| 21 | Ga0070680_100155993 | 3300005336 | Bacteria | 1918 |
| 22 | Ga0068868_100114720 | 3300005338 | Bacteria | 2192 |
| 23 | Ga0068868_101101890 | 3300005338 | Bacteria | 731 |
| 24 | Ga0070689_100382480 | 3300005340 | Bacteria | 1186 |
| 25 | Ga0070687_100207237 | 3300005343 | Bacteria | 1192 |
| 26 | Ga0070668_100027110 | 3300005347 | Bacteria | 4348 |
| 27 | Ga0070668_100103345 | 3300005347 | Bacteria | 2260 |
| 28 | Ga0070668_100174359 | 3300005347 | Bacteria | 1752 |
| 29 | Ga0070668_100430126 | 3300005347 | Bacteria | 1131 |
| 30 | Ga0070668_100678005 | 3300005347 | Bacteria | 907 |
| 31 | Ga0070671_100999578 | 3300005355 | Bacteria | 733 |
| 32 | Ga0070674_100036028 | 3300005356 | Bacteria | 3318 |
| 33 | Ga0070673_100256983 | 3300005364 | Bacteria | 1525 |
| 34 | Ga0070688_100369324 | 3300005365 | Bacteria | 1055 |
| 35 | Ga0070659_100228749 | 3300005366 | Bacteria | 1536 |
| 36 | Ga0070667_100891271 | 3300005367 | Bacteria | 828 |
| 37 | Ga0070713_100217909 | 3300005436 | Bacteria | 1731 |
| 38 | Ga0070713_100962118 | 3300005436 | Bacteria | 823 |
| 39 | Ga0070663_100059935 | 3300005455 | Bacteria | 2736 |
| 40 | Ga0070663_100145254 | 3300005455 | Bacteria | 1814 |
| 41 | Ga0070663_100189808 | 3300005455 | Bacteria | 1598 |
| 42 | Ga0070663_100656601 | 3300005455 | Bacteria | 887 |
| 43 | Ga0070662_100083187 | 3300005457 | Bacteria | 2388 |
| 44 | Ga0068867_100595080 | 3300005459 | Bacteria | 964 |
| 45 | Ga0070698_100209554 | 3300005471 | Bacteria | 1884 |
| 46 | Ga0070684_100010999 | 3300005535 | Bacteria | 7197 |
| 47 | Ga0070697_100053717 | 3300005536 | Bacteria | 3275 |
| 48 | Ga0068853_100213069 | 3300005539 | Bacteria | 1761 |
| 49 | Ga0068853_100293683 | 3300005539 | Bacteria | 1501 |
| 50 | Ga0070686_100230778 | 3300005544 | Bacteria | 1343 |
| 51 | Ga0070665_100153179 | 3300005548 | Bacteria | 2307 |
| 52 | Ga0070665_100192952 | 3300005548 | Bacteria | 2037 |
| 53 | Ga0070665_100357422 | 3300005548 | Bacteria | 1466 |
| 54 | Ga0070665_100430484 | 3300005548 | Bacteria | 1328 |
| 55 | Ga0068855_100244299 | 3300005563 | Bacteria | 2004 |
| 56 | Ga0068855_100607703 | 3300005563 | Bacteria | 1178 |
| 57 | Ga0070664_100242698 | 3300005564 | Bacteria | 1617 |
| 58 | Ga0070664_100785845 | 3300005564 | Bacteria | 890 |
| 59 | Ga0068856_100508519 | 3300005614 | Bacteria | 1226 |
| 60 | Ga0068856_100869406 | 3300005614 | Bacteria | 921 |
| 61 | Ga0068852_100391971 | 3300005616 | Bacteria | 1364 |
| 62 | Ga0068852_100993822 | 3300005616 | Bacteria | 858 |
| 63 | Ga0068864_100328139 | 3300005618 | Bacteria | 1439 |
| 64 | Ga0068864_100529912 | 3300005618 | Bacteria | 1136 |
| 65 | Ga0068851_10492948 | 3300005834 | Bacteria | 734 |
| 66 | Ga0068870_10109348 | 3300005840 | Bacteria | 1576 |
| 67 | Ga0068870_10500581 | 3300005840 | Bacteria | 810 |
| 68 | Ga0068863_100279776 | 3300005841 | Bacteria | 1616 |
| 69 | Ga0068863_101535728 | 3300005841 | Bacteria | 675 |
| 70 | Ga0068858_100122372 | 3300005842 | Bacteria | 2434 |
| 71 | Ga0068860_100094368 | 3300005843 | Bacteria | 2852 |
| 72 | Ga0068860_101067413 | 3300005843 | Bacteria | 826 |
| 73 | Ga0068862_100079284 | 3300005844 | Bacteria | 2846 |
| 74 | Ga0068862_100305099 | 3300005844 | Bacteria | 1466 |
| 75 | Ga0068862_100381121 | 3300005844 | Bacteria | 1315 |
| 76 | Ga0068862_100496742 | 3300005844 | Bacteria | 1157 |
| 77 | Ga0068862_100609103 | 3300005844 | Bacteria | 1049 |
| 78 | Ga0081455_10050141 | 3300005937 | Bacteria | 3592 |
| 79 | Ga0081455_10071493 | 3300005937 | Bacteria | 2876 |
| 80 | Ga0081540_1001986 | 3300005983 | Bacteria | 17063 |
| 81 | Ga0081540_1003959 | 3300005983 | Bacteria | 11507 |
| 82 | Ga0081540_1016453 | 3300005983 | Bacteria | 4627 |
| 83 | Ga0081540_1040288 | 3300005983 | Bacteria | 2436 |
| 84 | Ga0070717_10684231 | 3300006028 | Bacteria | 932 |
| 85 | Ga0075365_10081939 | 3300006038 | Bacteria | 2187 |
| 86 | Ga0075365_10097363 | 3300006038 | Bacteria | 2011 |
| 87 | Ga0075365_10107281 | 3300006038 | Bacteria | 1917 |
| 88 | Ga0075363_100072768 | 3300006048 | Bacteria | 1869 |
| 89 | Ga0075363_100336746 | 3300006048 | Bacteria | 879 |
| 90 | Ga0075363_100381484 | 3300006048 | Bacteria | 826 |
| 91 | Ga0075364_10095002 | 3300006051 | Bacteria | 1981 |
| 92 | Ga0075364_10186690 | 3300006051 | Bacteria | 1404 |
| 93 | Ga0070715_10245687 | 3300006163 | Bacteria | 933 |
| 94 | Ga0075362_10027219 | 3300006177 | Bacteria | 2446 |
| 95 | Ga0075367_10042624 | 3300006178 | Bacteria | 2656 |
| 96 | Ga0075367_10391503 | 3300006178 | Bacteria | 878 |
| 97 | Ga0075369_10169657 | 3300006186 | Bacteria | 1002 |
| 98 | Ga0075369_10322537 | 3300006186 | Bacteria | 723 |
| 99 | Ga0075366_10224491 | 3300006195 | Bacteria | 1144 |
| 100 | Ga0075366_10243457 | 3300006195 | Bacteria | 1096 |
| 101 | Ga0075366_10268549 | 3300006195 | Bacteria | 1042 |
| 102 | Ga0097621_100956827 | 3300006237 | Bacteria | 800 |
| 103 | Ga0075370_10177315 | 3300006353 | Bacteria | 1254 |
| 104 | Ga0075370_10220280 | 3300006353 | Bacteria | 1121 |
| 105 | Ga0075370_10223711 | 3300006353 | Bacteria | 1112 |
| 106 | Ga0075428_100196472 | 3300006844 | Bacteria | 2181 |
| 107 | Ga0068865_100101744 | 3300006881 | Bacteria | 2105 |
| 108 | Ga0068865_100373720 | 3300006881 | Bacteria | 1161 |
| 109 | Ga0075436_100777904 | 3300006914 | Bacteria | 712 |
| 110 | Ga0105240_10020447 | 3300009093 | Bacteria | 8829 |
| 111 | Ga0105240_11357177 | 3300009093 | Bacteria | 748 |
| 112 | Ga0105245_11092254 | 3300009098 | Bacteria | 844 |
| 113 | Ga0105247_10063969 | 3300009101 | Bacteria | 2285 |
| 114 | Ga0105247_10206866 | 3300009101 | Bacteria | 1322 |
| 115 | Ga0114129_10527086 | 3300009147 | Bacteria | 1539 |
| 116 | Ga0105243_10031732 | 3300009148 | Bacteria | 4075 |
| 117 | Ga0105243_10432358 | 3300009148 | Bacteria | 1231 |
| 118 | Ga0105243_10457568 | 3300009148 | Bacteria | 1199 |
| 119 | Ga0105243_10473269 | 3300009148 | Bacteria | 1181 |
| 120 | Ga0105241_10049513 | 3300009174 | Bacteria | 3200 |
| 121 | Ga0105241_10140618 | 3300009174 | Bacteria | 1965 |
| 122 | Ga0105241_11195539 | 3300009174 | Bacteria | 720 |
| 123 | Ga0105242_10608441 | 3300009176 | Bacteria | 1057 |
| 124 | Ga0105242_11156961 | 3300009176 | Bacteria | 791 |
| 125 | Ga0105248_10505669 | 3300009177 | Bacteria | 1362 |
| 126 | Ga0105237_10068396 | 3300009545 | Bacteria | 3545 |
| 127 | Ga0105238_10693667 | 3300009551 | Bacteria | 1030 |
| 128 | Ga0105249_10305151 | 3300009553 | Bacteria | 1598 |
| 129 | Ga0105249_11349016 | 3300009553 | Bacteria | 785 |
| 130 | Ga0099796_10148941 | 3300010159 | Bacteria | 920 |
| 131 | Ga0105239_10053578 | 3300010375 | Bacteria | 4425 |
| 132 | Ga0105239_10136576 | 3300010375 | Bacteria | 2730 |
| 133 | Ga0105239_10438457 | 3300010375 | Bacteria | 1481 |
| 134 | Ga0105239_10506257 | 3300010375 | Bacteria | 1373 |
| 135 | Ga0105239_10584380 | 3300010375 | Bacteria | 1273 |
| 136 | Ga0105239_10656958 | 3300010375 | Bacteria | 1198 |
| 137 | Ga0105239_11424524 | 3300010375 | Bacteria | 800 |
| 138 | Ga0157373_10649584 | 3300013100 | Bacteria | 770 |
| 139 | Ga0157370_10248815 | 3300013104 | Bacteria | 1644 |
| 140 | Ga0157374_10514938 | 3300013296 | Bacteria | 1202 |
| 141 | Ga0157374_10787273 | 3300013296 | Bacteria | 966 |
| 142 | Ga0157378_10301137 | 3300013297 | Bacteria | 1552 |
| 143 | Ga0163162_10605859 | 3300013306 | Bacteria | 1221 |
| 144 | Ga0157375_10273504 | 3300013308 | Bacteria | 1851 |
| 145 | Ga0157375_10768747 | 3300013308 | Bacteria | 1114 |
| 146 | Ga0163163_10117591 | 3300014325 | Bacteria | 2690 |
| 147 | Ga0163163_10297644 | 3300014325 | Bacteria | 1666 |
| 148 | Ga0163163_10957050 | 3300014325 | Bacteria | 919 |
| 149 | Ga0163163_11037067 | 3300014325 | Bacteria | 883 |
| 150 | Ga0157379_10389004 | 3300014968 | Bacteria | 1280 |
| 151 | Ga0157376_11212705 | 3300014969 | Bacteria | 783 |
| 152 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 153 | Ga0214544_1024413 | 3300021320 | Bacteria | 3140 |
| 154 | Ga0214542_1000005 | 3300021321 | Bacteria | 389646 |
| 155 | Ga0214542_1022513 | 3300021321 | Bacteria | 4021 |
| 156 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 157 | Ga0214545_1013953 | 3300021324 | Bacteria | 9654 |
| 158 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 159 | Ga0214543_1036318 | 3300021327 | Bacteria | 1543 |
| 160 | Ga0213872_10143744 | 3300021361 | Bacteria | 1045 |
| 161 | Ga0213874_10023666 | 3300021377 | Bacteria | 1716 |
| 162 | Ga0213876_10372511 | 3300021384 | Bacteria | 759 |
| 163 | Ga0213875_10034375 | 3300021388 | Bacteria | 2393 |
| 164 | Ga0213871_10006629 | 3300021441 | Bacteria | 2460 |
| 165 | Ga0209563_112577 | 3300025230 | Bacteria | 1152 |
| 166 | Ga0209677_101244 | 3300025253 | Bacteria | 11496 |
| 167 | Ga0209677_104808 | 3300025253 | Bacteria | 3741 |
| 168 | Ga0209148_1000253 | 3300025254 | Bacteria | 84643 |
| 169 | Ga0209233_1001970 | 3300025261 | Bacteria | 7805 |
| 170 | Ga0209233_1009212 | 3300025261 | Bacteria | 3015 |
| 171 | Ga0209455_1001785 | 3300025272 | Bacteria | 9087 |
| 172 | Ga0209455_1005205 | 3300025272 | Bacteria | 4072 |
| 173 | Ga0209455_1006143 | 3300025272 | Bacteria | 3598 |
| 174 | Ga0209455_1027323 | 3300025272 | Bacteria | 1012 |
| 175 | Ga0209564_1005010 | 3300025295 | Bacteria | 7778 |
| 176 | Ga0209564_1016256 | 3300025295 | Bacteria | 2974 |
| 177 | Ga0209758_1000026 | 3300025297 | Bacteria | 582706 |
| 178 | Ga0209758_1000318 | 3300025297 | Bacteria | 92807 |
| 179 | Ga0209758_1001423 | 3300025297 | Bacteria | 28319 |
| 180 | Ga0209758_1002424 | 3300025297 | Bacteria | 19060 |
| 181 | Ga0209758_1003005 | 3300025297 | Bacteria | 16142 |
| 182 | Ga0209758_1038631 | 3300025297 | Bacteria | 1828 |
| 183 | Ga0207426_1000425 | 3300025302 | Bacteria | 69088 |
| 184 | Ga0207426_1001506 | 3300025302 | Bacteria | 19028 |
| 185 | Ga0207426_1019039 | 3300025302 | Bacteria | 2407 |
| 186 | Ga0207426_1019633 | 3300025302 | Bacteria | 2360 |
| 187 | Ga0209051_1079705 | 3300025303 | Bacteria | 950 |
| 188 | Ga0209051_1103626 | 3300025303 | Bacteria | 759 |
| 189 | Ga0209257_1002846 | 3300025304 | Bacteria | 16199 |
| 190 | Ga0207697_10119290 | 3300025315 | Bacteria | 1134 |
| 191 | Ga0207696_1077826 | 3300025711 | Bacteria | 918 |
| 192 | Ga0207710_10193016 | 3300025900 | Bacteria | 1003 |
| 193 | Ga0207680_10303059 | 3300025903 | Bacteria | 1114 |
| 194 | Ga0207680_10370781 | 3300025903 | Bacteria | 1008 |
| 195 | Ga0207647_10080325 | 3300025904 | Bacteria | 1956 |
| 196 | Ga0207647_10130615 | 3300025904 | Bacteria | 1476 |
| 197 | Ga0207647_10220191 | 3300025904 | Bacteria | 1094 |
| 198 | Ga0207647_10386612 | 3300025904 | Bacteria | 789 |
| 199 | Ga0207699_10075887 | 3300025906 | Bacteria | 2069 |
| 200 | Ga0207645_10218177 | 3300025907 | Bacteria | 1257 |
| 201 | Ga0207643_10011341 | 3300025908 | Bacteria | 4813 |
| 202 | Ga0207643_10067803 | 3300025908 | Bacteria | 2049 |
| 203 | Ga0207654_10016046 | 3300025911 | Bacteria | 3896 |
| 204 | Ga0207654_10502014 | 3300025911 | Bacteria | 857 |
| 205 | Ga0207707_10171584 | 3300025912 | Bacteria | 1895 |
| 206 | Ga0207707_10833602 | 3300025912 | Bacteria | 766 |
| 207 | Ga0207695_10000634 | 3300025913 | Bacteria | 70325 |
| 208 | Ga0207671_10011863 | 3300025914 | Bacteria | 7053 |
| 209 | Ga0207671_10150853 | 3300025914 | Bacteria | 1796 |
| 210 | Ga0207693_10481253 | 3300025915 | Bacteria | 969 |
| 211 | Ga0207693_10622476 | 3300025915 | Bacteria | 839 |
| 212 | Ga0207663_10049899 | 3300025916 | Bacteria | 2598 |
| 213 | Ga0207662_10560122 | 3300025918 | Bacteria | 792 |
| 214 | Ga0207657_10007164 | 3300025919 | Bacteria | 11456 |
| 215 | Ga0207649_10631726 | 3300025920 | Bacteria | 826 |
| 216 | Ga0207646_10222438 | 3300025922 | Bacteria | 1705 |
| 217 | Ga0207681_10908983 | 3300025923 | Bacteria | 737 |
| 218 | Ga0207659_10301607 | 3300025926 | Bacteria | 1316 |
| 219 | Ga0207687_10109786 | 3300025927 | Bacteria | 2044 |
| 220 | Ga0207700_10086666 | 3300025928 | Bacteria | 2461 |
| 221 | Ga0207644_10143966 | 3300025931 | Bacteria | 1838 |
| 222 | Ga0207644_10577049 | 3300025931 | Bacteria | 932 |
| 223 | Ga0207690_10104373 | 3300025932 | Bacteria | 2030 |
| 224 | Ga0207690_10560745 | 3300025932 | Bacteria | 929 |
| 225 | Ga0207706_10027445 | 3300025933 | Bacteria | 5090 |
| 226 | Ga0207706_10280768 | 3300025933 | Bacteria | 1452 |
| 227 | Ga0207706_10436772 | 3300025933 | Bacteria | 1133 |
| 228 | Ga0207709_10033563 | 3300025935 | Bacteria | 3015 |
| 229 | Ga0207669_10017298 | 3300025937 | Bacteria | 3693 |
| 230 | Ga0207704_10079727 | 3300025938 | Bacteria | 2111 |
| 231 | Ga0207691_10172079 | 3300025940 | Bacteria | 1896 |
| 232 | Ga0207711_10758307 | 3300025941 | Bacteria | 904 |
| 233 | Ga0207661_10006721 | 3300025944 | Bacteria | 8137 |
| 234 | Ga0207679_10654677 | 3300025945 | Bacteria | 950 |
| 235 | Ga0207667_10142283 | 3300025949 | Bacteria | 2470 |
| 236 | Ga0207667_10886806 | 3300025949 | Bacteria | 884 |
| 237 | Ga0207667_10894275 | 3300025949 | Bacteria | 880 |
| 238 | Ga0207651_10521423 | 3300025960 | Bacteria | 1030 |
| 239 | Ga0207651_10621345 | 3300025960 | Bacteria | 946 |
| 240 | Ga0207651_10792171 | 3300025960 | Bacteria | 840 |
| 241 | Ga0207668_10024406 | 3300025972 | Bacteria | 3901 |
| 242 | Ga0207668_10087629 | 3300025972 | Bacteria | 2277 |
| 243 | Ga0207668_10245346 | 3300025972 | Bacteria | 1451 |
| 244 | Ga0207668_10253140 | 3300025972 | Bacteria | 1431 |
| 245 | Ga0207668_10319083 | 3300025972 | Bacteria | 1288 |
| 246 | Ga0207668_10769404 | 3300025972 | Bacteria | 850 |
| 247 | Ga0207640_10295965 | 3300025981 | Bacteria | 1278 |
| 248 | Ga0207658_10395367 | 3300025986 | Bacteria | 1214 |
| 249 | Ga0207677_10104387 | 3300026023 | Bacteria | 2094 |
| 250 | Ga0207703_10134202 | 3300026035 | Bacteria | 2141 |
| 251 | Ga0207639_10102083 | 3300026041 | Bacteria | 2321 |
| 252 | Ga0207678_10012307 | 3300026067 | Bacteria | 7512 |
| 253 | Ga0207678_10123704 | 3300026067 | Bacteria | 2207 |
| 254 | Ga0207678_10212311 | 3300026067 | Bacteria | 1656 |
| 255 | Ga0207678_10284104 | 3300026067 | Bacteria | 1421 |
| 256 | Ga0207678_10551168 | 3300026067 | Bacteria | 1008 |
| 257 | Ga0207678_11047033 | 3300026067 | Bacteria | 722 |
| 258 | Ga0207702_10477016 | 3300026078 | Bacteria | 1213 |
| 259 | Ga0207702_11376308 | 3300026078 | Bacteria | 699 |
| 260 | Ga0207641_10837203 | 3300026088 | Bacteria | 911 |
| 261 | Ga0207648_10361808 | 3300026089 | Bacteria | 1309 |
| 262 | Ga0207676_10273967 | 3300026095 | Bacteria | 1529 |
| 263 | Ga0207676_10346204 | 3300026095 | Bacteria | 1373 |
| 264 | Ga0207676_10397436 | 3300026095 | Bacteria | 1287 |
| 265 | Ga0207674_10206443 | 3300026116 | Bacteria | 1914 |
| 266 | Ga0207674_11176811 | 3300026116 | Bacteria | 736 |
| 267 | Ga0207675_100420333 | 3300026118 | Bacteria | 1320 |
| 268 | Ga0207675_100644472 | 3300026118 | Bacteria | 1065 |
| 269 | Ga0207683_10074762 | 3300026121 | Bacteria | 2998 |
| 270 | Ga0207683_10150767 | 3300026121 | Bacteria | 2098 |
| 271 | Ga0207683_10683100 | 3300026121 | Bacteria | 951 |
| 272 | Ga0207698_10044442 | 3300026142 | Bacteria | 3338 |
| 273 | Ga0207698_10078408 | 3300026142 | Bacteria | 2652 |
| 274 | Ga0207698_10100030 | 3300026142 | Bacteria | 2400 |
| 275 | Ga0209389_1000119 | 3300027296 | Bacteria | 70614 |
| 276 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 277 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 278 | Ga0209588_1027398 | 3300027671 | Bacteria | 1813 |
| 279 | Ga0268266_10011601 | 3300028379 | Bacteria | 7649 |
| 280 | Ga0268266_10036772 | 3300028379 | Bacteria | 4170 |
| 281 | Ga0268266_10223403 | 3300028379 | Bacteria | 1732 |
| 282 | Ga0268266_10525109 | 3300028379 | Bacteria | 1132 |
| 283 | Ga0268265_10131182 | 3300028380 | Bacteria | 2082 |
| 284 | Ga0268265_10613252 | 3300028380 | Bacteria | 1041 |
| 285 | Ga0268265_10727174 | 3300028380 | Bacteria | 961 |
| 286 | Ga0268265_10728730 | 3300028380 | Bacteria | 960 |
| 287 | Ga0268264_10283920 | 3300028381 | Bacteria | 1552 |
| 288 | Ga0268264_11063358 | 3300028381 | Bacteria | 817 |
| 289 | Ga0307517_10090077 | 3300028786 | Bacteria | 2520 |
| 290 | Ga0307515_10066890 | 3300028794 | Bacteria | 4968 |
| 291 | Ga0307515_10334080 | 3300028794 | Bacteria | 1172 |
| 292 | Ga0265340_10031864 | 3300031247 | Bacteria | 2634 |
| 293 | Ga0265339_10000560 | 3300031249 | Bacteria | 29070 |
| 294 | Ga0307509_10336075 | 3300031507 | Bacteria | 1240 |
| 295 | Ga0307509_10379289 | 3300031507 | Bacteria | 1127 |
| 296 | Ga0307508_10146942 | 3300031616 | Bacteria | 1962 |
| 297 | Ga0307516_10259187 | 3300031730 | Bacteria | 1430 |
| 298 | Ga0307410_10875830 | 3300031852 | Bacteria | 768 |
| 299 | Ga0307410_10885970 | 3300031852 | Bacteria | 764 |
| 300 | Ga0307407_10325433 | 3300031903 | Bacteria | 1080 |
| 301 | Ga0307409_101535943 | 3300031995 | Bacteria | 693 |
| 302 | Ga0307414_11188442 | 3300032004 | Bacteria | 706 |
| 303 | Ga0307415_101024222 | 3300032126 | Bacteria | 769 |
| 304 | Ga0307510_10024022 | 3300033180 | Bacteria | 7052 |
| 305 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 306 | Ga0316215_1006361 | 3300033544 | Bacteria | 1146 |
| 307 | Ga0373926_0141324 | 3300035083 | Bacteria | 914 |
| 308 | Ga0373923_0031344 | 3300035111 | Bacteria | 2143 |
| 309 | Ga0373953_0176796 | 3300035117 | Bacteria | 920 |
| 310 | Ga0373954_0081325 | 3300035118 | Bacteria | 1548 |
| 311 | Ga0373946_0008409 | 3300035171 | Bacteria | 3785 |
| 312 | Ga0373955_0240830 | 3300035172 | Bacteria | 1083 |
| 313 | Ga0373927_0002264 | 3300035695 | Bacteria | 14111 |
| 314 | Ga0373947_0002643 | 3300035725 | Bacteria | 10768 |
| 315 | Ga0373937_0019313 | 3300036401 | Bacteria | 6098 |
| 316 | Ga0372808_001288 | 3300036459 | Bacteria | 2538 |
| 317 | Ga0373925_0003737 | 3300037068 | Bacteria | 11690 |
| 318 | Ga0373925_0279007 | 3300037068 | Bacteria | 1345 |
| 319 | Ga0395899_0059903 | 3300037312 | Bacteria | 2806 |
| 320 | Ga0395899_0244671 | 3300037312 | Bacteria | 1233 |
| 321 | Ga0395900_0048961 | 3300037418 | Bacteria | 4353 |
| 322 | Ga0395900_0088980 | 3300037418 | Bacteria | 3174 |
| 323 | Ga0395898_0017014 | 3300037466 | Bacteria | 7425 |
| 324 | Ga0395898_0065085 | 3300037466 | Bacteria | 3535 |
| 325 | Ga0395898_0268082 | 3300037466 | Bacteria | 1628 |
| 326 | Ga0436364_0061231 | 3300037853 | Bacteria | 3861 |
| 327 | Ga0436364_0519888 | 3300037853 | Bacteria | 978 |
| 328 | Ga0436364_1454126 | 3300037853 | Bacteria | 2022 |
| 329 | Ga0395901_0058832 | 3300038443 | Bacteria | 3998 |
| 330 | Ga0436365_0773004 | 3300039437 | Bacteria | 3824 |
| 331 | Ga0436365_1149951 | 3300039437 | Bacteria | 772 |
| 332 | Ga0436365_1815196 | 3300039437 | Bacteria | 2164 |
| 333 | Ga0436360_0311998 | 3300039438 | Bacteria | 930 |
| 334 | Ga0436360_0328780 | 3300039438 | Bacteria | 3141 |
| 335 | Ga0436361_0069223 | 3300039447 | Bacteria | 1591 |
| 336 | Ga0436361_0510320 | 3300039447 | Bacteria | 2081 |
| 337 | Ga0436363_0834736 | 3300039450 | Bacteria | 766 |
| 338 | Ga0436363_1464422 | 3300039450 | Bacteria | 3283 |
| 339 | Ga0451793_0044027 | 3300041452 | Bacteria | 1204 |
| 340 | Ga0451843_1629634 | 3300041509 | Bacteria | 869 |
| 341 | Ga0466969_0029006 | 3300044656 | Bacteria | 2828 |
| 342 | Ga0466969_0163561 | 3300044656 | Bacteria | 1022 |
| 343 | Ga0466972_0000090 | 3300044658 | Bacteria | 82487 |
| 344 | Ga0466972_0056993 | 3300044658 | Bacteria | 1877 |
| 345 | Ga0466966_0342790 | 3300044684 | Bacteria | 898 |
| 346 | Ga0466961_0000081 | 3300044693 | Bacteria | 59450 |
| 347 | Ga0466963_0416354 | 3300044694 | Bacteria | 948 |
| 348 | Ga0466963_0668589 | 3300044694 | Bacteria | 733 |
| 349 | Ga0466970_0029783 | 3300044765 | Bacteria | 2877 |
| 350 | Ga0466957_0639696 | 3300044842 | Bacteria | 747 |
| 351 | Ga0466960_0197477 | 3300044901 | Bacteria | 1098 |
| 352 | Ga0466959_0004686 | 3300045049 | Bacteria | 9205 |
| 353 | Ga0466959_0162169 | 3300045049 | Bacteria | 1571 |
| 354 | Ga0466967_0212089 | 3300045976 | Bacteria | 1837 |
| 355 | Ga0466967_1178008 | 3300045976 | Bacteria | 763 |
| 356 | Ga0495617_029495 | 3300046452 | Bacteria | 1844 |
| 357 | Ga0495617_078863 | 3300046452 | Bacteria | 1079 |
| 358 | Ga0495603_0002182 | 3300046455 | Bacteria | 11513 |
| 359 | Ga0495603_0106070 | 3300046455 | Bacteria | 1639 |
| 360 | Ga0495590_0047429 | 3300046457 | Bacteria | 1498 |
| 361 | Ga0495629_0000226 | 3300046459 | Bacteria | 50363 |
| 362 | Ga0495629_0024603 | 3300046459 | Bacteria | 4287 |
| 363 | Ga0495629_0076212 | 3300046459 | Bacteria | 2342 |
| 364 | Ga0495638_0009527 | 3300046460 | Bacteria | 6809 |
| 365 | Ga0495638_0196767 | 3300046460 | Bacteria | 1140 |
| 366 | Ga0495638_0224898 | 3300046460 | Bacteria | 1047 |
| 367 | Ga0495641_0082969 | 3300046461 | Bacteria | 1435 |
| 368 | Ga0495651_0170800 | 3300046462 | Bacteria | 1548 |
| 369 | Ga0495653_0245980 | 3300046463 | Bacteria | 1189 |
| 370 | Ga0495650_0045495 | 3300046471 | Bacteria | 1848 |
| 371 | Ga0495580_0002229 | 3300046472 | Bacteria | 16931 |
| 372 | Ga0495582_0000106 | 3300046473 | Bacteria | 43588 |
| 373 | Ga0495605_0085148 | 3300046474 | Bacteria | 1473 |
| 374 | Ga0495639_0000912 | 3300046475 | Bacteria | 13341 |
| 375 | Ga0495639_0072285 | 3300046475 | Bacteria | 1595 |
| 376 | Ga0495662_0000112 | 3300046476 | Bacteria | 30326 |
| 377 | Ga0495662_0060449 | 3300046476 | Bacteria | 1830 |
| 378 | Ga0495664_0013066 | 3300046477 | Bacteria | 4708 |
| 379 | Ga0495585_0024609 | 3300046492 | Bacteria | 3451 |
| 380 | Ga0495594_0025944 | 3300046499 | Bacteria | 3151 |
| 381 | Ga0495594_0249620 | 3300046499 | Bacteria | 1011 |
| 382 | Ga0495596_0100590 | 3300046500 | Bacteria | 1122 |
| 383 | Ga0495583_0132350 | 3300046506 | Bacteria | 1043 |
| 384 | Ga0495606_0110756 | 3300046507 | Bacteria | 1656 |
| 385 | Ga0495606_0110891 | 3300046507 | Bacteria | 1655 |
| 386 | Ga0495606_0289373 | 3300046507 | Bacteria | 892 |
| 387 | Ga0495606_0292020 | 3300046507 | Bacteria | 887 |
| 388 | Ga0495608_0029753 | 3300046511 | Bacteria | 3702 |
| 389 | Ga0495608_0172768 | 3300046511 | Bacteria | 1370 |
| 390 | Ga0495616_0124502 | 3300046513 | Bacteria | 1187 |
| 391 | Ga0495628_0035863 | 3300046516 | Bacteria | 3984 |
| 392 | Ga0495628_0085095 | 3300046516 | Bacteria | 2453 |
| 393 | Ga0495630_0050483 | 3300046517 | Bacteria | 3113 |
| 394 | Ga0495631_0144906 | 3300046518 | Bacteria | 1020 |
| 395 | Ga0495643_0035822 | 3300046522 | Bacteria | 2730 |
| 396 | Ga0495648_0173409 | 3300046524 | Bacteria | 1103 |
| 397 | Ga0495663_0058933 | 3300046525 | Bacteria | 1204 |
| 398 | Ga0495666_0037053 | 3300046526 | Bacteria | 2373 |
| 399 | Ga0495642_0218245 | 3300046528 | Bacteria | 832 |
| 400 | Ga0495642_0259312 | 3300046528 | Bacteria | 760 |
| 401 | Ga0495652_0122765 | 3300046529 | Bacteria | 2068 |
| 402 | Ga0495652_0177443 | 3300046529 | Bacteria | 1638 |
| 403 | Ga0495652_0289271 | 3300046529 | Bacteria | 1196 |
| 404 | Ga0495665_0000254 | 3300046531 | Bacteria | 26918 |
| 405 | Ga0495665_0207098 | 3300046531 | Bacteria | 1016 |
| 406 | Ga0495640_0003800 | 3300046533 | Bacteria | 12124 |
| 407 | Ga0495640_0014514 | 3300046533 | Bacteria | 5956 |
| 408 | Ga0495640_0090953 | 3300046533 | Bacteria | 2014 |
| 409 | Ga0495586_0377784 | 3300046535 | Bacteria | 815 |
| 410 | Ga0495587_0025877 | 3300046536 | Bacteria | 3582 |
| 411 | Ga0495609_0049819 | 3300046538 | Bacteria | 1868 |
| 412 | Ga0495645_0036139 | 3300046543 | Bacteria | 3601 |
| 413 | Ga0495622_0015939 | 3300046557 | Bacteria | 3495 |
| 414 | Ga0495622_0116669 | 3300046557 | Bacteria | 1220 |
| 415 | Ga0495667_0025678 | 3300046559 | Bacteria | 3968 |
| 416 | Ga0495667_0041560 | 3300046559 | Bacteria | 3049 |
| 417 | Ga0495656_0045238 | 3300046615 | Bacteria | 1857 |
| 418 | Ga0495656_0062277 | 3300046615 | Bacteria | 1631 |
| 419 | Ga0495656_0190985 | 3300046615 | Bacteria | 1011 |
| 420 | Ga0495668_0183122 | 3300046616 | Bacteria | 1147 |
| 421 | Ga0495634_0001436 | 3300046642 | Bacteria | 21216 |
| 422 | Ga0495634_0105948 | 3300046642 | Bacteria | 1812 |
| 423 | Ga0495611_0053499 | 3300046648 | Bacteria | 1822 |
| 424 | Ga0495625_0164563 | 3300046660 | Bacteria | 1484 |
| 425 | Ga0495625_0203821 | 3300046660 | Bacteria | 1304 |
| 426 | Ga0495625_0480560 | 3300046660 | Bacteria | 763 |
| 427 | Ga0495635_0003067 | 3300046663 | Bacteria | 11493 |
| 428 | Ga0495635_0007905 | 3300046663 | Bacteria | 7430 |
| 429 | Ga0495659_0064408 | 3300046664 | Bacteria | 1361 |
| 430 | Ga0495588_0053957 | 3300046674 | Bacteria | 2073 |
| 431 | Ga0495588_0058529 | 3300046674 | Bacteria | 1992 |
| 432 | Ga0495657_0069160 | 3300046675 | Bacteria | 2311 |
| 433 | Ga0495657_0178219 | 3300046675 | Bacteria | 1306 |
| 434 | Ga0495599_0118484 | 3300046678 | Bacteria | 1646 |
| 435 | Ga0495646_0014484 | 3300046680 | Bacteria | 5014 |
| 436 | Ga0495646_0202850 | 3300046680 | Bacteria | 1079 |
| 437 | Ga0495646_0364343 | 3300046680 | Bacteria | 755 |
| 438 | Ga0495647_0003957 | 3300046681 | Bacteria | 4779 |
| 439 | Ga0495658_0000964 | 3300046683 | Bacteria | 15307 |
| 440 | Ga0495613_0004538 | 3300046689 | Bacteria | 10410 |
| 441 | Ga0495624_0005560 | 3300046690 | Bacteria | 9067 |
| 442 | Ga0495624_0031167 | 3300046690 | Bacteria | 3470 |
| 443 | Ga0495624_0132644 | 3300046690 | Bacteria | 1527 |
| 444 | Ga0495671_0205245 | 3300046692 | Bacteria | 955 |
| 445 | Ga0495649_0187311 | 3300046694 | Bacteria | 1078 |
| 446 | Ga0495589_0298561 | 3300046794 | Bacteria | 747 |
| 447 | Ga0495589_0314038 | 3300046794 | Bacteria | 725 |
| 448 | Ga0495581_0011778 | 3300047315 | Bacteria | 5064 |
| 449 | Ga0495581_0258984 | 3300047315 | Bacteria | 1017 |
| 450 | Ga0495581_0571888 | 3300047315 | Bacteria | 655 |
| 451 | Ga0495604_0043292 | 3300047317 | Bacteria | 3525 |
| 452 | Ga0495604_0152792 | 3300047317 | Bacteria | 1638 |
| 453 | Ga0495604_0273398 | 3300047317 | Bacteria | 1144 |
| 454 | Ga0495636_0105230 | 3300047318 | Bacteria | 1237 |
| 455 | Ga0495674_0000082 | 3300047319 | Bacteria | 65609 |
| 456 | Ga0495674_0164710 | 3300047319 | Bacteria | 1853 |
| 457 | Ga0495676_0064463 | 3300047321 | Bacteria | 2849 |
| 458 | Ga0495676_0119649 | 3300047321 | Bacteria | 1918 |
| 459 | Ga0495687_125916 | 3300047443 | Bacteria | 916 |
| 460 | Ga0495679_076280 | 3300047446 | Bacteria | 958 |
| 461 | Ga0495673_0096644 | 3300047469 | Bacteria | 1200 |
| 462 | Ga0495673_0126263 | 3300047469 | Bacteria | 1009 |
| 463 | Ga0495673_0174666 | 3300047469 | Bacteria | 817 |
| 464 | Ga0495681_0205167 | 3300047470 | Bacteria | 797 |
| 465 | Ga0495684_0220676 | 3300047471 | Bacteria | 1390 |
| 466 | Ga0495686_0320450 | 3300047472 | Bacteria | 850 |
| 467 | Ga0495593_0000366 | 3300047673 | Bacteria | 24885 |
| 468 | Ga0495593_0151693 | 3300047673 | Bacteria | 1172 |
| 469 | Ga0495615_0091377 | 3300048090 | Bacteria | 849 |
| 470 | Ga0496100_0146404 | 3300048903 | Bacteria | 1680 |
| 471 | Ga0496100_0175206 | 3300048903 | Bacteria | 1548 |
| 472 | Ga0496101_0128387 | 3300048904 | Bacteria | 1923 |
| 473 | Ga0496101_0167983 | 3300048904 | Bacteria | 1685 |
| 474 | Ga0496101_0294557 | 3300048904 | Bacteria | 1270 |
| 475 | Ga0496101_0315838 | 3300048904 | Bacteria | 1225 |
| 476 | Ga0496102_0028006 | 3300048905 | Bacteria | 5034 |
| 477 | Ga0496102_0272253 | 3300048905 | Bacteria | 1596 |
| 478 | Ga0496102_0312772 | 3300048905 | Bacteria | 1480 |
| 479 | Ga0496102_0517080 | 3300048905 | Bacteria | 1116 |
| 480 | Ga0496102_0605122 | 3300048905 | Bacteria | 1019 |
| 481 | Ga0496103_0049599 | 3300048906 | Bacteria | 2596 |
| 482 | Ga0496103_0153197 | 3300048906 | Bacteria | 1477 |
| 483 | Ga0496104_0018741 | 3300048907 | Bacteria | 6319 |
| 484 | Ga0496104_0094155 | 3300048907 | Bacteria | 2865 |
| 485 | Ga0496104_0617018 | 3300048907 | Bacteria | 994 |
| 486 | Ga0496105_0039541 | 3300048908 | Bacteria | 3887 |
| 487 | Ga0496105_0060956 | 3300048908 | Bacteria | 3113 |
| 488 | Ga0496105_0875258 | 3300048908 | Bacteria | 678 |
| 489 | Ga0496106_0063785 | 3300048909 | Bacteria | 2801 |
| 490 | Ga0496106_0075362 | 3300048909 | Bacteria | 2584 |
| 491 | Ga0496106_0427572 | 3300048909 | Bacteria | 1064 |
| 492 | Ga0496108_0225193 | 3300048911 | Bacteria | 1630 |
| 493 | Ga0496109_0377061 | 3300048912 | Bacteria | 1340 |
| 494 | Ga0496109_0434291 | 3300048912 | Bacteria | 1240 |
| 495 | Ga0496110_0302099 | 3300048913 | Bacteria | 1458 |
| 496 | Ga0496110_0319405 | 3300048913 | Bacteria | 1414 |
| 497 | Ga0496111_0129099 | 3300048914 | Bacteria | 1870 |
| 498 | Ga0496111_0200918 | 3300048914 | Bacteria | 1482 |
| 499 | Ga0496112_0056454 | 3300048915 | Bacteria | 3864 |
| 500 | Ga0496112_0111276 | 3300048915 | Bacteria | 2708 |
| 501 | Ga0496112_0135064 | 3300048915 | Bacteria | 2437 |
| 502 | Ga0496112_0177824 | 3300048915 | Bacteria | 2092 |
| 503 | Ga0496112_0312574 | 3300048915 | Bacteria | 1516 |
| 504 | Ga0496113_0167143 | 3300048916 | Bacteria | 1741 |
| 505 | Ga0496113_0251146 | 3300048916 | Bacteria | 1412 |
| 506 | Ga0496113_0432927 | 3300048916 | Bacteria | 1057 |
| 507 | Ga0496113_0518166 | 3300048916 | Bacteria | 957 |
| 508 | Ga0496113_0527634 | 3300048916 | Bacteria | 948 |
| 509 | Ga0496113_0531910 | 3300048916 | Bacteria | 943 |
| 510 | Ga0496114_0080842 | 3300048917 | Bacteria | 2745 |
| 511 | Ga0496114_0309072 | 3300048917 | Bacteria | 1396 |
| 512 | Ga0496114_0377859 | 3300048917 | Bacteria | 1254 |
| 513 | Ga0496114_0630215 | 3300048917 | Bacteria | 944 |
| 514 | Ga0496114_0730982 | 3300048917 | Bacteria | 866 |
| 515 | Ga0496115_0040830 | 3300048918 | Bacteria | 3690 |
| 516 | Ga0496115_0404418 | 3300048918 | Bacteria | 1107 |
| 517 | Ga0496115_0414070 | 3300048918 | Bacteria | 1092 |
| 518 | Ga0496115_0959265 | 3300048918 | Bacteria | 656 |
| 519 | Ga0496116_0052983 | 3300048919 | Bacteria | 2683 |
| 520 | Ga0496116_0185014 | 3300048919 | Bacteria | 1110 |
| 521 | Ga0496117_0062962 | 3300048920 | Bacteria | 2538 |
| 522 | Ga0496118_0115545 | 3300048921 | Bacteria | 1766 |
| 523 | Ga0496118_0131278 | 3300048921 | Bacteria | 1608 |
| 524 | Ga0496118_0248457 | 3300048921 | Bacteria | 1012 |
| 525 | Ga0496118_0268327 | 3300048921 | Bacteria | 958 |
| 526 | Ga0496119_0026612 | 3300048922 | Bacteria | 4005 |
| 527 | Ga0496119_0080598 | 3300048922 | Bacteria | 1877 |
| 528 | Ga0496119_0102232 | 3300048922 | Bacteria | 1607 |
| 529 | Ga0496119_0198660 | 3300048922 | Bacteria | 1039 |
| 530 | Ga0496119_0293466 | 3300048922 | Bacteria | 804 |
| 531 | Ga0496120_0064229 | 3300048923 | Bacteria | 2038 |
| 532 | Ga0496120_0126770 | 3300048923 | Bacteria | 1312 |
| 533 | Ga0496121_0015225 | 3300048924 | Bacteria | 8082 |
| 534 | Ga0496121_0038564 | 3300048924 | Bacteria | 4227 |
| 535 | Ga0496121_0148782 | 3300048924 | Bacteria | 1726 |
| 536 | Ga0496121_0198200 | 3300048924 | Bacteria | 1433 |
| 537 | Ga0496121_0228637 | 3300048924 | Bacteria | 1304 |
| 538 | Ga0496121_0268621 | 3300048924 | Bacteria | 1173 |
| 539 | Ga0496121_0275729 | 3300048924 | Bacteria | 1153 |
| 540 | Ga0496121_0335218 | 3300048924 | Bacteria | 1013 |
| 541 | Ga0496121_0397174 | 3300048924 | Bacteria | 904 |
| 542 | Ga0496121_0419502 | 3300048924 | Bacteria | 871 |
| 543 | Ga0496122_0128139 | 3300048925 | Bacteria | 1620 |
| 544 | Ga0496122_0147775 | 3300048925 | Bacteria | 1457 |
| 545 | Ga0496124_0206840 | 3300048927 | Bacteria | 1488 |
| 546 | Ga0496124_0213561 | 3300048927 | Bacteria | 1458 |
| 547 | Ga0496124_0226758 | 3300048927 | Bacteria | 1400 |
| 548 | Ga0496124_0340109 | 3300048927 | Bacteria | 1066 |
| 549 | Ga0496124_0460478 | 3300048927 | Bacteria | 864 |
| 550 | Ga0496125_0009522 | 3300048928 | Bacteria | 9970 |
| 551 | Ga0496125_0329781 | 3300048928 | Bacteria | 921 |
| 552 | Ga0496125_0431463 | 3300048928 | Bacteria | 761 |
| 553 | Ga0496125_0488078 | 3300048928 | Bacteria | 696 |
| 554 | Ga0496126_0018494 | 3300048929 | Bacteria | 6900 |
| 555 | Ga0496126_0047692 | 3300048929 | Bacteria | 3921 |
| 556 | Ga0496126_0082642 | 3300048929 | Bacteria | 2837 |
| 557 | Ga0496126_0175970 | 3300048929 | Bacteria | 1820 |
| 558 | Ga0496126_0186473 | 3300048929 | Bacteria | 1759 |
| 559 | Ga0496126_0201303 | 3300048929 | Bacteria | 1681 |
| 560 | Ga0496126_0322087 | 3300048929 | Bacteria | 1270 |
| 561 | Ga0496126_0409929 | 3300048929 | Bacteria | 1097 |
| 562 | Ga0495682_0072104 | 3300049460 | Bacteria | 1243 |
| 563 | Ga0495682_0154918 | 3300049460 | Bacteria | 817 |
| 564 | Ga0501031_0026577 | 3300049568 | Bacteria | 3773 |
| 565 | Ga0501031_0089978 | 3300049568 | Bacteria | 2001 |
| 566 | Ga0501031_0121919 | 3300049568 | Bacteria | 1703 |
| 567 | Ga0501031_0365092 | 3300049568 | Bacteria | 934 |
| 568 | Ga0501032_0015059 | 3300049569 | Bacteria | 5463 |
| 569 | Ga0501032_0124575 | 3300049569 | Bacteria | 1702 |
| 570 | Ga0501032_0148800 | 3300049569 | Bacteria | 1540 |
| 571 | Ga0501032_0268621 | 3300049569 | Bacteria | 1105 |
| 572 | Ga0501033_0004699 | 3300049570 | Bacteria | 10929 |
| 573 | Ga0501033_0430804 | 3300049570 | Bacteria | 917 |
| 574 | Ga0501033_0684654 | 3300049570 | Bacteria | 698 |
| 575 | Ga0501034_0095256 | 3300049571 | Bacteria | 2973 |
| 576 | Ga0501034_0203318 | 3300049571 | Bacteria | 1938 |
| 577 | Ga0501034_0276913 | 3300049571 | Bacteria | 1618 |
| 578 | Ga0501034_0392025 | 3300049571 | Bacteria | 1313 |
| 579 | Ga0501034_0465658 | 3300049571 | Bacteria | 1180 |
| 580 | Ga0501036_0046620 | 3300049572 | Bacteria | 3670 |
| 581 | Ga0501036_0104377 | 3300049572 | Bacteria | 2396 |
| 582 | Ga0501036_0124864 | 3300049572 | Bacteria | 2173 |
| 583 | Ga0501036_0329957 | 3300049572 | Bacteria | 1275 |
| 584 | Ga0501036_0392034 | 3300049572 | Bacteria | 1158 |
| 585 | Ga0501037_0000396 | 3300049573 | Bacteria | 36209 |
| 586 | Ga0501037_0021148 | 3300049573 | Bacteria | 4807 |
| 587 | Ga0501037_0032014 | 3300049573 | Bacteria | 3882 |
| 588 | Ga0501037_0060449 | 3300049573 | Bacteria | 2763 |
| 589 | Ga0501037_0151826 | 3300049573 | Bacteria | 1655 |
| 590 | Ga0501038_0002046 | 3300049574 | Bacteria | 18655 |
| 591 | Ga0501038_0004875 | 3300049574 | Bacteria | 12463 |
| 592 | Ga0501038_0017078 | 3300049574 | Bacteria | 6564 |
| 593 | Ga0501038_0124817 | 3300049574 | Bacteria | 2119 |
| 594 | Ga0501038_0162407 | 3300049574 | Bacteria | 1814 |
| 595 | Ga0501038_0185717 | 3300049574 | Bacteria | 1675 |
| 596 | Ga0501039_0006453 | 3300049575 | Bacteria | 8914 |
| 597 | Ga0501039_0094817 | 3300049575 | Bacteria | 2326 |
| 598 | Ga0501039_0173660 | 3300049575 | Bacteria | 1694 |
| 599 | Ga0501040_0059511 | 3300049576 | Bacteria | 2624 |
| 600 | Ga0501041_0115755 | 3300049577 | Bacteria | 1664 |
| 601 | Ga0501041_0124805 | 3300049577 | Bacteria | 1602 |
| 602 | Ga0501042_0010829 | 3300049578 | Bacteria | 6132 |
| 603 | Ga0501042_0306328 | 3300049578 | Bacteria | 1147 |
| 604 | Ga0501042_0609811 | 3300049578 | Bacteria | 793 |
| 605 | Ga0501043_0009493 | 3300049579 | Bacteria | 7630 |
| 606 | Ga0501043_0107537 | 3300049579 | Bacteria | 2190 |
| 607 | Ga0501043_0127453 | 3300049579 | Bacteria | 1996 |
| 608 | Ga0501043_0232314 | 3300049579 | Bacteria | 1424 |
| 609 | Ga0501043_0375178 | 3300049579 | Bacteria | 1077 |
| 610 | Ga0501046_0011234 | 3300049580 | Bacteria | 7666 |
| 611 | Ga0501046_0012369 | 3300049580 | Bacteria | 7269 |
| 612 | Ga0501046_0036451 | 3300049580 | Bacteria | 3957 |
| 613 | Ga0501046_0120977 | 3300049580 | Bacteria | 1991 |
| 614 | Ga0501046_0238617 | 3300049580 | Bacteria | 1341 |
| 615 | Ga0501047_0084506 | 3300049581 | Bacteria | 3050 |
| 616 | Ga0501047_0180578 | 3300049581 | Bacteria | 1977 |
| 617 | Ga0501047_0183263 | 3300049581 | Bacteria | 1960 |
| 618 | Ga0501047_0186509 | 3300049581 | Bacteria | 1939 |
| 619 | Ga0501047_0227279 | 3300049581 | Bacteria | 1720 |
| 620 | Ga0501047_0381294 | 3300049581 | Bacteria | 1244 |
| 621 | Ga0501047_0430356 | 3300049581 | Bacteria | 1150 |
| 622 | Ga0501047_0961988 | 3300049581 | Bacteria | 667 |
| 623 | Ga0501048_0073468 | 3300049582 | Bacteria | 2413 |
| 624 | Ga0501048_0197293 | 3300049582 | Bacteria | 1427 |
| 625 | Ga0501067_0008905 | 3300049583 | Bacteria | 5560 |
| 626 | Ga0501067_0083746 | 3300049583 | Bacteria | 1769 |
| 627 | Ga0501068_0033304 | 3300049584 | Bacteria | 3068 |
| 628 | Ga0501068_0060477 | 3300049584 | Bacteria | 2300 |
| 629 | Ga0501068_0077477 | 3300049584 | Bacteria | 2036 |
| 630 | Ga0501068_0310137 | 3300049584 | Bacteria | 1011 |
| 631 | Ga0501069_0059634 | 3300049585 | Bacteria | 2129 |
| 632 | Ga0501069_0061227 | 3300049585 | Bacteria | 2101 |
| 633 | Ga0501070_0025427 | 3300049586 | Bacteria | 4966 |
| 634 | Ga0501070_0173313 | 3300049586 | Bacteria | 1777 |
| 635 | Ga0501070_0722157 | 3300049586 | Bacteria | 787 |
| 636 | Ga0501070_0997429 | 3300049586 | Bacteria | 649 |
| 637 | Ga0501071_0062939 | 3300049587 | Bacteria | 2689 |
| 638 | Ga0501073_0036008 | 3300049589 | Bacteria | 3517 |
| 639 | Ga0501073_0198639 | 3300049589 | Bacteria | 1387 |
| 640 | Ga0501073_0225265 | 3300049589 | Bacteria | 1295 |
| 641 | Ga0501073_0708173 | 3300049589 | Bacteria | 695 |
| 642 | Ga0501074_0041848 | 3300049590 | Bacteria | 3315 |
| 643 | Ga0501076_0072201 | 3300049592 | Bacteria | 2762 |
| 644 | Ga0501076_0588593 | 3300049592 | Bacteria | 918 |
| 645 | Ga0501079_0055313 | 3300049741 | Bacteria | 3062 |
| 646 | Ga0501080_0079464 | 3300049742 | Bacteria | 3049 |
| 647 | Ga0501080_0241801 | 3300049742 | Bacteria | 1647 |
| 648 | Ga0501080_0323017 | 3300049742 | Bacteria | 1397 |
| 649 | Ga0501080_0356239 | 3300049742 | Bacteria | 1321 |
| 650 | Ga0501080_0588663 | 3300049742 | Bacteria | 988 |
| 651 | Ga0501081_0735241 | 3300049743 | Bacteria | 741 |
| 652 | Ga0501083_0019398 | 3300049744 | Bacteria | 4738 |
| 653 | Ga0501035_0005535 | 3300049822 | Bacteria | 11936 |
| 654 | Ga0501035_0089419 | 3300049822 | Bacteria | 2712 |
| 655 | Ga0501035_0393301 | 3300049822 | Bacteria | 1154 |
| 656 | Ga0501035_0487840 | 3300049822 | Bacteria | 1015 |
| 657 | Ga0501044_0000266 | 3300049823 | Bacteria | 66205 |
| 658 | Ga0501044_0086969 | 3300049823 | Bacteria | 3157 |
| 659 | Ga0501044_0087043 | 3300049823 | Bacteria | 3155 |
| 660 | Ga0501044_0154144 | 3300049823 | Bacteria | 2278 |
| 661 | Ga0501044_0184866 | 3300049823 | Bacteria | 2049 |
| 662 | Ga0501044_0221756 | 3300049823 | Bacteria | 1841 |
| 663 | Ga0501045_0061052 | 3300049824 | Bacteria | 2764 |
| 664 | Ga0501045_0506427 | 3300049824 | Bacteria | 897 |
| 665 | Ga0501045_0654631 | 3300049824 | Bacteria | 776 |
| 666 | nmdc:mga03683_35414_c1 | 3300050489 | Bacteria | 2025 |
| 667 | nmdc:mga03683_59279_c1 | 3300050489 | Bacteria | 1614 |
| 668 | nmdc:mga03n38_184883_c1 | 3300050490 | Bacteria | 1070 |
| 669 | nmdc:mga00v17_181630_c1 | 3300050491 | Bacteria | 1357 |
| 670 | nmdc:mga00v17_212175_c1 | 3300050491 | Bacteria | 1253 |
| 671 | nmdc:mga00v17_63879_c2 | 3300050491 | Bacteria | 763 |
| 672 | nmdc:mga0yw44_152509_c1 | 3300050492 | Bacteria | 1508 |
| 673 | nmdc:mga0yw44_255443_c1 | 3300050492 | Bacteria | 1167 |
| 674 | nmdc:mga0yw44_467598_c1 | 3300050492 | Bacteria | 855 |
| 675 | nmdc:mga0yw44_71145_c1 | 3300050492 | Bacteria | 2159 |
| 676 | nmdc:mga0yw44_7902_c1 | 3300050492 | Bacteria | 5268 |
| 677 | nmdc:mga0k408_588395_c1 | 3300050493 | Bacteria | 657 |
| 678 | nmdc:mga06z11_396588_c1 | 3300050494 | Bacteria | 830 |
| 679 | nmdc:mga06z11_44141_c1 | 3300050494 | Bacteria | 2246 |
| 680 | nmdc:mga06z11_86718_c1 | 3300050494 | Bacteria | 989 |
| 681 | nmdc:mga04h51_70975_c1 | 3300050495 | Bacteria | 1216 |
| 682 | nmdc:mga07m45_45396_c1 | 3300050496 | Bacteria | 2467 |
| 683 | nmdc:mga08x19_723900_c1 | 3300050514 | Bacteria | 706 |
| 684 | nmdc:mga0a205_708126_c1 | 3300050515 | Bacteria | 856 |
| 685 | nmdc:mga0sz30_18667_c1 | 3300050516 | Bacteria | 2778 |
| 686 | nmdc:mga0sz30_220165_c1 | 3300050516 | Bacteria | 844 |
| 687 | nmdc:mga0sz30_296678_c1 | 3300050516 | Bacteria | 721 |
| 688 | Ga0495612_0140110 | 3300053078 | Bacteria | 1049 |
| 689 | Ga0500635_0060880 | 3300053080 | Bacteria | 1317 |
| 690 | Ga0495595_0046790 | 3300053084 | Bacteria | 1994 |
| 691 | Ga0495619_0093254 | 3300053085 | Bacteria | 2041 |
| 692 | Ga0500643_000057 | 3300053087 | Bacteria | 131401 |
| 693 | Ga0500643_036668 | 3300053087 | Bacteria | 1464 |
| 694 | Ga0500651_0041183 | 3300053093 | Bacteria | 2911 |
| 695 | Ga0500566_0001388 | 3300053094 | Bacteria | 14164 |
| 696 | Ga0500566_0109053 | 3300053094 | Bacteria | 1507 |
| 697 | Ga0500641_0076207 | 3300053096 | Bacteria | 1418 |
| 698 | Ga0500641_0095981 | 3300053096 | Bacteria | 1269 |
| 699 | Ga0500555_016297 | 3300053103 | Bacteria | 2141 |
| 700 | Ga0500556_0221039 | 3300053104 | Bacteria | 747 |
| 701 | Ga0500557_000225 | 3300053105 | Bacteria | 8786 |
| 702 | Ga0500562_012723 | 3300053108 | Bacteria | 2142 |
| 703 | Ga0500562_027780 | 3300053108 | Bacteria | 1485 |
| 704 | Ga0500569_124764 | 3300053109 | Bacteria | 859 |
| 705 | Ga0500592_030897 | 3300053116 | Bacteria | 864 |
| 706 | Ga0500595_021149 | 3300053119 | Bacteria | 2327 |
| 707 | Ga0500595_029690 | 3300053119 | Bacteria | 1852 |
| 708 | Ga0500595_040499 | 3300053119 | Bacteria | 1502 |
| 709 | Ga0500597_166784 | 3300053120 | Bacteria | 940 |
| 710 | Ga0500607_055866 | 3300053121 | Bacteria | 2086 |
| 711 | Ga0500614_028299 | 3300053123 | Bacteria | 1352 |
| 712 | Ga0500621_093921 | 3300053126 | Bacteria | 1190 |
| 713 | Ga0500621_210666 | 3300053126 | Bacteria | 681 |
| 714 | Ga0500642_0000740 | 3300053130 | Bacteria | 9638 |
| 715 | Ga0500642_0008396 | 3300053130 | Bacteria | 3533 |
| 716 | Ga0500642_0163182 | 3300053130 | Bacteria | 1044 |
| 717 | Ga0500655_034390 | 3300053133 | Bacteria | 983 |
| 718 | Ga0500658_0245689 | 3300053134 | Bacteria | 822 |
| 719 | Ga0500559_0009353 | 3300053136 | Bacteria | 4247 |
| 720 | Ga0500559_0014510 | 3300053136 | Bacteria | 3329 |
| 721 | Ga0500577_0097649 | 3300053142 | Bacteria | 1196 |
| 722 | Ga0500577_0200872 | 3300053142 | Bacteria | 860 |
| 723 | Ga0500586_001990 | 3300053145 | Bacteria | 4483 |
| 724 | Ga0500588_0025909 | 3300053146 | Bacteria | 1635 |
| 725 | Ga0500589_163993 | 3300053147 | Bacteria | 890 |
| 726 | Ga0500603_001521 | 3300053150 | Bacteria | 5266 |
| 727 | Ga0500620_015387 | 3300053155 | Bacteria | 2163 |
| 728 | Ga0500634_0079239 | 3300053161 | Bacteria | 1697 |
| 729 | Ga0500636_0036112 | 3300053177 | Bacteria | 2924 |
| 730 | Ga0500636_0048443 | 3300053177 | Bacteria | 2501 |
| 731 | Ga0500637_0065890 | 3300053178 | Bacteria | 2078 |
| 732 | Ga0500570_024854 | 3300053724 | Bacteria | 3297 |
| 733 | Ga0500611_023664 | 3300053727 | Bacteria | 1198 |
| 734 | Ga0500625_015449 | 3300053729 | Bacteria | 3542 |
| 735 | Ga0500645_017168 | 3300053730 | Bacteria | 2271 |
| 736 | Ga0500645_073405 | 3300053730 | Bacteria | 981 |
| 737 | Ga0500609_008934 | 3300053731 | Bacteria | 1352 |
| 738 | Ga0500601_001283 | 3300053737 | Bacteria | 2785 |
| 739 | Ga0501084_0071584 | 3300054114 | Bacteria | 2903 |
| 740 | Ga0501084_0137721 | 3300054114 | Bacteria | 2055 |
| 741 | Ga0501082_0094831 | 3300060353 | Bacteria | 2578 |
| 742 | Ga0501082_0212829 | 3300060353 | Bacteria | 1681 |
| 743 | Ga0501082_0446640 | 3300060353 | Bacteria | 1130 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047315 | Ga0495581_0258984 | Ga0495581_0258984_65_625 | 186 |
| 2 | 3300053130 | Ga0500642_0163182 | Ga0500642_0163182_11_571 | 186 |
| 3 | 3300048918 | Ga0496115_0959265 | Ga0496115_0959265_23_604 | 193 |
| 4 | 3300049581 | Ga0501047_0961988 | Ga0501047_0961988_25_606 | 193 |
| 5 | 3300026142 | Ga0207698_10044442 | Ga0207698_100444424 | 196 |
| 6 | 3300053177 | Ga0500636_0048443 | Ga0500636_0048443_914_1504 | 196 |
| 7 | iso_pu_bacteria | 2517093001 | 2517100647 | 197 |
| 8 | iso_pu_bacteria | 2507262055 | 2507511077 | 198 |
| 9 | iso_pu_bacteria | 2508501009 | 2508544894 | 198 |
| 10 | iso_pu_bacteria | 2508501042 | 2508696880 | 198 |
| 11 | iso_pu_bacteria | 2508501128 | 2509151818 | 198 |
| 12 | iso_pu_bacteria | 2511231028 | 2511400415 | 198 |
| 13 | iso_pu_bacteria | 2513237094 | 2513637412 | 198 |
| 14 | iso_pu_bacteria | 2513237095 | 2513649740 | 198 |
| 15 | iso_pu_bacteria | 2513237096 | 2513655093 | 198 |
| 16 | iso_pu_bacteria | 2513237101 | 2513696509 | 198 |
| 17 | iso_pu_bacteria | 2513237102 | 2513701148 | 198 |
| 18 | iso_pu_bacteria | 2513237104 | 2513716973 | 198 |
| 19 | iso_pu_bacteria | 2513237141 | 2513892147 | 198 |
| 20 | iso_pu_bacteria | 2513237145 | 2513915884 | 198 |
| 21 | iso_pu_bacteria | 2513237161 | 2514010576 | 198 |
| 22 | iso_pu_bacteria | 2515154112 | 2515625351 | 198 |
| 23 | iso_pu_bacteria | 2517572143 | 2517894811 | 198 |
| 24 | iso_pu_bacteria | 2528768022 | 2528857590 | 198 |
| 25 | iso_pu_bacteria | 2617270741 | 2617373202 | 198 |
| 26 | iso_pu_bacteria | 2721755755 | 2723843017 | 198 |
| 27 | iso_pu_bacteria | 2791355196 | 2793066023 | 198 |
| 28 | iso_pu_bacteria | 2791355199 | 2793084043 | 198 |
| 29 | iso_pu_bacteria | 2816332527 | 2818238212 | 198 |
| 30 | iso_pu_bacteria | 2824600985 | 2824607538 | 198 |
| 31 | iso_pu_bacteria | 2824609381 | 2824617054 | 198 |
| 32 | iso_pu_bacteria | 2824653114 | 2824658769 | 198 |
| 33 | iso_pu_bacteria | 2824661429 | 2824667967 | 198 |
| 34 | iso_pu_bacteria | 2824671348 | 2824678540 | 198 |
| 35 | iso_pu_bacteria | 2824679649 | 2824686654 | 198 |
| 36 | iso_pu_bacteria | 2824687955 | 2824694992 | 198 |
| 37 | iso_pu_bacteria | 2824732956 | 2824738721 | 198 |
| 38 | iso_pu_bacteria | 2824746037 | 2824752398 | 198 |
| 39 | iso_pu_bacteria | 2824773399 | 2824780498 | 198 |
| 40 | iso_pu_bacteria | 2841941048 | 2841943246 | 198 |
| 41 | iso_pu_bacteria | 2841974524 | 2841976677 | 198 |
| 42 | iso_pu_bacteria | 2842038055 | 2842042644 | 198 |
| 43 | iso_pu_bacteria | 2842045827 | 2842050687 | 198 |
| 44 | iso_pu_bacteria | 2849076700 | 2849081593 | 198 |
| 45 | iso_pu_bacteria | 2857509624 | 2857512247 | 198 |
| 46 | iso_pu_bacteria | 2874590934 | 2874597810 | 198 |
| 47 | iso_pu_bacteria | 2874628541 | 2874634209 | 198 |
| 48 | iso_pu_bacteria | 2874645413 | 2874651339 | 198 |
| 49 | iso_pu_bacteria | 2876771140 | 2876776410 | 198 |
| 50 | iso_pu_bacteria | 2876818435 | 2876820978 | 198 |
| 51 | iso_pu_bacteria | 2879074833 | 2879081727 | 198 |
| 52 | iso_pu_bacteria | 2879099564 | 2879108863 | 198 |
| 53 | iso_pu_bacteria | 2879127579 | 2879130441 | 198 |
| 54 | iso_pu_bacteria | 2879142872 | 2879146327 | 198 |
| 55 | iso_pu_bacteria | 2881364244 | 2881370738 | 198 |
| 56 | iso_pu_bacteria | 2885366525 | 2885366879 | 198 |
| 57 | iso_pu_bacteria | 2885409591 | 2885411867 | 198 |
| 58 | iso_pu_bacteria | 2888388044 | 2888389179 | 198 |
| 59 | iso_pu_bacteria | 2888419890 | 2888421869 | 198 |
| 60 | iso_pu_bacteria | 2889033259 | 2889033691 | 198 |
| 61 | iso_pu_bacteria | 2906635258 | 2906642425 | 198 |
| 62 | iso_pu_bacteria | 2906660503 | 2906660732 | 198 |
| 63 | iso_pu_bacteria | 2908775508 | 2908781658 | 198 |
| 64 | iso_pu_bacteria | 2922361189 | 2922367048 | 198 |
| 65 | iso_pu_bacteria | 2922368715 | 2922371120 | 198 |
| 66 | iso_pu_bacteria | 2922386360 | 2922390173 | 198 |
| 67 | iso_pu_bacteria | 2922393267 | 2922393501 | 198 |
| 68 | iso_pu_bacteria | 2929615660 | 2929619517 | 198 |
| 69 | iso_pu_bacteria | 2929624759 | 2929628013 | 198 |
| 70 | iso_pu_bacteria | 2932784394 | 2932785841 | 198 |
| 71 | iso_pu_bacteria | 2932809354 | 2932813593 | 198 |
| 72 | iso_pu_bacteria | 2932818245 | 2932826699 | 198 |
| 73 | iso_pu_bacteria | 2932828146 | 2932830886 | 198 |
| 74 | iso_pu_bacteria | 2933577622 | 2933581438 | 198 |
| 75 | iso_pu_bacteria | 2935608549 | 2935612691 | 198 |
| 76 | iso_pu_bacteria | 2935616580 | 2935620928 | 198 |
| 77 | iso_pu_bacteria | 2935638405 | 2935640012 | 198 |
| 78 | iso_pu_bacteria | 2935648319 | 2935655192 | 198 |
| 79 | iso_pu_bacteria | 2935656913 | 2935664073 | 198 |
| 80 | iso_pu_bacteria | 2935665750 | 2935667134 | 198 |
| 81 | iso_pu_bacteria | 2935675223 | 2935677807 | 198 |
| 82 | iso_pu_bacteria | 2935684952 | 2935690264 | 198 |
| 83 | iso_pu_bacteria | 2935694250 | 2935697401 | 198 |
| 84 | iso_pu_bacteria | 2935703347 | 2935704890 | 198 |
| 85 | iso_pu_bacteria | 2935713505 | 2935718040 | 198 |
| 86 | iso_pu_bacteria | 2935722832 | 2935726810 | 198 |
| 87 | iso_pu_bacteria | 2935732158 | 2935735580 | 198 |
| 88 | iso_pu_bacteria | 2935741537 | 2935745149 | 198 |
| 89 | iso_pu_bacteria | 2935750917 | 2935755274 | 198 |
| 90 | iso_pu_bacteria | 2935760218 | 2935762204 | 198 |
| 91 | iso_pu_bacteria | 2935777560 | 2935780144 | 198 |
| 92 | iso_pu_bacteria | 2935801545 | 2935803708 | 198 |
| 93 | iso_pu_bacteria | 2935810662 | 2935811621 | 198 |
| 94 | iso_pu_bacteria | 2935819856 | 2935824180 | 198 |
| 95 | iso_pu_bacteria | 2935827899 | 2935829495 | 198 |
| 96 | iso_pu_bacteria | 2935837841 | 2935842528 | 198 |
| 97 | iso_pu_bacteria | 2935847175 | 2935852673 | 198 |
| 98 | iso_pu_bacteria | 2935855204 | 2935858736 | 198 |
| 99 | iso_pu_bacteria | 2935864058 | 2935866842 | 198 |
| 100 | iso_pu_bacteria | 2935873716 | 2935876973 | 198 |
| 101 | iso_pu_bacteria | 2935908558 | 2935912176 | 198 |
| 102 | iso_pu_bacteria | 2935916978 | 2935922389 | 198 |
| 103 | iso_pu_bacteria | 2935926038 | 2935929205 | 198 |
| 104 | iso_pu_bacteria | 2935934488 | 2935935836 | 198 |
| 105 | iso_pu_bacteria | 2935942939 | 2935947402 | 198 |
| 106 | iso_pu_bacteria | 2935951376 | 2935953503 | 198 |
| 107 | iso_pu_bacteria | 2935959822 | 2935961983 | 198 |
| 108 | iso_pu_bacteria | 2935967501 | 2935968529 | 198 |
| 109 | iso_pu_bacteria | 2935975950 | 2935976713 | 198 |
| 110 | iso_pu_bacteria | 2935984226 | 2935990664 | 198 |
| 111 | iso_pu_bacteria | 2935992306 | 2935993388 | 198 |
| 112 | iso_pu_bacteria | 2936002035 | 2936004283 | 198 |
| 113 | iso_pu_bacteria | 2936011229 | 2936015429 | 198 |
| 114 | iso_pu_bacteria | 2936019824 | 2936024063 | 198 |
| 115 | iso_pu_bacteria | 2936028420 | 2936033078 | 198 |
| 116 | iso_pu_bacteria | 2936037263 | 2936038203 | 198 |
| 117 | iso_pu_bacteria | 2936046547 | 2936051171 | 198 |
| 118 | iso_pu_bacteria | 2936055302 | 2936058549 | 198 |
| 119 | iso_pu_bacteria | 2940556831 | 2940561445 | 198 |
| 120 | iso_pu_bacteria | 2941538514 | 2941544625 | 198 |
| 121 | iso_pu_bacteria | 3005483717 | 3005489781 | 198 |
| 122 | iso_pu_bacteria | 3005587118 | 3005593031 | 198 |
| 123 | iso_pu_bacteria | 3005594810 | 3005596484 | 198 |
| 124 | iso_pu_bacteria | 8006964411 | 8006966583 | 198 |
| 125 | iso_pu_bacteria | 8006984368 | 8006989429 | 198 |
| 126 | iso_pu_bacteria | 8006994254 | 8006997898 | 198 |
| 127 | iso_pu_bacteria | 8016511872 | 8016516502 | 198 |
| 128 | iso_pu_bacteria | 8016522445 | 8016523913 | 198 |
| 129 | iso_pu_bacteria | 8016530956 | 8016537443 | 198 |
| 130 | iso_pu_bacteria | 8016539877 | 8016541714 | 198 |
| 131 | iso_pu_bacteria | 8016548790 | 8016551559 | 198 |
| 132 | iso_pu_bacteria | 8016557553 | 8016559940 | 198 |
| 133 | iso_pu_bacteria | 8016566248 | 8016567099 | 198 |
| 134 | iso_pu_bacteria | 8016575299 | 8016579818 | 198 |
| 135 | iso_pu_bacteria | 8016583857 | 8016589064 | 198 |
| 136 | iso_pu_bacteria | 8016595262 | 8016597872 | 198 |
| 137 | iso_pu_bacteria | 8016603502 | 8016604010 | 198 |
| 138 | iso_pu_bacteria | 8016630954 | 8016633913 | 198 |
| 139 | iso_pu_bacteria | 8017057580 | 8017060037 | 198 |
| 140 | iso_pu_bacteria | 8019530166 | 8019537127 | 198 |
| 141 | iso_pu_bacteria | 8019538911 | 8019542421 | 198 |
| 142 | iso_pu_bacteria | 8019576017 | 8019579541 | 198 |
| 143 | iso_pu_bacteria | 8019586578 | 8019587252 | 198 |
| 144 | iso_pu_bacteria | 8019597564 | 8019604087 | 198 |
| 145 | iso_pu_bacteria | 8019608314 | 8019614442 | 198 |
| 146 | iso_pu_bacteria | 8019619141 | 8019625072 | 198 |
| 147 | iso_pu_bacteria | 8019638758 | 8019642492 | 198 |
| 148 | iso_pu_bacteria | 8019659431 | 8019664976 | 198 |
| 149 | iso_pu_bacteria | 8019678201 | 8019681592 | 198 |
| 150 | iso_pu_bacteria | 8019687851 | 8019694182 | 198 |
| 151 | iso_pu_bacteria | 8055742211 | 8055749225 | 198 |
| 152 | 3300046660 | Ga0495625_0480560 | Ga0495625_0480560_83_688 | 199 |
| 153 | 3300053094 | Ga0500566_0109053 | Ga0500566_0109053_306_914 | 199 |
| 154 | 3300053108 | Ga0500562_012723 | Ga0500562_012723_845_1450 | 199 |
| 155 | 3300053121 | Ga0500607_055866 | Ga0500607_055866_349_957 | 199 |
| 156 | 3300053123 | Ga0500614_028299 | Ga0500614_028299_387_995 | 199 |
| 157 | 3300053136 | Ga0500559_0014510 | Ga0500559_0014510_1391_1999 | 199 |
| 158 | 3300053155 | Ga0500620_015387 | Ga0500620_015387_704_1312 | 199 |
| 159 | 3300053177 | Ga0500636_0036112 | Ga0500636_0036112_966_1574 | 199 |
| 160 | 3300053727 | Ga0500611_023664 | Ga0500611_023664_455_1060 | 199 |
| 161 | 3300053730 | Ga0500645_073405 | Ga0500645_073405_215_820 | 199 |
| 162 | iso_pu_bacteria | 2874612657 | 2874616867 | 199 |
| 163 | 3300003215 | JGI25153J46596_10002568 | JGI25153J46596_100025686 | 201 |
| 164 | 3300003354 | JGI25160J50197_1003238 | JGI25160J50197_10032388 | 201 |
| 165 | 3300003771 | Ga0055526_1035800 | Ga0055526_10358001 | 201 |
| 166 | 3300004625 | Ga0055543_1002483 | Ga0055543_10024832 | 201 |
| 167 | 3300005262 | Ga0065165_1000866 | Ga0065165_100086611 | 201 |
| 168 | 3300005262 | Ga0065165_1023762 | Ga0065165_10237623 | 201 |
| 169 | 3300006051 | Ga0075364_10186690 | Ga0075364_101866902 | 201 |
| 170 | 3300010375 | Ga0105239_10584380 | Ga0105239_105843802 | 201 |
| 171 | 3300025261 | Ga0209233_1001970 | Ga0209233_10019702 | 201 |
| 172 | 3300025295 | Ga0209564_1005010 | Ga0209564_10050102 | 201 |
| 173 | 3300025295 | Ga0209564_1016256 | Ga0209564_10162562 | 201 |
| 174 | 3300025297 | Ga0209758_1003005 | Ga0209758_100300511 | 201 |
| 175 | 3300025302 | Ga0207426_1000425 | Ga0207426_10004253 | 201 |
| 176 | 3300025303 | Ga0209051_1103626 | Ga0209051_11036262 | 201 |
| 177 | 3300037853 | Ga0436364_0519888 | Ga0436364_0519888_202_825 | 201 |
| 178 | 3300047469 | Ga0495673_0174666 | Ga0495673_0174666_99_704 | 201 |
| 179 | 3300048924 | Ga0496121_0419502 | Ga0496121_0419502_143_751 | 201 |
| 180 | 3300048925 | Ga0496122_0147775 | Ga0496122_0147775_785_1393 | 201 |
| 181 | 3300048927 | Ga0496124_0206840 | Ga0496124_0206840_606_1214 | 201 |
| 182 | 3300053119 | Ga0500595_040499 | Ga0500595_040499_763_1368 | 201 |
| 183 | 3300053133 | Ga0500655_034390 | Ga0500655_034390_198_803 | 201 |
| 184 | 3300053145 | Ga0500586_001990 | Ga0500586_001990_3230_3838 | 201 |
| 185 | iso_pu_bacteria | 2824617872 | 2824625914 | 201 |
| 186 | iso_pu_bacteria | 2824626560 | 2824634670 | 201 |
| 187 | iso_pu_bacteria | 2824635225 | 2824642728 | 201 |
| 188 | iso_pu_bacteria | 2824644064 | 2824650648 | 201 |
| 189 | iso_pu_bacteria | 2824714736 | 2824721433 | 201 |
| 190 | iso_pu_bacteria | 2824723954 | 2824730743 | 201 |
| 191 | 3300002067 | JGI24735J21928_10099732 | JGI24735J21928_100997322 | 202 |
| 192 | 3300002244 | JGI24742J22300_10061538 | JGI24742J22300_100615381 | 202 |
| 193 | 3300003214 | JGI25165J46597_1012784 | JGI25165J46597_10127842 | 202 |
| 194 | 3300003215 | JGI25153J46596_10013493 | JGI25153J46596_100134934 | 202 |
| 195 | 3300003215 | JGI25153J46596_10014078 | JGI25153J46596_100140783 | 202 |
| 196 | 3300003354 | JGI25160J50197_1024080 | JGI25160J50197_10240802 | 202 |
| 197 | 3300003659 | JGI25404J52841_10015155 | JGI25404J52841_100151552 | 202 |
| 198 | 3300003759 | Ga0055525_1007627 | Ga0055525_10076272 | 202 |
| 199 | 3300003794 | Ga0055531_10026099 | Ga0055531_100260992 | 202 |
| 200 | 3300005262 | Ga0065165_1022843 | Ga0065165_10228431 | 202 |
| 201 | 3300005327 | Ga0070658_11123532 | Ga0070658_111235321 | 202 |
| 202 | 3300005327 | Ga0070658_11126514 | Ga0070658_111265141 | 202 |
| 203 | 3300005330 | Ga0070690_100769055 | Ga0070690_1007690551 | 202 |
| 204 | 3300005334 | Ga0068869_100054968 | Ga0068869_1000549684 | 202 |
| 205 | 3300005336 | Ga0070680_100155993 | Ga0070680_1001559931 | 202 |
| 206 | 3300005338 | Ga0068868_100114720 | Ga0068868_1001147201 | 202 |
| 207 | 3300005338 | Ga0068868_101101890 | Ga0068868_1011018901 | 202 |
| 208 | 3300005340 | Ga0070689_100382480 | Ga0070689_1003824801 | 202 |
| 209 | 3300005343 | Ga0070687_100207237 | Ga0070687_1002072372 | 202 |
| 210 | 3300005347 | Ga0070668_100027110 | Ga0070668_1000271102 | 202 |
| 211 | 3300005347 | Ga0070668_100103345 | Ga0070668_1001033453 | 202 |
| 212 | 3300005347 | Ga0070668_100174359 | Ga0070668_1001743592 | 202 |
| 213 | 3300005347 | Ga0070668_100430126 | Ga0070668_1004301262 | 202 |
| 214 | 3300005347 | Ga0070668_100678005 | Ga0070668_1006780051 | 202 |
| 215 | 3300005355 | Ga0070671_100999578 | Ga0070671_1009995781 | 202 |
| 216 | 3300005356 | Ga0070674_100036028 | Ga0070674_1000360284 | 202 |
| 217 | 3300005364 | Ga0070673_100256983 | Ga0070673_1002569831 | 202 |
| 218 | 3300005365 | Ga0070688_100369324 | Ga0070688_1003693241 | 202 |
| 219 | 3300005366 | Ga0070659_100228749 | Ga0070659_1002287492 | 202 |
| 220 | 3300005367 | Ga0070667_100891271 | Ga0070667_1008912712 | 202 |
| 221 | 3300005436 | Ga0070713_100217909 | Ga0070713_1002179091 | 202 |
| 222 | 3300005436 | Ga0070713_100962118 | Ga0070713_1009621181 | 202 |
| 223 | 3300005455 | Ga0070663_100059935 | Ga0070663_1000599352 | 202 |
| 224 | 3300005455 | Ga0070663_100145254 | Ga0070663_1001452541 | 202 |
| 225 | 3300005455 | Ga0070663_100189808 | Ga0070663_1001898082 | 202 |
| 226 | 3300005455 | Ga0070663_100656601 | Ga0070663_1006566011 | 202 |
| 227 | 3300005457 | Ga0070662_100083187 | Ga0070662_1000831871 | 202 |
| 228 | 3300005459 | Ga0068867_100595080 | Ga0068867_1005950802 | 202 |
| 229 | 3300005471 | Ga0070698_100209554 | Ga0070698_1002095542 | 202 |
| 230 | 3300005535 | Ga0070684_100010999 | Ga0070684_1000109994 | 202 |
| 231 | 3300005536 | Ga0070697_100053717 | Ga0070697_1000537174 | 202 |
| 232 | 3300005539 | Ga0068853_100213069 | Ga0068853_1002130692 | 202 |
| 233 | 3300005539 | Ga0068853_100293683 | Ga0068853_1002936832 | 202 |
| 234 | 3300005544 | Ga0070686_100230778 | Ga0070686_1002307782 | 202 |
| 235 | 3300005548 | Ga0070665_100153179 | Ga0070665_1001531792 | 202 |
| 236 | 3300005548 | Ga0070665_100192952 | Ga0070665_1001929522 | 202 |
| 237 | 3300005548 | Ga0070665_100357422 | Ga0070665_1003574222 | 202 |
| 238 | 3300005548 | Ga0070665_100430484 | Ga0070665_1004304842 | 202 |
| 239 | 3300005563 | Ga0068855_100244299 | Ga0068855_1002442992 | 202 |
| 240 | 3300005563 | Ga0068855_100607703 | Ga0068855_1006077032 | 202 |
| 241 | 3300005564 | Ga0070664_100242698 | Ga0070664_1002426982 | 202 |
| 242 | 3300005564 | Ga0070664_100785845 | Ga0070664_1007858452 | 202 |
| 243 | 3300005614 | Ga0068856_100508519 | Ga0068856_1005085192 | 202 |
| 244 | 3300005614 | Ga0068856_100869406 | Ga0068856_1008694062 | 202 |
| 245 | 3300005616 | Ga0068852_100391971 | Ga0068852_1003919711 | 202 |
| 246 | 3300005616 | Ga0068852_100993822 | Ga0068852_1009938222 | 202 |
| 247 | 3300005618 | Ga0068864_100328139 | Ga0068864_1003281392 | 202 |
| 248 | 3300005618 | Ga0068864_100529912 | Ga0068864_1005299122 | 202 |
| 249 | 3300005834 | Ga0068851_10492948 | Ga0068851_104929481 | 202 |
| 250 | 3300005840 | Ga0068870_10109348 | Ga0068870_101093481 | 202 |
| 251 | 3300005840 | Ga0068870_10500581 | Ga0068870_105005811 | 202 |
| 252 | 3300005841 | Ga0068863_100279776 | Ga0068863_1002797762 | 202 |
| 253 | 3300005841 | Ga0068863_101535728 | Ga0068863_1015357281 | 202 |
| 254 | 3300005842 | Ga0068858_100122372 | Ga0068858_1001223724 | 202 |
| 255 | 3300005843 | Ga0068860_100094368 | Ga0068860_1000943682 | 202 |
| 256 | 3300005843 | Ga0068860_101067413 | Ga0068860_1010674132 | 202 |
| 257 | 3300005844 | Ga0068862_100079284 | Ga0068862_1000792844 | 202 |
| 258 | 3300005844 | Ga0068862_100305099 | Ga0068862_1003050992 | 202 |
| 259 | 3300005844 | Ga0068862_100381121 | Ga0068862_1003811212 | 202 |
| 260 | 3300005844 | Ga0068862_100496742 | Ga0068862_1004967422 | 202 |
| 261 | 3300005844 | Ga0068862_100609103 | Ga0068862_1006091032 | 202 |
| 262 | 3300005937 | Ga0081455_10050141 | Ga0081455_100501415 | 202 |
| 263 | 3300005937 | Ga0081455_10071493 | Ga0081455_100714931 | 202 |
| 264 | 3300005983 | Ga0081540_1001986 | Ga0081540_100198621 | 202 |
| 265 | 3300005983 | Ga0081540_1003959 | Ga0081540_10039594 | 202 |
| 266 | 3300005983 | Ga0081540_1016453 | Ga0081540_10164533 | 202 |
| 267 | 3300005983 | Ga0081540_1040288 | Ga0081540_10402882 | 202 |
| 268 | 3300006028 | Ga0070717_10684231 | Ga0070717_106842312 | 202 |
| 269 | 3300006038 | Ga0075365_10081939 | Ga0075365_100819392 | 202 |
| 270 | 3300006038 | Ga0075365_10097363 | Ga0075365_100973634 | 202 |
| 271 | 3300006038 | Ga0075365_10107281 | Ga0075365_101072812 | 202 |
| 272 | 3300006048 | Ga0075363_100072768 | Ga0075363_1000727682 | 202 |
| 273 | 3300006048 | Ga0075363_100336746 | Ga0075363_1003367461 | 202 |
| 274 | 3300006048 | Ga0075363_100381484 | Ga0075363_1003814841 | 202 |
| 275 | 3300006051 | Ga0075364_10095002 | Ga0075364_100950023 | 202 |
| 276 | 3300006163 | Ga0070715_10245687 | Ga0070715_102456872 | 202 |
| 277 | 3300006177 | Ga0075362_10027219 | Ga0075362_100272194 | 202 |
| 278 | 3300006178 | Ga0075367_10042624 | Ga0075367_100426242 | 202 |
| 279 | 3300006178 | Ga0075367_10391503 | Ga0075367_103915031 | 202 |
| 280 | 3300006186 | Ga0075369_10169657 | Ga0075369_101696572 | 202 |
| 281 | 3300006186 | Ga0075369_10322537 | Ga0075369_103225371 | 202 |
| 282 | 3300006195 | Ga0075366_10224491 | Ga0075366_102244912 | 202 |
| 283 | 3300006195 | Ga0075366_10243457 | Ga0075366_102434572 | 202 |
| 284 | 3300006195 | Ga0075366_10268549 | Ga0075366_102685491 | 202 |
| 285 | 3300006237 | Ga0097621_100956827 | Ga0097621_1009568272 | 202 |
| 286 | 3300006353 | Ga0075370_10177315 | Ga0075370_101773152 | 202 |
| 287 | 3300006353 | Ga0075370_10220280 | Ga0075370_102202802 | 202 |
| 288 | 3300006353 | Ga0075370_10223711 | Ga0075370_102237112 | 202 |
| 289 | 3300006844 | Ga0075428_100196472 | Ga0075428_1001964722 | 202 |
| 290 | 3300006881 | Ga0068865_100101744 | Ga0068865_1001017442 | 202 |
| 291 | 3300006881 | Ga0068865_100373720 | Ga0068865_1003737201 | 202 |
| 292 | 3300006914 | Ga0075436_100777904 | Ga0075436_1007779042 | 202 |
| 293 | 3300009093 | Ga0105240_10020447 | Ga0105240_100204474 | 202 |
| 294 | 3300009093 | Ga0105240_11357177 | Ga0105240_113571771 | 202 |
| 295 | 3300009098 | Ga0105245_11092254 | Ga0105245_110922542 | 202 |
| 296 | 3300009101 | Ga0105247_10063969 | Ga0105247_100639692 | 202 |
| 297 | 3300009101 | Ga0105247_10206866 | Ga0105247_102068662 | 202 |
| 298 | 3300009147 | Ga0114129_10527086 | Ga0114129_105270862 | 202 |
| 299 | 3300009148 | Ga0105243_10031732 | Ga0105243_100317324 | 202 |
| 300 | 3300009148 | Ga0105243_10432358 | Ga0105243_104323581 | 202 |
| 301 | 3300009148 | Ga0105243_10457568 | Ga0105243_104575682 | 202 |
| 302 | 3300009148 | Ga0105243_10473269 | Ga0105243_104732692 | 202 |
| 303 | 3300009174 | Ga0105241_10049513 | Ga0105241_100495134 | 202 |
| 304 | 3300009174 | Ga0105241_10140618 | Ga0105241_101406182 | 202 |
| 305 | 3300009174 | Ga0105241_11195539 | Ga0105241_111955392 | 202 |
| 306 | 3300009176 | Ga0105242_10608441 | Ga0105242_106084411 | 202 |
| 307 | 3300009176 | Ga0105242_11156961 | Ga0105242_111569612 | 202 |
| 308 | 3300009177 | Ga0105248_10505669 | Ga0105248_105056692 | 202 |
| 309 | 3300009545 | Ga0105237_10068396 | Ga0105237_100683962 | 202 |
| 310 | 3300009551 | Ga0105238_10693667 | Ga0105238_106936671 | 202 |
| 311 | 3300009553 | Ga0105249_10305151 | Ga0105249_103051512 | 202 |
| 312 | 3300009553 | Ga0105249_11349016 | Ga0105249_113490161 | 202 |
| 313 | 3300010159 | Ga0099796_10148941 | Ga0099796_101489412 | 202 |
| 314 | 3300010375 | Ga0105239_10053578 | Ga0105239_100535781 | 202 |
| 315 | 3300010375 | Ga0105239_10136576 | Ga0105239_101365764 | 202 |
| 316 | 3300010375 | Ga0105239_10438457 | Ga0105239_104384572 | 202 |
| 317 | 3300010375 | Ga0105239_10506257 | Ga0105239_105062572 | 202 |
| 318 | 3300010375 | Ga0105239_10656958 | Ga0105239_106569581 | 202 |
| 319 | 3300010375 | Ga0105239_11424524 | Ga0105239_114245241 | 202 |
| 320 | 3300013100 | Ga0157373_10649584 | Ga0157373_106495841 | 202 |
| 321 | 3300013104 | Ga0157370_10248815 | Ga0157370_102488152 | 202 |
| 322 | 3300013296 | Ga0157374_10514938 | Ga0157374_105149381 | 202 |
| 323 | 3300013296 | Ga0157374_10787273 | Ga0157374_107872732 | 202 |
| 324 | 3300013297 | Ga0157378_10301137 | Ga0157378_103011372 | 202 |
| 325 | 3300013306 | Ga0163162_10605859 | Ga0163162_106058592 | 202 |
| 326 | 3300013308 | Ga0157375_10273504 | Ga0157375_102735042 | 202 |
| 327 | 3300013308 | Ga0157375_10768747 | Ga0157375_107687472 | 202 |
| 328 | 3300014325 | Ga0163163_10117591 | Ga0163163_101175912 | 202 |
| 329 | 3300014325 | Ga0163163_10297644 | Ga0163163_102976442 | 202 |
| 330 | 3300014325 | Ga0163163_10957050 | Ga0163163_109570502 | 202 |
| 331 | 3300014325 | Ga0163163_11037067 | Ga0163163_110370672 | 202 |
| 332 | 3300014968 | Ga0157379_10389004 | Ga0157379_103890042 | 202 |
| 333 | 3300014969 | Ga0157376_11212705 | Ga0157376_112127052 | 202 |
| 334 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001276 | 202 |
| 335 | 3300021320 | Ga0214544_1024413 | Ga0214544_10244133 | 202 |
| 336 | 3300021321 | Ga0214542_1000005 | Ga0214542_1000005276 | 202 |
| 337 | 3300021321 | Ga0214542_1022513 | Ga0214542_10225134 | 202 |
| 338 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003488 | 202 |
| 339 | 3300021324 | Ga0214545_1013953 | Ga0214545_101395311 | 202 |
| 340 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002277 | 202 |
| 341 | 3300021327 | Ga0214543_1036318 | Ga0214543_10363182 | 202 |
| 342 | 3300021361 | Ga0213872_10143744 | Ga0213872_101437442 | 202 |
| 343 | 3300021377 | Ga0213874_10023666 | Ga0213874_100236662 | 202 |
| 344 | 3300021384 | Ga0213876_10372511 | Ga0213876_103725111 | 202 |
| 345 | 3300021388 | Ga0213875_10034375 | Ga0213875_100343752 | 202 |
| 346 | 3300021441 | Ga0213871_10006629 | Ga0213871_100066292 | 202 |
| 347 | 3300025230 | Ga0209563_112577 | Ga0209563_1125772 | 202 |
| 348 | 3300025253 | Ga0209677_101244 | Ga0209677_1012444 | 202 |
| 349 | 3300025253 | Ga0209677_104808 | Ga0209677_1048082 | 202 |
| 350 | 3300025254 | Ga0209148_1000253 | Ga0209148_100025323 | 202 |
| 351 | 3300025261 | Ga0209233_1009212 | Ga0209233_10092122 | 202 |
| 352 | 3300025272 | Ga0209455_1001785 | Ga0209455_10017852 | 202 |
| 353 | 3300025272 | Ga0209455_1005205 | Ga0209455_10052054 | 202 |
| 354 | 3300025272 | Ga0209455_1006143 | Ga0209455_10061434 | 202 |
| 355 | 3300025272 | Ga0209455_1027323 | Ga0209455_10273232 | 202 |
| 356 | 3300025297 | Ga0209758_1000026 | Ga0209758_100002644 | 202 |
| 357 | 3300025297 | Ga0209758_1000318 | Ga0209758_100031881 | 202 |
| 358 | 3300025297 | Ga0209758_1001423 | Ga0209758_100142314 | 202 |
| 359 | 3300025297 | Ga0209758_1002424 | Ga0209758_10024242 | 202 |
| 360 | 3300025297 | Ga0209758_1038631 | Ga0209758_10386313 | 202 |
| 361 | 3300025302 | Ga0207426_1001506 | Ga0207426_100150622 | 202 |
| 362 | 3300025302 | Ga0207426_1019039 | Ga0207426_10190392 | 202 |
| 363 | 3300025302 | Ga0207426_1019633 | Ga0207426_10196332 | 202 |
| 364 | 3300025303 | Ga0209051_1079705 | Ga0209051_10797052 | 202 |
| 365 | 3300025304 | Ga0209257_1002846 | Ga0209257_100284616 | 202 |
| 366 | 3300025315 | Ga0207697_10119290 | Ga0207697_101192902 | 202 |
| 367 | 3300025711 | Ga0207696_1077826 | Ga0207696_10778261 | 202 |
| 368 | 3300025900 | Ga0207710_10193016 | Ga0207710_101930161 | 202 |
| 369 | 3300025903 | Ga0207680_10303059 | Ga0207680_103030592 | 202 |
| 370 | 3300025903 | Ga0207680_10370781 | Ga0207680_103707812 | 202 |
| 371 | 3300025904 | Ga0207647_10080325 | Ga0207647_100803252 | 202 |
| 372 | 3300025904 | Ga0207647_10130615 | Ga0207647_101306152 | 202 |
| 373 | 3300025904 | Ga0207647_10220191 | Ga0207647_102201911 | 202 |
| 374 | 3300025904 | Ga0207647_10386612 | Ga0207647_103866121 | 202 |
| 375 | 3300025906 | Ga0207699_10075887 | Ga0207699_100758874 | 202 |
| 376 | 3300025907 | Ga0207645_10218177 | Ga0207645_102181772 | 202 |
| 377 | 3300025908 | Ga0207643_10011341 | Ga0207643_100113411 | 202 |
| 378 | 3300025908 | Ga0207643_10067803 | Ga0207643_100678032 | 202 |
| 379 | 3300025911 | Ga0207654_10016046 | Ga0207654_100160462 | 202 |
| 380 | 3300025911 | Ga0207654_10502014 | Ga0207654_105020142 | 202 |
| 381 | 3300025912 | Ga0207707_10171584 | Ga0207707_101715841 | 202 |
| 382 | 3300025912 | Ga0207707_10833602 | Ga0207707_108336021 | 202 |
| 383 | 3300025913 | Ga0207695_10000634 | Ga0207695_1000063411 | 202 |
| 384 | 3300025914 | Ga0207671_10011863 | Ga0207671_100118637 | 202 |
| 385 | 3300025914 | Ga0207671_10150853 | Ga0207671_101508532 | 202 |
| 386 | 3300025915 | Ga0207693_10481253 | Ga0207693_104812531 | 202 |
| 387 | 3300025915 | Ga0207693_10622476 | Ga0207693_106224762 | 202 |
| 388 | 3300025916 | Ga0207663_10049899 | Ga0207663_100498991 | 202 |
| 389 | 3300025918 | Ga0207662_10560122 | Ga0207662_105601221 | 202 |
| 390 | 3300025919 | Ga0207657_10007164 | Ga0207657_100071642 | 202 |
| 391 | 3300025920 | Ga0207649_10631726 | Ga0207649_106317262 | 202 |
| 392 | 3300025922 | Ga0207646_10222438 | Ga0207646_102224382 | 202 |
| 393 | 3300025923 | Ga0207681_10908983 | Ga0207681_109089831 | 202 |
| 394 | 3300025926 | Ga0207659_10301607 | Ga0207659_103016072 | 202 |
| 395 | 3300025927 | Ga0207687_10109786 | Ga0207687_101097862 | 202 |
| 396 | 3300025928 | Ga0207700_10086666 | Ga0207700_100866662 | 202 |
| 397 | 3300025931 | Ga0207644_10143966 | Ga0207644_101439663 | 202 |
| 398 | 3300025931 | Ga0207644_10577049 | Ga0207644_105770491 | 202 |
| 399 | 3300025932 | Ga0207690_10104373 | Ga0207690_101043732 | 202 |
| 400 | 3300025932 | Ga0207690_10560745 | Ga0207690_105607452 | 202 |
| 401 | 3300025933 | Ga0207706_10027445 | Ga0207706_100274454 | 202 |
| 402 | 3300025933 | Ga0207706_10280768 | Ga0207706_102807681 | 202 |
| 403 | 3300025933 | Ga0207706_10436772 | Ga0207706_104367722 | 202 |
| 404 | 3300025935 | Ga0207709_10033563 | Ga0207709_100335634 | 202 |
| 405 | 3300025937 | Ga0207669_10017298 | Ga0207669_100172982 | 202 |
| 406 | 3300025938 | Ga0207704_10079727 | Ga0207704_100797272 | 202 |
| 407 | 3300025940 | Ga0207691_10172079 | Ga0207691_101720792 | 202 |
| 408 | 3300025941 | Ga0207711_10758307 | Ga0207711_107583071 | 202 |
| 409 | 3300025944 | Ga0207661_10006721 | Ga0207661_100067216 | 202 |
| 410 | 3300025945 | Ga0207679_10654677 | Ga0207679_106546772 | 202 |
| 411 | 3300025949 | Ga0207667_10142283 | Ga0207667_101422832 | 202 |
| 412 | 3300025949 | Ga0207667_10886806 | Ga0207667_108868062 | 202 |
| 413 | 3300025949 | Ga0207667_10894275 | Ga0207667_108942751 | 202 |
| 414 | 3300025960 | Ga0207651_10521423 | Ga0207651_105214231 | 202 |
| 415 | 3300025960 | Ga0207651_10621345 | Ga0207651_106213452 | 202 |
| 416 | 3300025960 | Ga0207651_10792171 | Ga0207651_107921712 | 202 |
| 417 | 3300025972 | Ga0207668_10024406 | Ga0207668_100244064 | 202 |
| 418 | 3300025972 | Ga0207668_10087629 | Ga0207668_100876293 | 202 |
| 419 | 3300025972 | Ga0207668_10245346 | Ga0207668_102453462 | 202 |
| 420 | 3300025972 | Ga0207668_10253140 | Ga0207668_102531402 | 202 |
| 421 | 3300025972 | Ga0207668_10319083 | Ga0207668_103190832 | 202 |
| 422 | 3300025972 | Ga0207668_10769404 | Ga0207668_107694042 | 202 |
| 423 | 3300025981 | Ga0207640_10295965 | Ga0207640_102959652 | 202 |
| 424 | 3300025986 | Ga0207658_10395367 | Ga0207658_103953671 | 202 |
| 425 | 3300026023 | Ga0207677_10104387 | Ga0207677_101043871 | 202 |
| 426 | 3300026035 | Ga0207703_10134202 | Ga0207703_101342021 | 202 |
| 427 | 3300026041 | Ga0207639_10102083 | Ga0207639_101020832 | 202 |
| 428 | 3300026067 | Ga0207678_10012307 | Ga0207678_1001230710 | 202 |
| 429 | 3300026067 | Ga0207678_10123704 | Ga0207678_101237043 | 202 |
| 430 | 3300026067 | Ga0207678_10212311 | Ga0207678_102123112 | 202 |
| 431 | 3300026067 | Ga0207678_10284104 | Ga0207678_102841042 | 202 |
| 432 | 3300026067 | Ga0207678_10551168 | Ga0207678_105511682 | 202 |
| 433 | 3300026067 | Ga0207678_11047033 | Ga0207678_110470332 | 202 |
| 434 | 3300026078 | Ga0207702_10477016 | Ga0207702_104770162 | 202 |
| 435 | 3300026078 | Ga0207702_11376308 | Ga0207702_113763081 | 202 |
| 436 | 3300026088 | Ga0207641_10837203 | Ga0207641_108372032 | 202 |
| 437 | 3300026089 | Ga0207648_10361808 | Ga0207648_103618082 | 202 |
| 438 | 3300026095 | Ga0207676_10273967 | Ga0207676_102739671 | 202 |
| 439 | 3300026095 | Ga0207676_10346204 | Ga0207676_103462042 | 202 |
| 440 | 3300026095 | Ga0207676_10397436 | Ga0207676_103974362 | 202 |
| 441 | 3300026116 | Ga0207674_10206443 | Ga0207674_102064432 | 202 |
| 442 | 3300026116 | Ga0207674_11176811 | Ga0207674_111768111 | 202 |
| 443 | 3300026118 | Ga0207675_100420333 | Ga0207675_1004203332 | 202 |
| 444 | 3300026118 | Ga0207675_100644472 | Ga0207675_1006444721 | 202 |
| 445 | 3300026121 | Ga0207683_10074762 | Ga0207683_100747622 | 202 |
| 446 | 3300026121 | Ga0207683_10150767 | Ga0207683_101507673 | 202 |
| 447 | 3300026121 | Ga0207683_10683100 | Ga0207683_106831002 | 202 |
| 448 | 3300026142 | Ga0207698_10078408 | Ga0207698_100784082 | 202 |
| 449 | 3300026142 | Ga0207698_10100030 | Ga0207698_101000302 | 202 |
| 450 | 3300027296 | Ga0209389_1000119 | Ga0209389_100011943 | 202 |
| 451 | 3300027357 | Ga0209589_1000010 | Ga0209589_1000010200 | 202 |
| 452 | 3300027361 | Ga0209489_100011 | Ga0209489_10001136 | 202 |
| 453 | 3300027671 | Ga0209588_1027398 | Ga0209588_10273982 | 202 |
| 454 | 3300028379 | Ga0268266_10011601 | Ga0268266_100116016 | 202 |
| 455 | 3300028379 | Ga0268266_10036772 | Ga0268266_100367725 | 202 |
| 456 | 3300028379 | Ga0268266_10223403 | Ga0268266_102234032 | 202 |
| 457 | 3300028379 | Ga0268266_10525109 | Ga0268266_105251092 | 202 |
| 458 | 3300028380 | Ga0268265_10131182 | Ga0268265_101311822 | 202 |
| 459 | 3300028380 | Ga0268265_10613252 | Ga0268265_106132522 | 202 |
| 460 | 3300028380 | Ga0268265_10727174 | Ga0268265_107271742 | 202 |
| 461 | 3300028380 | Ga0268265_10728730 | Ga0268265_107287302 | 202 |
| 462 | 3300028381 | Ga0268264_10283920 | Ga0268264_102839202 | 202 |
| 463 | 3300028381 | Ga0268264_11063358 | Ga0268264_110633582 | 202 |
| 464 | 3300028786 | Ga0307517_10090077 | Ga0307517_100900773 | 202 |
| 465 | 3300028794 | Ga0307515_10066890 | Ga0307515_100668907 | 202 |
| 466 | 3300028794 | Ga0307515_10334080 | Ga0307515_103340802 | 202 |
| 467 | 3300031247 | Ga0265340_10031864 | Ga0265340_100318642 | 202 |
| 468 | 3300031249 | Ga0265339_10000560 | Ga0265339_100005603 | 202 |
| 469 | 3300031507 | Ga0307509_10336075 | Ga0307509_103360752 | 202 |
| 470 | 3300031507 | Ga0307509_10379289 | Ga0307509_103792892 | 202 |
| 471 | 3300031616 | Ga0307508_10146942 | Ga0307508_101469422 | 202 |
| 472 | 3300031730 | Ga0307516_10259187 | Ga0307516_102591872 | 202 |
| 473 | 3300031852 | Ga0307410_10875830 | Ga0307410_108758301 | 202 |
| 474 | 3300031852 | Ga0307410_10885970 | Ga0307410_108859702 | 202 |
| 475 | 3300031903 | Ga0307407_10325433 | Ga0307407_103254332 | 202 |
| 476 | 3300031995 | Ga0307409_101535943 | Ga0307409_1015359431 | 202 |
| 477 | 3300032004 | Ga0307414_11188442 | Ga0307414_111884421 | 202 |
| 478 | 3300032126 | Ga0307415_101024222 | Ga0307415_1010242221 | 202 |
| 479 | 3300033180 | Ga0307510_10024022 | Ga0307510_1002402211 | 202 |
| 480 | 3300033442 | Ga0315911_1000010 | Ga0315911_100001081 | 202 |
| 481 | 3300033544 | Ga0316215_1006361 | Ga0316215_10063612 | 202 |
| 482 | 3300035083 | Ga0373926_0141324 | Ga0373926_0141324_14_622 | 202 |
| 483 | 3300035111 | Ga0373923_0031344 | Ga0373923_0031344_881_1489 | 202 |
| 484 | 3300035117 | Ga0373953_0176796 | Ga0373953_0176796_161_769 | 202 |
| 485 | 3300035118 | Ga0373954_0081325 | Ga0373954_0081325_210_818 | 202 |
| 486 | 3300035171 | Ga0373946_0008409 | Ga0373946_0008409_553_1161 | 202 |
| 487 | 3300035172 | Ga0373955_0240830 | Ga0373955_0240830_167_775 | 202 |
| 488 | 3300035695 | Ga0373927_0002264 | Ga0373927_0002264_970_1578 | 202 |
| 489 | 3300035725 | Ga0373947_0002643 | Ga0373947_0002643_6450_7058 | 202 |
| 490 | 3300036401 | Ga0373937_0019313 | Ga0373937_0019313_3614_4222 | 202 |
| 491 | 3300036459 | Ga0372808_001288 | Ga0372808_001288_874_1482 | 202 |
| 492 | 3300037068 | Ga0373925_0003737 | Ga0373925_0003737_950_1558 | 202 |
| 493 | 3300037068 | Ga0373925_0279007 | Ga0373925_0279007_568_1176 | 202 |
| 494 | 3300037312 | Ga0395899_0059903 | Ga0395899_0059903_1385_1993 | 202 |
| 495 | 3300037312 | Ga0395899_0244671 | Ga0395899_0244671_101_709 | 202 |
| 496 | 3300037418 | Ga0395900_0048961 | Ga0395900_0048961_2356_2964 | 202 |
| 497 | 3300037418 | Ga0395900_0088980 | Ga0395900_0088980_1722_2330 | 202 |
| 498 | 3300037466 | Ga0395898_0017014 | Ga0395898_0017014_1502_2110 | 202 |
| 499 | 3300037466 | Ga0395898_0065085 | Ga0395898_0065085_160_768 | 202 |
| 500 | 3300037466 | Ga0395898_0268082 | Ga0395898_0268082_40_648 | 202 |
| 501 | 3300037853 | Ga0436364_0061231 | Ga0436364_0061231_1345_1953 | 202 |
| 502 | 3300037853 | Ga0436364_1454126 | Ga0436364_1454126_764_1372 | 202 |
| 503 | 3300038443 | Ga0395901_0058832 | Ga0395901_0058832_2601_3209 | 202 |
| 504 | 3300039437 | Ga0436365_0773004 | Ga0436365_0773004_146_754 | 202 |
| 505 | 3300039437 | Ga0436365_1149951 | Ga0436365_1149951_91_699 | 202 |
| 506 | 3300039437 | Ga0436365_1815196 | Ga0436365_1815196_740_1348 | 202 |
| 507 | 3300039438 | Ga0436360_0311998 | Ga0436360_0311998_103_747 | 202 |
| 508 | 3300039438 | Ga0436360_0328780 | Ga0436360_0328780_2283_2891 | 202 |
| 509 | 3300039447 | Ga0436361_0069223 | Ga0436361_0069223_382_990 | 202 |
| 510 | 3300039447 | Ga0436361_0510320 | Ga0436361_0510320_236_844 | 202 |
| 511 | 3300039450 | Ga0436363_0834736 | Ga0436363_0834736_133_741 | 202 |
| 512 | 3300039450 | Ga0436363_1464422 | Ga0436363_1464422_345_953 | 202 |
| 513 | 3300041452 | Ga0451793_0044027 | Ga0451793_0044027_529_1137 | 202 |
| 514 | 3300041509 | Ga0451843_1629634 | Ga0451843_1629634_202_810 | 202 |
| 515 | 3300044656 | Ga0466969_0029006 | Ga0466969_0029006_2088_2696 | 202 |
| 516 | 3300044656 | Ga0466969_0163561 | Ga0466969_0163561_300_908 | 202 |
| 517 | 3300044658 | Ga0466972_0000090 | Ga0466972_0000090_35437_36045 | 202 |
| 518 | 3300044658 | Ga0466972_0056993 | Ga0466972_0056993_394_1002 | 202 |
| 519 | 3300044684 | Ga0466966_0342790 | Ga0466966_0342790_14_622 | 202 |
| 520 | 3300044693 | Ga0466961_0000081 | Ga0466961_0000081_4452_5060 | 202 |
| 521 | 3300044694 | Ga0466963_0416354 | Ga0466963_0416354_42_650 | 202 |
| 522 | 3300044694 | Ga0466963_0668589 | Ga0466963_0668589_69_680 | 202 |
| 523 | 3300044765 | Ga0466970_0029783 | Ga0466970_0029783_43_651 | 202 |
| 524 | 3300044842 | Ga0466957_0639696 | Ga0466957_0639696_87_695 | 202 |
| 525 | 3300044901 | Ga0466960_0197477 | Ga0466960_0197477_17_625 | 202 |
| 526 | 3300045049 | Ga0466959_0004686 | Ga0466959_0004686_7671_8279 | 202 |
| 527 | 3300045049 | Ga0466959_0162169 | Ga0466959_0162169_546_1154 | 202 |
| 528 | 3300045976 | Ga0466967_0212089 | Ga0466967_0212089_284_895 | 202 |
| 529 | 3300045976 | Ga0466967_1178008 | Ga0466967_1178008_67_675 | 202 |
| 530 | 3300046452 | Ga0495617_029495 | Ga0495617_029495_462_1070 | 202 |
| 531 | 3300046452 | Ga0495617_078863 | Ga0495617_078863_232_840 | 202 |
| 532 | 3300046455 | Ga0495603_0002182 | Ga0495603_0002182_7195_7803 | 202 |
| 533 | 3300046455 | Ga0495603_0106070 | Ga0495603_0106070_587_1213 | 202 |
| 534 | 3300046457 | Ga0495590_0047429 | Ga0495590_0047429_370_978 | 202 |
| 535 | 3300046459 | Ga0495629_0000226 | Ga0495629_0000226_3683_4291 | 202 |
| 536 | 3300046459 | Ga0495629_0024603 | Ga0495629_0024603_1505_2131 | 202 |
| 537 | 3300046459 | Ga0495629_0076212 | Ga0495629_0076212_333_941 | 202 |
| 538 | 3300046460 | Ga0495638_0009527 | Ga0495638_0009527_3596_4204 | 202 |
| 539 | 3300046460 | Ga0495638_0196767 | Ga0495638_0196767_41_649 | 202 |
| 540 | 3300046460 | Ga0495638_0224898 | Ga0495638_0224898_25_633 | 202 |
| 541 | 3300046461 | Ga0495641_0082969 | Ga0495641_0082969_205_813 | 202 |
| 542 | 3300046462 | Ga0495651_0170800 | Ga0495651_0170800_91_717 | 202 |
| 543 | 3300046463 | Ga0495653_0245980 | Ga0495653_0245980_479_1087 | 202 |
| 544 | 3300046471 | Ga0495650_0045495 | Ga0495650_0045495_1051_1659 | 202 |
| 545 | 3300046472 | Ga0495580_0002229 | Ga0495580_0002229_15521_16129 | 202 |
| 546 | 3300046473 | Ga0495582_0000106 | Ga0495582_0000106_3678_4286 | 202 |
| 547 | 3300046474 | Ga0495605_0085148 | Ga0495605_0085148_525_1133 | 202 |
| 548 | 3300046475 | Ga0495639_0000912 | Ga0495639_0000912_6979_7587 | 202 |
| 549 | 3300046475 | Ga0495639_0072285 | Ga0495639_0072285_902_1510 | 202 |
| 550 | 3300046476 | Ga0495662_0000112 | Ga0495662_0000112_1650_2258 | 202 |
| 551 | 3300046476 | Ga0495662_0060449 | Ga0495662_0060449_816_1442 | 202 |
| 552 | 3300046477 | Ga0495664_0013066 | Ga0495664_0013066_1029_1637 | 202 |
| 553 | 3300046492 | Ga0495585_0024609 | Ga0495585_0024609_914_1522 | 202 |
| 554 | 3300046499 | Ga0495594_0025944 | Ga0495594_0025944_1731_2339 | 202 |
| 555 | 3300046499 | Ga0495594_0249620 | Ga0495594_0249620_18_626 | 202 |
| 556 | 3300046500 | Ga0495596_0100590 | Ga0495596_0100590_158_766 | 202 |
| 557 | 3300046506 | Ga0495583_0132350 | Ga0495583_0132350_264_872 | 202 |
| 558 | 3300046507 | Ga0495606_0110756 | Ga0495606_0110756_269_895 | 202 |
| 559 | 3300046507 | Ga0495606_0110891 | Ga0495606_0110891_672_1280 | 202 |
| 560 | 3300046507 | Ga0495606_0289373 | Ga0495606_0289373_234_842 | 202 |
| 561 | 3300046507 | Ga0495606_0292020 | Ga0495606_0292020_217_825 | 202 |
| 562 | 3300046511 | Ga0495608_0029753 | Ga0495608_0029753_91_717 | 202 |
| 563 | 3300046511 | Ga0495608_0172768 | Ga0495608_0172768_162_788 | 202 |
| 564 | 3300046513 | Ga0495616_0124502 | Ga0495616_0124502_502_1128 | 202 |
| 565 | 3300046516 | Ga0495628_0035863 | Ga0495628_0035863_253_879 | 202 |
| 566 | 3300046516 | Ga0495628_0085095 | Ga0495628_0085095_584_1192 | 202 |
| 567 | 3300046517 | Ga0495630_0050483 | Ga0495630_0050483_967_1575 | 202 |
| 568 | 3300046518 | Ga0495631_0144906 | Ga0495631_0144906_18_626 | 202 |
| 569 | 3300046522 | Ga0495643_0035822 | Ga0495643_0035822_1262_1888 | 202 |
| 570 | 3300046524 | Ga0495648_0173409 | Ga0495648_0173409_411_1019 | 202 |
| 571 | 3300046525 | Ga0495663_0058933 | Ga0495663_0058933_131_739 | 202 |
| 572 | 3300046526 | Ga0495666_0037053 | Ga0495666_0037053_855_1463 | 202 |
| 573 | 3300046528 | Ga0495642_0218245 | Ga0495642_0218245_47_655 | 202 |
| 574 | 3300046528 | Ga0495642_0259312 | Ga0495642_0259312_97_705 | 202 |
| 575 | 3300046529 | Ga0495652_0122765 | Ga0495652_0122765_1218_1826 | 202 |
| 576 | 3300046529 | Ga0495652_0177443 | Ga0495652_0177443_523_1149 | 202 |
| 577 | 3300046529 | Ga0495652_0289271 | Ga0495652_0289271_315_941 | 202 |
| 578 | 3300046531 | Ga0495665_0000254 | Ga0495665_0000254_3867_4475 | 202 |
| 579 | 3300046531 | Ga0495665_0207098 | Ga0495665_0207098_23_649 | 202 |
| 580 | 3300046533 | Ga0495640_0003800 | Ga0495640_0003800_3691_4299 | 202 |
| 581 | 3300046533 | Ga0495640_0014514 | Ga0495640_0014514_5063_5689 | 202 |
| 582 | 3300046533 | Ga0495640_0090953 | Ga0495640_0090953_744_1370 | 202 |
| 583 | 3300046535 | Ga0495586_0377784 | Ga0495586_0377784_171_779 | 202 |
| 584 | 3300046536 | Ga0495587_0025877 | Ga0495587_0025877_365_991 | 202 |
| 585 | 3300046538 | Ga0495609_0049819 | Ga0495609_0049819_285_893 | 202 |
| 586 | 3300046543 | Ga0495645_0036139 | Ga0495645_0036139_999_1625 | 202 |
| 587 | 3300046557 | Ga0495622_0015939 | Ga0495622_0015939_1272_1880 | 202 |
| 588 | 3300046557 | Ga0495622_0116669 | Ga0495622_0116669_528_1154 | 202 |
| 589 | 3300046559 | Ga0495667_0025678 | Ga0495667_0025678_818_1426 | 202 |
| 590 | 3300046559 | Ga0495667_0041560 | Ga0495667_0041560_869_1495 | 202 |
| 591 | 3300046615 | Ga0495656_0045238 | Ga0495656_0045238_771_1397 | 202 |
| 592 | 3300046615 | Ga0495656_0062277 | Ga0495656_0062277_198_806 | 202 |
| 593 | 3300046615 | Ga0495656_0190985 | Ga0495656_0190985_17_625 | 202 |
| 594 | 3300046616 | Ga0495668_0183122 | Ga0495668_0183122_170_778 | 202 |
| 595 | 3300046642 | Ga0495634_0001436 | Ga0495634_0001436_19510_20118 | 202 |
| 596 | 3300046642 | Ga0495634_0105948 | Ga0495634_0105948_689_1315 | 202 |
| 597 | 3300046648 | Ga0495611_0053499 | Ga0495611_0053499_548_1156 | 202 |
| 598 | 3300046660 | Ga0495625_0164563 | Ga0495625_0164563_434_1042 | 202 |
| 599 | 3300046660 | Ga0495625_0203821 | Ga0495625_0203821_438_1064 | 202 |
| 600 | 3300046663 | Ga0495635_0003067 | Ga0495635_0003067_1144_1752 | 202 |
| 601 | 3300046663 | Ga0495635_0007905 | Ga0495635_0007905_988_1614 | 202 |
| 602 | 3300046664 | Ga0495659_0064408 | Ga0495659_0064408_448_1056 | 202 |
| 603 | 3300046674 | Ga0495588_0053957 | Ga0495588_0053957_827_1435 | 202 |
| 604 | 3300046674 | Ga0495588_0058529 | Ga0495588_0058529_499_1107 | 202 |
| 605 | 3300046675 | Ga0495657_0069160 | Ga0495657_0069160_869_1495 | 202 |
| 606 | 3300046675 | Ga0495657_0178219 | Ga0495657_0178219_318_944 | 202 |
| 607 | 3300046678 | Ga0495599_0118484 | Ga0495599_0118484_797_1423 | 202 |
| 608 | 3300046680 | Ga0495646_0014484 | Ga0495646_0014484_100_708 | 202 |
| 609 | 3300046680 | Ga0495646_0202850 | Ga0495646_0202850_53_679 | 202 |
| 610 | 3300046680 | Ga0495646_0364343 | Ga0495646_0364343_64_690 | 202 |
| 611 | 3300046681 | Ga0495647_0003957 | Ga0495647_0003957_3925_4533 | 202 |
| 612 | 3300046683 | Ga0495658_0000964 | Ga0495658_0000964_13420_14028 | 202 |
| 613 | 3300046689 | Ga0495613_0004538 | Ga0495613_0004538_1134_1742 | 202 |
| 614 | 3300046690 | Ga0495624_0005560 | Ga0495624_0005560_4782_5390 | 202 |
| 615 | 3300046690 | Ga0495624_0031167 | Ga0495624_0031167_703_1329 | 202 |
| 616 | 3300046690 | Ga0495624_0132644 | Ga0495624_0132644_255_863 | 202 |
| 617 | 3300046692 | Ga0495671_0205245 | Ga0495671_0205245_143_751 | 202 |
| 618 | 3300046694 | Ga0495649_0187311 | Ga0495649_0187311_434_1060 | 202 |
| 619 | 3300046794 | Ga0495589_0298561 | Ga0495589_0298561_89_697 | 202 |
| 620 | 3300046794 | Ga0495589_0314038 | Ga0495589_0314038_88_696 | 202 |
| 621 | 3300047315 | Ga0495581_0011778 | Ga0495581_0011778_766_1374 | 202 |
| 622 | 3300047315 | Ga0495581_0571888 | Ga0495581_0571888_14_640 | 202 |
| 623 | 3300047317 | Ga0495604_0043292 | Ga0495604_0043292_680_1306 | 202 |
| 624 | 3300047317 | Ga0495604_0152792 | Ga0495604_0152792_676_1302 | 202 |
| 625 | 3300047317 | Ga0495604_0273398 | Ga0495604_0273398_148_756 | 202 |
| 626 | 3300047318 | Ga0495636_0105230 | Ga0495636_0105230_525_1133 | 202 |
| 627 | 3300047319 | Ga0495674_0000082 | Ga0495674_0000082_61334_61942 | 202 |
| 628 | 3300047319 | Ga0495674_0164710 | Ga0495674_0164710_752_1378 | 202 |
| 629 | 3300047321 | Ga0495676_0064463 | Ga0495676_0064463_2216_2824 | 202 |
| 630 | 3300047321 | Ga0495676_0119649 | Ga0495676_0119649_603_1229 | 202 |
| 631 | 3300047443 | Ga0495687_125916 | Ga0495687_125916_35_643 | 202 |
| 632 | 3300047446 | Ga0495679_076280 | Ga0495679_076280_274_882 | 202 |
| 633 | 3300047469 | Ga0495673_0096644 | Ga0495673_0096644_457_1083 | 202 |
| 634 | 3300047469 | Ga0495673_0126263 | Ga0495673_0126263_324_950 | 202 |
| 635 | 3300047470 | Ga0495681_0205167 | Ga0495681_0205167_76_684 | 202 |
| 636 | 3300047471 | Ga0495684_0220676 | Ga0495684_0220676_251_877 | 202 |
| 637 | 3300047472 | Ga0495686_0320450 | Ga0495686_0320450_78_686 | 202 |
| 638 | 3300047673 | Ga0495593_0000366 | Ga0495593_0000366_20598_21206 | 202 |
| 639 | 3300047673 | Ga0495593_0151693 | Ga0495593_0151693_282_890 | 202 |
| 640 | 3300048090 | Ga0495615_0091377 | Ga0495615_0091377_59_667 | 202 |
| 641 | 3300048903 | Ga0496100_0146404 | Ga0496100_0146404_967_1575 | 202 |
| 642 | 3300048903 | Ga0496100_0175206 | Ga0496100_0175206_752_1378 | 202 |
| 643 | 3300048904 | Ga0496101_0128387 | Ga0496101_0128387_885_1493 | 202 |
| 644 | 3300048904 | Ga0496101_0167983 | Ga0496101_0167983_699_1307 | 202 |
| 645 | 3300048904 | Ga0496101_0294557 | Ga0496101_0294557_55_681 | 202 |
| 646 | 3300048904 | Ga0496101_0315838 | Ga0496101_0315838_95_703 | 202 |
| 647 | 3300048905 | Ga0496102_0028006 | Ga0496102_0028006_675_1283 | 202 |
| 648 | 3300048905 | Ga0496102_0272253 | Ga0496102_0272253_795_1403 | 202 |
| 649 | 3300048905 | Ga0496102_0312772 | Ga0496102_0312772_193_819 | 202 |
| 650 | 3300048905 | Ga0496102_0517080 | Ga0496102_0517080_164_772 | 202 |
| 651 | 3300048905 | Ga0496102_0605122 | Ga0496102_0605122_108_734 | 202 |
| 652 | 3300048906 | Ga0496103_0049599 | Ga0496103_0049599_1965_2573 | 202 |
| 653 | 3300048906 | Ga0496103_0153197 | Ga0496103_0153197_75_683 | 202 |
| 654 | 3300048907 | Ga0496104_0018741 | Ga0496104_0018741_4733_5341 | 202 |
| 655 | 3300048907 | Ga0496104_0094155 | Ga0496104_0094155_1276_1902 | 202 |
| 656 | 3300048907 | Ga0496104_0617018 | Ga0496104_0617018_95_703 | 202 |
| 657 | 3300048908 | Ga0496105_0039541 | Ga0496105_0039541_2188_2814 | 202 |
| 658 | 3300048908 | Ga0496105_0060956 | Ga0496105_0060956_544_1152 | 202 |
| 659 | 3300048908 | Ga0496105_0875258 | Ga0496105_0875258_21_629 | 202 |
| 660 | 3300048909 | Ga0496106_0063785 | Ga0496106_0063785_1170_1778 | 202 |
| 661 | 3300048909 | Ga0496106_0075362 | Ga0496106_0075362_1883_2491 | 202 |
| 662 | 3300048909 | Ga0496106_0427572 | Ga0496106_0427572_326_934 | 202 |
| 663 | 3300048911 | Ga0496108_0225193 | Ga0496108_0225193_1011_1619 | 202 |
| 664 | 3300048912 | Ga0496109_0377061 | Ga0496109_0377061_666_1274 | 202 |
| 665 | 3300048912 | Ga0496109_0434291 | Ga0496109_0434291_303_911 | 202 |
| 666 | 3300048913 | Ga0496110_0302099 | Ga0496110_0302099_289_897 | 202 |
| 667 | 3300048913 | Ga0496110_0319405 | Ga0496110_0319405_667_1275 | 202 |
| 668 | 3300048914 | Ga0496111_0129099 | Ga0496111_0129099_789_1397 | 202 |
| 669 | 3300048914 | Ga0496111_0200918 | Ga0496111_0200918_778_1386 | 202 |
| 670 | 3300048915 | Ga0496112_0056454 | Ga0496112_0056454_339_1001 | 202 |
| 671 | 3300048915 | Ga0496112_0111276 | Ga0496112_0111276_2086_2694 | 202 |
| 672 | 3300048915 | Ga0496112_0135064 | Ga0496112_0135064_907_1515 | 202 |
| 673 | 3300048915 | Ga0496112_0177824 | Ga0496112_0177824_1116_1724 | 202 |
| 674 | 3300048915 | Ga0496112_0312574 | Ga0496112_0312574_291_917 | 202 |
| 675 | 3300048916 | Ga0496113_0167143 | Ga0496113_0167143_447_1109 | 202 |
| 676 | 3300048916 | Ga0496113_0251146 | Ga0496113_0251146_35_643 | 202 |
| 677 | 3300048916 | Ga0496113_0432927 | Ga0496113_0432927_65_673 | 202 |
| 678 | 3300048916 | Ga0496113_0518166 | Ga0496113_0518166_277_903 | 202 |
| 679 | 3300048916 | Ga0496113_0527634 | Ga0496113_0527634_11_619 | 202 |
| 680 | 3300048916 | Ga0496113_0531910 | Ga0496113_0531910_86_694 | 202 |
| 681 | 3300048917 | Ga0496114_0080842 | Ga0496114_0080842_1596_2204 | 202 |
| 682 | 3300048917 | Ga0496114_0309072 | Ga0496114_0309072_112_738 | 202 |
| 683 | 3300048917 | Ga0496114_0377859 | Ga0496114_0377859_106_714 | 202 |
| 684 | 3300048917 | Ga0496114_0630215 | Ga0496114_0630215_306_914 | 202 |
| 685 | 3300048917 | Ga0496114_0730982 | Ga0496114_0730982_188_796 | 202 |
| 686 | 3300048918 | Ga0496115_0040830 | Ga0496115_0040830_2269_2895 | 202 |
| 687 | 3300048918 | Ga0496115_0404418 | Ga0496115_0404418_478_1086 | 202 |
| 688 | 3300048918 | Ga0496115_0414070 | Ga0496115_0414070_344_952 | 202 |
| 689 | 3300048919 | Ga0496116_0052983 | Ga0496116_0052983_1285_1893 | 202 |
| 690 | 3300048919 | Ga0496116_0185014 | Ga0496116_0185014_444_1052 | 202 |
| 691 | 3300048920 | Ga0496117_0062962 | Ga0496117_0062962_1254_1868 | 202 |
| 692 | 3300048921 | Ga0496118_0115545 | Ga0496118_0115545_40_648 | 202 |
| 693 | 3300048921 | Ga0496118_0131278 | Ga0496118_0131278_645_1259 | 202 |
| 694 | 3300048921 | Ga0496118_0248457 | Ga0496118_0248457_189_797 | 202 |
| 695 | 3300048921 | Ga0496118_0268327 | Ga0496118_0268327_270_878 | 202 |
| 696 | 3300048922 | Ga0496119_0026612 | Ga0496119_0026612_2190_2816 | 202 |
| 697 | 3300048922 | Ga0496119_0080598 | Ga0496119_0080598_516_1124 | 202 |
| 698 | 3300048922 | Ga0496119_0102232 | Ga0496119_0102232_316_924 | 202 |
| 699 | 3300048922 | Ga0496119_0198660 | Ga0496119_0198660_403_1011 | 202 |
| 700 | 3300048922 | Ga0496119_0293466 | Ga0496119_0293466_57_665 | 202 |
| 701 | 3300048923 | Ga0496120_0064229 | Ga0496120_0064229_602_1228 | 202 |
| 702 | 3300048923 | Ga0496120_0126770 | Ga0496120_0126770_380_994 | 202 |
| 703 | 3300048924 | Ga0496121_0015225 | Ga0496121_0015225_5624_6232 | 202 |
| 704 | 3300048924 | Ga0496121_0038564 | Ga0496121_0038564_789_1397 | 202 |
| 705 | 3300048924 | Ga0496121_0148782 | Ga0496121_0148782_353_961 | 202 |
| 706 | 3300048924 | Ga0496121_0198200 | Ga0496121_0198200_303_911 | 202 |
| 707 | 3300048924 | Ga0496121_0228637 | Ga0496121_0228637_579_1187 | 202 |
| 708 | 3300048924 | Ga0496121_0268621 | Ga0496121_0268621_34_642 | 202 |
| 709 | 3300048924 | Ga0496121_0275729 | Ga0496121_0275729_68_694 | 202 |
| 710 | 3300048924 | Ga0496121_0335218 | Ga0496121_0335218_197_805 | 202 |
| 711 | 3300048924 | Ga0496121_0397174 | Ga0496121_0397174_12_620 | 202 |
| 712 | 3300048925 | Ga0496122_0128139 | Ga0496122_0128139_999_1607 | 202 |
| 713 | 3300048927 | Ga0496124_0213561 | Ga0496124_0213561_289_897 | 202 |
| 714 | 3300048927 | Ga0496124_0226758 | Ga0496124_0226758_716_1330 | 202 |
| 715 | 3300048927 | Ga0496124_0340109 | Ga0496124_0340109_91_699 | 202 |
| 716 | 3300048927 | Ga0496124_0460478 | Ga0496124_0460478_124_732 | 202 |
| 717 | 3300048928 | Ga0496125_0009522 | Ga0496125_0009522_8944_9558 | 202 |
| 718 | 3300048928 | Ga0496125_0329781 | Ga0496125_0329781_11_637 | 202 |
| 719 | 3300048928 | Ga0496125_0431463 | Ga0496125_0431463_75_683 | 202 |
| 720 | 3300048928 | Ga0496125_0488078 | Ga0496125_0488078_52_660 | 202 |
| 721 | 3300048929 | Ga0496126_0018494 | Ga0496126_0018494_215_823 | 202 |
| 722 | 3300048929 | Ga0496126_0047692 | Ga0496126_0047692_560_1168 | 202 |
| 723 | 3300048929 | Ga0496126_0082642 | Ga0496126_0082642_316_942 | 202 |
| 724 | 3300048929 | Ga0496126_0175970 | Ga0496126_0175970_487_1095 | 202 |
| 725 | 3300048929 | Ga0496126_0186473 | Ga0496126_0186473_128_742 | 202 |
| 726 | 3300048929 | Ga0496126_0201303 | Ga0496126_0201303_273_881 | 202 |
| 727 | 3300048929 | Ga0496126_0322087 | Ga0496126_0322087_525_1133 | 202 |
| 728 | 3300048929 | Ga0496126_0409929 | Ga0496126_0409929_77_685 | 202 |
| 729 | 3300049460 | Ga0495682_0072104 | Ga0495682_0072104_240_866 | 202 |
| 730 | 3300049460 | Ga0495682_0154918 | Ga0495682_0154918_109_717 | 202 |
| 731 | 3300049568 | Ga0501031_0026577 | Ga0501031_0026577_1776_2384 | 202 |
| 732 | 3300049568 | Ga0501031_0089978 | Ga0501031_0089978_23_631 | 202 |
| 733 | 3300049568 | Ga0501031_0121919 | Ga0501031_0121919_997_1605 | 202 |
| 734 | 3300049568 | Ga0501031_0365092 | Ga0501031_0365092_113_721 | 202 |
| 735 | 3300049569 | Ga0501032_0015059 | Ga0501032_0015059_4812_5420 | 202 |
| 736 | 3300049569 | Ga0501032_0124575 | Ga0501032_0124575_56_664 | 202 |
| 737 | 3300049569 | Ga0501032_0148800 | Ga0501032_0148800_165_773 | 202 |
| 738 | 3300049569 | Ga0501032_0268621 | Ga0501032_0268621_405_1013 | 202 |
| 739 | 3300049570 | Ga0501033_0004699 | Ga0501033_0004699_2613_3221 | 202 |
| 740 | 3300049570 | Ga0501033_0430804 | Ga0501033_0430804_72_680 | 202 |
| 741 | 3300049570 | Ga0501033_0684654 | Ga0501033_0684654_77_685 | 202 |
| 742 | 3300049571 | Ga0501034_0095256 | Ga0501034_0095256_1758_2366 | 202 |
| 743 | 3300049571 | Ga0501034_0203318 | Ga0501034_0203318_485_1099 | 202 |
| 744 | 3300049571 | Ga0501034_0276913 | Ga0501034_0276913_248_856 | 202 |
| 745 | 3300049571 | Ga0501034_0392025 | Ga0501034_0392025_47_655 | 202 |
| 746 | 3300049571 | Ga0501034_0465658 | Ga0501034_0465658_71_688 | 202 |
| 747 | 3300049572 | Ga0501036_0046620 | Ga0501036_0046620_1768_2376 | 202 |
| 748 | 3300049572 | Ga0501036_0104377 | Ga0501036_0104377_1039_1647 | 202 |
| 749 | 3300049572 | Ga0501036_0124864 | Ga0501036_0124864_185_793 | 202 |
| 750 | 3300049572 | Ga0501036_0329957 | Ga0501036_0329957_84_692 | 202 |
| 751 | 3300049572 | Ga0501036_0392034 | Ga0501036_0392034_356_964 | 202 |
| 752 | 3300049573 | Ga0501037_0000396 | Ga0501037_0000396_16414_17022 | 202 |
| 753 | 3300049573 | Ga0501037_0021148 | Ga0501037_0021148_1300_1908 | 202 |
| 754 | 3300049573 | Ga0501037_0032014 | Ga0501037_0032014_869_1477 | 202 |
| 755 | 3300049573 | Ga0501037_0060449 | Ga0501037_0060449_2100_2708 | 202 |
| 756 | 3300049573 | Ga0501037_0151826 | Ga0501037_0151826_160_768 | 202 |
| 757 | 3300049574 | Ga0501038_0002046 | Ga0501038_0002046_7643_8251 | 202 |
| 758 | 3300049574 | Ga0501038_0004875 | Ga0501038_0004875_9766_10374 | 202 |
| 759 | 3300049574 | Ga0501038_0017078 | Ga0501038_0017078_1971_2579 | 202 |
| 760 | 3300049574 | Ga0501038_0124817 | Ga0501038_0124817_1039_1647 | 202 |
| 761 | 3300049574 | Ga0501038_0162407 | Ga0501038_0162407_710_1318 | 202 |
| 762 | 3300049574 | Ga0501038_0185717 | Ga0501038_0185717_1022_1630 | 202 |
| 763 | 3300049575 | Ga0501039_0006453 | Ga0501039_0006453_6480_7088 | 202 |
| 764 | 3300049575 | Ga0501039_0094817 | Ga0501039_0094817_1274_1882 | 202 |
| 765 | 3300049575 | Ga0501039_0173660 | Ga0501039_0173660_1039_1647 | 202 |
| 766 | 3300049576 | Ga0501040_0059511 | Ga0501040_0059511_957_1565 | 202 |
| 767 | 3300049577 | Ga0501041_0115755 | Ga0501041_0115755_506_1114 | 202 |
| 768 | 3300049577 | Ga0501041_0124805 | Ga0501041_0124805_499_1107 | 202 |
| 769 | 3300049578 | Ga0501042_0010829 | Ga0501042_0010829_4108_4716 | 202 |
| 770 | 3300049578 | Ga0501042_0306328 | Ga0501042_0306328_528_1136 | 202 |
| 771 | 3300049578 | Ga0501042_0609811 | Ga0501042_0609811_45_653 | 202 |
| 772 | 3300049579 | Ga0501043_0009493 | Ga0501043_0009493_4789_5397 | 202 |
| 773 | 3300049579 | Ga0501043_0107537 | Ga0501043_0107537_1570_2178 | 202 |
| 774 | 3300049579 | Ga0501043_0127453 | Ga0501043_0127453_1097_1705 | 202 |
| 775 | 3300049579 | Ga0501043_0232314 | Ga0501043_0232314_490_1098 | 202 |
| 776 | 3300049579 | Ga0501043_0375178 | Ga0501043_0375178_110_718 | 202 |
| 777 | 3300049580 | Ga0501046_0011234 | Ga0501046_0011234_3776_4384 | 202 |
| 778 | 3300049580 | Ga0501046_0012369 | Ga0501046_0012369_6553_7161 | 202 |
| 779 | 3300049580 | Ga0501046_0036451 | Ga0501046_0036451_1174_1782 | 202 |
| 780 | 3300049580 | Ga0501046_0120977 | Ga0501046_0120977_707_1315 | 202 |
| 781 | 3300049580 | Ga0501046_0238617 | Ga0501046_0238617_371_979 | 202 |
| 782 | 3300049581 | Ga0501047_0084506 | Ga0501047_0084506_215_823 | 202 |
| 783 | 3300049581 | Ga0501047_0180578 | Ga0501047_0180578_35_643 | 202 |
| 784 | 3300049581 | Ga0501047_0183263 | Ga0501047_0183263_330_938 | 202 |
| 785 | 3300049581 | Ga0501047_0186509 | Ga0501047_0186509_229_837 | 202 |
| 786 | 3300049581 | Ga0501047_0227279 | Ga0501047_0227279_23_631 | 202 |
| 787 | 3300049581 | Ga0501047_0381294 | Ga0501047_0381294_615_1223 | 202 |
| 788 | 3300049581 | Ga0501047_0430356 | Ga0501047_0430356_206_814 | 202 |
| 789 | 3300049582 | Ga0501048_0073468 | Ga0501048_0073468_436_1044 | 202 |
| 790 | 3300049582 | Ga0501048_0197293 | Ga0501048_0197293_608_1216 | 202 |
| 791 | 3300049583 | Ga0501067_0008905 | Ga0501067_0008905_2672_3280 | 202 |
| 792 | 3300049583 | Ga0501067_0083746 | Ga0501067_0083746_92_700 | 202 |
| 793 | 3300049584 | Ga0501068_0033304 | Ga0501068_0033304_1411_2019 | 202 |
| 794 | 3300049584 | Ga0501068_0060477 | Ga0501068_0060477_1456_2064 | 202 |
| 795 | 3300049584 | Ga0501068_0077477 | Ga0501068_0077477_995_1603 | 202 |
| 796 | 3300049584 | Ga0501068_0310137 | Ga0501068_0310137_295_903 | 202 |
| 797 | 3300049585 | Ga0501069_0059634 | Ga0501069_0059634_246_854 | 202 |
| 798 | 3300049585 | Ga0501069_0061227 | Ga0501069_0061227_1357_1965 | 202 |
| 799 | 3300049586 | Ga0501070_0025427 | Ga0501070_0025427_821_1429 | 202 |
| 800 | 3300049586 | Ga0501070_0173313 | Ga0501070_0173313_1015_1623 | 202 |
| 801 | 3300049586 | Ga0501070_0722157 | Ga0501070_0722157_89_697 | 202 |
| 802 | 3300049586 | Ga0501070_0997429 | Ga0501070_0997429_14_622 | 202 |
| 803 | 3300049587 | Ga0501071_0062939 | Ga0501071_0062939_1714_2322 | 202 |
| 804 | 3300049589 | Ga0501073_0036008 | Ga0501073_0036008_139_747 | 202 |
| 805 | 3300049589 | Ga0501073_0198639 | Ga0501073_0198639_485_1099 | 202 |
| 806 | 3300049589 | Ga0501073_0225265 | Ga0501073_0225265_354_962 | 202 |
| 807 | 3300049589 | Ga0501073_0708173 | Ga0501073_0708173_51_659 | 202 |
| 808 | 3300049590 | Ga0501074_0041848 | Ga0501074_0041848_2348_2956 | 202 |
| 809 | 3300049592 | Ga0501076_0072201 | Ga0501076_0072201_1053_1661 | 202 |
| 810 | 3300049592 | Ga0501076_0588593 | Ga0501076_0588593_110_718 | 202 |
| 811 | 3300049741 | Ga0501079_0055313 | Ga0501079_0055313_814_1422 | 202 |
| 812 | 3300049742 | Ga0501080_0079464 | Ga0501080_0079464_1692_2300 | 202 |
| 813 | 3300049742 | Ga0501080_0241801 | Ga0501080_0241801_51_659 | 202 |
| 814 | 3300049742 | Ga0501080_0323017 | Ga0501080_0323017_258_866 | 202 |
| 815 | 3300049742 | Ga0501080_0356239 | Ga0501080_0356239_239_847 | 202 |
| 816 | 3300049742 | Ga0501080_0588663 | Ga0501080_0588663_218_826 | 202 |
| 817 | 3300049743 | Ga0501081_0735241 | Ga0501081_0735241_90_698 | 202 |
| 818 | 3300049744 | Ga0501083_0019398 | Ga0501083_0019398_2909_3517 | 202 |
| 819 | 3300049822 | Ga0501035_0005535 | Ga0501035_0005535_3576_4184 | 202 |
| 820 | 3300049822 | Ga0501035_0089419 | Ga0501035_0089419_2054_2662 | 202 |
| 821 | 3300049822 | Ga0501035_0393301 | Ga0501035_0393301_385_993 | 202 |
| 822 | 3300049822 | Ga0501035_0487840 | Ga0501035_0487840_360_968 | 202 |
| 823 | 3300049823 | Ga0501044_0000266 | Ga0501044_0000266_1465_2082 | 202 |
| 824 | 3300049823 | Ga0501044_0086969 | Ga0501044_0086969_198_806 | 202 |
| 825 | 3300049823 | Ga0501044_0087043 | Ga0501044_0087043_1798_2406 | 202 |
| 826 | 3300049823 | Ga0501044_0154144 | Ga0501044_0154144_991_1599 | 202 |
| 827 | 3300049823 | Ga0501044_0184866 | Ga0501044_0184866_658_1266 | 202 |
| 828 | 3300049823 | Ga0501044_0221756 | Ga0501044_0221756_93_701 | 202 |
| 829 | 3300049824 | Ga0501045_0061052 | Ga0501045_0061052_991_1599 | 202 |
| 830 | 3300049824 | Ga0501045_0506427 | Ga0501045_0506427_114_722 | 202 |
| 831 | 3300049824 | Ga0501045_0654631 | Ga0501045_0654631_134_742 | 202 |
| 832 | 3300050489 | nmdc:mga03683_35414_c1 | nmdc:mga03683_35414_c1_664_1272 | 202 |
| 833 | 3300050489 | nmdc:mga03683_59279_c1 | nmdc:mga03683_59279_c1_970_1596 | 202 |
| 834 | 3300050490 | nmdc:mga03n38_184883_c1 | nmdc:mga03n38_184883_c1_438_1052 | 202 |
| 835 | 3300050491 | nmdc:mga00v17_181630_c1 | nmdc:mga00v17_181630_c1_591_1199 | 202 |
| 836 | 3300050491 | nmdc:mga00v17_212175_c1 | nmdc:mga00v17_212175_c1_453_1079 | 202 |
| 837 | 3300050491 | nmdc:mga00v17_63879_c2 | nmdc:mga00v17_63879_c2_114_728 | 202 |
| 838 | 3300050492 | nmdc:mga0yw44_152509_c1 | nmdc:mga0yw44_152509_c1_502_1116 | 202 |
| 839 | 3300050492 | nmdc:mga0yw44_255443_c1 | nmdc:mga0yw44_255443_c1_192_800 | 202 |
| 840 | 3300050492 | nmdc:mga0yw44_467598_c1 | nmdc:mga0yw44_467598_c1_84_692 | 202 |
| 841 | 3300050492 | nmdc:mga0yw44_71145_c1 | nmdc:mga0yw44_71145_c1_263_871 | 202 |
| 842 | 3300050492 | nmdc:mga0yw44_7902_c1 | nmdc:mga0yw44_7902_c1_4282_4890 | 202 |
| 843 | 3300050493 | nmdc:mga0k408_588395_c1 | nmdc:mga0k408_588395_c1_17_625 | 202 |
| 844 | 3300050494 | nmdc:mga06z11_396588_c1 | nmdc:mga06z11_396588_c1_56_664 | 202 |
| 845 | 3300050494 | nmdc:mga06z11_44141_c1 | nmdc:mga06z11_44141_c1_757_1371 | 202 |
| 846 | 3300050494 | nmdc:mga06z11_86718_c1 | nmdc:mga06z11_86718_c1_155_763 | 202 |
| 847 | 3300050495 | nmdc:mga04h51_70975_c1 | nmdc:mga04h51_70975_c1_413_1039 | 202 |
| 848 | 3300050496 | nmdc:mga07m45_45396_c1 | nmdc:mga07m45_45396_c1_840_1454 | 202 |
| 849 | 3300050514 | nmdc:mga08x19_723900_c1 | nmdc:mga08x19_723900_c1_74_682 | 202 |
| 850 | 3300050515 | nmdc:mga0a205_708126_c1 | nmdc:mga0a205_708126_c1_82_690 | 202 |
| 851 | 3300050516 | nmdc:mga0sz30_18667_c1 | nmdc:mga0sz30_18667_c1_1795_2409 | 202 |
| 852 | 3300050516 | nmdc:mga0sz30_220165_c1 | nmdc:mga0sz30_220165_c1_71_679 | 202 |
| 853 | 3300050516 | nmdc:mga0sz30_296678_c1 | nmdc:mga0sz30_296678_c1_28_654 | 202 |
| 854 | 3300053078 | Ga0495612_0140110 | Ga0495612_0140110_291_917 | 202 |
| 855 | 3300053080 | Ga0500635_0060880 | Ga0500635_0060880_610_1236 | 202 |
| 856 | 3300053084 | Ga0495595_0046790 | Ga0495595_0046790_336_962 | 202 |
| 857 | 3300053085 | Ga0495619_0093254 | Ga0495619_0093254_485_1111 | 202 |
| 858 | 3300053087 | Ga0500643_000057 | Ga0500643_000057_33286_33894 | 202 |
| 859 | 3300053087 | Ga0500643_036668 | Ga0500643_036668_393_1001 | 202 |
| 860 | 3300053093 | Ga0500651_0041183 | Ga0500651_0041183_810_1418 | 202 |
| 861 | 3300053094 | Ga0500566_0001388 | Ga0500566_0001388_7000_7608 | 202 |
| 862 | 3300053096 | Ga0500641_0076207 | Ga0500641_0076207_537_1145 | 202 |
| 863 | 3300053096 | Ga0500641_0095981 | Ga0500641_0095981_621_1229 | 202 |
| 864 | 3300053103 | Ga0500555_016297 | Ga0500555_016297_1142_1750 | 202 |
| 865 | 3300053104 | Ga0500556_0221039 | Ga0500556_0221039_76_684 | 202 |
| 866 | 3300053105 | Ga0500557_000225 | Ga0500557_000225_1285_1893 | 202 |
| 867 | 3300053108 | Ga0500562_027780 | Ga0500562_027780_672_1280 | 202 |
| 868 | 3300053109 | Ga0500569_124764 | Ga0500569_124764_164_772 | 202 |
| 869 | 3300053116 | Ga0500592_030897 | Ga0500592_030897_98_706 | 202 |
| 870 | 3300053119 | Ga0500595_021149 | Ga0500595_021149_850_1458 | 202 |
| 871 | 3300053119 | Ga0500595_029690 | Ga0500595_029690_400_1008 | 202 |
| 872 | 3300053120 | Ga0500597_166784 | Ga0500597_166784_13_621 | 202 |
| 873 | 3300053126 | Ga0500621_093921 | Ga0500621_093921_31_639 | 202 |
| 874 | 3300053126 | Ga0500621_210666 | Ga0500621_210666_33_641 | 202 |
| 875 | 3300053130 | Ga0500642_0000740 | Ga0500642_0000740_7985_8593 | 202 |
| 876 | 3300053130 | Ga0500642_0008396 | Ga0500642_0008396_2100_2708 | 202 |
| 877 | 3300053134 | Ga0500658_0245689 | Ga0500658_0245689_10_618 | 202 |
| 878 | 3300053136 | Ga0500559_0009353 | Ga0500559_0009353_321_947 | 202 |
| 879 | 3300053142 | Ga0500577_0097649 | Ga0500577_0097649_543_1151 | 202 |
| 880 | 3300053142 | Ga0500577_0200872 | Ga0500577_0200872_34_642 | 202 |
| 881 | 3300053146 | Ga0500588_0025909 | Ga0500588_0025909_169_777 | 202 |
| 882 | 3300053147 | Ga0500589_163993 | Ga0500589_163993_60_668 | 202 |
| 883 | 3300053150 | Ga0500603_001521 | Ga0500603_001521_3176_3802 | 202 |
| 884 | 3300053161 | Ga0500634_0079239 | Ga0500634_0079239_253_861 | 202 |
| 885 | 3300053178 | Ga0500637_0065890 | Ga0500637_0065890_1093_1719 | 202 |
| 886 | 3300053724 | Ga0500570_024854 | Ga0500570_024854_1276_1884 | 202 |
| 887 | 3300053729 | Ga0500625_015449 | Ga0500625_015449_805_1413 | 202 |
| 888 | 3300053730 | Ga0500645_017168 | Ga0500645_017168_1436_2062 | 202 |
| 889 | 3300053731 | Ga0500609_008934 | Ga0500609_008934_698_1306 | 202 |
| 890 | 3300053737 | Ga0500601_001283 | Ga0500601_001283_872_1498 | 202 |
| 891 | 3300054114 | Ga0501084_0071584 | Ga0501084_0071584_1247_1855 | 202 |
| 892 | 3300054114 | Ga0501084_0137721 | Ga0501084_0137721_783_1391 | 202 |
| 893 | 3300060353 | Ga0501082_0094831 | Ga0501082_0094831_853_1461 | 202 |
| 894 | 3300060353 | Ga0501082_0212829 | Ga0501082_0212829_740_1348 | 202 |
| 895 | 3300060353 | Ga0501082_0446640 | Ga0501082_0446640_229_837 | 202 |
| 896 | iso_pu_bacteria | 2874604998 | 2874612650 | 202 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xi3-assembly1.cif.gz_B | thiamine phosphate pyrophosphorylase from pyrococcus furiosus pfu-1255191-001 | 0.8698 | 6 | 200 |
| 1g67-assembly1.cif.gz_A | thiamin phosphate synthase | 0.8636 | 7 | 200 |
| 1g4t-assembly1.cif.gz_A | thiamin phosphate synthase | 0.86 | 7 | 200 |
| 1g67-assembly1.cif.gz_A | thiamin phosphate synthase | 0.8284 | 7 | 200 |
| 1g4p-assembly1.cif.gz_A | thiamin phosphate synthase | 0.8252 | 7 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P30137_10_206_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9629 | 7 | 196 | 3.20.20.70 |
| af_P30137_10_206_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.925 | 7 | 196 | 3.20.20.70 |
| af_Q2FWG3_1_212_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8742 | 6 | 196 | 3.20.20.70 |
| 1xi3B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8698 | 6 | 200 | 3.20.20.70 |
| af_A0A1D6MYJ2_339_548_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.86 | 7 | 199 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H0TEU9-F1-model_v4 | Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) | 0.9964 | 1 | 202 |
GO:0000287
GO:0004789 GO:0005737 GO:0009228 GO:0009229 |
| AF-H0SSH3-F1-model_v4 | Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) | 0.996 | 1 | 198 |
GO:0000287
GO:0004789 GO:0005737 GO:0009228 GO:0009229 |
| AF-A0A1W9ILI2-F1-model_v4 | Thiamine-phosphate synthase (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) | 0.9951 | 1 | 202 |
GO:0004789
GO:0005737 GO:0009228 GO:0009229 GO:0046872 |
| AF-A0A023XMX1-F1-model_v4 | deleted | 0.9949 | 1 | 196 |
|
| AF-A0A3S0E386-F1-model_v4 | deleted | 0.9947 | 1 | 198 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar