F485004

General Info

Members Datasets Scaffolds Average Seq Length
896 394 1786 302

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100004487|Ga0070699_10000448711
Length 341
Sequence MDGNEGIGCTRREFVGRTALVLAAGALASAVPRAARVASAEQGNVIPIEFMSKGVRCRGLKYIPDDLRAGGRRPAIVMAHGFSAVKEMYFTNYAEEFRRAGLVAVLFDYRYLGESGGEPRGQVLPFEQIEDYRNAITFAQTQPEVDPEKIGVFGSSYSGGHVIVVGAVDRRVKCVASQVPYLDGWATADALNTKTGIDGFVKFLEGDRSERYKSGRVNYLPVVAADGNAVLNTQTSYQWFTETAKKMAPRWENRVTVESLEWLFLYHPVLFVPKVSPTPLLIVVAENDELVPTEVTLRAYNGALEPKKIVIVPGGHFDAYVKGFPVSSRAATAWFTQWLKG

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
101 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
102 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
183 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
184 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
185 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
195 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
196 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
197 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
200 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
201 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
207 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
215 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
216 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
217 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
218 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
226 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
232 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
233 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
234 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
235 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
236 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
237 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
240 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
243 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
244 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
245 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
246 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
264 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
267 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
281 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
284 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
285 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
286 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
287 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
288 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
289 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
290 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
291 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
292 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
293 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
294 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
295 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
296 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
297 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
298 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
299 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
300 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
301 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
302 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
303 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
304 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
305 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
325 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
339 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
340 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
341 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
342 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
343 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
344 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
345 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
346 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
347 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
348 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
349 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
353 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
354 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
355 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
356 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
357 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
358 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
359 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
360 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
361 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
362 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
363 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
364 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
367 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
368 2519899620 Rhizobium sp. Pop5 Isolate Nodule
369 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
370 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
371 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
372 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
373 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
374 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
375 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
376 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
377 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
378 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
379 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
380 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
381 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
382 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
383 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
384 2838061910 Rhizobium phaseoli L15 Isolate Nodule
385 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
386 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
387 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
388 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
389 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
390 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
391 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
392 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
393 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
394 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.09
Metatranscriptomes 0.67
Isolates 3.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 2.68
Rhizoplane 4.35
Rhizosphere 90.4
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100004487 3300005518 Bacteria 12349
2 JGI25407J50210_10033097 3300003373 Bacteria 1335
3 JGI25404J52841_10016018 3300003659 Bacteria 1626
4 Ga0065714_10064488 3300005288 Bacteria 50757
5 Ga0070658_10044196 3300005327 Bacteria 3600
6 Ga0070683_100069142 3300005329 Bacteria 3291
7 Ga0070690_100137485 3300005330 Bacteria 1656
8 Ga0070690_100249112 3300005330 Bacteria 1256
9 Ga0068869_100010792 3300005334 Bacteria 5969
10 Ga0068869_100017165 3300005334 Bacteria 4899
11 Ga0070682_100085427 3300005337 Bacteria 2053
12 Ga0070682_100260966 3300005337 Bacteria 1254
13 Ga0068868_100049779 3300005338 Bacteria 3288
14 Ga0068868_100102203 3300005338 Bacteria 2321
15 Ga0068868_100139737 3300005338 Bacteria 1987
16 Ga0070660_100110427 3300005339 Bacteria 2187
17 Ga0070660_100212352 3300005339 Bacteria 1571
18 Ga0070689_100192148 3300005340 Bacteria 1663
19 Ga0070689_100274564 3300005340 Bacteria 1396
20 Ga0070691_10094271 3300005341 Bacteria 1479
21 Ga0070691_10100528 3300005341 Bacteria 1436
22 Ga0070687_100021534 3300005343 Bacteria 3033
23 Ga0070661_100201543 3300005344 Bacteria 1521
24 Ga0070661_100251876 3300005344 Bacteria 1363
25 Ga0070669_100326364 3300005353 Bacteria 1241
26 Ga0070669_100478132 3300005353 Bacteria 1030
27 Ga0070675_100222727 3300005354 Bacteria 1643
28 Ga0070671_100119557 3300005355 Bacteria 2217
29 Ga0070671_100278399 3300005355 Bacteria 1423
30 Ga0070674_100042793 3300005356 Bacteria 3078
31 Ga0070674_100073239 3300005356 Bacteria 2427
32 Ga0070673_100179484 3300005364 Bacteria 1812
33 Ga0070659_100243969 3300005366 Bacteria 1487
34 Ga0070667_100050321 3300005367 Bacteria 3511
35 Ga0070703_10005742 3300005406 Bacteria 3475
36 Ga0070703_10037325 3300005406 Bacteria 1497
37 Ga0070709_10000496 3300005434 Bacteria 23223
38 Ga0070709_10040329 3300005434 Bacteria 2870
39 Ga0070714_100001238 3300005435 Bacteria 18416
40 Ga0070714_100015331 3300005435 Bacteria 6167
41 Ga0070714_100045294 3300005435 Bacteria 3728
42 Ga0070714_100079343 3300005435 Bacteria 2854
43 Ga0070714_100096627 3300005435 Bacteria 2596
44 Ga0070714_100215790 3300005435 Bacteria 1761
45 Ga0070713_100000944 3300005436 Bacteria 18579
46 Ga0070713_100503841 3300005436 Bacteria 1143
47 Ga0070710_10000118 3300005437 Bacteria 37278
48 Ga0070710_10009882 3300005437 Bacteria 4677
49 Ga0070710_10098838 3300005437 Bacteria 1734
50 Ga0070710_10101197 3300005437 Bacteria 1716
51 Ga0070701_10178762 3300005438 Bacteria 1240
52 Ga0070711_100002360 3300005439 Bacteria 10737
53 Ga0070711_100059222 3300005439 Bacteria 2658
54 Ga0070711_100223794 3300005439 Bacteria 1464
55 Ga0070711_100242638 3300005439 Bacteria 1409
56 Ga0070711_100260594 3300005439 Bacteria 1364
57 Ga0070705_100145214 3300005440 Bacteria 1566
58 Ga0070700_100041275 3300005441 Bacteria 2828
59 Ga0070700_100203392 3300005441 Bacteria 1392
60 Ga0070694_100337821 3300005444 Bacteria 1164
61 Ga0070708_100045027 3300005445 Bacteria 3885
62 Ga0070708_100053865 3300005445 Bacteria 3572
63 Ga0070708_100096805 3300005445 Bacteria 2696
64 Ga0070663_100026750 3300005455 Bacteria 3910
65 Ga0070663_100068412 3300005455 Bacteria 2578
66 Ga0070663_100070226 3300005455 Bacteria 2546
67 Ga0070678_100244096 3300005456 Bacteria 1503
68 Ga0070678_100264280 3300005456 Bacteria 1448
69 Ga0070662_100022030 3300005457 Bacteria 4357
70 Ga0070662_100067850 3300005457 Bacteria 2620
71 Ga0070662_100283197 3300005457 Bacteria 1342
72 Ga0070681_10015427 3300005458 Bacteria 7606
73 Ga0070681_10077661 3300005458 Bacteria 3278
74 Ga0070681_10461428 3300005458 Bacteria 1182
75 Ga0068867_100085865 3300005459 Bacteria 2380
76 Ga0068867_100131368 3300005459 Bacteria 1946
77 Ga0070685_10225494 3300005466 Bacteria 1230
78 Ga0070706_100000149 3300005467 Bacteria 89007
79 Ga0070706_100007316 3300005467 Bacteria 10358
80 Ga0070706_100055140 3300005467 Bacteria 3669
81 Ga0070706_100065035 3300005467 Bacteria 3372
82 Ga0070706_100076714 3300005467 Bacteria 3093
83 Ga0070706_100268544 3300005467 Bacteria 1592
84 Ga0070707_100018717 3300005468 Bacteria 6519
85 Ga0070707_100324042 3300005468 Bacteria 1497
86 Ga0070698_100000884 3300005471 Bacteria 32963
87 Ga0070698_100018754 3300005471 Bacteria 7283
88 Ga0070698_100052216 3300005471 Bacteria 4160
89 Ga0070698_100065588 3300005471 Bacteria 3655
90 Ga0070699_100015634 3300005518 Bacteria 6519
91 Ga0070699_100165682 3300005518 Bacteria 1957
92 Ga0070679_100019594 3300005530 Bacteria 6583
93 Ga0070679_100546029 3300005530 Bacteria 1102
94 Ga0070684_100048522 3300005535 Bacteria 3683
95 Ga0070684_100129915 3300005535 Bacteria 2272
96 Ga0070684_100144787 3300005535 Bacteria 2150
97 Ga0070684_100234587 3300005535 Bacteria 1676
98 Ga0070684_100245578 3300005535 Bacteria 1636
99 Ga0070684_100287154 3300005535 Bacteria 1508
100 Ga0070697_100006268 3300005536 Bacteria 9209
101 Ga0070697_100057955 3300005536 Bacteria 3151
102 Ga0070697_100106631 3300005536 Bacteria 2331
103 Ga0068853_100473756 3300005539 Bacteria 1180
104 Ga0070672_100080295 3300005543 Bacteria 2613
105 Ga0070672_100365095 3300005543 Bacteria 1233
106 Ga0070695_100148228 3300005545 Bacteria 1635
107 Ga0070695_100209748 3300005545 Bacteria 1397
108 Ga0070696_100071444 3300005546 Bacteria 2442
109 Ga0070696_100071601 3300005546 Bacteria 2440
110 Ga0070693_100040960 3300005547 Bacteria 2603
111 Ga0070665_100136861 3300005548 Bacteria 2452
112 Ga0070704_100090954 3300005549 Bacteria 2274
113 Ga0070704_100365746 3300005549 Bacteria 1221
114 Ga0070704_100497786 3300005549 Bacteria 1057
115 Ga0068855_100084690 3300005563 Bacteria 3670
116 Ga0068855_100090424 3300005563 Bacteria 3533
117 Ga0068855_100156067 3300005563 Bacteria 2593
118 Ga0068855_100283344 3300005563 Bacteria 1839
119 Ga0068855_100538367 3300005563 Bacteria 1265
120 Ga0070664_100091530 3300005564 Bacteria 2632
121 Ga0068857_100479504 3300005577 Bacteria 1165
122 Ga0068857_100513623 3300005577 Bacteria 1125
123 Ga0068854_100149865 3300005578 Bacteria 1798
124 Ga0068856_100012742 3300005614 Bacteria 8141
125 Ga0068856_100339520 3300005614 Bacteria 1520
126 Ga0070702_100083932 3300005615 Bacteria 1914
127 Ga0070702_100141996 3300005615 Bacteria 1531
128 Ga0068852_100174825 3300005616 Bacteria 2015
129 Ga0068859_100009055 3300005617 Bacteria 10055
130 Ga0068859_100056371 3300005617 Bacteria 3954
131 Ga0068859_100113423 3300005617 Bacteria 2774
132 Ga0068864_100077034 3300005618 Bacteria 2915
133 Ga0068864_100191991 3300005618 Bacteria 1873
134 Ga0068864_100304684 3300005618 Bacteria 1492
135 Ga0068866_10157680 3300005718 Bacteria 1320
136 Ga0068866_10195038 3300005718 Bacteria 1206
137 Ga0068861_100073391 3300005719 Bacteria 2658
138 Ga0068861_100088615 3300005719 Bacteria 2437
139 Ga0068870_10197166 3300005840 Bacteria 1218
140 Ga0068863_100025751 3300005841 Bacteria 5611
141 Ga0068863_100343866 3300005841 Bacteria 1451
142 Ga0068858_100163325 3300005842 Bacteria 2097
143 Ga0068860_100316818 3300005843 Bacteria 1530
144 Ga0068860_100491332 3300005843 Bacteria 1224
145 Ga0068862_100041217 3300005844 Bacteria 3928
146 Ga0068862_100635150 3300005844 Bacteria 1028
147 Ga0081455_10033872 3300005937 Bacteria 4583
148 Ga0081455_10120187 3300005937 Bacteria 2071
149 Ga0081538_10000799 3300005981 Bacteria 34169
150 Ga0081538_10004349 3300005981 Bacteria 13082
151 Ga0081538_10006649 3300005981 Bacteria 10135
152 Ga0081538_10008135 3300005981 Bacteria 8946
153 Ga0081538_10015545 3300005981 Bacteria 5884
154 Ga0081538_10041385 3300005981 Bacteria 2925
155 Ga0081540_1002707 3300005983 Bacteria 14415
156 Ga0081540_1045742 3300005983 Bacteria 2218
157 Ga0070717_10000940 3300006028 Bacteria 19389
158 Ga0070717_10014268 3300006028 Bacteria 6110
159 Ga0070717_10114208 3300006028 Bacteria 2306
160 Ga0070717_10130253 3300006028 Bacteria 2163
161 Ga0070715_10002346 3300006163 Bacteria 5789
162 Ga0070715_10011075 3300006163 Bacteria 3235
163 Ga0070715_10027656 3300006163 Bacteria 2267
164 Ga0070715_10066592 3300006163 Bacteria 1597
165 Ga0070716_100000135 3300006173 Bacteria 29582
166 Ga0070716_100074001 3300006173 Bacteria 2011
167 Ga0070716_100095425 3300006173 Bacteria 1810
168 Ga0070716_100102757 3300006173 Bacteria 1756
169 Ga0070712_100002084 3300006175 Bacteria 12285
170 Ga0070712_100082843 3300006175 Bacteria 2327
171 Ga0070712_100273923 3300006175 Bacteria 1357
172 Ga0097621_100029089 3300006237 Bacteria 4361
173 Ga0097621_100069760 3300006237 Bacteria 2902
174 Ga0097621_100118806 3300006237 Bacteria 2241
175 Ga0068871_100120275 3300006358 Bacteria 2218
176 Ga0075428_100128048 3300006844 Unclassified 2762
177 Ga0075431_100204336 3300006847 Unclassified 2020
178 Ga0075434_100037748 3300006871 Bacteria 4783
179 Ga0075434_100446495 3300006871 Bacteria 1314
180 Ga0075429_100147457 3300006880 Bacteria 2060
181 Ga0068865_100264674 3300006881 Bacteria 1363
182 Ga0068865_100389707 3300006881 Bacteria 1138
183 Ga0097620_100009055 3300006931 Bacteria 10055
184 Ga0097620_100056374 3300006931 Bacteria 3954
185 Ga0097620_100113414 3300006931 Bacteria 2774
186 Ga0075435_100014105 3300007076 Bacteria 5963
187 Ga0099795_10042369 3300007788 Bacteria 1625
188 Ga0105251_10124069 3300009011 Bacteria 1172
189 Ga0105240_10465849 3300009093 Bacteria 1411
190 Ga0105240_10582259 3300009093 Bacteria 1234
191 Ga0111539_10099904 3300009094 Bacteria 3407
192 Ga0111539_10143364 3300009094 Unclassified 2796
193 Ga0105245_10055902 3300009098 Bacteria 3546
194 Ga0105245_10120442 3300009098 Bacteria 2451
195 Ga0105245_10238001 3300009098 Bacteria 1763
196 Ga0105245_10379643 3300009098 Bacteria 1407
197 Ga0105245_10417587 3300009098 Bacteria 1344
198 Ga0105247_10043647 3300009101 Bacteria 2748
199 Ga0105247_10085619 3300009101 Bacteria 1993
200 Ga0105247_10092612 3300009101 Bacteria 1920
201 Ga0105247_10199081 3300009101 Bacteria 1345
202 Ga0114129_10019373 3300009147 Bacteria 9691
203 Ga0114129_10068104 3300009147 Bacteria 4964
204 Ga0105243_10021830 3300009148 Bacteria 4860
205 Ga0105243_10053332 3300009148 Bacteria 3207
206 Ga0105243_10053889 3300009148 Bacteria 3191
207 Ga0105241_10142570 3300009174 Bacteria 1952
208 Ga0105241_10166641 3300009174 Bacteria 1816
209 Ga0105248_10022968 3300009177 Bacteria 6927
210 Ga0105248_10024179 3300009177 Bacteria 6752
211 Ga0105248_10178508 3300009177 Bacteria 2393
212 Ga0105237_10144090 3300009545 Bacteria 2377
213 Ga0105237_10242608 3300009545 Bacteria 1803
214 Ga0105237_10435784 3300009545 Bacteria 1316
215 Ga0105238_10264240 3300009551 Bacteria 1701
216 Ga0105238_10429023 3300009551 Bacteria 1317
217 Ga0105249_10041332 3300009553 Bacteria 4191
218 Ga0105249_10177789 3300009553 Bacteria 2068
219 Ga0105249_10337798 3300009553 Bacteria 1522
220 Ga0105239_10058076 3300010375 Bacteria 4245
221 Ga0105239_10143237 3300010375 Bacteria 2664
222 Ga0105239_10431872 3300010375 Bacteria 1493
223 Ga0105239_10827901 3300010375 Bacteria 1061
224 Ga0105246_10453403 3300011119 Bacteria 1078
225 Ga0157340_1002853 3300012473 Bacteria 911
226 Ga0157335_1003549 3300012492 Bacteria 1008
227 Ga0157339_1003929 3300012505 Bacteria 1100
228 Ga0157371_10237905 3300013102 Bacteria 1309
229 Ga0157370_10398503 3300013104 Bacteria 1267
230 Ga0157369_10240449 3300013105 Bacteria 1891
231 Ga0157374_10022843 3300013296 Bacteria 5586
232 Ga0157374_10028837 3300013296 Bacteria 5018
233 Ga0157374_10238213 3300013296 Bacteria 1789
234 Ga0163162_10236490 3300013306 Bacteria 1957
235 Ga0163162_10330763 3300013306 Bacteria 1656
236 Ga0157372_10125617 3300013307 Bacteria 2949
237 Ga0157372_10178822 3300013307 Bacteria 2455
238 Ga0157372_10559830 3300013307 Bacteria 1333
239 Ga0157375_10016093 3300013308 Bacteria 6710
240 Ga0157375_10036066 3300013308 Bacteria 4727
241 Ga0157375_10188051 3300013308 Bacteria 2219
242 Ga0163163_10066668 3300014325 Bacteria 3576
243 Ga0163163_10144868 3300014325 Bacteria 2419
244 Ga0157380_10067315 3300014326 Bacteria 2883
245 Ga0182008_10075339 3300014497 Bacteria 1660
246 Ga0157377_10171036 3300014745 Bacteria 1359
247 Ga0157379_10145255 3300014968 Bacteria 2139
248 Ga0157379_10209448 3300014968 Bacteria 1764
249 Ga0157379_10288808 3300014968 Bacteria 1493
250 Ga0157379_10566661 3300014968 Bacteria 1058
251 Ga0157376_10121694 3300014969 Bacteria 2314
252 Ga0157376_10206071 3300014969 Bacteria 1812
253 Ga0182005_1000222 3300015265 Bacteria 37589
254 Ga0163161_10268741 3300017792 Unclassified 1334
255 Ga0206351_10157124 3300020077 Bacteria 1688
256 Ga0206354_10659615 3300020081 Bacteria 1171
257 Ga0213873_10020569 3300021358 Bacteria 1543
258 Ga0213874_10069298 3300021377 Bacteria 1121
259 Ga0213875_10006446 3300021388 Bacteria 6158
260 Ga0213875_10104874 3300021388 Archaea 1320
261 Ga0213875_10125439 3300021388 Bacteria 1200
262 Ga0224712_10106508 3300022467 Bacteria 1197
263 Ga0224712_10107799 3300022467 Bacteria 1191
264 Ga0207656_10075084 3300025321 Bacteria 1509
265 Ga0207656_10079477 3300025321 Bacteria 1471
266 Ga0207692_10018518 3300025898 Bacteria 3128
267 Ga0207692_10059681 3300025898 Bacteria 1970
268 Ga0207692_10078569 3300025898 Bacteria 1758
269 Ga0207692_10168871 3300025898 Bacteria 1266
270 Ga0207710_10104803 3300025900 Bacteria 1338
271 Ga0207688_10005068 3300025901 Bacteria 7165
272 Ga0207688_10007486 3300025901 Bacteria 5938
273 Ga0207680_10105598 3300025903 Bacteria 1817
274 Ga0207680_10167817 3300025903 Bacteria 1476
275 Ga0207647_10108815 3300025904 Bacteria 1640
276 Ga0207647_10125230 3300025904 Bacteria 1512
277 Ga0207685_10002244 3300025905 Bacteria 4376
278 Ga0207685_10018726 3300025905 Bacteria 2266
279 Ga0207685_10074280 3300025905 Bacteria 1388
280 Ga0207685_10076049 3300025905 Bacteria 1376
281 Ga0207685_10080271 3300025905 Bacteria 1348
282 Ga0207699_10000190 3300025906 Bacteria 37336
283 Ga0207699_10006021 3300025906 Bacteria 5837
284 Ga0207699_10013972 3300025906 Bacteria 4125
285 Ga0207699_10022566 3300025906 Bacteria 3413
286 Ga0207699_10195853 3300025906 Bacteria 1366
287 Ga0207645_10021979 3300025907 Bacteria 4155
288 Ga0207643_10149108 3300025908 Bacteria 1401
289 Ga0207643_10194289 3300025908 Bacteria 1233
290 Ga0207705_10210882 3300025909 Bacteria 1473
291 Ga0207684_10000119 3300025910 Bacteria 144532
292 Ga0207684_10011069 3300025910 Bacteria 7899
293 Ga0207684_10011969 3300025910 Bacteria 7556
294 Ga0207684_10056413 3300025910 Bacteria 3332
295 Ga0207654_10233640 3300025911 Bacteria 1226
296 Ga0207707_10047800 3300025912 Bacteria 3726
297 Ga0207707_10066747 3300025912 Bacteria 3133
298 Ga0207693_10001809 3300025915 Bacteria 18749
299 Ga0207693_10013660 3300025915 Bacteria 6540
300 Ga0207693_10074854 3300025915 Bacteria 2651
301 Ga0207693_10191374 3300025915 Bacteria 1610
302 Ga0207663_10001409 3300025916 Bacteria 11149
303 Ga0207663_10004562 3300025916 Bacteria 6905
304 Ga0207663_10200213 3300025916 Bacteria 1440
305 Ga0207662_10064210 3300025918 Bacteria 2209
306 Ga0207662_10235780 3300025918 Bacteria 1196
307 Ga0207657_10010642 3300025919 Bacteria 9163
308 Ga0207657_10020943 3300025919 Bacteria 6170
309 Ga0207652_10067620 3300025921 Bacteria 3099
310 Ga0207652_10632170 3300025921 Bacteria 958
311 Ga0207646_10049126 3300025922 Bacteria 3779
312 Ga0207646_10070816 3300025922 Bacteria 3114
313 Ga0207646_10118464 3300025922 Bacteria 2378
314 Ga0207646_10165298 3300025922 Bacteria 1997
315 Ga0207681_10083898 3300025923 Bacteria 2257
316 Ga0207681_10223570 3300025923 Bacteria 1458
317 Ga0207687_10128130 3300025927 Bacteria 1909
318 Ga0207687_10314485 3300025927 Bacteria 1266
319 Ga0207700_10000043 3300025928 Bacteria 92646
320 Ga0207700_10101492 3300025928 Bacteria 2295
321 Ga0207700_10162419 3300025928 Bacteria 1856
322 Ga0207700_10230227 3300025928 Bacteria 1575
323 Ga0207700_10284075 3300025928 Bacteria 1424
324 Ga0207664_10000123 3300025929 Bacteria 68003
325 Ga0207664_10022951 3300025929 Bacteria 4668
326 Ga0207664_10023323 3300025929 Bacteria 4635
327 Ga0207664_10027592 3300025929 Bacteria 4306
328 Ga0207664_10076020 3300025929 Bacteria 2717
329 Ga0207664_10104882 3300025929 Bacteria 2341
330 Ga0207664_10175832 3300025929 Bacteria 1835
331 Ga0207664_10202807 3300025929 Bacteria 1713
332 Ga0207664_10336519 3300025929 Bacteria 1334
333 Ga0207644_10251668 3300025931 Bacteria 1410
334 Ga0207690_10126569 3300025932 Bacteria 1864
335 Ga0207706_10048647 3300025933 Bacteria 3749
336 Ga0207706_10074643 3300025933 Bacteria 2982
337 Ga0207706_10119859 3300025933 Bacteria 2313
338 Ga0207670_10157324 3300025936 Bacteria 1693
339 Ga0207670_10258556 3300025936 Bacteria 1349
340 Ga0207669_10017128 3300025937 Bacteria 3707
341 Ga0207704_10038204 3300025938 Unclassified 2782
342 Ga0207704_10173465 3300025938 Bacteria 1550
343 Ga0207704_10287333 3300025938 Bacteria 1253
344 Ga0207665_10000157 3300025939 Bacteria 46258
345 Ga0207665_10005348 3300025939 Bacteria 8576
346 Ga0207665_10019302 3300025939 Bacteria 4480
347 Ga0207665_10023765 3300025939 Bacteria 4037
348 Ga0207665_10048112 3300025939 Bacteria 2861
349 Ga0207665_10110236 3300025939 Bacteria 1933
350 Ga0207691_10045431 3300025940 Bacteria 4037
351 Ga0207691_10108567 3300025940 Bacteria 2469
352 Ga0207691_10178307 3300025940 Bacteria 1857
353 Ga0207711_10112570 3300025941 Bacteria 2422
354 Ga0207689_10003083 3300025942 Bacteria 15335
355 Ga0207689_10004491 3300025942 Bacteria 12645
356 Ga0207689_10019899 3300025942 Bacteria 5653
357 Ga0207689_10453665 3300025942 Bacteria 1072
358 Ga0207661_10088009 3300025944 Bacteria 2581
359 Ga0207679_10072368 3300025945 Bacteria 2603
360 Ga0207667_10380346 3300025949 Bacteria 1438
361 Ga0207651_10112719 3300025960 Bacteria 2045
362 Ga0207712_10076522 3300025961 Bacteria 2423
363 Ga0207712_10139952 3300025961 Bacteria 1856
364 Ga0207668_10047147 3300025972 Bacteria 2949
365 Ga0207658_10119055 3300025986 Bacteria 2102
366 Ga0207658_10171663 3300025986 Bacteria 1787
367 Ga0207677_10109046 3300026023 Bacteria 2057
368 Ga0207703_10523949 3300026035 Bacteria 1115
369 Ga0207678_10009116 3300026067 Bacteria 8738
370 Ga0207678_10055461 3300026067 Bacteria 3413
371 Ga0207708_10055642 3300026075 Bacteria 3016
372 Ga0207708_10059100 3300026075 Bacteria 2926
373 Ga0207708_10085776 3300026075 Bacteria 2423
374 Ga0207702_10111271 3300026078 Bacteria 2435
375 Ga0207641_10074329 3300026088 Bacteria 2931
376 Ga0207641_10079429 3300026088 Bacteria 2844
377 Ga0207641_10299232 3300026088 Bacteria 1519
378 Ga0207648_10024604 3300026089 Bacteria 5372
379 Ga0207648_10086218 3300026089 Bacteria 2740
380 Ga0207648_10287241 3300026089 Bacteria 1472
381 Ga0207676_10151114 3300026095 Bacteria 2000
382 Ga0207674_10019879 3300026116 Bacteria 7266
383 Ga0207674_10144296 3300026116 Bacteria 2340
384 Ga0207675_100084680 3300026118 Bacteria 2975
385 Ga0207675_100092165 3300026118 Bacteria 2850
386 Ga0207675_100107389 3300026118 Bacteria 2632
387 Ga0207675_100119529 3300026118 Bacteria 2492
388 Ga0207683_10079029 3300026121 Bacteria 2916
389 Ga0207683_10332448 3300026121 Bacteria 1393
390 Ga0207698_10333749 3300026142 Bacteria 1425
391 Ga0207698_10384319 3300026142 Bacteria 1336
392 Ga0207428_10117916 3300027907 Bacteria 2037
393 Ga0207428_10353865 3300027907 Bacteria 1080
394 Ga0268266_10096160 3300028379 Bacteria 2602
395 Ga0268266_10137374 3300028379 Bacteria 2191
396 Ga0268265_10044777 3300028380 Bacteria 3298
397 Ga0268265_10391322 3300028380 Bacteria 1282
398 Ga0268265_10655480 3300028380 Bacteria 1009
399 Ga0268264_10525656 3300028381 Bacteria 1157
400 Ga0265338_10002561 3300028800 Bacteria 26893
401 Ga0316575_10065491 3300031665 Bacteria 1455
402 Ga0316579_10052780 3300031691 Bacteria 1903
403 Ga0316576_10064216 3300031727 Bacteria 2696
404 Ga0316576_10079270 3300031727 Bacteria 2434
405 Ga0316576_10081853 3300031727 Unclassified 2396
406 Ga0316576_10194273 3300031727 Bacteria 1529
407 Ga0316576_10333179 3300031727 Bacteria 1131
408 Ga0316578_10010183 3300031728 Bacteria 4868
409 Ga0316578_10056587 3300031728 Bacteria 2303
410 Ga0307405_10027916 3300031731 Bacteria 3280
411 Ga0316577_10079541 3300031733 Bacteria 1831
412 Ga0307410_10111047 3300031852 Bacteria 1984
413 Ga0307410_10353248 3300031852 Bacteria 1175
414 Ga0307412_10250769 3300031911 Bacteria 1374
415 Ga0307409_100065011 3300031995 Bacteria 2868
416 Ga0307409_100243591 3300031995 Bacteria 1638
417 Ga0307416_100068345 3300032002 Bacteria 2935
418 Ga0307416_100070127 3300032002 Bacteria 2904
419 Ga0307416_100143419 3300032002 Bacteria 2176
420 Ga0307416_100517975 3300032002 Bacteria 1260
421 Ga0307411_10078299 3300032005 Unclassified 2266
422 Ga0307415_100059998 3300032126 Bacteria 2626
423 Ga0307415_100282037 3300032126 Bacteria 1367
424 Ga0316583_10049833 3300032133 Bacteria 1474
425 Ga0316585_10045036 3300032137 Bacteria 1410
426 Ga0316580_10027776 3300032139 Bacteria 1748
427 Ga0316588_1005050 3300033528 Unclassified 2543
428 Ga0316596_1042802 3300033541 Bacteria 1192
429 Ga0373926_0001226 3300035083 Bacteria 7711
430 Ga0373926_0020135 3300035083 Bacteria 2304
431 Ga0373928_0016167 3300035084 Bacteria 1525
432 Ga0373934_0008545 3300035086 Bacteria 3817
433 Ga0373934_0023732 3300035086 Bacteria 2371
434 Ga0373934_0032755 3300035086 Bacteria 2039
435 Ga0373934_0034592 3300035086 Bacteria 1986
436 Ga0373934_0039360 3300035086 Bacteria 1863
437 Ga0373944_0007930 3300035089 Bacteria 2860
438 Ga0373944_0070635 3300035089 Bacteria 1137
439 Ga0373923_0008131 3300035111 Bacteria 3724
440 Ga0373923_0158879 3300035111 Bacteria 1030
441 Ga0373932_0006677 3300035112 Bacteria 2735
442 Ga0373936_0000065 3300035113 Bacteria 50174
443 Ga0373936_0000557 3300035113 Bacteria 12798
444 Ga0373936_0012559 3300035113 Bacteria 3224
445 Ga0373936_0042807 3300035113 Bacteria 1818
446 Ga0373936_0043340 3300035113 Bacteria 1808
447 Ga0373945_0000072 3300035116 Bacteria 23111
448 Ga0373945_0008710 3300035116 Bacteria 3310
449 Ga0373945_0040060 3300035116 Bacteria 1690
450 Ga0373945_0061556 3300035116 Bacteria 1402
451 Ga0373953_0004979 3300035117 Bacteria 4280
452 Ga0373953_0061152 3300035117 Bacteria 1540
453 Ga0373954_0023538 3300035118 Bacteria 2801
454 Ga0373954_0033443 3300035118 Bacteria 2379
455 Ga0373954_0055836 3300035118 Bacteria 1858
456 Ga0373954_0078376 3300035118 Bacteria 1576
457 Ga0373954_0136716 3300035118 Bacteria 1194
458 Ga0373956_0092206 3300035119 Bacteria 1398
459 Ga0373956_0095251 3300035119 Bacteria 1376
460 Ga0373957_0007546 3300035120 Bacteria 3484
461 Ga0373957_0026354 3300035120 Bacteria 2102
462 Ga0373957_0081318 3300035120 Bacteria 1279
463 Ga0373957_0085663 3300035120 Bacteria 1247
464 Ga0373943_0003543 3300035170 Bacteria 7107
465 Ga0373943_0049116 3300035170 Bacteria 2069
466 Ga0373943_0145901 3300035170 Bacteria 1278
467 Ga0373943_0145939 3300035170 Bacteria 1278
468 Ga0373946_0003354 3300035171 Bacteria 5678
469 Ga0373955_0003475 3300035172 Bacteria 6925
470 Ga0373955_0010304 3300035172 Bacteria 4410
471 Ga0373955_0061214 3300035172 Bacteria 2078
472 Ga0373955_0099279 3300035172 Bacteria 1669
473 Ga0373942_0040111 3300035207 Bacteria 1276
474 Ga0373961_0006687 3300035241 Bacteria 2772
475 Ga0373962_0035861 3300035242 Bacteria 1379
476 Ga0316574_0047167 3300035398 Unclassified 2673
477 Ga0316574_0054507 3300035398 Bacteria 2497
478 Ga0316574_0084675 3300035398 Bacteria 2017
479 Ga0373924_0000934 3300035410 Bacteria 9213
480 Ga0373924_0077439 3300035410 Bacteria 1410
481 Ga0373931_0069933 3300035691 Bacteria 1913
482 Ga0373935_0002797 3300035692 Bacteria 10042
483 Ga0373935_0021735 3300035692 Bacteria 3928
484 Ga0373935_0147397 3300035692 Bacteria 1594
485 Ga0373935_0259466 3300035692 Bacteria 1218
486 Ga0373927_0000757 3300035695 Bacteria 24696
487 Ga0373933_0006242 3300035724 Bacteria 6488
488 Ga0373933_0021373 3300035724 Bacteria 3676
489 Ga0373933_0034669 3300035724 Bacteria 2942
490 Ga0373933_0138597 3300035724 Bacteria 1534
491 Ga0373947_0002870 3300035725 Bacteria 10298
492 Ga0373947_0034530 3300035725 Bacteria 2991
493 Ga0373947_0089365 3300035725 Bacteria 1918
494 Ga0373937_0020317 3300036401 Bacteria 5954
495 Ga0373937_0026714 3300036401 Bacteria 5216
496 Ga0373937_0040827 3300036401 Archaea 4230
497 Ga0373937_0056437 3300036401 Bacteria 3607
498 Ga0373937_0068122 3300036401 Bacteria 3280
499 Ga0373937_0124443 3300036401 Bacteria 2404
500 Ga0373937_0249136 3300036401 Bacteria 1674
501 Ga0316582_0410047 3300036647 Unclassified 933
502 Ga0316584_0001556 3300036712 Bacteria 13901
503 Ga0316584_0130188 3300036712 Bacteria 1880
504 Ga0373925_0001542 3300037068 Bacteria 19627
505 Ga0373925_0004939 3300037068 Bacteria 10025
506 Ga0373925_0032211 3300037068 Bacteria 3857
507 Ga0373925_0073413 3300037068 Bacteria 2589
508 Ga0373925_0113389 3300037068 Bacteria 2096
509 Ga0395900_0110620 3300037418 Bacteria 2822
510 Ga0395900_0546478 3300037418 Bacteria 1103
511 Ga0395898_0061886 3300037466 Bacteria 3636
512 Ga0395898_0448356 3300037466 Bacteria 1229
513 Ga0395905_0071919 3300037471 Bacteria 3242
514 Ga0395905_0231603 3300037471 Bacteria 1727
515 Ga0436364_0622553 3300037853 Bacteria 3854
516 Ga0436364_0623133 3300037853 Archaea 1834
517 Ga0436364_1481811 3300037853 Bacteria 16621
518 Ga0436364_1517018 3300037853 Bacteria 10872
519 Ga0395901_0103118 3300038443 Bacteria 2993
520 Ga0395901_0189924 3300038443 Bacteria 2154
521 Ga0400485_12647 3300038735 Bacteria 2973
522 Ga0400485_19114 3300038735 Bacteria 22750
523 Ga0400488_03612 3300038741 Bacteria 5905
524 Ga0400486_24978 3300038742 Bacteria 48837
525 Ga0400483_020888 3300039062 Unclassified 1346
526 Ga0400487_20151 3300039110 Bacteria 26068
527 Ga0436365_0829170 3300039437 Bacteria 2449
528 Ga0436365_1522245 3300039437 Bacteria 1607
529 Ga0436365_1737778 3300039437 Bacteria 2091
530 Ga0436360_0623051 3300039438 Bacteria 1914
531 Ga0436363_0113080 3300039450 Bacteria 6083
532 Ga0436363_0742947 3300039450 Bacteria 2116
533 Ga0436363_0782842 3300039450 Bacteria 1028
534 Ga0436363_0805767 3300039450 Bacteria 7445
535 Ga0436362_0489135 3300039453 Bacteria 2260
536 Ga0436362_0528474 3300039453 Bacteria 2861
537 Ga0439447_010395 3300041407 Bacteria 2763
538 Ga0439452_007039 3300042010 Bacteria 3471
539 Ga0450912_003295 3300042116 Bacteria 1142
540 Ga0466965_0131249 3300044683 Bacteria 1299
541 Ga0466961_0127447 3300044693 Bacteria 1596
542 Ga0453684_0044307 3300044712 Bacteria 5957
543 Ga0466960_0015328 3300044901 Bacteria 3302
544 Ga0466958_0069759 3300045836 Bacteria 2150
545 Ga0466958_0339689 3300045836 Bacteria 966
546 Ga0466967_0011688 3300045976 Bacteria 6672
547 Ga0466967_0040415 3300045976 Bacteria 4015
548 Ga0466967_0179943 3300045976 Bacteria 1994
549 Ga0466967_0316679 3300045976 Bacteria 1504
550 Ga0466967_0489438 3300045976 Bacteria 1206
551 Ga0495592_0015368 3300046454 Bacteria 5807
552 Ga0495603_0044256 3300046455 Bacteria 2656
553 Ga0495603_0096617 3300046455 Bacteria 1726
554 Ga0495603_0140146 3300046455 Bacteria 1407
555 Ga0495629_0006045 3300046459 Bacteria 8999
556 Ga0495629_0034919 3300046459 Bacteria 3554
557 Ga0495629_0164150 3300046459 Bacteria 1542
558 Ga0495629_0256140 3300046459 Bacteria 1203
559 Ga0495638_0001463 3300046460 Bacteria 21329
560 Ga0495638_0002853 3300046460 Bacteria 13853
561 Ga0495638_0263314 3300046460 Bacteria 944
562 Ga0495641_0000184 3300046461 Bacteria 48241
563 Ga0495641_0002737 3300046461 Bacteria 13675
564 Ga0495641_0009986 3300046461 Bacteria 5573
565 Ga0495651_0000215 3300046462 Bacteria 44284
566 Ga0495651_0000361 3300046462 Bacteria 34960
567 Ga0495651_0022089 3300046462 Bacteria 4947
568 Ga0495651_0025332 3300046462 Bacteria 4617
569 Ga0495651_0053944 3300046462 Bacteria 3093
570 Ga0495651_0075885 3300046462 Bacteria 2547
571 Ga0495653_0002705 3300046463 Bacteria 14128
572 Ga0495653_0011683 3300046463 Bacteria 7165
573 Ga0495653_0015829 3300046463 Bacteria 6147
574 Ga0495653_0043428 3300046463 Bacteria 3494
575 Ga0495650_0000625 3300046471 Bacteria 47624
576 Ga0495580_0076435 3300046472 Bacteria 2336
577 Ga0495580_0078645 3300046472 Bacteria 2300
578 Ga0495580_0378284 3300046472 Unclassified 957
579 Ga0495582_0000343 3300046473 Bacteria 25586
580 Ga0495582_0006812 3300046473 Bacteria 6359
581 Ga0495582_0020052 3300046473 Bacteria 3658
582 Ga0495605_0000270 3300046474 Bacteria 58922
583 Ga0495605_0002158 3300046474 Bacteria 12287
584 Ga0495639_0001940 3300046475 Bacteria 9183
585 Ga0495639_0020808 3300046475 Bacteria 2868
586 Ga0495639_0104774 3300046475 Bacteria 1338
587 Ga0495662_0000054 3300046476 Bacteria 39454
588 Ga0495662_0026504 3300046476 Bacteria 2798
589 Ga0495662_0155381 3300046476 Bacteria 1127
590 Ga0495664_0000832 3300046477 Bacteria 15798
591 Ga0495664_0074814 3300046477 Bacteria 2026
592 Ga0495664_0205500 3300046477 Bacteria 1193
593 Ga0495594_0080383 3300046499 Bacteria 1820
594 Ga0495594_0091456 3300046499 Bacteria 1705
595 Ga0495607_0021794 3300046501 Bacteria 4028
596 Ga0495606_0000437 3300046507 Bacteria 68999
597 Ga0495608_0006748 3300046511 Bacteria 8139
598 Ga0495608_0011312 3300046511 Bacteria 6213
599 Ga0495608_0017699 3300046511 Bacteria 4927
600 Ga0495608_0018722 3300046511 Archaea 4773
601 Ga0495608_0026613 3300046511 Bacteria 3941
602 Ga0495608_0026687 3300046511 Bacteria 3936
603 Ga0495618_0000626 3300046514 Bacteria 25051
604 Ga0495618_0003343 3300046514 Bacteria 10011
605 Ga0495618_0012306 3300046514 Bacteria 5193
606 Ga0495618_0021058 3300046514 Bacteria 4018
607 Ga0495618_0094167 3300046514 Archaea 1915
608 Ga0495628_0029143 3300046516 Archaea 4479
609 Ga0495628_0031776 3300046516 Bacteria 4267
610 Ga0495628_0139416 3300046516 Bacteria 1851
611 Ga0495628_0163693 3300046516 Bacteria 1689
612 Ga0495628_0187661 3300046516 Bacteria 1562
613 Ga0495628_0222175 3300046516 Bacteria 1418
614 Ga0495630_0000866 3300046517 Bacteria 21319
615 Ga0495630_0001781 3300046517 Bacteria 15069
616 Ga0495630_0022875 3300046517 Bacteria 4616
617 Ga0495632_0001430 3300046519 Bacteria 19886
618 Ga0495632_0002781 3300046519 Bacteria 12981
619 Ga0495643_0111516 3300046522 Bacteria 1390
620 Ga0495644_0000019 3300046523 Bacteria 84214
621 Ga0495648_0000469 3300046524 Bacteria 43478
622 Ga0495666_0000320 3300046526 Bacteria 20909
623 Ga0495652_0004006 3300046529 Bacteria 14254
624 Ga0495652_0009253 3300046529 Bacteria 8955
625 Ga0495652_0009760 3300046529 Bacteria 8708
626 Ga0495652_0035077 3300046529 Bacteria 4367
627 Ga0495652_0161930 3300046529 Bacteria 1736
628 Ga0495652_0273814 3300046529 Bacteria 1239
629 Ga0495665_0000427 3300046531 Bacteria 21447
630 Ga0495665_0005121 3300046531 Bacteria 7068
631 Ga0495665_0014015 3300046531 Bacteria 4330
632 Ga0495640_0036373 3300046533 Bacteria 3479
633 Ga0495640_0044927 3300046533 Bacteria 3067
634 Ga0495586_0031387 3300046535 Bacteria 2845
635 Ga0495586_0097081 3300046535 Bacteria 1632
636 Ga0495587_0003209 3300046536 Bacteria 10928
637 Ga0495587_0035946 3300046536 Bacteria 2982
638 Ga0495587_0060897 3300046536 Bacteria 2212
639 Ga0495645_0000167 3300046543 Bacteria 45640
640 Ga0495645_0036875 3300046543 Bacteria 3564
641 Ga0495645_0064470 3300046543 Bacteria 2651
642 Ga0495622_0040103 3300046557 Bacteria 2180
643 Ga0495667_0002767 3300046559 Bacteria 11705
644 Ga0495667_0006103 3300046559 Bacteria 8156
645 Ga0495667_0014062 3300046559 Bacteria 5401
646 Ga0495667_0020098 3300046559 Bacteria 4503
647 Ga0495667_0030652 3300046559 Archaea 3613
648 Ga0495634_0007772 3300046642 Bacteria 8020
649 Ga0495634_0013178 3300046642 Bacteria 5975
650 Ga0495634_0017131 3300046642 Bacteria 5174
651 Ga0495634_0021970 3300046642 Bacteria 4500
652 Ga0495634_0046066 3300046642 Bacteria 2944
653 Ga0495635_0000190 3300046663 Bacteria 38869
654 Ga0495635_0003200 3300046663 Bacteria 11286
655 Ga0495635_0006815 3300046663 Bacteria 7984
656 Ga0495635_0010731 3300046663 Bacteria 6416
657 Ga0495635_0011831 3300046663 Bacteria 6117
658 Ga0495635_0020663 3300046663 Bacteria 4586
659 Ga0495588_0036124 3300046674 Bacteria 2506
660 Ga0495657_0016521 3300046675 Bacteria 5377
661 Ga0495657_0041543 3300046675 Bacteria 3145
662 Ga0495657_0045429 3300046675 Bacteria 2980
663 Ga0495657_0048544 3300046675 Bacteria 2863
664 Ga0495657_0051060 3300046675 Bacteria 2778
665 Ga0495657_0082292 3300046675 Bacteria 2080
666 Ga0495657_0143749 3300046675 Bacteria 1485
667 Ga0495657_0266460 3300046675 Bacteria 1028
668 Ga0495599_0007441 3300046678 Bacteria 6641
669 Ga0495599_0013130 3300046678 Bacteria 5118
670 Ga0495599_0020971 3300046678 Bacteria 4074
671 Ga0495599_0033598 3300046678 Bacteria 3224
672 Ga0495599_0034575 3300046678 Bacteria 3174
673 Ga0495599_0061663 3300046678 Archaea 2343
674 Ga0495599_0090521 3300046678 Bacteria 1909
675 Ga0495599_0164099 3300046678 Bacteria 1372
676 Ga0495623_0025763 3300046679 Bacteria 3787
677 Ga0495623_0039843 3300046679 Bacteria 3002
678 Ga0495623_0079433 3300046679 Bacteria 2032
679 Ga0495623_0083946 3300046679 Bacteria 1966
680 Ga0495646_0011962 3300046680 Bacteria 5520
681 Ga0495646_0047786 3300046680 Bacteria 2603
682 Ga0495646_0158789 3300046680 Bacteria 1253
683 Ga0495646_0171341 3300046680 Bacteria 1196
684 Ga0495647_0003770 3300046681 Bacteria 4875
685 Ga0495647_0173985 3300046681 Bacteria 934
686 Ga0495658_0000340 3300046683 Bacteria 26360
687 Ga0495658_0076748 3300046683 Bacteria 1953
688 Ga0495658_0170341 3300046683 Bacteria 1347
689 Ga0495613_0005640 3300046689 Bacteria 9390
690 Ga0495613_0137910 3300046689 Bacteria 1744
691 Ga0495613_0300808 3300046689 Bacteria 1110
692 Ga0495624_0000442 3300046690 Bacteria 32670
693 Ga0495624_0000590 3300046690 Bacteria 28259
694 Ga0495624_0128967 3300046690 Bacteria 1551
695 Ga0495624_0174348 3300046690 Bacteria 1311
696 Ga0495624_0239046 3300046690 Bacteria 1099
697 Ga0495600_0000437 3300046809 Bacteria 21408
698 Ga0495600_0024484 3300046809 Bacteria 3886
699 Ga0495600_0054611 3300046809 Bacteria 2609
700 Ga0495581_0000704 3300047315 Bacteria 17572
701 Ga0495581_0006341 3300047315 Bacteria 6860
702 Ga0495604_0000286 3300047317 Bacteria 45196
703 Ga0495604_0059033 3300047317 Bacteria 2943
704 Ga0495604_0243376 3300047317 Bacteria 1229
705 Ga0495674_0001722 3300047319 Bacteria 21498
706 Ga0495674_0007339 3300047319 Bacteria 10538
707 Ga0495674_0016629 3300047319 Bacteria 6864
708 Ga0495674_0041539 3300047319 Bacteria 4107
709 Ga0495674_0059750 3300047319 Archaea 3329
710 Ga0495674_0389475 3300047319 Bacteria 1126
711 Ga0495676_0000478 3300047321 Bacteria 32779
712 Ga0495676_0005837 3300047321 Bacteria 11300
713 Ga0495676_0093045 3300047321 Bacteria 2249
714 Ga0495676_0141292 3300047321 Bacteria 1725
715 Ga0495676_0182385 3300047321 Bacteria 1470
716 Ga0495680_0002155 3300047322 Bacteria 20405
717 Ga0495680_0004262 3300047322 Bacteria 13733
718 Ga0495680_0005727 3300047322 Bacteria 11637
719 Ga0495680_0006558 3300047322 Bacteria 10801
720 Ga0495680_0009281 3300047322 Bacteria 8861
721 Ga0495680_0010122 3300047322 Bacteria 8431
722 Ga0495680_0019225 3300047322 Bacteria 5775
723 Ga0495680_0025076 3300047322 Bacteria 4939
724 Ga0495680_0032136 3300047322 Bacteria 4264
725 Ga0495680_0097794 3300047322 Bacteria 2190
726 Ga0495675_0009854 3300047444 Bacteria 5957
727 Ga0495675_0041659 3300047444 Bacteria 2926
728 Ga0495675_0054353 3300047444 Bacteria 2541
729 Ga0495675_0163424 3300047444 Bacteria 1370
730 Ga0495673_0026705 3300047469 Bacteria 2757
731 Ga0495681_0087787 3300047470 Bacteria 1378
732 Ga0495684_0003349 3300047471 Bacteria 12582
733 Ga0495684_0012238 3300047471 Bacteria 6619
734 Ga0495684_0026162 3300047471 Bacteria 4483
735 Ga0495684_0033620 3300047471 Bacteria 3932
736 Ga0495684_0064635 3300047471 Bacteria 2781
737 Ga0495684_0076312 3300047471 Bacteria 2545
738 Ga0495684_0252568 3300047471 Bacteria 1282
739 Ga0495684_0259062 3300047471 Bacteria 1262
740 Ga0495684_0315066 3300047471 Unclassified 1120
741 Ga0495593_0001228 3300047673 Bacteria 14990
742 Ga0495593_0008486 3300047673 Bacteria 5972
743 Ga0495593_0047643 3300047673 Bacteria 2279
744 Ga0495602_0005728 3300048088 Bacteria 13031
745 Ga0495602_0028054 3300048088 Bacteria 5397
746 Ga0495602_0028844 3300048088 Bacteria 5302
747 Ga0495602_0106811 3300048088 Bacteria 2284
748 Ga0495614_0012072 3300048089 Bacteria 3794
749 Ga0496100_0006354 3300048903 Bacteria 6438
750 Ga0496100_0198861 3300048903 Bacteria 1459
751 Ga0496101_0111906 3300048904 Bacteria 2056
752 Ga0496101_0147404 3300048904 Bacteria 1798
753 Ga0496102_0155758 3300048905 Bacteria 2148
754 Ga0496104_0009114 3300048907 Bacteria 8824
755 Ga0496104_0039441 3300048907 Bacteria 4422
756 Ga0496104_0220347 3300048907 Bacteria 1809
757 Ga0496104_0571422 3300048907 Bacteria 1041
758 Ga0496105_0003118 3300048908 Bacteria 12200
759 Ga0496105_0032854 3300048908 Bacteria 4258
760 Ga0496106_0114518 3300048909 Bacteria 2103
761 Ga0496106_0116666 3300048909 Bacteria 2083
762 Ga0496106_0132321 3300048909 Bacteria 1957
763 Ga0496106_0187207 3300048909 Bacteria 1645
764 Ga0496106_0206568 3300048909 Bacteria 1564
765 Ga0496107_0232322 3300048910 Bacteria 1372
766 Ga0496108_0015217 3300048911 Bacteria 6277
767 Ga0496108_0068466 3300048911 Bacteria 2995
768 Ga0496108_0252696 3300048911 Bacteria 1533
769 Ga0496109_0173558 3300048912 Bacteria 2023
770 Ga0496109_0183422 3300048912 Bacteria 1966
771 Ga0496109_0293601 3300048912 Bacteria 1532
772 Ga0496109_0341671 3300048912 Bacteria 1414
773 Ga0496109_0360656 3300048912 Bacteria 1373
774 Ga0496109_0398259 3300048912 Bacteria 1301
775 Ga0496110_0119797 3300048913 Bacteria 2371
776 Ga0496110_0125738 3300048913 Bacteria 2313
777 Ga0496111_0146050 3300048914 Bacteria 1753
778 Ga0496112_0001084 3300048915 Bacteria 20135
779 Ga0496112_0223214 3300048915 Bacteria 1840
780 Ga0496112_0585463 3300048915 Bacteria 1048
781 Ga0496113_0141423 3300048916 Bacteria 1894
782 Ga0496113_0166636 3300048916 Bacteria 1743
783 Ga0496114_0180263 3300048917 Bacteria 1845
784 Ga0496114_0230442 3300048917 Bacteria 1627
785 Ga0496114_0389139 3300048917 Bacteria 1235
786 Ga0496115_0216089 3300048918 Bacteria 1583
787 Ga0496115_0413081 3300048918 Bacteria 1094
788 Ga0496125_0000574 3300048928 Bacteria 62986
789 Ga0501031_0002065 3300049568 Bacteria 12646
790 Ga0501033_0055224 3300049570 Bacteria 2937
791 Ga0501034_0710891 3300049571 Bacteria 903
792 Ga0501036_0003896 3300049572 Bacteria 11974
793 Ga0501036_0035976 3300049572 Bacteria 4189
794 Ga0501036_0206738 3300049572 Bacteria 1650
795 Ga0501037_0012765 3300049573 Bacteria 6188
796 Ga0501038_0046127 3300049574 Bacteria 3779
797 Ga0501038_0220497 3300049574 Bacteria 1513
798 Ga0501039_0003050 3300049575 Bacteria 12529
799 Ga0501039_0046370 3300049575 Bacteria 3358
800 Ga0501040_0002380 3300049576 Bacteria 12085
801 Ga0501040_0006723 3300049576 Bacteria 7459
802 Ga0501040_0054555 3300049576 Bacteria 2740
803 Ga0501041_0000943 3300049577 Bacteria 15788
804 Ga0501041_0020859 3300049577 Bacteria 3922
805 Ga0501042_0000510 3300049578 Bacteria 20275
806 Ga0501042_0122988 3300049578 Bacteria 1868
807 Ga0501043_0038365 3300049579 Bacteria 3767
808 Ga0501043_0277043 3300049579 Bacteria 1286
809 Ga0501046_0000458 3300049580 Bacteria 40789
810 Ga0501046_0140984 3300049580 Bacteria 1824
811 Ga0501048_0039767 3300049582 Bacteria 3372
812 Ga0501048_0168988 3300049582 Bacteria 1548
813 Ga0501069_0139179 3300049585 Bacteria 1392
814 Ga0501071_0001850 3300049587 Bacteria 12553
815 Ga0501071_0076939 3300049587 Bacteria 2437
816 Ga0501072_0003100 3300049588 Bacteria 12525
817 Ga0501073_0142916 3300049589 Bacteria 1658
818 Ga0501074_0002795 3300049590 Bacteria 12214
819 Ga0501074_0010061 3300049590 Bacteria 6866
820 Ga0501075_0009015 3300049591 Bacteria 6962
821 Ga0501075_0040749 3300049591 Bacteria 3479
822 Ga0501075_0113719 3300049591 Bacteria 2058
823 Ga0501076_0004485 3300049592 Bacteria 9942
824 Ga0501076_0155011 3300049592 Bacteria 1864
825 Ga0501077_0001971 3300049593 Bacteria 12410
826 Ga0501079_0000220 3300049741 Bacteria 33882
827 Ga0501079_0050886 3300049741 Bacteria 3197
828 Ga0501079_0063185 3300049741 Bacteria 2857
829 Ga0501080_0087479 3300049742 Bacteria 2895
830 Ga0501080_0139279 3300049742 Bacteria 2244
831 Ga0501081_0002486 3300049743 Bacteria 11617
832 Ga0501081_0076693 3300049743 Bacteria 2334
833 Ga0501083_0198691 3300049744 Bacteria 1308
834 Ga0501035_0122930 3300049822 Bacteria 2267
835 Ga0501044_0211018 3300049823 Bacteria 1896
836 Ga0501045_0002537 3300049824 Bacteria 12438
837 Ga0501045_0006419 3300049824 Bacteria 8144
838 Ga0501045_0314685 3300049824 Bacteria 1165
839 nmdc:mga06r32_613022_c1 3300050510 Bacteria 1058
840 nmdc:mga08y16_196436_c1 3300050511 Bacteria 2091
841 nmdc:mga08y16_84408_c1 3300050511 Bacteria 3310
842 nmdc:mga0n895_11002_c1 3300050512 Bacteria 8042
843 nmdc:mga0rr50_18597_c1 3300050513 Bacteria 4672
844 Ga0495601_0001416 3300053077 Bacteria 13210
845 Ga0495601_0071886 3300053077 Bacteria 2209
846 Ga0495601_0095577 3300053077 Bacteria 1916
847 Ga0495601_0215658 3300053077 Bacteria 1253
848 Ga0495612_0004272 3300053078 Bacteria 5936
849 Ga0495612_0072580 3300053078 Bacteria 1437
850 Ga0495595_0001306 3300053084 Bacteria 9700
851 Ga0495595_0008392 3300053084 Bacteria 4240
852 Ga0495595_0032570 3300053084 Bacteria 2348
853 Ga0495619_0004523 3300053085 Bacteria 8879
854 Ga0495619_0072249 3300053085 Bacteria 2310
855 Ga0495619_0075126 3300053085 Bacteria 2267
856 Ga0495619_0162790 3300053085 Bacteria 1541
857 Ga0501084_0001665 3300054114 Bacteria 17665
858 Ga0501084_0003268 3300054114 Bacteria 13111
859 Ga0590071_004517 3300059421 Bacteria 3376
860 Ga0590074_010613 3300059423 Bacteria 1539
861 Ga0590077_003016 3300059426 Bacteria 3525
862 Ga0501082_0003933 3300060353 Bacteria 12961
863 Ga0501082_0082026 3300060353 Bacteria 2782
864 Ga0530510_0002641 3300061734 Bacteria 12323
865 2509112777 2508501122 Bacteria 6292184
866 2520375493 2519899620 Bacteria 6499161
867 2524454203 2524023207 Bacteria 6813453
868 2524454399 2524023207 Bacteria 6813453
869 2623500827 2622736605 Bacteria 4992138
870 2719669013 2718217997 Bacteria 6740740
871 2720489707 2718218199 Bacteria 6740745
872 2720610439 2718218232 Bacteria 6720332
873 2720628983 2718218235 Bacteria 6630699
874 2720772968 2718218269 Bacteria 6906114
875 2723030394 2721755556 Bacteria 6745503
876 2723564756 2721755684 Bacteria 6859907
877 2723570277 2721755685 Bacteria 6704835
878 2724092997 2721755819 Bacteria 6906405
879 2724101824 2721755822 Bacteria 6726041
880 2724113379 2721755823 Bacteria 6752556
881 2730110927 2728369352 Bacteria 6745171
882 2838045419 2838042994 Bacteria 6046894
883 2838064502 2838061910 Bacteria 6794874
884 2842265619 2842264693 Bacteria 6472963
885 2842428331 2842428310 Bacteria 6767288
886 2842434945 2842434925 Bacteria 6502746
887 2842442193 2842441272 Bacteria 6769273
888 2842469277 2842469257 Bacteria 6752936
889 2856288248 2856287931 Bacteria 7223934
890 2883294553 2883291878 Bacteria 5894118
891 8005286014 8005282627 Bacteria 6675747
892 8005624463 8005619151 Bacteria 7030230
893 8054473621 8054472261 Bacteria 7464355
894 Ga0070699_100004487
895 JGI25407J50210_10033097
896 JGI25404J52841_10016018
897 Ga0065714_10064488
898 Ga0070658_10044196
899 Ga0070683_100069142
900 Ga0070690_100137485
901 Ga0070690_100249112
902 Ga0068869_100010792
903 Ga0068869_100017165
904 Ga0070682_100085427
905 Ga0070682_100260966
906 Ga0068868_100049779
907 Ga0068868_100102203
908 Ga0068868_100139737
909 Ga0070660_100110427
910 Ga0070660_100212352
911 Ga0070689_100192148
912 Ga0070689_100274564
913 Ga0070691_10094271
914 Ga0070691_10100528
915 Ga0070687_100021534
916 Ga0070661_100201543
917 Ga0070661_100251876
918 Ga0070669_100326364
919 Ga0070669_100478132
920 Ga0070675_100222727
921 Ga0070671_100119557
922 Ga0070671_100278399
923 Ga0070674_100042793
924 Ga0070674_100073239
925 Ga0070673_100179484
926 Ga0070659_100243969
927 Ga0070667_100050321
928 Ga0070703_10005742
929 Ga0070703_10037325
930 Ga0070709_10000496
931 Ga0070709_10040329
932 Ga0070714_100001238
933 Ga0070714_100015331
934 Ga0070714_100045294
935 Ga0070714_100079343
936 Ga0070714_100096627
937 Ga0070714_100215790
938 Ga0070713_100000944
939 Ga0070713_100503841
940 Ga0070710_10000118
941 Ga0070710_10009882
942 Ga0070710_10098838
943 Ga0070710_10101197
944 Ga0070701_10178762
945 Ga0070711_100002360
946 Ga0070711_100059222
947 Ga0070711_100223794
948 Ga0070711_100242638
949 Ga0070711_100260594
950 Ga0070705_100145214
951 Ga0070700_100041275
952 Ga0070700_100203392
953 Ga0070694_100337821
954 Ga0070708_100045027
955 Ga0070708_100053865
956 Ga0070708_100096805
957 Ga0070663_100026750
958 Ga0070663_100068412
959 Ga0070663_100070226
960 Ga0070678_100244096
961 Ga0070678_100264280
962 Ga0070662_100022030
963 Ga0070662_100067850
964 Ga0070662_100283197
965 Ga0070681_10015427
966 Ga0070681_10077661
967 Ga0070681_10461428
968 Ga0068867_100085865
969 Ga0068867_100131368
970 Ga0070685_10225494
971 Ga0070706_100000149
972 Ga0070706_100007316
973 Ga0070706_100055140
974 Ga0070706_100065035
975 Ga0070706_100076714
976 Ga0070706_100268544
977 Ga0070707_100018717
978 Ga0070707_100324042
979 Ga0070698_100000884
980 Ga0070698_100018754
981 Ga0070698_100052216
982 Ga0070698_100065588
983 Ga0070699_100015634
984 Ga0070699_100165682
985 Ga0070679_100019594
986 Ga0070679_100546029
987 Ga0070684_100048522
988 Ga0070684_100129915
989 Ga0070684_100144787
990 Ga0070684_100234587
991 Ga0070684_100245578
992 Ga0070684_100287154
993 Ga0070697_100006268
994 Ga0070697_100057955
995 Ga0070697_100106631
996 Ga0068853_100473756
997 Ga0070672_100080295
998 Ga0070672_100365095
999 Ga0070695_100148228
1000 Ga0070695_100209748
1001 Ga0070696_100071444
1002 Ga0070696_100071601
1003 Ga0070693_100040960
1004 Ga0070665_100136861
1005 Ga0070704_100090954
1006 Ga0070704_100365746
1007 Ga0070704_100497786
1008 Ga0068855_100084690
1009 Ga0068855_100090424
1010 Ga0068855_100156067
1011 Ga0068855_100283344
1012 Ga0068855_100538367
1013 Ga0070664_100091530
1014 Ga0068857_100479504
1015 Ga0068857_100513623
1016 Ga0068854_100149865
1017 Ga0068856_100012742
1018 Ga0068856_100339520
1019 Ga0070702_100083932
1020 Ga0070702_100141996
1021 Ga0068852_100174825
1022 Ga0068859_100009055
1023 Ga0068859_100056371
1024 Ga0068859_100113423
1025 Ga0068864_100077034
1026 Ga0068864_100191991
1027 Ga0068864_100304684
1028 Ga0068866_10157680
1029 Ga0068866_10195038
1030 Ga0068861_100073391
1031 Ga0068861_100088615
1032 Ga0068870_10197166
1033 Ga0068863_100025751
1034 Ga0068863_100343866
1035 Ga0068858_100163325
1036 Ga0068860_100316818
1037 Ga0068860_100491332
1038 Ga0068862_100041217
1039 Ga0068862_100635150
1040 Ga0081455_10033872
1041 Ga0081455_10120187
1042 Ga0081538_10000799
1043 Ga0081538_10004349
1044 Ga0081538_10006649
1045 Ga0081538_10008135
1046 Ga0081538_10015545
1047 Ga0081538_10041385
1048 Ga0081540_1002707
1049 Ga0081540_1045742
1050 Ga0070717_10000940
1051 Ga0070717_10014268
1052 Ga0070717_10114208
1053 Ga0070717_10130253
1054 Ga0070715_10002346
1055 Ga0070715_10011075
1056 Ga0070715_10027656
1057 Ga0070715_10066592
1058 Ga0070716_100000135
1059 Ga0070716_100074001
1060 Ga0070716_100095425
1061 Ga0070716_100102757
1062 Ga0070712_100002084
1063 Ga0070712_100082843
1064 Ga0070712_100273923
1065 Ga0097621_100029089
1066 Ga0097621_100069760
1067 Ga0097621_100118806
1068 Ga0068871_100120275
1069 Ga0075428_100128048
1070 Ga0075431_100204336
1071 Ga0075434_100037748
1072 Ga0075434_100446495
1073 Ga0075429_100147457
1074 Ga0068865_100264674
1075 Ga0068865_100389707
1076 Ga0097620_100009055
1077 Ga0097620_100056374
1078 Ga0097620_100113414
1079 Ga0075435_100014105
1080 Ga0099795_10042369
1081 Ga0105251_10124069
1082 Ga0105240_10465849
1083 Ga0105240_10582259
1084 Ga0111539_10099904
1085 Ga0111539_10143364
1086 Ga0105245_10055902
1087 Ga0105245_10120442
1088 Ga0105245_10238001
1089 Ga0105245_10379643
1090 Ga0105245_10417587
1091 Ga0105247_10043647
1092 Ga0105247_10085619
1093 Ga0105247_10092612
1094 Ga0105247_10199081
1095 Ga0114129_10019373
1096 Ga0114129_10068104
1097 Ga0105243_10021830
1098 Ga0105243_10053332
1099 Ga0105243_10053889
1100 Ga0105241_10142570
1101 Ga0105241_10166641
1102 Ga0105248_10022968
1103 Ga0105248_10024179
1104 Ga0105248_10178508
1105 Ga0105237_10144090
1106 Ga0105237_10242608
1107 Ga0105237_10435784
1108 Ga0105238_10264240
1109 Ga0105238_10429023
1110 Ga0105249_10041332
1111 Ga0105249_10177789
1112 Ga0105249_10337798
1113 Ga0105239_10058076
1114 Ga0105239_10143237
1115 Ga0105239_10431872
1116 Ga0105239_10827901
1117 Ga0105246_10453403
1118 Ga0157340_1002853
1119 Ga0157335_1003549
1120 Ga0157339_1003929
1121 Ga0157371_10237905
1122 Ga0157370_10398503
1123 Ga0157369_10240449
1124 Ga0157374_10022843
1125 Ga0157374_10028837
1126 Ga0157374_10238213
1127 Ga0163162_10236490
1128 Ga0163162_10330763
1129 Ga0157372_10125617
1130 Ga0157372_10178822
1131 Ga0157372_10559830
1132 Ga0157375_10016093
1133 Ga0157375_10036066
1134 Ga0157375_10188051
1135 Ga0163163_10066668
1136 Ga0163163_10144868
1137 Ga0157380_10067315
1138 Ga0182008_10075339
1139 Ga0157377_10171036
1140 Ga0157379_10145255
1141 Ga0157379_10209448
1142 Ga0157379_10288808
1143 Ga0157379_10566661
1144 Ga0157376_10121694
1145 Ga0157376_10206071
1146 Ga0182005_1000222
1147 Ga0163161_10268741
1148 Ga0206351_10157124
1149 Ga0206354_10659615
1150 Ga0213873_10020569
1151 Ga0213874_10069298
1152 Ga0213875_10006446
1153 Ga0213875_10104874
1154 Ga0213875_10125439
1155 Ga0224712_10106508
1156 Ga0224712_10107799
1157 Ga0207656_10075084
1158 Ga0207656_10079477
1159 Ga0207692_10018518
1160 Ga0207692_10059681
1161 Ga0207692_10078569
1162 Ga0207692_10168871
1163 Ga0207710_10104803
1164 Ga0207688_10005068
1165 Ga0207688_10007486
1166 Ga0207680_10105598
1167 Ga0207680_10167817
1168 Ga0207647_10108815
1169 Ga0207647_10125230
1170 Ga0207685_10002244
1171 Ga0207685_10018726
1172 Ga0207685_10074280
1173 Ga0207685_10076049
1174 Ga0207685_10080271
1175 Ga0207699_10000190
1176 Ga0207699_10006021
1177 Ga0207699_10013972
1178 Ga0207699_10022566
1179 Ga0207699_10195853
1180 Ga0207645_10021979
1181 Ga0207643_10149108
1182 Ga0207643_10194289
1183 Ga0207705_10210882
1184 Ga0207684_10000119
1185 Ga0207684_10011069
1186 Ga0207684_10011969
1187 Ga0207684_10056413
1188 Ga0207654_10233640
1189 Ga0207707_10047800
1190 Ga0207707_10066747
1191 Ga0207693_10001809
1192 Ga0207693_10013660
1193 Ga0207693_10074854
1194 Ga0207693_10191374
1195 Ga0207663_10001409
1196 Ga0207663_10004562
1197 Ga0207663_10200213
1198 Ga0207662_10064210
1199 Ga0207662_10235780
1200 Ga0207657_10010642
1201 Ga0207657_10020943
1202 Ga0207652_10067620
1203 Ga0207652_10632170
1204 Ga0207646_10049126
1205 Ga0207646_10070816
1206 Ga0207646_10118464
1207 Ga0207646_10165298
1208 Ga0207681_10083898
1209 Ga0207681_10223570
1210 Ga0207687_10128130
1211 Ga0207687_10314485
1212 Ga0207700_10000043
1213 Ga0207700_10101492
1214 Ga0207700_10162419
1215 Ga0207700_10230227
1216 Ga0207700_10284075
1217 Ga0207664_10000123
1218 Ga0207664_10022951
1219 Ga0207664_10023323
1220 Ga0207664_10027592
1221 Ga0207664_10076020
1222 Ga0207664_10104882
1223 Ga0207664_10175832
1224 Ga0207664_10202807
1225 Ga0207664_10336519
1226 Ga0207644_10251668
1227 Ga0207690_10126569
1228 Ga0207706_10048647
1229 Ga0207706_10074643
1230 Ga0207706_10119859
1231 Ga0207670_10157324
1232 Ga0207670_10258556
1233 Ga0207669_10017128
1234 Ga0207704_10038204
1235 Ga0207704_10173465
1236 Ga0207704_10287333
1237 Ga0207665_10000157
1238 Ga0207665_10005348
1239 Ga0207665_10019302
1240 Ga0207665_10023765
1241 Ga0207665_10048112
1242 Ga0207665_10110236
1243 Ga0207691_10045431
1244 Ga0207691_10108567
1245 Ga0207691_10178307
1246 Ga0207711_10112570
1247 Ga0207689_10003083
1248 Ga0207689_10004491
1249 Ga0207689_10019899
1250 Ga0207689_10453665
1251 Ga0207661_10088009
1252 Ga0207679_10072368
1253 Ga0207667_10380346
1254 Ga0207651_10112719
1255 Ga0207712_10076522
1256 Ga0207712_10139952
1257 Ga0207668_10047147
1258 Ga0207658_10119055
1259 Ga0207658_10171663
1260 Ga0207677_10109046
1261 Ga0207703_10523949
1262 Ga0207678_10009116
1263 Ga0207678_10055461
1264 Ga0207708_10055642
1265 Ga0207708_10059100
1266 Ga0207708_10085776
1267 Ga0207702_10111271
1268 Ga0207641_10074329
1269 Ga0207641_10079429
1270 Ga0207641_10299232
1271 Ga0207648_10024604
1272 Ga0207648_10086218
1273 Ga0207648_10287241
1274 Ga0207676_10151114
1275 Ga0207674_10019879
1276 Ga0207674_10144296
1277 Ga0207675_100084680
1278 Ga0207675_100092165
1279 Ga0207675_100107389
1280 Ga0207675_100119529
1281 Ga0207683_10079029
1282 Ga0207683_10332448
1283 Ga0207698_10333749
1284 Ga0207698_10384319
1285 Ga0207428_10117916
1286 Ga0207428_10353865
1287 Ga0268266_10096160
1288 Ga0268266_10137374
1289 Ga0268265_10044777
1290 Ga0268265_10391322
1291 Ga0268265_10655480
1292 Ga0268264_10525656
1293 Ga0265338_10002561
1294 Ga0316575_10065491
1295 Ga0316579_10052780
1296 Ga0316576_10064216
1297 Ga0316576_10079270
1298 Ga0316576_10081853
1299 Ga0316576_10194273
1300 Ga0316576_10333179
1301 Ga0316578_10010183
1302 Ga0316578_10056587
1303 Ga0307405_10027916
1304 Ga0316577_10079541
1305 Ga0307410_10111047
1306 Ga0307410_10353248
1307 Ga0307412_10250769
1308 Ga0307409_100065011
1309 Ga0307409_100243591
1310 Ga0307416_100068345
1311 Ga0307416_100070127
1312 Ga0307416_100143419
1313 Ga0307416_100517975
1314 Ga0307411_10078299
1315 Ga0307415_100059998
1316 Ga0307415_100282037
1317 Ga0316583_10049833
1318 Ga0316585_10045036
1319 Ga0316580_10027776
1320 Ga0316588_1005050
1321 Ga0316596_1042802
1322 Ga0373926_0001226
1323 Ga0373926_0020135
1324 Ga0373928_0016167
1325 Ga0373934_0008545
1326 Ga0373934_0023732
1327 Ga0373934_0032755
1328 Ga0373934_0034592
1329 Ga0373934_0039360
1330 Ga0373944_0007930
1331 Ga0373944_0070635
1332 Ga0373923_0008131
1333 Ga0373923_0158879
1334 Ga0373932_0006677
1335 Ga0373936_0000065
1336 Ga0373936_0000557
1337 Ga0373936_0012559
1338 Ga0373936_0042807
1339 Ga0373936_0043340
1340 Ga0373945_0000072
1341 Ga0373945_0008710
1342 Ga0373945_0040060
1343 Ga0373945_0061556
1344 Ga0373953_0004979
1345 Ga0373953_0061152
1346 Ga0373954_0023538
1347 Ga0373954_0033443
1348 Ga0373954_0055836
1349 Ga0373954_0078376
1350 Ga0373954_0136716
1351 Ga0373956_0092206
1352 Ga0373956_0095251
1353 Ga0373957_0007546
1354 Ga0373957_0026354
1355 Ga0373957_0081318
1356 Ga0373957_0085663
1357 Ga0373943_0003543
1358 Ga0373943_0049116
1359 Ga0373943_0145901
1360 Ga0373943_0145939
1361 Ga0373946_0003354
1362 Ga0373955_0003475
1363 Ga0373955_0010304
1364 Ga0373955_0061214
1365 Ga0373955_0099279
1366 Ga0373942_0040111
1367 Ga0373961_0006687
1368 Ga0373962_0035861
1369 Ga0316574_0047167
1370 Ga0316574_0054507
1371 Ga0316574_0084675
1372 Ga0373924_0000934
1373 Ga0373924_0077439
1374 Ga0373931_0069933
1375 Ga0373935_0002797
1376 Ga0373935_0021735
1377 Ga0373935_0147397
1378 Ga0373935_0259466
1379 Ga0373927_0000757
1380 Ga0373933_0006242
1381 Ga0373933_0021373
1382 Ga0373933_0034669
1383 Ga0373933_0138597
1384 Ga0373947_0002870
1385 Ga0373947_0034530
1386 Ga0373947_0089365
1387 Ga0373937_0020317
1388 Ga0373937_0026714
1389 Ga0373937_0040827
1390 Ga0373937_0056437
1391 Ga0373937_0068122
1392 Ga0373937_0124443
1393 Ga0373937_0249136
1394 Ga0316582_0410047
1395 Ga0316584_0001556
1396 Ga0316584_0130188
1397 Ga0373925_0001542
1398 Ga0373925_0004939
1399 Ga0373925_0032211
1400 Ga0373925_0073413
1401 Ga0373925_0113389
1402 Ga0395900_0110620
1403 Ga0395900_0546478
1404 Ga0395898_0061886
1405 Ga0395898_0448356
1406 Ga0395905_0071919
1407 Ga0395905_0231603
1408 Ga0436364_0622553
1409 Ga0436364_0623133
1410 Ga0436364_1481811
1411 Ga0436364_1517018
1412 Ga0395901_0103118
1413 Ga0395901_0189924
1414 Ga0400485_12647
1415 Ga0400485_19114
1416 Ga0400488_03612
1417 Ga0400486_24978
1418 Ga0400483_020888
1419 Ga0400487_20151
1420 Ga0436365_0829170
1421 Ga0436365_1522245
1422 Ga0436365_1737778
1423 Ga0436360_0623051
1424 Ga0436363_0113080
1425 Ga0436363_0742947
1426 Ga0436363_0782842
1427 Ga0436363_0805767
1428 Ga0436362_0489135
1429 Ga0436362_0528474
1430 Ga0439447_010395
1431 Ga0439452_007039
1432 Ga0450912_003295
1433 Ga0466965_0131249
1434 Ga0466961_0127447
1435 Ga0453684_0044307
1436 Ga0466960_0015328
1437 Ga0466958_0069759
1438 Ga0466958_0339689
1439 Ga0466967_0011688
1440 Ga0466967_0040415
1441 Ga0466967_0179943
1442 Ga0466967_0316679
1443 Ga0466967_0489438
1444 Ga0495592_0015368
1445 Ga0495603_0044256
1446 Ga0495603_0096617
1447 Ga0495603_0140146
1448 Ga0495629_0006045
1449 Ga0495629_0034919
1450 Ga0495629_0164150
1451 Ga0495629_0256140
1452 Ga0495638_0001463
1453 Ga0495638_0002853
1454 Ga0495638_0263314
1455 Ga0495641_0000184
1456 Ga0495641_0002737
1457 Ga0495641_0009986
1458 Ga0495651_0000215
1459 Ga0495651_0000361
1460 Ga0495651_0022089
1461 Ga0495651_0025332
1462 Ga0495651_0053944
1463 Ga0495651_0075885
1464 Ga0495653_0002705
1465 Ga0495653_0011683
1466 Ga0495653_0015829
1467 Ga0495653_0043428
1468 Ga0495650_0000625
1469 Ga0495580_0076435
1470 Ga0495580_0078645
1471 Ga0495580_0378284
1472 Ga0495582_0000343
1473 Ga0495582_0006812
1474 Ga0495582_0020052
1475 Ga0495605_0000270
1476 Ga0495605_0002158
1477 Ga0495639_0001940
1478 Ga0495639_0020808
1479 Ga0495639_0104774
1480 Ga0495662_0000054
1481 Ga0495662_0026504
1482 Ga0495662_0155381
1483 Ga0495664_0000832
1484 Ga0495664_0074814
1485 Ga0495664_0205500
1486 Ga0495594_0080383
1487 Ga0495594_0091456
1488 Ga0495607_0021794
1489 Ga0495606_0000437
1490 Ga0495608_0006748
1491 Ga0495608_0011312
1492 Ga0495608_0017699
1493 Ga0495608_0018722
1494 Ga0495608_0026613
1495 Ga0495608_0026687
1496 Ga0495618_0000626
1497 Ga0495618_0003343
1498 Ga0495618_0012306
1499 Ga0495618_0021058
1500 Ga0495618_0094167
1501 Ga0495628_0029143
1502 Ga0495628_0031776
1503 Ga0495628_0139416
1504 Ga0495628_0163693
1505 Ga0495628_0187661
1506 Ga0495628_0222175
1507 Ga0495630_0000866
1508 Ga0495630_0001781
1509 Ga0495630_0022875
1510 Ga0495632_0001430
1511 Ga0495632_0002781
1512 Ga0495643_0111516
1513 Ga0495644_0000019
1514 Ga0495648_0000469
1515 Ga0495666_0000320
1516 Ga0495652_0004006
1517 Ga0495652_0009253
1518 Ga0495652_0009760
1519 Ga0495652_0035077
1520 Ga0495652_0161930
1521 Ga0495652_0273814
1522 Ga0495665_0000427
1523 Ga0495665_0005121
1524 Ga0495665_0014015
1525 Ga0495640_0036373
1526 Ga0495640_0044927
1527 Ga0495586_0031387
1528 Ga0495586_0097081
1529 Ga0495587_0003209
1530 Ga0495587_0035946
1531 Ga0495587_0060897
1532 Ga0495645_0000167
1533 Ga0495645_0036875
1534 Ga0495645_0064470
1535 Ga0495622_0040103
1536 Ga0495667_0002767
1537 Ga0495667_0006103
1538 Ga0495667_0014062
1539 Ga0495667_0020098
1540 Ga0495667_0030652
1541 Ga0495634_0007772
1542 Ga0495634_0013178
1543 Ga0495634_0017131
1544 Ga0495634_0021970
1545 Ga0495634_0046066
1546 Ga0495635_0000190
1547 Ga0495635_0003200
1548 Ga0495635_0006815
1549 Ga0495635_0010731
1550 Ga0495635_0011831
1551 Ga0495635_0020663
1552 Ga0495588_0036124
1553 Ga0495657_0016521
1554 Ga0495657_0041543
1555 Ga0495657_0045429
1556 Ga0495657_0048544
1557 Ga0495657_0051060
1558 Ga0495657_0082292
1559 Ga0495657_0143749
1560 Ga0495657_0266460
1561 Ga0495599_0007441
1562 Ga0495599_0013130
1563 Ga0495599_0020971
1564 Ga0495599_0033598
1565 Ga0495599_0034575
1566 Ga0495599_0061663
1567 Ga0495599_0090521
1568 Ga0495599_0164099
1569 Ga0495623_0025763
1570 Ga0495623_0039843
1571 Ga0495623_0079433
1572 Ga0495623_0083946
1573 Ga0495646_0011962
1574 Ga0495646_0047786
1575 Ga0495646_0158789
1576 Ga0495646_0171341
1577 Ga0495647_0003770
1578 Ga0495647_0173985
1579 Ga0495658_0000340
1580 Ga0495658_0076748
1581 Ga0495658_0170341
1582 Ga0495613_0005640
1583 Ga0495613_0137910
1584 Ga0495613_0300808
1585 Ga0495624_0000442
1586 Ga0495624_0000590
1587 Ga0495624_0128967
1588 Ga0495624_0174348
1589 Ga0495624_0239046
1590 Ga0495600_0000437
1591 Ga0495600_0024484
1592 Ga0495600_0054611
1593 Ga0495581_0000704
1594 Ga0495581_0006341
1595 Ga0495604_0000286
1596 Ga0495604_0059033
1597 Ga0495604_0243376
1598 Ga0495674_0001722
1599 Ga0495674_0007339
1600 Ga0495674_0016629
1601 Ga0495674_0041539
1602 Ga0495674_0059750
1603 Ga0495674_0389475
1604 Ga0495676_0000478
1605 Ga0495676_0005837
1606 Ga0495676_0093045
1607 Ga0495676_0141292
1608 Ga0495676_0182385
1609 Ga0495680_0002155
1610 Ga0495680_0004262
1611 Ga0495680_0005727
1612 Ga0495680_0006558
1613 Ga0495680_0009281
1614 Ga0495680_0010122
1615 Ga0495680_0019225
1616 Ga0495680_0025076
1617 Ga0495680_0032136
1618 Ga0495680_0097794
1619 Ga0495675_0009854
1620 Ga0495675_0041659
1621 Ga0495675_0054353
1622 Ga0495675_0163424
1623 Ga0495673_0026705
1624 Ga0495681_0087787
1625 Ga0495684_0003349
1626 Ga0495684_0012238
1627 Ga0495684_0026162
1628 Ga0495684_0033620
1629 Ga0495684_0064635
1630 Ga0495684_0076312
1631 Ga0495684_0252568
1632 Ga0495684_0259062
1633 Ga0495684_0315066
1634 Ga0495593_0001228
1635 Ga0495593_0008486
1636 Ga0495593_0047643
1637 Ga0495602_0005728
1638 Ga0495602_0028054
1639 Ga0495602_0028844
1640 Ga0495602_0106811
1641 Ga0495614_0012072
1642 Ga0496100_0006354
1643 Ga0496100_0198861
1644 Ga0496101_0111906
1645 Ga0496101_0147404
1646 Ga0496102_0155758
1647 Ga0496104_0009114
1648 Ga0496104_0039441
1649 Ga0496104_0220347
1650 Ga0496104_0571422
1651 Ga0496105_0003118
1652 Ga0496105_0032854
1653 Ga0496106_0114518
1654 Ga0496106_0116666
1655 Ga0496106_0132321
1656 Ga0496106_0187207
1657 Ga0496106_0206568
1658 Ga0496107_0232322
1659 Ga0496108_0015217
1660 Ga0496108_0068466
1661 Ga0496108_0252696
1662 Ga0496109_0173558
1663 Ga0496109_0183422
1664 Ga0496109_0293601
1665 Ga0496109_0341671
1666 Ga0496109_0360656
1667 Ga0496109_0398259
1668 Ga0496110_0119797
1669 Ga0496110_0125738
1670 Ga0496111_0146050
1671 Ga0496112_0001084
1672 Ga0496112_0223214
1673 Ga0496112_0585463
1674 Ga0496113_0141423
1675 Ga0496113_0166636
1676 Ga0496114_0180263
1677 Ga0496114_0230442
1678 Ga0496114_0389139
1679 Ga0496115_0216089
1680 Ga0496115_0413081
1681 Ga0496125_0000574
1682 Ga0501031_0002065
1683 Ga0501033_0055224
1684 Ga0501034_0710891
1685 Ga0501036_0003896
1686 Ga0501036_0035976
1687 Ga0501036_0206738
1688 Ga0501037_0012765
1689 Ga0501038_0046127
1690 Ga0501038_0220497
1691 Ga0501039_0003050
1692 Ga0501039_0046370
1693 Ga0501040_0002380
1694 Ga0501040_0006723
1695 Ga0501040_0054555
1696 Ga0501041_0000943
1697 Ga0501041_0020859
1698 Ga0501042_0000510
1699 Ga0501042_0122988
1700 Ga0501043_0038365
1701 Ga0501043_0277043
1702 Ga0501046_0000458
1703 Ga0501046_0140984
1704 Ga0501048_0039767
1705 Ga0501048_0168988
1706 Ga0501069_0139179
1707 Ga0501071_0001850
1708 Ga0501071_0076939
1709 Ga0501072_0003100
1710 Ga0501073_0142916
1711 Ga0501074_0002795
1712 Ga0501074_0010061
1713 Ga0501075_0009015
1714 Ga0501075_0040749
1715 Ga0501075_0113719
1716 Ga0501076_0004485
1717 Ga0501076_0155011
1718 Ga0501077_0001971
1719 Ga0501079_0000220
1720 Ga0501079_0050886
1721 Ga0501079_0063185
1722 Ga0501080_0087479
1723 Ga0501080_0139279
1724 Ga0501081_0002486
1725 Ga0501081_0076693
1726 Ga0501083_0198691
1727 Ga0501035_0122930
1728 Ga0501044_0211018
1729 Ga0501045_0002537
1730 Ga0501045_0006419
1731 Ga0501045_0314685
1732 nmdc:mga06r32_613022_c1
1733 nmdc:mga08y16_196436_c1
1734 nmdc:mga08y16_84408_c1
1735 nmdc:mga0n895_11002_c1
1736 nmdc:mga0rr50_18597_c1
1737 Ga0495601_0001416
1738 Ga0495601_0071886
1739 Ga0495601_0095577
1740 Ga0495601_0215658
1741 Ga0495612_0004272
1742 Ga0495612_0072580
1743 Ga0495595_0001306
1744 Ga0495595_0008392
1745 Ga0495595_0032570
1746 Ga0495619_0004523
1747 Ga0495619_0072249
1748 Ga0495619_0075126
1749 Ga0495619_0162790
1750 Ga0501084_0001665
1751 Ga0501084_0003268
1752 Ga0590071_004517
1753 Ga0590074_010613
1754 Ga0590077_003016
1755 Ga0501082_0003933
1756 Ga0501082_0082026
1757 Ga0530510_0002641
1758 2509112777
1759 2520375493
1760 2524454203
1761 2524454399
1762 2623500827
1763 2719669013
1764 2720489707
1765 2720610439
1766 2720628983
1767 2720772968
1768 2723030394
1769 2723564756
1770 2723570277
1771 2724092997
1772 2724101824
1773 2724113379
1774 2730110927
1775 2838045419
1776 2838064502
1777 2842265619
1778 2842428331
1779 2842434945
1780 2842442193
1781 2842469277
1782 2856288248
1783 2883294553
1784 8005286014
1785 8005624463
1786 8054473621

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02129

Peptidase_S15

X-Pro dipeptidyl-peptidase (S15 family)

53

318

0.81

PF05448

AXE1

Acetyl xylan esterase (AXE1)

124

220

0.81

PF20434

BD-FAE

BD-FAE

62

301

0.81

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

74

322

0.76

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

76

324

0.51

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qjm-assembly2.cif.gz_B crystal structure of an alpha/beta-hydrolase enzyme from chloroflexus sp. ms-g (202) 0.9224 2 298
7qjm-assembly2.cif.gz_B crystal structure of an alpha/beta-hydrolase enzyme from chloroflexus sp. ms-g (202) 0.9134 2 298
7d79-assembly2.cif.gz_B-2 the structure of dcsb complex with its substrate analogue 0.9036 1 295
7d79-assembly2.cif.gz_C the structure of dcsb complex with its substrate analogue 0.9024 1 298
7d79-assembly1.cif.gz_A the structure of dcsb complex with its substrate analogue 0.9009 1 298
ID Description Score Start End Superfamily
2hdwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9265 1 296 3.40.50.1820
2hdwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8562 1 296 3.40.50.1820
af_Q9FVR4_40_268_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8528 2 292 3.40.50.1820
af_A0A0R0GYE0_51_217_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8512 1 159 3.40.50.1820
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.851 1 136 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A535RIK3-F1-model_v4 Acetylxylan esterase 0.9884 1 112 GO:0016787
AF-J2KRX6-F1-model_v4 Alpha/beta superfamily hydrolase 0.9867 1 296 GO:0016787
AF-A0A370HCK3-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9862 1 300 GO:0052689
AF-A0A260UA11-F1-model_v4 deleted 0.9858 1 296
AF-A0A7G1KXA7-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9844 1 298 GO:0052689

Map