F485004
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 896 | 394 | 1786 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100004487|Ga0070699_10000448711 |
| Length | 341 |
| Sequence | MDGNEGIGCTRREFVGRTALVLAAGALASAVPRAARVASAEQGNVIPIEFMSKGVRCRGLKYIPDDLRAGGRRPAIVMAHGFSAVKEMYFTNYAEEFRRAGLVAVLFDYRYLGESGGEPRGQVLPFEQIEDYRNAITFAQTQPEVDPEKIGVFGSSYSGGHVIVVGAVDRRVKCVASQVPYLDGWATADALNTKTGIDGFVKFLEGDRSERYKSGRVNYLPVVAADGNAVLNTQTSYQWFTETAKKMAPRWENRVTVESLEWLFLYHPVLFVPKVSPTPLLIVVAENDELVPTEVTLRAYNGALEPKKIVIVPGGHFDAYVKGFPVSSRAATAWFTQWLKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 101 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 102 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 121 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 122 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 183 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 184 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 185 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 186 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 195 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 196 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 197 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 200 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 217 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 218 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 222 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 226 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 232 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 233 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 234 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 235 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 236 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 237 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 238 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 239 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 240 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 241 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 242 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 243 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 244 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 245 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 246 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 247 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 248 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 249 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 312 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 313 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 314 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 315 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 316 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 319 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 320 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 321 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 322 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 323 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 324 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 325 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 363 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 364 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 365 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 367 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 368 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 369 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 370 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 371 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 372 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 373 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 374 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 375 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 376 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 377 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 378 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 379 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 380 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 381 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 382 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 383 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 384 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 385 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 386 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 387 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 388 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 389 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 390 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 391 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 392 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 393 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 394 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.09 |
| Metatranscriptomes | 0.67 |
| Isolates | 3.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 2.68 |
| Rhizoplane | 4.35 |
| Rhizosphere | 90.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070699_100004487 | 3300005518 | Bacteria | 12349 |
| 2 | JGI25407J50210_10033097 | 3300003373 | Bacteria | 1335 |
| 3 | JGI25404J52841_10016018 | 3300003659 | Bacteria | 1626 |
| 4 | Ga0065714_10064488 | 3300005288 | Bacteria | 50757 |
| 5 | Ga0070658_10044196 | 3300005327 | Bacteria | 3600 |
| 6 | Ga0070683_100069142 | 3300005329 | Bacteria | 3291 |
| 7 | Ga0070690_100137485 | 3300005330 | Bacteria | 1656 |
| 8 | Ga0070690_100249112 | 3300005330 | Bacteria | 1256 |
| 9 | Ga0068869_100010792 | 3300005334 | Bacteria | 5969 |
| 10 | Ga0068869_100017165 | 3300005334 | Bacteria | 4899 |
| 11 | Ga0070682_100085427 | 3300005337 | Bacteria | 2053 |
| 12 | Ga0070682_100260966 | 3300005337 | Bacteria | 1254 |
| 13 | Ga0068868_100049779 | 3300005338 | Bacteria | 3288 |
| 14 | Ga0068868_100102203 | 3300005338 | Bacteria | 2321 |
| 15 | Ga0068868_100139737 | 3300005338 | Bacteria | 1987 |
| 16 | Ga0070660_100110427 | 3300005339 | Bacteria | 2187 |
| 17 | Ga0070660_100212352 | 3300005339 | Bacteria | 1571 |
| 18 | Ga0070689_100192148 | 3300005340 | Bacteria | 1663 |
| 19 | Ga0070689_100274564 | 3300005340 | Bacteria | 1396 |
| 20 | Ga0070691_10094271 | 3300005341 | Bacteria | 1479 |
| 21 | Ga0070691_10100528 | 3300005341 | Bacteria | 1436 |
| 22 | Ga0070687_100021534 | 3300005343 | Bacteria | 3033 |
| 23 | Ga0070661_100201543 | 3300005344 | Bacteria | 1521 |
| 24 | Ga0070661_100251876 | 3300005344 | Bacteria | 1363 |
| 25 | Ga0070669_100326364 | 3300005353 | Bacteria | 1241 |
| 26 | Ga0070669_100478132 | 3300005353 | Bacteria | 1030 |
| 27 | Ga0070675_100222727 | 3300005354 | Bacteria | 1643 |
| 28 | Ga0070671_100119557 | 3300005355 | Bacteria | 2217 |
| 29 | Ga0070671_100278399 | 3300005355 | Bacteria | 1423 |
| 30 | Ga0070674_100042793 | 3300005356 | Bacteria | 3078 |
| 31 | Ga0070674_100073239 | 3300005356 | Bacteria | 2427 |
| 32 | Ga0070673_100179484 | 3300005364 | Bacteria | 1812 |
| 33 | Ga0070659_100243969 | 3300005366 | Bacteria | 1487 |
| 34 | Ga0070667_100050321 | 3300005367 | Bacteria | 3511 |
| 35 | Ga0070703_10005742 | 3300005406 | Bacteria | 3475 |
| 36 | Ga0070703_10037325 | 3300005406 | Bacteria | 1497 |
| 37 | Ga0070709_10000496 | 3300005434 | Bacteria | 23223 |
| 38 | Ga0070709_10040329 | 3300005434 | Bacteria | 2870 |
| 39 | Ga0070714_100001238 | 3300005435 | Bacteria | 18416 |
| 40 | Ga0070714_100015331 | 3300005435 | Bacteria | 6167 |
| 41 | Ga0070714_100045294 | 3300005435 | Bacteria | 3728 |
| 42 | Ga0070714_100079343 | 3300005435 | Bacteria | 2854 |
| 43 | Ga0070714_100096627 | 3300005435 | Bacteria | 2596 |
| 44 | Ga0070714_100215790 | 3300005435 | Bacteria | 1761 |
| 45 | Ga0070713_100000944 | 3300005436 | Bacteria | 18579 |
| 46 | Ga0070713_100503841 | 3300005436 | Bacteria | 1143 |
| 47 | Ga0070710_10000118 | 3300005437 | Bacteria | 37278 |
| 48 | Ga0070710_10009882 | 3300005437 | Bacteria | 4677 |
| 49 | Ga0070710_10098838 | 3300005437 | Bacteria | 1734 |
| 50 | Ga0070710_10101197 | 3300005437 | Bacteria | 1716 |
| 51 | Ga0070701_10178762 | 3300005438 | Bacteria | 1240 |
| 52 | Ga0070711_100002360 | 3300005439 | Bacteria | 10737 |
| 53 | Ga0070711_100059222 | 3300005439 | Bacteria | 2658 |
| 54 | Ga0070711_100223794 | 3300005439 | Bacteria | 1464 |
| 55 | Ga0070711_100242638 | 3300005439 | Bacteria | 1409 |
| 56 | Ga0070711_100260594 | 3300005439 | Bacteria | 1364 |
| 57 | Ga0070705_100145214 | 3300005440 | Bacteria | 1566 |
| 58 | Ga0070700_100041275 | 3300005441 | Bacteria | 2828 |
| 59 | Ga0070700_100203392 | 3300005441 | Bacteria | 1392 |
| 60 | Ga0070694_100337821 | 3300005444 | Bacteria | 1164 |
| 61 | Ga0070708_100045027 | 3300005445 | Bacteria | 3885 |
| 62 | Ga0070708_100053865 | 3300005445 | Bacteria | 3572 |
| 63 | Ga0070708_100096805 | 3300005445 | Bacteria | 2696 |
| 64 | Ga0070663_100026750 | 3300005455 | Bacteria | 3910 |
| 65 | Ga0070663_100068412 | 3300005455 | Bacteria | 2578 |
| 66 | Ga0070663_100070226 | 3300005455 | Bacteria | 2546 |
| 67 | Ga0070678_100244096 | 3300005456 | Bacteria | 1503 |
| 68 | Ga0070678_100264280 | 3300005456 | Bacteria | 1448 |
| 69 | Ga0070662_100022030 | 3300005457 | Bacteria | 4357 |
| 70 | Ga0070662_100067850 | 3300005457 | Bacteria | 2620 |
| 71 | Ga0070662_100283197 | 3300005457 | Bacteria | 1342 |
| 72 | Ga0070681_10015427 | 3300005458 | Bacteria | 7606 |
| 73 | Ga0070681_10077661 | 3300005458 | Bacteria | 3278 |
| 74 | Ga0070681_10461428 | 3300005458 | Bacteria | 1182 |
| 75 | Ga0068867_100085865 | 3300005459 | Bacteria | 2380 |
| 76 | Ga0068867_100131368 | 3300005459 | Bacteria | 1946 |
| 77 | Ga0070685_10225494 | 3300005466 | Bacteria | 1230 |
| 78 | Ga0070706_100000149 | 3300005467 | Bacteria | 89007 |
| 79 | Ga0070706_100007316 | 3300005467 | Bacteria | 10358 |
| 80 | Ga0070706_100055140 | 3300005467 | Bacteria | 3669 |
| 81 | Ga0070706_100065035 | 3300005467 | Bacteria | 3372 |
| 82 | Ga0070706_100076714 | 3300005467 | Bacteria | 3093 |
| 83 | Ga0070706_100268544 | 3300005467 | Bacteria | 1592 |
| 84 | Ga0070707_100018717 | 3300005468 | Bacteria | 6519 |
| 85 | Ga0070707_100324042 | 3300005468 | Bacteria | 1497 |
| 86 | Ga0070698_100000884 | 3300005471 | Bacteria | 32963 |
| 87 | Ga0070698_100018754 | 3300005471 | Bacteria | 7283 |
| 88 | Ga0070698_100052216 | 3300005471 | Bacteria | 4160 |
| 89 | Ga0070698_100065588 | 3300005471 | Bacteria | 3655 |
| 90 | Ga0070699_100015634 | 3300005518 | Bacteria | 6519 |
| 91 | Ga0070699_100165682 | 3300005518 | Bacteria | 1957 |
| 92 | Ga0070679_100019594 | 3300005530 | Bacteria | 6583 |
| 93 | Ga0070679_100546029 | 3300005530 | Bacteria | 1102 |
| 94 | Ga0070684_100048522 | 3300005535 | Bacteria | 3683 |
| 95 | Ga0070684_100129915 | 3300005535 | Bacteria | 2272 |
| 96 | Ga0070684_100144787 | 3300005535 | Bacteria | 2150 |
| 97 | Ga0070684_100234587 | 3300005535 | Bacteria | 1676 |
| 98 | Ga0070684_100245578 | 3300005535 | Bacteria | 1636 |
| 99 | Ga0070684_100287154 | 3300005535 | Bacteria | 1508 |
| 100 | Ga0070697_100006268 | 3300005536 | Bacteria | 9209 |
| 101 | Ga0070697_100057955 | 3300005536 | Bacteria | 3151 |
| 102 | Ga0070697_100106631 | 3300005536 | Bacteria | 2331 |
| 103 | Ga0068853_100473756 | 3300005539 | Bacteria | 1180 |
| 104 | Ga0070672_100080295 | 3300005543 | Bacteria | 2613 |
| 105 | Ga0070672_100365095 | 3300005543 | Bacteria | 1233 |
| 106 | Ga0070695_100148228 | 3300005545 | Bacteria | 1635 |
| 107 | Ga0070695_100209748 | 3300005545 | Bacteria | 1397 |
| 108 | Ga0070696_100071444 | 3300005546 | Bacteria | 2442 |
| 109 | Ga0070696_100071601 | 3300005546 | Bacteria | 2440 |
| 110 | Ga0070693_100040960 | 3300005547 | Bacteria | 2603 |
| 111 | Ga0070665_100136861 | 3300005548 | Bacteria | 2452 |
| 112 | Ga0070704_100090954 | 3300005549 | Bacteria | 2274 |
| 113 | Ga0070704_100365746 | 3300005549 | Bacteria | 1221 |
| 114 | Ga0070704_100497786 | 3300005549 | Bacteria | 1057 |
| 115 | Ga0068855_100084690 | 3300005563 | Bacteria | 3670 |
| 116 | Ga0068855_100090424 | 3300005563 | Bacteria | 3533 |
| 117 | Ga0068855_100156067 | 3300005563 | Bacteria | 2593 |
| 118 | Ga0068855_100283344 | 3300005563 | Bacteria | 1839 |
| 119 | Ga0068855_100538367 | 3300005563 | Bacteria | 1265 |
| 120 | Ga0070664_100091530 | 3300005564 | Bacteria | 2632 |
| 121 | Ga0068857_100479504 | 3300005577 | Bacteria | 1165 |
| 122 | Ga0068857_100513623 | 3300005577 | Bacteria | 1125 |
| 123 | Ga0068854_100149865 | 3300005578 | Bacteria | 1798 |
| 124 | Ga0068856_100012742 | 3300005614 | Bacteria | 8141 |
| 125 | Ga0068856_100339520 | 3300005614 | Bacteria | 1520 |
| 126 | Ga0070702_100083932 | 3300005615 | Bacteria | 1914 |
| 127 | Ga0070702_100141996 | 3300005615 | Bacteria | 1531 |
| 128 | Ga0068852_100174825 | 3300005616 | Bacteria | 2015 |
| 129 | Ga0068859_100009055 | 3300005617 | Bacteria | 10055 |
| 130 | Ga0068859_100056371 | 3300005617 | Bacteria | 3954 |
| 131 | Ga0068859_100113423 | 3300005617 | Bacteria | 2774 |
| 132 | Ga0068864_100077034 | 3300005618 | Bacteria | 2915 |
| 133 | Ga0068864_100191991 | 3300005618 | Bacteria | 1873 |
| 134 | Ga0068864_100304684 | 3300005618 | Bacteria | 1492 |
| 135 | Ga0068866_10157680 | 3300005718 | Bacteria | 1320 |
| 136 | Ga0068866_10195038 | 3300005718 | Bacteria | 1206 |
| 137 | Ga0068861_100073391 | 3300005719 | Bacteria | 2658 |
| 138 | Ga0068861_100088615 | 3300005719 | Bacteria | 2437 |
| 139 | Ga0068870_10197166 | 3300005840 | Bacteria | 1218 |
| 140 | Ga0068863_100025751 | 3300005841 | Bacteria | 5611 |
| 141 | Ga0068863_100343866 | 3300005841 | Bacteria | 1451 |
| 142 | Ga0068858_100163325 | 3300005842 | Bacteria | 2097 |
| 143 | Ga0068860_100316818 | 3300005843 | Bacteria | 1530 |
| 144 | Ga0068860_100491332 | 3300005843 | Bacteria | 1224 |
| 145 | Ga0068862_100041217 | 3300005844 | Bacteria | 3928 |
| 146 | Ga0068862_100635150 | 3300005844 | Bacteria | 1028 |
| 147 | Ga0081455_10033872 | 3300005937 | Bacteria | 4583 |
| 148 | Ga0081455_10120187 | 3300005937 | Bacteria | 2071 |
| 149 | Ga0081538_10000799 | 3300005981 | Bacteria | 34169 |
| 150 | Ga0081538_10004349 | 3300005981 | Bacteria | 13082 |
| 151 | Ga0081538_10006649 | 3300005981 | Bacteria | 10135 |
| 152 | Ga0081538_10008135 | 3300005981 | Bacteria | 8946 |
| 153 | Ga0081538_10015545 | 3300005981 | Bacteria | 5884 |
| 154 | Ga0081538_10041385 | 3300005981 | Bacteria | 2925 |
| 155 | Ga0081540_1002707 | 3300005983 | Bacteria | 14415 |
| 156 | Ga0081540_1045742 | 3300005983 | Bacteria | 2218 |
| 157 | Ga0070717_10000940 | 3300006028 | Bacteria | 19389 |
| 158 | Ga0070717_10014268 | 3300006028 | Bacteria | 6110 |
| 159 | Ga0070717_10114208 | 3300006028 | Bacteria | 2306 |
| 160 | Ga0070717_10130253 | 3300006028 | Bacteria | 2163 |
| 161 | Ga0070715_10002346 | 3300006163 | Bacteria | 5789 |
| 162 | Ga0070715_10011075 | 3300006163 | Bacteria | 3235 |
| 163 | Ga0070715_10027656 | 3300006163 | Bacteria | 2267 |
| 164 | Ga0070715_10066592 | 3300006163 | Bacteria | 1597 |
| 165 | Ga0070716_100000135 | 3300006173 | Bacteria | 29582 |
| 166 | Ga0070716_100074001 | 3300006173 | Bacteria | 2011 |
| 167 | Ga0070716_100095425 | 3300006173 | Bacteria | 1810 |
| 168 | Ga0070716_100102757 | 3300006173 | Bacteria | 1756 |
| 169 | Ga0070712_100002084 | 3300006175 | Bacteria | 12285 |
| 170 | Ga0070712_100082843 | 3300006175 | Bacteria | 2327 |
| 171 | Ga0070712_100273923 | 3300006175 | Bacteria | 1357 |
| 172 | Ga0097621_100029089 | 3300006237 | Bacteria | 4361 |
| 173 | Ga0097621_100069760 | 3300006237 | Bacteria | 2902 |
| 174 | Ga0097621_100118806 | 3300006237 | Bacteria | 2241 |
| 175 | Ga0068871_100120275 | 3300006358 | Bacteria | 2218 |
| 176 | Ga0075428_100128048 | 3300006844 | Unclassified | 2762 |
| 177 | Ga0075431_100204336 | 3300006847 | Unclassified | 2020 |
| 178 | Ga0075434_100037748 | 3300006871 | Bacteria | 4783 |
| 179 | Ga0075434_100446495 | 3300006871 | Bacteria | 1314 |
| 180 | Ga0075429_100147457 | 3300006880 | Bacteria | 2060 |
| 181 | Ga0068865_100264674 | 3300006881 | Bacteria | 1363 |
| 182 | Ga0068865_100389707 | 3300006881 | Bacteria | 1138 |
| 183 | Ga0097620_100009055 | 3300006931 | Bacteria | 10055 |
| 184 | Ga0097620_100056374 | 3300006931 | Bacteria | 3954 |
| 185 | Ga0097620_100113414 | 3300006931 | Bacteria | 2774 |
| 186 | Ga0075435_100014105 | 3300007076 | Bacteria | 5963 |
| 187 | Ga0099795_10042369 | 3300007788 | Bacteria | 1625 |
| 188 | Ga0105251_10124069 | 3300009011 | Bacteria | 1172 |
| 189 | Ga0105240_10465849 | 3300009093 | Bacteria | 1411 |
| 190 | Ga0105240_10582259 | 3300009093 | Bacteria | 1234 |
| 191 | Ga0111539_10099904 | 3300009094 | Bacteria | 3407 |
| 192 | Ga0111539_10143364 | 3300009094 | Unclassified | 2796 |
| 193 | Ga0105245_10055902 | 3300009098 | Bacteria | 3546 |
| 194 | Ga0105245_10120442 | 3300009098 | Bacteria | 2451 |
| 195 | Ga0105245_10238001 | 3300009098 | Bacteria | 1763 |
| 196 | Ga0105245_10379643 | 3300009098 | Bacteria | 1407 |
| 197 | Ga0105245_10417587 | 3300009098 | Bacteria | 1344 |
| 198 | Ga0105247_10043647 | 3300009101 | Bacteria | 2748 |
| 199 | Ga0105247_10085619 | 3300009101 | Bacteria | 1993 |
| 200 | Ga0105247_10092612 | 3300009101 | Bacteria | 1920 |
| 201 | Ga0105247_10199081 | 3300009101 | Bacteria | 1345 |
| 202 | Ga0114129_10019373 | 3300009147 | Bacteria | 9691 |
| 203 | Ga0114129_10068104 | 3300009147 | Bacteria | 4964 |
| 204 | Ga0105243_10021830 | 3300009148 | Bacteria | 4860 |
| 205 | Ga0105243_10053332 | 3300009148 | Bacteria | 3207 |
| 206 | Ga0105243_10053889 | 3300009148 | Bacteria | 3191 |
| 207 | Ga0105241_10142570 | 3300009174 | Bacteria | 1952 |
| 208 | Ga0105241_10166641 | 3300009174 | Bacteria | 1816 |
| 209 | Ga0105248_10022968 | 3300009177 | Bacteria | 6927 |
| 210 | Ga0105248_10024179 | 3300009177 | Bacteria | 6752 |
| 211 | Ga0105248_10178508 | 3300009177 | Bacteria | 2393 |
| 212 | Ga0105237_10144090 | 3300009545 | Bacteria | 2377 |
| 213 | Ga0105237_10242608 | 3300009545 | Bacteria | 1803 |
| 214 | Ga0105237_10435784 | 3300009545 | Bacteria | 1316 |
| 215 | Ga0105238_10264240 | 3300009551 | Bacteria | 1701 |
| 216 | Ga0105238_10429023 | 3300009551 | Bacteria | 1317 |
| 217 | Ga0105249_10041332 | 3300009553 | Bacteria | 4191 |
| 218 | Ga0105249_10177789 | 3300009553 | Bacteria | 2068 |
| 219 | Ga0105249_10337798 | 3300009553 | Bacteria | 1522 |
| 220 | Ga0105239_10058076 | 3300010375 | Bacteria | 4245 |
| 221 | Ga0105239_10143237 | 3300010375 | Bacteria | 2664 |
| 222 | Ga0105239_10431872 | 3300010375 | Bacteria | 1493 |
| 223 | Ga0105239_10827901 | 3300010375 | Bacteria | 1061 |
| 224 | Ga0105246_10453403 | 3300011119 | Bacteria | 1078 |
| 225 | Ga0157340_1002853 | 3300012473 | Bacteria | 911 |
| 226 | Ga0157335_1003549 | 3300012492 | Bacteria | 1008 |
| 227 | Ga0157339_1003929 | 3300012505 | Bacteria | 1100 |
| 228 | Ga0157371_10237905 | 3300013102 | Bacteria | 1309 |
| 229 | Ga0157370_10398503 | 3300013104 | Bacteria | 1267 |
| 230 | Ga0157369_10240449 | 3300013105 | Bacteria | 1891 |
| 231 | Ga0157374_10022843 | 3300013296 | Bacteria | 5586 |
| 232 | Ga0157374_10028837 | 3300013296 | Bacteria | 5018 |
| 233 | Ga0157374_10238213 | 3300013296 | Bacteria | 1789 |
| 234 | Ga0163162_10236490 | 3300013306 | Bacteria | 1957 |
| 235 | Ga0163162_10330763 | 3300013306 | Bacteria | 1656 |
| 236 | Ga0157372_10125617 | 3300013307 | Bacteria | 2949 |
| 237 | Ga0157372_10178822 | 3300013307 | Bacteria | 2455 |
| 238 | Ga0157372_10559830 | 3300013307 | Bacteria | 1333 |
| 239 | Ga0157375_10016093 | 3300013308 | Bacteria | 6710 |
| 240 | Ga0157375_10036066 | 3300013308 | Bacteria | 4727 |
| 241 | Ga0157375_10188051 | 3300013308 | Bacteria | 2219 |
| 242 | Ga0163163_10066668 | 3300014325 | Bacteria | 3576 |
| 243 | Ga0163163_10144868 | 3300014325 | Bacteria | 2419 |
| 244 | Ga0157380_10067315 | 3300014326 | Bacteria | 2883 |
| 245 | Ga0182008_10075339 | 3300014497 | Bacteria | 1660 |
| 246 | Ga0157377_10171036 | 3300014745 | Bacteria | 1359 |
| 247 | Ga0157379_10145255 | 3300014968 | Bacteria | 2139 |
| 248 | Ga0157379_10209448 | 3300014968 | Bacteria | 1764 |
| 249 | Ga0157379_10288808 | 3300014968 | Bacteria | 1493 |
| 250 | Ga0157379_10566661 | 3300014968 | Bacteria | 1058 |
| 251 | Ga0157376_10121694 | 3300014969 | Bacteria | 2314 |
| 252 | Ga0157376_10206071 | 3300014969 | Bacteria | 1812 |
| 253 | Ga0182005_1000222 | 3300015265 | Bacteria | 37589 |
| 254 | Ga0163161_10268741 | 3300017792 | Unclassified | 1334 |
| 255 | Ga0206351_10157124 | 3300020077 | Bacteria | 1688 |
| 256 | Ga0206354_10659615 | 3300020081 | Bacteria | 1171 |
| 257 | Ga0213873_10020569 | 3300021358 | Bacteria | 1543 |
| 258 | Ga0213874_10069298 | 3300021377 | Bacteria | 1121 |
| 259 | Ga0213875_10006446 | 3300021388 | Bacteria | 6158 |
| 260 | Ga0213875_10104874 | 3300021388 | Archaea | 1320 |
| 261 | Ga0213875_10125439 | 3300021388 | Bacteria | 1200 |
| 262 | Ga0224712_10106508 | 3300022467 | Bacteria | 1197 |
| 263 | Ga0224712_10107799 | 3300022467 | Bacteria | 1191 |
| 264 | Ga0207656_10075084 | 3300025321 | Bacteria | 1509 |
| 265 | Ga0207656_10079477 | 3300025321 | Bacteria | 1471 |
| 266 | Ga0207692_10018518 | 3300025898 | Bacteria | 3128 |
| 267 | Ga0207692_10059681 | 3300025898 | Bacteria | 1970 |
| 268 | Ga0207692_10078569 | 3300025898 | Bacteria | 1758 |
| 269 | Ga0207692_10168871 | 3300025898 | Bacteria | 1266 |
| 270 | Ga0207710_10104803 | 3300025900 | Bacteria | 1338 |
| 271 | Ga0207688_10005068 | 3300025901 | Bacteria | 7165 |
| 272 | Ga0207688_10007486 | 3300025901 | Bacteria | 5938 |
| 273 | Ga0207680_10105598 | 3300025903 | Bacteria | 1817 |
| 274 | Ga0207680_10167817 | 3300025903 | Bacteria | 1476 |
| 275 | Ga0207647_10108815 | 3300025904 | Bacteria | 1640 |
| 276 | Ga0207647_10125230 | 3300025904 | Bacteria | 1512 |
| 277 | Ga0207685_10002244 | 3300025905 | Bacteria | 4376 |
| 278 | Ga0207685_10018726 | 3300025905 | Bacteria | 2266 |
| 279 | Ga0207685_10074280 | 3300025905 | Bacteria | 1388 |
| 280 | Ga0207685_10076049 | 3300025905 | Bacteria | 1376 |
| 281 | Ga0207685_10080271 | 3300025905 | Bacteria | 1348 |
| 282 | Ga0207699_10000190 | 3300025906 | Bacteria | 37336 |
| 283 | Ga0207699_10006021 | 3300025906 | Bacteria | 5837 |
| 284 | Ga0207699_10013972 | 3300025906 | Bacteria | 4125 |
| 285 | Ga0207699_10022566 | 3300025906 | Bacteria | 3413 |
| 286 | Ga0207699_10195853 | 3300025906 | Bacteria | 1366 |
| 287 | Ga0207645_10021979 | 3300025907 | Bacteria | 4155 |
| 288 | Ga0207643_10149108 | 3300025908 | Bacteria | 1401 |
| 289 | Ga0207643_10194289 | 3300025908 | Bacteria | 1233 |
| 290 | Ga0207705_10210882 | 3300025909 | Bacteria | 1473 |
| 291 | Ga0207684_10000119 | 3300025910 | Bacteria | 144532 |
| 292 | Ga0207684_10011069 | 3300025910 | Bacteria | 7899 |
| 293 | Ga0207684_10011969 | 3300025910 | Bacteria | 7556 |
| 294 | Ga0207684_10056413 | 3300025910 | Bacteria | 3332 |
| 295 | Ga0207654_10233640 | 3300025911 | Bacteria | 1226 |
| 296 | Ga0207707_10047800 | 3300025912 | Bacteria | 3726 |
| 297 | Ga0207707_10066747 | 3300025912 | Bacteria | 3133 |
| 298 | Ga0207693_10001809 | 3300025915 | Bacteria | 18749 |
| 299 | Ga0207693_10013660 | 3300025915 | Bacteria | 6540 |
| 300 | Ga0207693_10074854 | 3300025915 | Bacteria | 2651 |
| 301 | Ga0207693_10191374 | 3300025915 | Bacteria | 1610 |
| 302 | Ga0207663_10001409 | 3300025916 | Bacteria | 11149 |
| 303 | Ga0207663_10004562 | 3300025916 | Bacteria | 6905 |
| 304 | Ga0207663_10200213 | 3300025916 | Bacteria | 1440 |
| 305 | Ga0207662_10064210 | 3300025918 | Bacteria | 2209 |
| 306 | Ga0207662_10235780 | 3300025918 | Bacteria | 1196 |
| 307 | Ga0207657_10010642 | 3300025919 | Bacteria | 9163 |
| 308 | Ga0207657_10020943 | 3300025919 | Bacteria | 6170 |
| 309 | Ga0207652_10067620 | 3300025921 | Bacteria | 3099 |
| 310 | Ga0207652_10632170 | 3300025921 | Bacteria | 958 |
| 311 | Ga0207646_10049126 | 3300025922 | Bacteria | 3779 |
| 312 | Ga0207646_10070816 | 3300025922 | Bacteria | 3114 |
| 313 | Ga0207646_10118464 | 3300025922 | Bacteria | 2378 |
| 314 | Ga0207646_10165298 | 3300025922 | Bacteria | 1997 |
| 315 | Ga0207681_10083898 | 3300025923 | Bacteria | 2257 |
| 316 | Ga0207681_10223570 | 3300025923 | Bacteria | 1458 |
| 317 | Ga0207687_10128130 | 3300025927 | Bacteria | 1909 |
| 318 | Ga0207687_10314485 | 3300025927 | Bacteria | 1266 |
| 319 | Ga0207700_10000043 | 3300025928 | Bacteria | 92646 |
| 320 | Ga0207700_10101492 | 3300025928 | Bacteria | 2295 |
| 321 | Ga0207700_10162419 | 3300025928 | Bacteria | 1856 |
| 322 | Ga0207700_10230227 | 3300025928 | Bacteria | 1575 |
| 323 | Ga0207700_10284075 | 3300025928 | Bacteria | 1424 |
| 324 | Ga0207664_10000123 | 3300025929 | Bacteria | 68003 |
| 325 | Ga0207664_10022951 | 3300025929 | Bacteria | 4668 |
| 326 | Ga0207664_10023323 | 3300025929 | Bacteria | 4635 |
| 327 | Ga0207664_10027592 | 3300025929 | Bacteria | 4306 |
| 328 | Ga0207664_10076020 | 3300025929 | Bacteria | 2717 |
| 329 | Ga0207664_10104882 | 3300025929 | Bacteria | 2341 |
| 330 | Ga0207664_10175832 | 3300025929 | Bacteria | 1835 |
| 331 | Ga0207664_10202807 | 3300025929 | Bacteria | 1713 |
| 332 | Ga0207664_10336519 | 3300025929 | Bacteria | 1334 |
| 333 | Ga0207644_10251668 | 3300025931 | Bacteria | 1410 |
| 334 | Ga0207690_10126569 | 3300025932 | Bacteria | 1864 |
| 335 | Ga0207706_10048647 | 3300025933 | Bacteria | 3749 |
| 336 | Ga0207706_10074643 | 3300025933 | Bacteria | 2982 |
| 337 | Ga0207706_10119859 | 3300025933 | Bacteria | 2313 |
| 338 | Ga0207670_10157324 | 3300025936 | Bacteria | 1693 |
| 339 | Ga0207670_10258556 | 3300025936 | Bacteria | 1349 |
| 340 | Ga0207669_10017128 | 3300025937 | Bacteria | 3707 |
| 341 | Ga0207704_10038204 | 3300025938 | Unclassified | 2782 |
| 342 | Ga0207704_10173465 | 3300025938 | Bacteria | 1550 |
| 343 | Ga0207704_10287333 | 3300025938 | Bacteria | 1253 |
| 344 | Ga0207665_10000157 | 3300025939 | Bacteria | 46258 |
| 345 | Ga0207665_10005348 | 3300025939 | Bacteria | 8576 |
| 346 | Ga0207665_10019302 | 3300025939 | Bacteria | 4480 |
| 347 | Ga0207665_10023765 | 3300025939 | Bacteria | 4037 |
| 348 | Ga0207665_10048112 | 3300025939 | Bacteria | 2861 |
| 349 | Ga0207665_10110236 | 3300025939 | Bacteria | 1933 |
| 350 | Ga0207691_10045431 | 3300025940 | Bacteria | 4037 |
| 351 | Ga0207691_10108567 | 3300025940 | Bacteria | 2469 |
| 352 | Ga0207691_10178307 | 3300025940 | Bacteria | 1857 |
| 353 | Ga0207711_10112570 | 3300025941 | Bacteria | 2422 |
| 354 | Ga0207689_10003083 | 3300025942 | Bacteria | 15335 |
| 355 | Ga0207689_10004491 | 3300025942 | Bacteria | 12645 |
| 356 | Ga0207689_10019899 | 3300025942 | Bacteria | 5653 |
| 357 | Ga0207689_10453665 | 3300025942 | Bacteria | 1072 |
| 358 | Ga0207661_10088009 | 3300025944 | Bacteria | 2581 |
| 359 | Ga0207679_10072368 | 3300025945 | Bacteria | 2603 |
| 360 | Ga0207667_10380346 | 3300025949 | Bacteria | 1438 |
| 361 | Ga0207651_10112719 | 3300025960 | Bacteria | 2045 |
| 362 | Ga0207712_10076522 | 3300025961 | Bacteria | 2423 |
| 363 | Ga0207712_10139952 | 3300025961 | Bacteria | 1856 |
| 364 | Ga0207668_10047147 | 3300025972 | Bacteria | 2949 |
| 365 | Ga0207658_10119055 | 3300025986 | Bacteria | 2102 |
| 366 | Ga0207658_10171663 | 3300025986 | Bacteria | 1787 |
| 367 | Ga0207677_10109046 | 3300026023 | Bacteria | 2057 |
| 368 | Ga0207703_10523949 | 3300026035 | Bacteria | 1115 |
| 369 | Ga0207678_10009116 | 3300026067 | Bacteria | 8738 |
| 370 | Ga0207678_10055461 | 3300026067 | Bacteria | 3413 |
| 371 | Ga0207708_10055642 | 3300026075 | Bacteria | 3016 |
| 372 | Ga0207708_10059100 | 3300026075 | Bacteria | 2926 |
| 373 | Ga0207708_10085776 | 3300026075 | Bacteria | 2423 |
| 374 | Ga0207702_10111271 | 3300026078 | Bacteria | 2435 |
| 375 | Ga0207641_10074329 | 3300026088 | Bacteria | 2931 |
| 376 | Ga0207641_10079429 | 3300026088 | Bacteria | 2844 |
| 377 | Ga0207641_10299232 | 3300026088 | Bacteria | 1519 |
| 378 | Ga0207648_10024604 | 3300026089 | Bacteria | 5372 |
| 379 | Ga0207648_10086218 | 3300026089 | Bacteria | 2740 |
| 380 | Ga0207648_10287241 | 3300026089 | Bacteria | 1472 |
| 381 | Ga0207676_10151114 | 3300026095 | Bacteria | 2000 |
| 382 | Ga0207674_10019879 | 3300026116 | Bacteria | 7266 |
| 383 | Ga0207674_10144296 | 3300026116 | Bacteria | 2340 |
| 384 | Ga0207675_100084680 | 3300026118 | Bacteria | 2975 |
| 385 | Ga0207675_100092165 | 3300026118 | Bacteria | 2850 |
| 386 | Ga0207675_100107389 | 3300026118 | Bacteria | 2632 |
| 387 | Ga0207675_100119529 | 3300026118 | Bacteria | 2492 |
| 388 | Ga0207683_10079029 | 3300026121 | Bacteria | 2916 |
| 389 | Ga0207683_10332448 | 3300026121 | Bacteria | 1393 |
| 390 | Ga0207698_10333749 | 3300026142 | Bacteria | 1425 |
| 391 | Ga0207698_10384319 | 3300026142 | Bacteria | 1336 |
| 392 | Ga0207428_10117916 | 3300027907 | Bacteria | 2037 |
| 393 | Ga0207428_10353865 | 3300027907 | Bacteria | 1080 |
| 394 | Ga0268266_10096160 | 3300028379 | Bacteria | 2602 |
| 395 | Ga0268266_10137374 | 3300028379 | Bacteria | 2191 |
| 396 | Ga0268265_10044777 | 3300028380 | Bacteria | 3298 |
| 397 | Ga0268265_10391322 | 3300028380 | Bacteria | 1282 |
| 398 | Ga0268265_10655480 | 3300028380 | Bacteria | 1009 |
| 399 | Ga0268264_10525656 | 3300028381 | Bacteria | 1157 |
| 400 | Ga0265338_10002561 | 3300028800 | Bacteria | 26893 |
| 401 | Ga0316575_10065491 | 3300031665 | Bacteria | 1455 |
| 402 | Ga0316579_10052780 | 3300031691 | Bacteria | 1903 |
| 403 | Ga0316576_10064216 | 3300031727 | Bacteria | 2696 |
| 404 | Ga0316576_10079270 | 3300031727 | Bacteria | 2434 |
| 405 | Ga0316576_10081853 | 3300031727 | Unclassified | 2396 |
| 406 | Ga0316576_10194273 | 3300031727 | Bacteria | 1529 |
| 407 | Ga0316576_10333179 | 3300031727 | Bacteria | 1131 |
| 408 | Ga0316578_10010183 | 3300031728 | Bacteria | 4868 |
| 409 | Ga0316578_10056587 | 3300031728 | Bacteria | 2303 |
| 410 | Ga0307405_10027916 | 3300031731 | Bacteria | 3280 |
| 411 | Ga0316577_10079541 | 3300031733 | Bacteria | 1831 |
| 412 | Ga0307410_10111047 | 3300031852 | Bacteria | 1984 |
| 413 | Ga0307410_10353248 | 3300031852 | Bacteria | 1175 |
| 414 | Ga0307412_10250769 | 3300031911 | Bacteria | 1374 |
| 415 | Ga0307409_100065011 | 3300031995 | Bacteria | 2868 |
| 416 | Ga0307409_100243591 | 3300031995 | Bacteria | 1638 |
| 417 | Ga0307416_100068345 | 3300032002 | Bacteria | 2935 |
| 418 | Ga0307416_100070127 | 3300032002 | Bacteria | 2904 |
| 419 | Ga0307416_100143419 | 3300032002 | Bacteria | 2176 |
| 420 | Ga0307416_100517975 | 3300032002 | Bacteria | 1260 |
| 421 | Ga0307411_10078299 | 3300032005 | Unclassified | 2266 |
| 422 | Ga0307415_100059998 | 3300032126 | Bacteria | 2626 |
| 423 | Ga0307415_100282037 | 3300032126 | Bacteria | 1367 |
| 424 | Ga0316583_10049833 | 3300032133 | Bacteria | 1474 |
| 425 | Ga0316585_10045036 | 3300032137 | Bacteria | 1410 |
| 426 | Ga0316580_10027776 | 3300032139 | Bacteria | 1748 |
| 427 | Ga0316588_1005050 | 3300033528 | Unclassified | 2543 |
| 428 | Ga0316596_1042802 | 3300033541 | Bacteria | 1192 |
| 429 | Ga0373926_0001226 | 3300035083 | Bacteria | 7711 |
| 430 | Ga0373926_0020135 | 3300035083 | Bacteria | 2304 |
| 431 | Ga0373928_0016167 | 3300035084 | Bacteria | 1525 |
| 432 | Ga0373934_0008545 | 3300035086 | Bacteria | 3817 |
| 433 | Ga0373934_0023732 | 3300035086 | Bacteria | 2371 |
| 434 | Ga0373934_0032755 | 3300035086 | Bacteria | 2039 |
| 435 | Ga0373934_0034592 | 3300035086 | Bacteria | 1986 |
| 436 | Ga0373934_0039360 | 3300035086 | Bacteria | 1863 |
| 437 | Ga0373944_0007930 | 3300035089 | Bacteria | 2860 |
| 438 | Ga0373944_0070635 | 3300035089 | Bacteria | 1137 |
| 439 | Ga0373923_0008131 | 3300035111 | Bacteria | 3724 |
| 440 | Ga0373923_0158879 | 3300035111 | Bacteria | 1030 |
| 441 | Ga0373932_0006677 | 3300035112 | Bacteria | 2735 |
| 442 | Ga0373936_0000065 | 3300035113 | Bacteria | 50174 |
| 443 | Ga0373936_0000557 | 3300035113 | Bacteria | 12798 |
| 444 | Ga0373936_0012559 | 3300035113 | Bacteria | 3224 |
| 445 | Ga0373936_0042807 | 3300035113 | Bacteria | 1818 |
| 446 | Ga0373936_0043340 | 3300035113 | Bacteria | 1808 |
| 447 | Ga0373945_0000072 | 3300035116 | Bacteria | 23111 |
| 448 | Ga0373945_0008710 | 3300035116 | Bacteria | 3310 |
| 449 | Ga0373945_0040060 | 3300035116 | Bacteria | 1690 |
| 450 | Ga0373945_0061556 | 3300035116 | Bacteria | 1402 |
| 451 | Ga0373953_0004979 | 3300035117 | Bacteria | 4280 |
| 452 | Ga0373953_0061152 | 3300035117 | Bacteria | 1540 |
| 453 | Ga0373954_0023538 | 3300035118 | Bacteria | 2801 |
| 454 | Ga0373954_0033443 | 3300035118 | Bacteria | 2379 |
| 455 | Ga0373954_0055836 | 3300035118 | Bacteria | 1858 |
| 456 | Ga0373954_0078376 | 3300035118 | Bacteria | 1576 |
| 457 | Ga0373954_0136716 | 3300035118 | Bacteria | 1194 |
| 458 | Ga0373956_0092206 | 3300035119 | Bacteria | 1398 |
| 459 | Ga0373956_0095251 | 3300035119 | Bacteria | 1376 |
| 460 | Ga0373957_0007546 | 3300035120 | Bacteria | 3484 |
| 461 | Ga0373957_0026354 | 3300035120 | Bacteria | 2102 |
| 462 | Ga0373957_0081318 | 3300035120 | Bacteria | 1279 |
| 463 | Ga0373957_0085663 | 3300035120 | Bacteria | 1247 |
| 464 | Ga0373943_0003543 | 3300035170 | Bacteria | 7107 |
| 465 | Ga0373943_0049116 | 3300035170 | Bacteria | 2069 |
| 466 | Ga0373943_0145901 | 3300035170 | Bacteria | 1278 |
| 467 | Ga0373943_0145939 | 3300035170 | Bacteria | 1278 |
| 468 | Ga0373946_0003354 | 3300035171 | Bacteria | 5678 |
| 469 | Ga0373955_0003475 | 3300035172 | Bacteria | 6925 |
| 470 | Ga0373955_0010304 | 3300035172 | Bacteria | 4410 |
| 471 | Ga0373955_0061214 | 3300035172 | Bacteria | 2078 |
| 472 | Ga0373955_0099279 | 3300035172 | Bacteria | 1669 |
| 473 | Ga0373942_0040111 | 3300035207 | Bacteria | 1276 |
| 474 | Ga0373961_0006687 | 3300035241 | Bacteria | 2772 |
| 475 | Ga0373962_0035861 | 3300035242 | Bacteria | 1379 |
| 476 | Ga0316574_0047167 | 3300035398 | Unclassified | 2673 |
| 477 | Ga0316574_0054507 | 3300035398 | Bacteria | 2497 |
| 478 | Ga0316574_0084675 | 3300035398 | Bacteria | 2017 |
| 479 | Ga0373924_0000934 | 3300035410 | Bacteria | 9213 |
| 480 | Ga0373924_0077439 | 3300035410 | Bacteria | 1410 |
| 481 | Ga0373931_0069933 | 3300035691 | Bacteria | 1913 |
| 482 | Ga0373935_0002797 | 3300035692 | Bacteria | 10042 |
| 483 | Ga0373935_0021735 | 3300035692 | Bacteria | 3928 |
| 484 | Ga0373935_0147397 | 3300035692 | Bacteria | 1594 |
| 485 | Ga0373935_0259466 | 3300035692 | Bacteria | 1218 |
| 486 | Ga0373927_0000757 | 3300035695 | Bacteria | 24696 |
| 487 | Ga0373933_0006242 | 3300035724 | Bacteria | 6488 |
| 488 | Ga0373933_0021373 | 3300035724 | Bacteria | 3676 |
| 489 | Ga0373933_0034669 | 3300035724 | Bacteria | 2942 |
| 490 | Ga0373933_0138597 | 3300035724 | Bacteria | 1534 |
| 491 | Ga0373947_0002870 | 3300035725 | Bacteria | 10298 |
| 492 | Ga0373947_0034530 | 3300035725 | Bacteria | 2991 |
| 493 | Ga0373947_0089365 | 3300035725 | Bacteria | 1918 |
| 494 | Ga0373937_0020317 | 3300036401 | Bacteria | 5954 |
| 495 | Ga0373937_0026714 | 3300036401 | Bacteria | 5216 |
| 496 | Ga0373937_0040827 | 3300036401 | Archaea | 4230 |
| 497 | Ga0373937_0056437 | 3300036401 | Bacteria | 3607 |
| 498 | Ga0373937_0068122 | 3300036401 | Bacteria | 3280 |
| 499 | Ga0373937_0124443 | 3300036401 | Bacteria | 2404 |
| 500 | Ga0373937_0249136 | 3300036401 | Bacteria | 1674 |
| 501 | Ga0316582_0410047 | 3300036647 | Unclassified | 933 |
| 502 | Ga0316584_0001556 | 3300036712 | Bacteria | 13901 |
| 503 | Ga0316584_0130188 | 3300036712 | Bacteria | 1880 |
| 504 | Ga0373925_0001542 | 3300037068 | Bacteria | 19627 |
| 505 | Ga0373925_0004939 | 3300037068 | Bacteria | 10025 |
| 506 | Ga0373925_0032211 | 3300037068 | Bacteria | 3857 |
| 507 | Ga0373925_0073413 | 3300037068 | Bacteria | 2589 |
| 508 | Ga0373925_0113389 | 3300037068 | Bacteria | 2096 |
| 509 | Ga0395900_0110620 | 3300037418 | Bacteria | 2822 |
| 510 | Ga0395900_0546478 | 3300037418 | Bacteria | 1103 |
| 511 | Ga0395898_0061886 | 3300037466 | Bacteria | 3636 |
| 512 | Ga0395898_0448356 | 3300037466 | Bacteria | 1229 |
| 513 | Ga0395905_0071919 | 3300037471 | Bacteria | 3242 |
| 514 | Ga0395905_0231603 | 3300037471 | Bacteria | 1727 |
| 515 | Ga0436364_0622553 | 3300037853 | Bacteria | 3854 |
| 516 | Ga0436364_0623133 | 3300037853 | Archaea | 1834 |
| 517 | Ga0436364_1481811 | 3300037853 | Bacteria | 16621 |
| 518 | Ga0436364_1517018 | 3300037853 | Bacteria | 10872 |
| 519 | Ga0395901_0103118 | 3300038443 | Bacteria | 2993 |
| 520 | Ga0395901_0189924 | 3300038443 | Bacteria | 2154 |
| 521 | Ga0400485_12647 | 3300038735 | Bacteria | 2973 |
| 522 | Ga0400485_19114 | 3300038735 | Bacteria | 22750 |
| 523 | Ga0400488_03612 | 3300038741 | Bacteria | 5905 |
| 524 | Ga0400486_24978 | 3300038742 | Bacteria | 48837 |
| 525 | Ga0400483_020888 | 3300039062 | Unclassified | 1346 |
| 526 | Ga0400487_20151 | 3300039110 | Bacteria | 26068 |
| 527 | Ga0436365_0829170 | 3300039437 | Bacteria | 2449 |
| 528 | Ga0436365_1522245 | 3300039437 | Bacteria | 1607 |
| 529 | Ga0436365_1737778 | 3300039437 | Bacteria | 2091 |
| 530 | Ga0436360_0623051 | 3300039438 | Bacteria | 1914 |
| 531 | Ga0436363_0113080 | 3300039450 | Bacteria | 6083 |
| 532 | Ga0436363_0742947 | 3300039450 | Bacteria | 2116 |
| 533 | Ga0436363_0782842 | 3300039450 | Bacteria | 1028 |
| 534 | Ga0436363_0805767 | 3300039450 | Bacteria | 7445 |
| 535 | Ga0436362_0489135 | 3300039453 | Bacteria | 2260 |
| 536 | Ga0436362_0528474 | 3300039453 | Bacteria | 2861 |
| 537 | Ga0439447_010395 | 3300041407 | Bacteria | 2763 |
| 538 | Ga0439452_007039 | 3300042010 | Bacteria | 3471 |
| 539 | Ga0450912_003295 | 3300042116 | Bacteria | 1142 |
| 540 | Ga0466965_0131249 | 3300044683 | Bacteria | 1299 |
| 541 | Ga0466961_0127447 | 3300044693 | Bacteria | 1596 |
| 542 | Ga0453684_0044307 | 3300044712 | Bacteria | 5957 |
| 543 | Ga0466960_0015328 | 3300044901 | Bacteria | 3302 |
| 544 | Ga0466958_0069759 | 3300045836 | Bacteria | 2150 |
| 545 | Ga0466958_0339689 | 3300045836 | Bacteria | 966 |
| 546 | Ga0466967_0011688 | 3300045976 | Bacteria | 6672 |
| 547 | Ga0466967_0040415 | 3300045976 | Bacteria | 4015 |
| 548 | Ga0466967_0179943 | 3300045976 | Bacteria | 1994 |
| 549 | Ga0466967_0316679 | 3300045976 | Bacteria | 1504 |
| 550 | Ga0466967_0489438 | 3300045976 | Bacteria | 1206 |
| 551 | Ga0495592_0015368 | 3300046454 | Bacteria | 5807 |
| 552 | Ga0495603_0044256 | 3300046455 | Bacteria | 2656 |
| 553 | Ga0495603_0096617 | 3300046455 | Bacteria | 1726 |
| 554 | Ga0495603_0140146 | 3300046455 | Bacteria | 1407 |
| 555 | Ga0495629_0006045 | 3300046459 | Bacteria | 8999 |
| 556 | Ga0495629_0034919 | 3300046459 | Bacteria | 3554 |
| 557 | Ga0495629_0164150 | 3300046459 | Bacteria | 1542 |
| 558 | Ga0495629_0256140 | 3300046459 | Bacteria | 1203 |
| 559 | Ga0495638_0001463 | 3300046460 | Bacteria | 21329 |
| 560 | Ga0495638_0002853 | 3300046460 | Bacteria | 13853 |
| 561 | Ga0495638_0263314 | 3300046460 | Bacteria | 944 |
| 562 | Ga0495641_0000184 | 3300046461 | Bacteria | 48241 |
| 563 | Ga0495641_0002737 | 3300046461 | Bacteria | 13675 |
| 564 | Ga0495641_0009986 | 3300046461 | Bacteria | 5573 |
| 565 | Ga0495651_0000215 | 3300046462 | Bacteria | 44284 |
| 566 | Ga0495651_0000361 | 3300046462 | Bacteria | 34960 |
| 567 | Ga0495651_0022089 | 3300046462 | Bacteria | 4947 |
| 568 | Ga0495651_0025332 | 3300046462 | Bacteria | 4617 |
| 569 | Ga0495651_0053944 | 3300046462 | Bacteria | 3093 |
| 570 | Ga0495651_0075885 | 3300046462 | Bacteria | 2547 |
| 571 | Ga0495653_0002705 | 3300046463 | Bacteria | 14128 |
| 572 | Ga0495653_0011683 | 3300046463 | Bacteria | 7165 |
| 573 | Ga0495653_0015829 | 3300046463 | Bacteria | 6147 |
| 574 | Ga0495653_0043428 | 3300046463 | Bacteria | 3494 |
| 575 | Ga0495650_0000625 | 3300046471 | Bacteria | 47624 |
| 576 | Ga0495580_0076435 | 3300046472 | Bacteria | 2336 |
| 577 | Ga0495580_0078645 | 3300046472 | Bacteria | 2300 |
| 578 | Ga0495580_0378284 | 3300046472 | Unclassified | 957 |
| 579 | Ga0495582_0000343 | 3300046473 | Bacteria | 25586 |
| 580 | Ga0495582_0006812 | 3300046473 | Bacteria | 6359 |
| 581 | Ga0495582_0020052 | 3300046473 | Bacteria | 3658 |
| 582 | Ga0495605_0000270 | 3300046474 | Bacteria | 58922 |
| 583 | Ga0495605_0002158 | 3300046474 | Bacteria | 12287 |
| 584 | Ga0495639_0001940 | 3300046475 | Bacteria | 9183 |
| 585 | Ga0495639_0020808 | 3300046475 | Bacteria | 2868 |
| 586 | Ga0495639_0104774 | 3300046475 | Bacteria | 1338 |
| 587 | Ga0495662_0000054 | 3300046476 | Bacteria | 39454 |
| 588 | Ga0495662_0026504 | 3300046476 | Bacteria | 2798 |
| 589 | Ga0495662_0155381 | 3300046476 | Bacteria | 1127 |
| 590 | Ga0495664_0000832 | 3300046477 | Bacteria | 15798 |
| 591 | Ga0495664_0074814 | 3300046477 | Bacteria | 2026 |
| 592 | Ga0495664_0205500 | 3300046477 | Bacteria | 1193 |
| 593 | Ga0495594_0080383 | 3300046499 | Bacteria | 1820 |
| 594 | Ga0495594_0091456 | 3300046499 | Bacteria | 1705 |
| 595 | Ga0495607_0021794 | 3300046501 | Bacteria | 4028 |
| 596 | Ga0495606_0000437 | 3300046507 | Bacteria | 68999 |
| 597 | Ga0495608_0006748 | 3300046511 | Bacteria | 8139 |
| 598 | Ga0495608_0011312 | 3300046511 | Bacteria | 6213 |
| 599 | Ga0495608_0017699 | 3300046511 | Bacteria | 4927 |
| 600 | Ga0495608_0018722 | 3300046511 | Archaea | 4773 |
| 601 | Ga0495608_0026613 | 3300046511 | Bacteria | 3941 |
| 602 | Ga0495608_0026687 | 3300046511 | Bacteria | 3936 |
| 603 | Ga0495618_0000626 | 3300046514 | Bacteria | 25051 |
| 604 | Ga0495618_0003343 | 3300046514 | Bacteria | 10011 |
| 605 | Ga0495618_0012306 | 3300046514 | Bacteria | 5193 |
| 606 | Ga0495618_0021058 | 3300046514 | Bacteria | 4018 |
| 607 | Ga0495618_0094167 | 3300046514 | Archaea | 1915 |
| 608 | Ga0495628_0029143 | 3300046516 | Archaea | 4479 |
| 609 | Ga0495628_0031776 | 3300046516 | Bacteria | 4267 |
| 610 | Ga0495628_0139416 | 3300046516 | Bacteria | 1851 |
| 611 | Ga0495628_0163693 | 3300046516 | Bacteria | 1689 |
| 612 | Ga0495628_0187661 | 3300046516 | Bacteria | 1562 |
| 613 | Ga0495628_0222175 | 3300046516 | Bacteria | 1418 |
| 614 | Ga0495630_0000866 | 3300046517 | Bacteria | 21319 |
| 615 | Ga0495630_0001781 | 3300046517 | Bacteria | 15069 |
| 616 | Ga0495630_0022875 | 3300046517 | Bacteria | 4616 |
| 617 | Ga0495632_0001430 | 3300046519 | Bacteria | 19886 |
| 618 | Ga0495632_0002781 | 3300046519 | Bacteria | 12981 |
| 619 | Ga0495643_0111516 | 3300046522 | Bacteria | 1390 |
| 620 | Ga0495644_0000019 | 3300046523 | Bacteria | 84214 |
| 621 | Ga0495648_0000469 | 3300046524 | Bacteria | 43478 |
| 622 | Ga0495666_0000320 | 3300046526 | Bacteria | 20909 |
| 623 | Ga0495652_0004006 | 3300046529 | Bacteria | 14254 |
| 624 | Ga0495652_0009253 | 3300046529 | Bacteria | 8955 |
| 625 | Ga0495652_0009760 | 3300046529 | Bacteria | 8708 |
| 626 | Ga0495652_0035077 | 3300046529 | Bacteria | 4367 |
| 627 | Ga0495652_0161930 | 3300046529 | Bacteria | 1736 |
| 628 | Ga0495652_0273814 | 3300046529 | Bacteria | 1239 |
| 629 | Ga0495665_0000427 | 3300046531 | Bacteria | 21447 |
| 630 | Ga0495665_0005121 | 3300046531 | Bacteria | 7068 |
| 631 | Ga0495665_0014015 | 3300046531 | Bacteria | 4330 |
| 632 | Ga0495640_0036373 | 3300046533 | Bacteria | 3479 |
| 633 | Ga0495640_0044927 | 3300046533 | Bacteria | 3067 |
| 634 | Ga0495586_0031387 | 3300046535 | Bacteria | 2845 |
| 635 | Ga0495586_0097081 | 3300046535 | Bacteria | 1632 |
| 636 | Ga0495587_0003209 | 3300046536 | Bacteria | 10928 |
| 637 | Ga0495587_0035946 | 3300046536 | Bacteria | 2982 |
| 638 | Ga0495587_0060897 | 3300046536 | Bacteria | 2212 |
| 639 | Ga0495645_0000167 | 3300046543 | Bacteria | 45640 |
| 640 | Ga0495645_0036875 | 3300046543 | Bacteria | 3564 |
| 641 | Ga0495645_0064470 | 3300046543 | Bacteria | 2651 |
| 642 | Ga0495622_0040103 | 3300046557 | Bacteria | 2180 |
| 643 | Ga0495667_0002767 | 3300046559 | Bacteria | 11705 |
| 644 | Ga0495667_0006103 | 3300046559 | Bacteria | 8156 |
| 645 | Ga0495667_0014062 | 3300046559 | Bacteria | 5401 |
| 646 | Ga0495667_0020098 | 3300046559 | Bacteria | 4503 |
| 647 | Ga0495667_0030652 | 3300046559 | Archaea | 3613 |
| 648 | Ga0495634_0007772 | 3300046642 | Bacteria | 8020 |
| 649 | Ga0495634_0013178 | 3300046642 | Bacteria | 5975 |
| 650 | Ga0495634_0017131 | 3300046642 | Bacteria | 5174 |
| 651 | Ga0495634_0021970 | 3300046642 | Bacteria | 4500 |
| 652 | Ga0495634_0046066 | 3300046642 | Bacteria | 2944 |
| 653 | Ga0495635_0000190 | 3300046663 | Bacteria | 38869 |
| 654 | Ga0495635_0003200 | 3300046663 | Bacteria | 11286 |
| 655 | Ga0495635_0006815 | 3300046663 | Bacteria | 7984 |
| 656 | Ga0495635_0010731 | 3300046663 | Bacteria | 6416 |
| 657 | Ga0495635_0011831 | 3300046663 | Bacteria | 6117 |
| 658 | Ga0495635_0020663 | 3300046663 | Bacteria | 4586 |
| 659 | Ga0495588_0036124 | 3300046674 | Bacteria | 2506 |
| 660 | Ga0495657_0016521 | 3300046675 | Bacteria | 5377 |
| 661 | Ga0495657_0041543 | 3300046675 | Bacteria | 3145 |
| 662 | Ga0495657_0045429 | 3300046675 | Bacteria | 2980 |
| 663 | Ga0495657_0048544 | 3300046675 | Bacteria | 2863 |
| 664 | Ga0495657_0051060 | 3300046675 | Bacteria | 2778 |
| 665 | Ga0495657_0082292 | 3300046675 | Bacteria | 2080 |
| 666 | Ga0495657_0143749 | 3300046675 | Bacteria | 1485 |
| 667 | Ga0495657_0266460 | 3300046675 | Bacteria | 1028 |
| 668 | Ga0495599_0007441 | 3300046678 | Bacteria | 6641 |
| 669 | Ga0495599_0013130 | 3300046678 | Bacteria | 5118 |
| 670 | Ga0495599_0020971 | 3300046678 | Bacteria | 4074 |
| 671 | Ga0495599_0033598 | 3300046678 | Bacteria | 3224 |
| 672 | Ga0495599_0034575 | 3300046678 | Bacteria | 3174 |
| 673 | Ga0495599_0061663 | 3300046678 | Archaea | 2343 |
| 674 | Ga0495599_0090521 | 3300046678 | Bacteria | 1909 |
| 675 | Ga0495599_0164099 | 3300046678 | Bacteria | 1372 |
| 676 | Ga0495623_0025763 | 3300046679 | Bacteria | 3787 |
| 677 | Ga0495623_0039843 | 3300046679 | Bacteria | 3002 |
| 678 | Ga0495623_0079433 | 3300046679 | Bacteria | 2032 |
| 679 | Ga0495623_0083946 | 3300046679 | Bacteria | 1966 |
| 680 | Ga0495646_0011962 | 3300046680 | Bacteria | 5520 |
| 681 | Ga0495646_0047786 | 3300046680 | Bacteria | 2603 |
| 682 | Ga0495646_0158789 | 3300046680 | Bacteria | 1253 |
| 683 | Ga0495646_0171341 | 3300046680 | Bacteria | 1196 |
| 684 | Ga0495647_0003770 | 3300046681 | Bacteria | 4875 |
| 685 | Ga0495647_0173985 | 3300046681 | Bacteria | 934 |
| 686 | Ga0495658_0000340 | 3300046683 | Bacteria | 26360 |
| 687 | Ga0495658_0076748 | 3300046683 | Bacteria | 1953 |
| 688 | Ga0495658_0170341 | 3300046683 | Bacteria | 1347 |
| 689 | Ga0495613_0005640 | 3300046689 | Bacteria | 9390 |
| 690 | Ga0495613_0137910 | 3300046689 | Bacteria | 1744 |
| 691 | Ga0495613_0300808 | 3300046689 | Bacteria | 1110 |
| 692 | Ga0495624_0000442 | 3300046690 | Bacteria | 32670 |
| 693 | Ga0495624_0000590 | 3300046690 | Bacteria | 28259 |
| 694 | Ga0495624_0128967 | 3300046690 | Bacteria | 1551 |
| 695 | Ga0495624_0174348 | 3300046690 | Bacteria | 1311 |
| 696 | Ga0495624_0239046 | 3300046690 | Bacteria | 1099 |
| 697 | Ga0495600_0000437 | 3300046809 | Bacteria | 21408 |
| 698 | Ga0495600_0024484 | 3300046809 | Bacteria | 3886 |
| 699 | Ga0495600_0054611 | 3300046809 | Bacteria | 2609 |
| 700 | Ga0495581_0000704 | 3300047315 | Bacteria | 17572 |
| 701 | Ga0495581_0006341 | 3300047315 | Bacteria | 6860 |
| 702 | Ga0495604_0000286 | 3300047317 | Bacteria | 45196 |
| 703 | Ga0495604_0059033 | 3300047317 | Bacteria | 2943 |
| 704 | Ga0495604_0243376 | 3300047317 | Bacteria | 1229 |
| 705 | Ga0495674_0001722 | 3300047319 | Bacteria | 21498 |
| 706 | Ga0495674_0007339 | 3300047319 | Bacteria | 10538 |
| 707 | Ga0495674_0016629 | 3300047319 | Bacteria | 6864 |
| 708 | Ga0495674_0041539 | 3300047319 | Bacteria | 4107 |
| 709 | Ga0495674_0059750 | 3300047319 | Archaea | 3329 |
| 710 | Ga0495674_0389475 | 3300047319 | Bacteria | 1126 |
| 711 | Ga0495676_0000478 | 3300047321 | Bacteria | 32779 |
| 712 | Ga0495676_0005837 | 3300047321 | Bacteria | 11300 |
| 713 | Ga0495676_0093045 | 3300047321 | Bacteria | 2249 |
| 714 | Ga0495676_0141292 | 3300047321 | Bacteria | 1725 |
| 715 | Ga0495676_0182385 | 3300047321 | Bacteria | 1470 |
| 716 | Ga0495680_0002155 | 3300047322 | Bacteria | 20405 |
| 717 | Ga0495680_0004262 | 3300047322 | Bacteria | 13733 |
| 718 | Ga0495680_0005727 | 3300047322 | Bacteria | 11637 |
| 719 | Ga0495680_0006558 | 3300047322 | Bacteria | 10801 |
| 720 | Ga0495680_0009281 | 3300047322 | Bacteria | 8861 |
| 721 | Ga0495680_0010122 | 3300047322 | Bacteria | 8431 |
| 722 | Ga0495680_0019225 | 3300047322 | Bacteria | 5775 |
| 723 | Ga0495680_0025076 | 3300047322 | Bacteria | 4939 |
| 724 | Ga0495680_0032136 | 3300047322 | Bacteria | 4264 |
| 725 | Ga0495680_0097794 | 3300047322 | Bacteria | 2190 |
| 726 | Ga0495675_0009854 | 3300047444 | Bacteria | 5957 |
| 727 | Ga0495675_0041659 | 3300047444 | Bacteria | 2926 |
| 728 | Ga0495675_0054353 | 3300047444 | Bacteria | 2541 |
| 729 | Ga0495675_0163424 | 3300047444 | Bacteria | 1370 |
| 730 | Ga0495673_0026705 | 3300047469 | Bacteria | 2757 |
| 731 | Ga0495681_0087787 | 3300047470 | Bacteria | 1378 |
| 732 | Ga0495684_0003349 | 3300047471 | Bacteria | 12582 |
| 733 | Ga0495684_0012238 | 3300047471 | Bacteria | 6619 |
| 734 | Ga0495684_0026162 | 3300047471 | Bacteria | 4483 |
| 735 | Ga0495684_0033620 | 3300047471 | Bacteria | 3932 |
| 736 | Ga0495684_0064635 | 3300047471 | Bacteria | 2781 |
| 737 | Ga0495684_0076312 | 3300047471 | Bacteria | 2545 |
| 738 | Ga0495684_0252568 | 3300047471 | Bacteria | 1282 |
| 739 | Ga0495684_0259062 | 3300047471 | Bacteria | 1262 |
| 740 | Ga0495684_0315066 | 3300047471 | Unclassified | 1120 |
| 741 | Ga0495593_0001228 | 3300047673 | Bacteria | 14990 |
| 742 | Ga0495593_0008486 | 3300047673 | Bacteria | 5972 |
| 743 | Ga0495593_0047643 | 3300047673 | Bacteria | 2279 |
| 744 | Ga0495602_0005728 | 3300048088 | Bacteria | 13031 |
| 745 | Ga0495602_0028054 | 3300048088 | Bacteria | 5397 |
| 746 | Ga0495602_0028844 | 3300048088 | Bacteria | 5302 |
| 747 | Ga0495602_0106811 | 3300048088 | Bacteria | 2284 |
| 748 | Ga0495614_0012072 | 3300048089 | Bacteria | 3794 |
| 749 | Ga0496100_0006354 | 3300048903 | Bacteria | 6438 |
| 750 | Ga0496100_0198861 | 3300048903 | Bacteria | 1459 |
| 751 | Ga0496101_0111906 | 3300048904 | Bacteria | 2056 |
| 752 | Ga0496101_0147404 | 3300048904 | Bacteria | 1798 |
| 753 | Ga0496102_0155758 | 3300048905 | Bacteria | 2148 |
| 754 | Ga0496104_0009114 | 3300048907 | Bacteria | 8824 |
| 755 | Ga0496104_0039441 | 3300048907 | Bacteria | 4422 |
| 756 | Ga0496104_0220347 | 3300048907 | Bacteria | 1809 |
| 757 | Ga0496104_0571422 | 3300048907 | Bacteria | 1041 |
| 758 | Ga0496105_0003118 | 3300048908 | Bacteria | 12200 |
| 759 | Ga0496105_0032854 | 3300048908 | Bacteria | 4258 |
| 760 | Ga0496106_0114518 | 3300048909 | Bacteria | 2103 |
| 761 | Ga0496106_0116666 | 3300048909 | Bacteria | 2083 |
| 762 | Ga0496106_0132321 | 3300048909 | Bacteria | 1957 |
| 763 | Ga0496106_0187207 | 3300048909 | Bacteria | 1645 |
| 764 | Ga0496106_0206568 | 3300048909 | Bacteria | 1564 |
| 765 | Ga0496107_0232322 | 3300048910 | Bacteria | 1372 |
| 766 | Ga0496108_0015217 | 3300048911 | Bacteria | 6277 |
| 767 | Ga0496108_0068466 | 3300048911 | Bacteria | 2995 |
| 768 | Ga0496108_0252696 | 3300048911 | Bacteria | 1533 |
| 769 | Ga0496109_0173558 | 3300048912 | Bacteria | 2023 |
| 770 | Ga0496109_0183422 | 3300048912 | Bacteria | 1966 |
| 771 | Ga0496109_0293601 | 3300048912 | Bacteria | 1532 |
| 772 | Ga0496109_0341671 | 3300048912 | Bacteria | 1414 |
| 773 | Ga0496109_0360656 | 3300048912 | Bacteria | 1373 |
| 774 | Ga0496109_0398259 | 3300048912 | Bacteria | 1301 |
| 775 | Ga0496110_0119797 | 3300048913 | Bacteria | 2371 |
| 776 | Ga0496110_0125738 | 3300048913 | Bacteria | 2313 |
| 777 | Ga0496111_0146050 | 3300048914 | Bacteria | 1753 |
| 778 | Ga0496112_0001084 | 3300048915 | Bacteria | 20135 |
| 779 | Ga0496112_0223214 | 3300048915 | Bacteria | 1840 |
| 780 | Ga0496112_0585463 | 3300048915 | Bacteria | 1048 |
| 781 | Ga0496113_0141423 | 3300048916 | Bacteria | 1894 |
| 782 | Ga0496113_0166636 | 3300048916 | Bacteria | 1743 |
| 783 | Ga0496114_0180263 | 3300048917 | Bacteria | 1845 |
| 784 | Ga0496114_0230442 | 3300048917 | Bacteria | 1627 |
| 785 | Ga0496114_0389139 | 3300048917 | Bacteria | 1235 |
| 786 | Ga0496115_0216089 | 3300048918 | Bacteria | 1583 |
| 787 | Ga0496115_0413081 | 3300048918 | Bacteria | 1094 |
| 788 | Ga0496125_0000574 | 3300048928 | Bacteria | 62986 |
| 789 | Ga0501031_0002065 | 3300049568 | Bacteria | 12646 |
| 790 | Ga0501033_0055224 | 3300049570 | Bacteria | 2937 |
| 791 | Ga0501034_0710891 | 3300049571 | Bacteria | 903 |
| 792 | Ga0501036_0003896 | 3300049572 | Bacteria | 11974 |
| 793 | Ga0501036_0035976 | 3300049572 | Bacteria | 4189 |
| 794 | Ga0501036_0206738 | 3300049572 | Bacteria | 1650 |
| 795 | Ga0501037_0012765 | 3300049573 | Bacteria | 6188 |
| 796 | Ga0501038_0046127 | 3300049574 | Bacteria | 3779 |
| 797 | Ga0501038_0220497 | 3300049574 | Bacteria | 1513 |
| 798 | Ga0501039_0003050 | 3300049575 | Bacteria | 12529 |
| 799 | Ga0501039_0046370 | 3300049575 | Bacteria | 3358 |
| 800 | Ga0501040_0002380 | 3300049576 | Bacteria | 12085 |
| 801 | Ga0501040_0006723 | 3300049576 | Bacteria | 7459 |
| 802 | Ga0501040_0054555 | 3300049576 | Bacteria | 2740 |
| 803 | Ga0501041_0000943 | 3300049577 | Bacteria | 15788 |
| 804 | Ga0501041_0020859 | 3300049577 | Bacteria | 3922 |
| 805 | Ga0501042_0000510 | 3300049578 | Bacteria | 20275 |
| 806 | Ga0501042_0122988 | 3300049578 | Bacteria | 1868 |
| 807 | Ga0501043_0038365 | 3300049579 | Bacteria | 3767 |
| 808 | Ga0501043_0277043 | 3300049579 | Bacteria | 1286 |
| 809 | Ga0501046_0000458 | 3300049580 | Bacteria | 40789 |
| 810 | Ga0501046_0140984 | 3300049580 | Bacteria | 1824 |
| 811 | Ga0501048_0039767 | 3300049582 | Bacteria | 3372 |
| 812 | Ga0501048_0168988 | 3300049582 | Bacteria | 1548 |
| 813 | Ga0501069_0139179 | 3300049585 | Bacteria | 1392 |
| 814 | Ga0501071_0001850 | 3300049587 | Bacteria | 12553 |
| 815 | Ga0501071_0076939 | 3300049587 | Bacteria | 2437 |
| 816 | Ga0501072_0003100 | 3300049588 | Bacteria | 12525 |
| 817 | Ga0501073_0142916 | 3300049589 | Bacteria | 1658 |
| 818 | Ga0501074_0002795 | 3300049590 | Bacteria | 12214 |
| 819 | Ga0501074_0010061 | 3300049590 | Bacteria | 6866 |
| 820 | Ga0501075_0009015 | 3300049591 | Bacteria | 6962 |
| 821 | Ga0501075_0040749 | 3300049591 | Bacteria | 3479 |
| 822 | Ga0501075_0113719 | 3300049591 | Bacteria | 2058 |
| 823 | Ga0501076_0004485 | 3300049592 | Bacteria | 9942 |
| 824 | Ga0501076_0155011 | 3300049592 | Bacteria | 1864 |
| 825 | Ga0501077_0001971 | 3300049593 | Bacteria | 12410 |
| 826 | Ga0501079_0000220 | 3300049741 | Bacteria | 33882 |
| 827 | Ga0501079_0050886 | 3300049741 | Bacteria | 3197 |
| 828 | Ga0501079_0063185 | 3300049741 | Bacteria | 2857 |
| 829 | Ga0501080_0087479 | 3300049742 | Bacteria | 2895 |
| 830 | Ga0501080_0139279 | 3300049742 | Bacteria | 2244 |
| 831 | Ga0501081_0002486 | 3300049743 | Bacteria | 11617 |
| 832 | Ga0501081_0076693 | 3300049743 | Bacteria | 2334 |
| 833 | Ga0501083_0198691 | 3300049744 | Bacteria | 1308 |
| 834 | Ga0501035_0122930 | 3300049822 | Bacteria | 2267 |
| 835 | Ga0501044_0211018 | 3300049823 | Bacteria | 1896 |
| 836 | Ga0501045_0002537 | 3300049824 | Bacteria | 12438 |
| 837 | Ga0501045_0006419 | 3300049824 | Bacteria | 8144 |
| 838 | Ga0501045_0314685 | 3300049824 | Bacteria | 1165 |
| 839 | nmdc:mga06r32_613022_c1 | 3300050510 | Bacteria | 1058 |
| 840 | nmdc:mga08y16_196436_c1 | 3300050511 | Bacteria | 2091 |
| 841 | nmdc:mga08y16_84408_c1 | 3300050511 | Bacteria | 3310 |
| 842 | nmdc:mga0n895_11002_c1 | 3300050512 | Bacteria | 8042 |
| 843 | nmdc:mga0rr50_18597_c1 | 3300050513 | Bacteria | 4672 |
| 844 | Ga0495601_0001416 | 3300053077 | Bacteria | 13210 |
| 845 | Ga0495601_0071886 | 3300053077 | Bacteria | 2209 |
| 846 | Ga0495601_0095577 | 3300053077 | Bacteria | 1916 |
| 847 | Ga0495601_0215658 | 3300053077 | Bacteria | 1253 |
| 848 | Ga0495612_0004272 | 3300053078 | Bacteria | 5936 |
| 849 | Ga0495612_0072580 | 3300053078 | Bacteria | 1437 |
| 850 | Ga0495595_0001306 | 3300053084 | Bacteria | 9700 |
| 851 | Ga0495595_0008392 | 3300053084 | Bacteria | 4240 |
| 852 | Ga0495595_0032570 | 3300053084 | Bacteria | 2348 |
| 853 | Ga0495619_0004523 | 3300053085 | Bacteria | 8879 |
| 854 | Ga0495619_0072249 | 3300053085 | Bacteria | 2310 |
| 855 | Ga0495619_0075126 | 3300053085 | Bacteria | 2267 |
| 856 | Ga0495619_0162790 | 3300053085 | Bacteria | 1541 |
| 857 | Ga0501084_0001665 | 3300054114 | Bacteria | 17665 |
| 858 | Ga0501084_0003268 | 3300054114 | Bacteria | 13111 |
| 859 | Ga0590071_004517 | 3300059421 | Bacteria | 3376 |
| 860 | Ga0590074_010613 | 3300059423 | Bacteria | 1539 |
| 861 | Ga0590077_003016 | 3300059426 | Bacteria | 3525 |
| 862 | Ga0501082_0003933 | 3300060353 | Bacteria | 12961 |
| 863 | Ga0501082_0082026 | 3300060353 | Bacteria | 2782 |
| 864 | Ga0530510_0002641 | 3300061734 | Bacteria | 12323 |
| 865 | 2509112777 | 2508501122 | Bacteria | 6292184 |
| 866 | 2520375493 | 2519899620 | Bacteria | 6499161 |
| 867 | 2524454203 | 2524023207 | Bacteria | 6813453 |
| 868 | 2524454399 | 2524023207 | Bacteria | 6813453 |
| 869 | 2623500827 | 2622736605 | Bacteria | 4992138 |
| 870 | 2719669013 | 2718217997 | Bacteria | 6740740 |
| 871 | 2720489707 | 2718218199 | Bacteria | 6740745 |
| 872 | 2720610439 | 2718218232 | Bacteria | 6720332 |
| 873 | 2720628983 | 2718218235 | Bacteria | 6630699 |
| 874 | 2720772968 | 2718218269 | Bacteria | 6906114 |
| 875 | 2723030394 | 2721755556 | Bacteria | 6745503 |
| 876 | 2723564756 | 2721755684 | Bacteria | 6859907 |
| 877 | 2723570277 | 2721755685 | Bacteria | 6704835 |
| 878 | 2724092997 | 2721755819 | Bacteria | 6906405 |
| 879 | 2724101824 | 2721755822 | Bacteria | 6726041 |
| 880 | 2724113379 | 2721755823 | Bacteria | 6752556 |
| 881 | 2730110927 | 2728369352 | Bacteria | 6745171 |
| 882 | 2838045419 | 2838042994 | Bacteria | 6046894 |
| 883 | 2838064502 | 2838061910 | Bacteria | 6794874 |
| 884 | 2842265619 | 2842264693 | Bacteria | 6472963 |
| 885 | 2842428331 | 2842428310 | Bacteria | 6767288 |
| 886 | 2842434945 | 2842434925 | Bacteria | 6502746 |
| 887 | 2842442193 | 2842441272 | Bacteria | 6769273 |
| 888 | 2842469277 | 2842469257 | Bacteria | 6752936 |
| 889 | 2856288248 | 2856287931 | Bacteria | 7223934 |
| 890 | 2883294553 | 2883291878 | Bacteria | 5894118 |
| 891 | 8005286014 | 8005282627 | Bacteria | 6675747 |
| 892 | 8005624463 | 8005619151 | Bacteria | 7030230 |
| 893 | 8054473621 | 8054472261 | Bacteria | 7464355 |
| 894 | Ga0070699_100004487 | |||
| 895 | JGI25407J50210_10033097 | |||
| 896 | JGI25404J52841_10016018 | |||
| 897 | Ga0065714_10064488 | |||
| 898 | Ga0070658_10044196 | |||
| 899 | Ga0070683_100069142 | |||
| 900 | Ga0070690_100137485 | |||
| 901 | Ga0070690_100249112 | |||
| 902 | Ga0068869_100010792 | |||
| 903 | Ga0068869_100017165 | |||
| 904 | Ga0070682_100085427 | |||
| 905 | Ga0070682_100260966 | |||
| 906 | Ga0068868_100049779 | |||
| 907 | Ga0068868_100102203 | |||
| 908 | Ga0068868_100139737 | |||
| 909 | Ga0070660_100110427 | |||
| 910 | Ga0070660_100212352 | |||
| 911 | Ga0070689_100192148 | |||
| 912 | Ga0070689_100274564 | |||
| 913 | Ga0070691_10094271 | |||
| 914 | Ga0070691_10100528 | |||
| 915 | Ga0070687_100021534 | |||
| 916 | Ga0070661_100201543 | |||
| 917 | Ga0070661_100251876 | |||
| 918 | Ga0070669_100326364 | |||
| 919 | Ga0070669_100478132 | |||
| 920 | Ga0070675_100222727 | |||
| 921 | Ga0070671_100119557 | |||
| 922 | Ga0070671_100278399 | |||
| 923 | Ga0070674_100042793 | |||
| 924 | Ga0070674_100073239 | |||
| 925 | Ga0070673_100179484 | |||
| 926 | Ga0070659_100243969 | |||
| 927 | Ga0070667_100050321 | |||
| 928 | Ga0070703_10005742 | |||
| 929 | Ga0070703_10037325 | |||
| 930 | Ga0070709_10000496 | |||
| 931 | Ga0070709_10040329 | |||
| 932 | Ga0070714_100001238 | |||
| 933 | Ga0070714_100015331 | |||
| 934 | Ga0070714_100045294 | |||
| 935 | Ga0070714_100079343 | |||
| 936 | Ga0070714_100096627 | |||
| 937 | Ga0070714_100215790 | |||
| 938 | Ga0070713_100000944 | |||
| 939 | Ga0070713_100503841 | |||
| 940 | Ga0070710_10000118 | |||
| 941 | Ga0070710_10009882 | |||
| 942 | Ga0070710_10098838 | |||
| 943 | Ga0070710_10101197 | |||
| 944 | Ga0070701_10178762 | |||
| 945 | Ga0070711_100002360 | |||
| 946 | Ga0070711_100059222 | |||
| 947 | Ga0070711_100223794 | |||
| 948 | Ga0070711_100242638 | |||
| 949 | Ga0070711_100260594 | |||
| 950 | Ga0070705_100145214 | |||
| 951 | Ga0070700_100041275 | |||
| 952 | Ga0070700_100203392 | |||
| 953 | Ga0070694_100337821 | |||
| 954 | Ga0070708_100045027 | |||
| 955 | Ga0070708_100053865 | |||
| 956 | Ga0070708_100096805 | |||
| 957 | Ga0070663_100026750 | |||
| 958 | Ga0070663_100068412 | |||
| 959 | Ga0070663_100070226 | |||
| 960 | Ga0070678_100244096 | |||
| 961 | Ga0070678_100264280 | |||
| 962 | Ga0070662_100022030 | |||
| 963 | Ga0070662_100067850 | |||
| 964 | Ga0070662_100283197 | |||
| 965 | Ga0070681_10015427 | |||
| 966 | Ga0070681_10077661 | |||
| 967 | Ga0070681_10461428 | |||
| 968 | Ga0068867_100085865 | |||
| 969 | Ga0068867_100131368 | |||
| 970 | Ga0070685_10225494 | |||
| 971 | Ga0070706_100000149 | |||
| 972 | Ga0070706_100007316 | |||
| 973 | Ga0070706_100055140 | |||
| 974 | Ga0070706_100065035 | |||
| 975 | Ga0070706_100076714 | |||
| 976 | Ga0070706_100268544 | |||
| 977 | Ga0070707_100018717 | |||
| 978 | Ga0070707_100324042 | |||
| 979 | Ga0070698_100000884 | |||
| 980 | Ga0070698_100018754 | |||
| 981 | Ga0070698_100052216 | |||
| 982 | Ga0070698_100065588 | |||
| 983 | Ga0070699_100015634 | |||
| 984 | Ga0070699_100165682 | |||
| 985 | Ga0070679_100019594 | |||
| 986 | Ga0070679_100546029 | |||
| 987 | Ga0070684_100048522 | |||
| 988 | Ga0070684_100129915 | |||
| 989 | Ga0070684_100144787 | |||
| 990 | Ga0070684_100234587 | |||
| 991 | Ga0070684_100245578 | |||
| 992 | Ga0070684_100287154 | |||
| 993 | Ga0070697_100006268 | |||
| 994 | Ga0070697_100057955 | |||
| 995 | Ga0070697_100106631 | |||
| 996 | Ga0068853_100473756 | |||
| 997 | Ga0070672_100080295 | |||
| 998 | Ga0070672_100365095 | |||
| 999 | Ga0070695_100148228 | |||
| 1000 | Ga0070695_100209748 | |||
| 1001 | Ga0070696_100071444 | |||
| 1002 | Ga0070696_100071601 | |||
| 1003 | Ga0070693_100040960 | |||
| 1004 | Ga0070665_100136861 | |||
| 1005 | Ga0070704_100090954 | |||
| 1006 | Ga0070704_100365746 | |||
| 1007 | Ga0070704_100497786 | |||
| 1008 | Ga0068855_100084690 | |||
| 1009 | Ga0068855_100090424 | |||
| 1010 | Ga0068855_100156067 | |||
| 1011 | Ga0068855_100283344 | |||
| 1012 | Ga0068855_100538367 | |||
| 1013 | Ga0070664_100091530 | |||
| 1014 | Ga0068857_100479504 | |||
| 1015 | Ga0068857_100513623 | |||
| 1016 | Ga0068854_100149865 | |||
| 1017 | Ga0068856_100012742 | |||
| 1018 | Ga0068856_100339520 | |||
| 1019 | Ga0070702_100083932 | |||
| 1020 | Ga0070702_100141996 | |||
| 1021 | Ga0068852_100174825 | |||
| 1022 | Ga0068859_100009055 | |||
| 1023 | Ga0068859_100056371 | |||
| 1024 | Ga0068859_100113423 | |||
| 1025 | Ga0068864_100077034 | |||
| 1026 | Ga0068864_100191991 | |||
| 1027 | Ga0068864_100304684 | |||
| 1028 | Ga0068866_10157680 | |||
| 1029 | Ga0068866_10195038 | |||
| 1030 | Ga0068861_100073391 | |||
| 1031 | Ga0068861_100088615 | |||
| 1032 | Ga0068870_10197166 | |||
| 1033 | Ga0068863_100025751 | |||
| 1034 | Ga0068863_100343866 | |||
| 1035 | Ga0068858_100163325 | |||
| 1036 | Ga0068860_100316818 | |||
| 1037 | Ga0068860_100491332 | |||
| 1038 | Ga0068862_100041217 | |||
| 1039 | Ga0068862_100635150 | |||
| 1040 | Ga0081455_10033872 | |||
| 1041 | Ga0081455_10120187 | |||
| 1042 | Ga0081538_10000799 | |||
| 1043 | Ga0081538_10004349 | |||
| 1044 | Ga0081538_10006649 | |||
| 1045 | Ga0081538_10008135 | |||
| 1046 | Ga0081538_10015545 | |||
| 1047 | Ga0081538_10041385 | |||
| 1048 | Ga0081540_1002707 | |||
| 1049 | Ga0081540_1045742 | |||
| 1050 | Ga0070717_10000940 | |||
| 1051 | Ga0070717_10014268 | |||
| 1052 | Ga0070717_10114208 | |||
| 1053 | Ga0070717_10130253 | |||
| 1054 | Ga0070715_10002346 | |||
| 1055 | Ga0070715_10011075 | |||
| 1056 | Ga0070715_10027656 | |||
| 1057 | Ga0070715_10066592 | |||
| 1058 | Ga0070716_100000135 | |||
| 1059 | Ga0070716_100074001 | |||
| 1060 | Ga0070716_100095425 | |||
| 1061 | Ga0070716_100102757 | |||
| 1062 | Ga0070712_100002084 | |||
| 1063 | Ga0070712_100082843 | |||
| 1064 | Ga0070712_100273923 | |||
| 1065 | Ga0097621_100029089 | |||
| 1066 | Ga0097621_100069760 | |||
| 1067 | Ga0097621_100118806 | |||
| 1068 | Ga0068871_100120275 | |||
| 1069 | Ga0075428_100128048 | |||
| 1070 | Ga0075431_100204336 | |||
| 1071 | Ga0075434_100037748 | |||
| 1072 | Ga0075434_100446495 | |||
| 1073 | Ga0075429_100147457 | |||
| 1074 | Ga0068865_100264674 | |||
| 1075 | Ga0068865_100389707 | |||
| 1076 | Ga0097620_100009055 | |||
| 1077 | Ga0097620_100056374 | |||
| 1078 | Ga0097620_100113414 | |||
| 1079 | Ga0075435_100014105 | |||
| 1080 | Ga0099795_10042369 | |||
| 1081 | Ga0105251_10124069 | |||
| 1082 | Ga0105240_10465849 | |||
| 1083 | Ga0105240_10582259 | |||
| 1084 | Ga0111539_10099904 | |||
| 1085 | Ga0111539_10143364 | |||
| 1086 | Ga0105245_10055902 | |||
| 1087 | Ga0105245_10120442 | |||
| 1088 | Ga0105245_10238001 | |||
| 1089 | Ga0105245_10379643 | |||
| 1090 | Ga0105245_10417587 | |||
| 1091 | Ga0105247_10043647 | |||
| 1092 | Ga0105247_10085619 | |||
| 1093 | Ga0105247_10092612 | |||
| 1094 | Ga0105247_10199081 | |||
| 1095 | Ga0114129_10019373 | |||
| 1096 | Ga0114129_10068104 | |||
| 1097 | Ga0105243_10021830 | |||
| 1098 | Ga0105243_10053332 | |||
| 1099 | Ga0105243_10053889 | |||
| 1100 | Ga0105241_10142570 | |||
| 1101 | Ga0105241_10166641 | |||
| 1102 | Ga0105248_10022968 | |||
| 1103 | Ga0105248_10024179 | |||
| 1104 | Ga0105248_10178508 | |||
| 1105 | Ga0105237_10144090 | |||
| 1106 | Ga0105237_10242608 | |||
| 1107 | Ga0105237_10435784 | |||
| 1108 | Ga0105238_10264240 | |||
| 1109 | Ga0105238_10429023 | |||
| 1110 | Ga0105249_10041332 | |||
| 1111 | Ga0105249_10177789 | |||
| 1112 | Ga0105249_10337798 | |||
| 1113 | Ga0105239_10058076 | |||
| 1114 | Ga0105239_10143237 | |||
| 1115 | Ga0105239_10431872 | |||
| 1116 | Ga0105239_10827901 | |||
| 1117 | Ga0105246_10453403 | |||
| 1118 | Ga0157340_1002853 | |||
| 1119 | Ga0157335_1003549 | |||
| 1120 | Ga0157339_1003929 | |||
| 1121 | Ga0157371_10237905 | |||
| 1122 | Ga0157370_10398503 | |||
| 1123 | Ga0157369_10240449 | |||
| 1124 | Ga0157374_10022843 | |||
| 1125 | Ga0157374_10028837 | |||
| 1126 | Ga0157374_10238213 | |||
| 1127 | Ga0163162_10236490 | |||
| 1128 | Ga0163162_10330763 | |||
| 1129 | Ga0157372_10125617 | |||
| 1130 | Ga0157372_10178822 | |||
| 1131 | Ga0157372_10559830 | |||
| 1132 | Ga0157375_10016093 | |||
| 1133 | Ga0157375_10036066 | |||
| 1134 | Ga0157375_10188051 | |||
| 1135 | Ga0163163_10066668 | |||
| 1136 | Ga0163163_10144868 | |||
| 1137 | Ga0157380_10067315 | |||
| 1138 | Ga0182008_10075339 | |||
| 1139 | Ga0157377_10171036 | |||
| 1140 | Ga0157379_10145255 | |||
| 1141 | Ga0157379_10209448 | |||
| 1142 | Ga0157379_10288808 | |||
| 1143 | Ga0157379_10566661 | |||
| 1144 | Ga0157376_10121694 | |||
| 1145 | Ga0157376_10206071 | |||
| 1146 | Ga0182005_1000222 | |||
| 1147 | Ga0163161_10268741 | |||
| 1148 | Ga0206351_10157124 | |||
| 1149 | Ga0206354_10659615 | |||
| 1150 | Ga0213873_10020569 | |||
| 1151 | Ga0213874_10069298 | |||
| 1152 | Ga0213875_10006446 | |||
| 1153 | Ga0213875_10104874 | |||
| 1154 | Ga0213875_10125439 | |||
| 1155 | Ga0224712_10106508 | |||
| 1156 | Ga0224712_10107799 | |||
| 1157 | Ga0207656_10075084 | |||
| 1158 | Ga0207656_10079477 | |||
| 1159 | Ga0207692_10018518 | |||
| 1160 | Ga0207692_10059681 | |||
| 1161 | Ga0207692_10078569 | |||
| 1162 | Ga0207692_10168871 | |||
| 1163 | Ga0207710_10104803 | |||
| 1164 | Ga0207688_10005068 | |||
| 1165 | Ga0207688_10007486 | |||
| 1166 | Ga0207680_10105598 | |||
| 1167 | Ga0207680_10167817 | |||
| 1168 | Ga0207647_10108815 | |||
| 1169 | Ga0207647_10125230 | |||
| 1170 | Ga0207685_10002244 | |||
| 1171 | Ga0207685_10018726 | |||
| 1172 | Ga0207685_10074280 | |||
| 1173 | Ga0207685_10076049 | |||
| 1174 | Ga0207685_10080271 | |||
| 1175 | Ga0207699_10000190 | |||
| 1176 | Ga0207699_10006021 | |||
| 1177 | Ga0207699_10013972 | |||
| 1178 | Ga0207699_10022566 | |||
| 1179 | Ga0207699_10195853 | |||
| 1180 | Ga0207645_10021979 | |||
| 1181 | Ga0207643_10149108 | |||
| 1182 | Ga0207643_10194289 | |||
| 1183 | Ga0207705_10210882 | |||
| 1184 | Ga0207684_10000119 | |||
| 1185 | Ga0207684_10011069 | |||
| 1186 | Ga0207684_10011969 | |||
| 1187 | Ga0207684_10056413 | |||
| 1188 | Ga0207654_10233640 | |||
| 1189 | Ga0207707_10047800 | |||
| 1190 | Ga0207707_10066747 | |||
| 1191 | Ga0207693_10001809 | |||
| 1192 | Ga0207693_10013660 | |||
| 1193 | Ga0207693_10074854 | |||
| 1194 | Ga0207693_10191374 | |||
| 1195 | Ga0207663_10001409 | |||
| 1196 | Ga0207663_10004562 | |||
| 1197 | Ga0207663_10200213 | |||
| 1198 | Ga0207662_10064210 | |||
| 1199 | Ga0207662_10235780 | |||
| 1200 | Ga0207657_10010642 | |||
| 1201 | Ga0207657_10020943 | |||
| 1202 | Ga0207652_10067620 | |||
| 1203 | Ga0207652_10632170 | |||
| 1204 | Ga0207646_10049126 | |||
| 1205 | Ga0207646_10070816 | |||
| 1206 | Ga0207646_10118464 | |||
| 1207 | Ga0207646_10165298 | |||
| 1208 | Ga0207681_10083898 | |||
| 1209 | Ga0207681_10223570 | |||
| 1210 | Ga0207687_10128130 | |||
| 1211 | Ga0207687_10314485 | |||
| 1212 | Ga0207700_10000043 | |||
| 1213 | Ga0207700_10101492 | |||
| 1214 | Ga0207700_10162419 | |||
| 1215 | Ga0207700_10230227 | |||
| 1216 | Ga0207700_10284075 | |||
| 1217 | Ga0207664_10000123 | |||
| 1218 | Ga0207664_10022951 | |||
| 1219 | Ga0207664_10023323 | |||
| 1220 | Ga0207664_10027592 | |||
| 1221 | Ga0207664_10076020 | |||
| 1222 | Ga0207664_10104882 | |||
| 1223 | Ga0207664_10175832 | |||
| 1224 | Ga0207664_10202807 | |||
| 1225 | Ga0207664_10336519 | |||
| 1226 | Ga0207644_10251668 | |||
| 1227 | Ga0207690_10126569 | |||
| 1228 | Ga0207706_10048647 | |||
| 1229 | Ga0207706_10074643 | |||
| 1230 | Ga0207706_10119859 | |||
| 1231 | Ga0207670_10157324 | |||
| 1232 | Ga0207670_10258556 | |||
| 1233 | Ga0207669_10017128 | |||
| 1234 | Ga0207704_10038204 | |||
| 1235 | Ga0207704_10173465 | |||
| 1236 | Ga0207704_10287333 | |||
| 1237 | Ga0207665_10000157 | |||
| 1238 | Ga0207665_10005348 | |||
| 1239 | Ga0207665_10019302 | |||
| 1240 | Ga0207665_10023765 | |||
| 1241 | Ga0207665_10048112 | |||
| 1242 | Ga0207665_10110236 | |||
| 1243 | Ga0207691_10045431 | |||
| 1244 | Ga0207691_10108567 | |||
| 1245 | Ga0207691_10178307 | |||
| 1246 | Ga0207711_10112570 | |||
| 1247 | Ga0207689_10003083 | |||
| 1248 | Ga0207689_10004491 | |||
| 1249 | Ga0207689_10019899 | |||
| 1250 | Ga0207689_10453665 | |||
| 1251 | Ga0207661_10088009 | |||
| 1252 | Ga0207679_10072368 | |||
| 1253 | Ga0207667_10380346 | |||
| 1254 | Ga0207651_10112719 | |||
| 1255 | Ga0207712_10076522 | |||
| 1256 | Ga0207712_10139952 | |||
| 1257 | Ga0207668_10047147 | |||
| 1258 | Ga0207658_10119055 | |||
| 1259 | Ga0207658_10171663 | |||
| 1260 | Ga0207677_10109046 | |||
| 1261 | Ga0207703_10523949 | |||
| 1262 | Ga0207678_10009116 | |||
| 1263 | Ga0207678_10055461 | |||
| 1264 | Ga0207708_10055642 | |||
| 1265 | Ga0207708_10059100 | |||
| 1266 | Ga0207708_10085776 | |||
| 1267 | Ga0207702_10111271 | |||
| 1268 | Ga0207641_10074329 | |||
| 1269 | Ga0207641_10079429 | |||
| 1270 | Ga0207641_10299232 | |||
| 1271 | Ga0207648_10024604 | |||
| 1272 | Ga0207648_10086218 | |||
| 1273 | Ga0207648_10287241 | |||
| 1274 | Ga0207676_10151114 | |||
| 1275 | Ga0207674_10019879 | |||
| 1276 | Ga0207674_10144296 | |||
| 1277 | Ga0207675_100084680 | |||
| 1278 | Ga0207675_100092165 | |||
| 1279 | Ga0207675_100107389 | |||
| 1280 | Ga0207675_100119529 | |||
| 1281 | Ga0207683_10079029 | |||
| 1282 | Ga0207683_10332448 | |||
| 1283 | Ga0207698_10333749 | |||
| 1284 | Ga0207698_10384319 | |||
| 1285 | Ga0207428_10117916 | |||
| 1286 | Ga0207428_10353865 | |||
| 1287 | Ga0268266_10096160 | |||
| 1288 | Ga0268266_10137374 | |||
| 1289 | Ga0268265_10044777 | |||
| 1290 | Ga0268265_10391322 | |||
| 1291 | Ga0268265_10655480 | |||
| 1292 | Ga0268264_10525656 | |||
| 1293 | Ga0265338_10002561 | |||
| 1294 | Ga0316575_10065491 | |||
| 1295 | Ga0316579_10052780 | |||
| 1296 | Ga0316576_10064216 | |||
| 1297 | Ga0316576_10079270 | |||
| 1298 | Ga0316576_10081853 | |||
| 1299 | Ga0316576_10194273 | |||
| 1300 | Ga0316576_10333179 | |||
| 1301 | Ga0316578_10010183 | |||
| 1302 | Ga0316578_10056587 | |||
| 1303 | Ga0307405_10027916 | |||
| 1304 | Ga0316577_10079541 | |||
| 1305 | Ga0307410_10111047 | |||
| 1306 | Ga0307410_10353248 | |||
| 1307 | Ga0307412_10250769 | |||
| 1308 | Ga0307409_100065011 | |||
| 1309 | Ga0307409_100243591 | |||
| 1310 | Ga0307416_100068345 | |||
| 1311 | Ga0307416_100070127 | |||
| 1312 | Ga0307416_100143419 | |||
| 1313 | Ga0307416_100517975 | |||
| 1314 | Ga0307411_10078299 | |||
| 1315 | Ga0307415_100059998 | |||
| 1316 | Ga0307415_100282037 | |||
| 1317 | Ga0316583_10049833 | |||
| 1318 | Ga0316585_10045036 | |||
| 1319 | Ga0316580_10027776 | |||
| 1320 | Ga0316588_1005050 | |||
| 1321 | Ga0316596_1042802 | |||
| 1322 | Ga0373926_0001226 | |||
| 1323 | Ga0373926_0020135 | |||
| 1324 | Ga0373928_0016167 | |||
| 1325 | Ga0373934_0008545 | |||
| 1326 | Ga0373934_0023732 | |||
| 1327 | Ga0373934_0032755 | |||
| 1328 | Ga0373934_0034592 | |||
| 1329 | Ga0373934_0039360 | |||
| 1330 | Ga0373944_0007930 | |||
| 1331 | Ga0373944_0070635 | |||
| 1332 | Ga0373923_0008131 | |||
| 1333 | Ga0373923_0158879 | |||
| 1334 | Ga0373932_0006677 | |||
| 1335 | Ga0373936_0000065 | |||
| 1336 | Ga0373936_0000557 | |||
| 1337 | Ga0373936_0012559 | |||
| 1338 | Ga0373936_0042807 | |||
| 1339 | Ga0373936_0043340 | |||
| 1340 | Ga0373945_0000072 | |||
| 1341 | Ga0373945_0008710 | |||
| 1342 | Ga0373945_0040060 | |||
| 1343 | Ga0373945_0061556 | |||
| 1344 | Ga0373953_0004979 | |||
| 1345 | Ga0373953_0061152 | |||
| 1346 | Ga0373954_0023538 | |||
| 1347 | Ga0373954_0033443 | |||
| 1348 | Ga0373954_0055836 | |||
| 1349 | Ga0373954_0078376 | |||
| 1350 | Ga0373954_0136716 | |||
| 1351 | Ga0373956_0092206 | |||
| 1352 | Ga0373956_0095251 | |||
| 1353 | Ga0373957_0007546 | |||
| 1354 | Ga0373957_0026354 | |||
| 1355 | Ga0373957_0081318 | |||
| 1356 | Ga0373957_0085663 | |||
| 1357 | Ga0373943_0003543 | |||
| 1358 | Ga0373943_0049116 | |||
| 1359 | Ga0373943_0145901 | |||
| 1360 | Ga0373943_0145939 | |||
| 1361 | Ga0373946_0003354 | |||
| 1362 | Ga0373955_0003475 | |||
| 1363 | Ga0373955_0010304 | |||
| 1364 | Ga0373955_0061214 | |||
| 1365 | Ga0373955_0099279 | |||
| 1366 | Ga0373942_0040111 | |||
| 1367 | Ga0373961_0006687 | |||
| 1368 | Ga0373962_0035861 | |||
| 1369 | Ga0316574_0047167 | |||
| 1370 | Ga0316574_0054507 | |||
| 1371 | Ga0316574_0084675 | |||
| 1372 | Ga0373924_0000934 | |||
| 1373 | Ga0373924_0077439 | |||
| 1374 | Ga0373931_0069933 | |||
| 1375 | Ga0373935_0002797 | |||
| 1376 | Ga0373935_0021735 | |||
| 1377 | Ga0373935_0147397 | |||
| 1378 | Ga0373935_0259466 | |||
| 1379 | Ga0373927_0000757 | |||
| 1380 | Ga0373933_0006242 | |||
| 1381 | Ga0373933_0021373 | |||
| 1382 | Ga0373933_0034669 | |||
| 1383 | Ga0373933_0138597 | |||
| 1384 | Ga0373947_0002870 | |||
| 1385 | Ga0373947_0034530 | |||
| 1386 | Ga0373947_0089365 | |||
| 1387 | Ga0373937_0020317 | |||
| 1388 | Ga0373937_0026714 | |||
| 1389 | Ga0373937_0040827 | |||
| 1390 | Ga0373937_0056437 | |||
| 1391 | Ga0373937_0068122 | |||
| 1392 | Ga0373937_0124443 | |||
| 1393 | Ga0373937_0249136 | |||
| 1394 | Ga0316582_0410047 | |||
| 1395 | Ga0316584_0001556 | |||
| 1396 | Ga0316584_0130188 | |||
| 1397 | Ga0373925_0001542 | |||
| 1398 | Ga0373925_0004939 | |||
| 1399 | Ga0373925_0032211 | |||
| 1400 | Ga0373925_0073413 | |||
| 1401 | Ga0373925_0113389 | |||
| 1402 | Ga0395900_0110620 | |||
| 1403 | Ga0395900_0546478 | |||
| 1404 | Ga0395898_0061886 | |||
| 1405 | Ga0395898_0448356 | |||
| 1406 | Ga0395905_0071919 | |||
| 1407 | Ga0395905_0231603 | |||
| 1408 | Ga0436364_0622553 | |||
| 1409 | Ga0436364_0623133 | |||
| 1410 | Ga0436364_1481811 | |||
| 1411 | Ga0436364_1517018 | |||
| 1412 | Ga0395901_0103118 | |||
| 1413 | Ga0395901_0189924 | |||
| 1414 | Ga0400485_12647 | |||
| 1415 | Ga0400485_19114 | |||
| 1416 | Ga0400488_03612 | |||
| 1417 | Ga0400486_24978 | |||
| 1418 | Ga0400483_020888 | |||
| 1419 | Ga0400487_20151 | |||
| 1420 | Ga0436365_0829170 | |||
| 1421 | Ga0436365_1522245 | |||
| 1422 | Ga0436365_1737778 | |||
| 1423 | Ga0436360_0623051 | |||
| 1424 | Ga0436363_0113080 | |||
| 1425 | Ga0436363_0742947 | |||
| 1426 | Ga0436363_0782842 | |||
| 1427 | Ga0436363_0805767 | |||
| 1428 | Ga0436362_0489135 | |||
| 1429 | Ga0436362_0528474 | |||
| 1430 | Ga0439447_010395 | |||
| 1431 | Ga0439452_007039 | |||
| 1432 | Ga0450912_003295 | |||
| 1433 | Ga0466965_0131249 | |||
| 1434 | Ga0466961_0127447 | |||
| 1435 | Ga0453684_0044307 | |||
| 1436 | Ga0466960_0015328 | |||
| 1437 | Ga0466958_0069759 | |||
| 1438 | Ga0466958_0339689 | |||
| 1439 | Ga0466967_0011688 | |||
| 1440 | Ga0466967_0040415 | |||
| 1441 | Ga0466967_0179943 | |||
| 1442 | Ga0466967_0316679 | |||
| 1443 | Ga0466967_0489438 | |||
| 1444 | Ga0495592_0015368 | |||
| 1445 | Ga0495603_0044256 | |||
| 1446 | Ga0495603_0096617 | |||
| 1447 | Ga0495603_0140146 | |||
| 1448 | Ga0495629_0006045 | |||
| 1449 | Ga0495629_0034919 | |||
| 1450 | Ga0495629_0164150 | |||
| 1451 | Ga0495629_0256140 | |||
| 1452 | Ga0495638_0001463 | |||
| 1453 | Ga0495638_0002853 | |||
| 1454 | Ga0495638_0263314 | |||
| 1455 | Ga0495641_0000184 | |||
| 1456 | Ga0495641_0002737 | |||
| 1457 | Ga0495641_0009986 | |||
| 1458 | Ga0495651_0000215 | |||
| 1459 | Ga0495651_0000361 | |||
| 1460 | Ga0495651_0022089 | |||
| 1461 | Ga0495651_0025332 | |||
| 1462 | Ga0495651_0053944 | |||
| 1463 | Ga0495651_0075885 | |||
| 1464 | Ga0495653_0002705 | |||
| 1465 | Ga0495653_0011683 | |||
| 1466 | Ga0495653_0015829 | |||
| 1467 | Ga0495653_0043428 | |||
| 1468 | Ga0495650_0000625 | |||
| 1469 | Ga0495580_0076435 | |||
| 1470 | Ga0495580_0078645 | |||
| 1471 | Ga0495580_0378284 | |||
| 1472 | Ga0495582_0000343 | |||
| 1473 | Ga0495582_0006812 | |||
| 1474 | Ga0495582_0020052 | |||
| 1475 | Ga0495605_0000270 | |||
| 1476 | Ga0495605_0002158 | |||
| 1477 | Ga0495639_0001940 | |||
| 1478 | Ga0495639_0020808 | |||
| 1479 | Ga0495639_0104774 | |||
| 1480 | Ga0495662_0000054 | |||
| 1481 | Ga0495662_0026504 | |||
| 1482 | Ga0495662_0155381 | |||
| 1483 | Ga0495664_0000832 | |||
| 1484 | Ga0495664_0074814 | |||
| 1485 | Ga0495664_0205500 | |||
| 1486 | Ga0495594_0080383 | |||
| 1487 | Ga0495594_0091456 | |||
| 1488 | Ga0495607_0021794 | |||
| 1489 | Ga0495606_0000437 | |||
| 1490 | Ga0495608_0006748 | |||
| 1491 | Ga0495608_0011312 | |||
| 1492 | Ga0495608_0017699 | |||
| 1493 | Ga0495608_0018722 | |||
| 1494 | Ga0495608_0026613 | |||
| 1495 | Ga0495608_0026687 | |||
| 1496 | Ga0495618_0000626 | |||
| 1497 | Ga0495618_0003343 | |||
| 1498 | Ga0495618_0012306 | |||
| 1499 | Ga0495618_0021058 | |||
| 1500 | Ga0495618_0094167 | |||
| 1501 | Ga0495628_0029143 | |||
| 1502 | Ga0495628_0031776 | |||
| 1503 | Ga0495628_0139416 | |||
| 1504 | Ga0495628_0163693 | |||
| 1505 | Ga0495628_0187661 | |||
| 1506 | Ga0495628_0222175 | |||
| 1507 | Ga0495630_0000866 | |||
| 1508 | Ga0495630_0001781 | |||
| 1509 | Ga0495630_0022875 | |||
| 1510 | Ga0495632_0001430 | |||
| 1511 | Ga0495632_0002781 | |||
| 1512 | Ga0495643_0111516 | |||
| 1513 | Ga0495644_0000019 | |||
| 1514 | Ga0495648_0000469 | |||
| 1515 | Ga0495666_0000320 | |||
| 1516 | Ga0495652_0004006 | |||
| 1517 | Ga0495652_0009253 | |||
| 1518 | Ga0495652_0009760 | |||
| 1519 | Ga0495652_0035077 | |||
| 1520 | Ga0495652_0161930 | |||
| 1521 | Ga0495652_0273814 | |||
| 1522 | Ga0495665_0000427 | |||
| 1523 | Ga0495665_0005121 | |||
| 1524 | Ga0495665_0014015 | |||
| 1525 | Ga0495640_0036373 | |||
| 1526 | Ga0495640_0044927 | |||
| 1527 | Ga0495586_0031387 | |||
| 1528 | Ga0495586_0097081 | |||
| 1529 | Ga0495587_0003209 | |||
| 1530 | Ga0495587_0035946 | |||
| 1531 | Ga0495587_0060897 | |||
| 1532 | Ga0495645_0000167 | |||
| 1533 | Ga0495645_0036875 | |||
| 1534 | Ga0495645_0064470 | |||
| 1535 | Ga0495622_0040103 | |||
| 1536 | Ga0495667_0002767 | |||
| 1537 | Ga0495667_0006103 | |||
| 1538 | Ga0495667_0014062 | |||
| 1539 | Ga0495667_0020098 | |||
| 1540 | Ga0495667_0030652 | |||
| 1541 | Ga0495634_0007772 | |||
| 1542 | Ga0495634_0013178 | |||
| 1543 | Ga0495634_0017131 | |||
| 1544 | Ga0495634_0021970 | |||
| 1545 | Ga0495634_0046066 | |||
| 1546 | Ga0495635_0000190 | |||
| 1547 | Ga0495635_0003200 | |||
| 1548 | Ga0495635_0006815 | |||
| 1549 | Ga0495635_0010731 | |||
| 1550 | Ga0495635_0011831 | |||
| 1551 | Ga0495635_0020663 | |||
| 1552 | Ga0495588_0036124 | |||
| 1553 | Ga0495657_0016521 | |||
| 1554 | Ga0495657_0041543 | |||
| 1555 | Ga0495657_0045429 | |||
| 1556 | Ga0495657_0048544 | |||
| 1557 | Ga0495657_0051060 | |||
| 1558 | Ga0495657_0082292 | |||
| 1559 | Ga0495657_0143749 | |||
| 1560 | Ga0495657_0266460 | |||
| 1561 | Ga0495599_0007441 | |||
| 1562 | Ga0495599_0013130 | |||
| 1563 | Ga0495599_0020971 | |||
| 1564 | Ga0495599_0033598 | |||
| 1565 | Ga0495599_0034575 | |||
| 1566 | Ga0495599_0061663 | |||
| 1567 | Ga0495599_0090521 | |||
| 1568 | Ga0495599_0164099 | |||
| 1569 | Ga0495623_0025763 | |||
| 1570 | Ga0495623_0039843 | |||
| 1571 | Ga0495623_0079433 | |||
| 1572 | Ga0495623_0083946 | |||
| 1573 | Ga0495646_0011962 | |||
| 1574 | Ga0495646_0047786 | |||
| 1575 | Ga0495646_0158789 | |||
| 1576 | Ga0495646_0171341 | |||
| 1577 | Ga0495647_0003770 | |||
| 1578 | Ga0495647_0173985 | |||
| 1579 | Ga0495658_0000340 | |||
| 1580 | Ga0495658_0076748 | |||
| 1581 | Ga0495658_0170341 | |||
| 1582 | Ga0495613_0005640 | |||
| 1583 | Ga0495613_0137910 | |||
| 1584 | Ga0495613_0300808 | |||
| 1585 | Ga0495624_0000442 | |||
| 1586 | Ga0495624_0000590 | |||
| 1587 | Ga0495624_0128967 | |||
| 1588 | Ga0495624_0174348 | |||
| 1589 | Ga0495624_0239046 | |||
| 1590 | Ga0495600_0000437 | |||
| 1591 | Ga0495600_0024484 | |||
| 1592 | Ga0495600_0054611 | |||
| 1593 | Ga0495581_0000704 | |||
| 1594 | Ga0495581_0006341 | |||
| 1595 | Ga0495604_0000286 | |||
| 1596 | Ga0495604_0059033 | |||
| 1597 | Ga0495604_0243376 | |||
| 1598 | Ga0495674_0001722 | |||
| 1599 | Ga0495674_0007339 | |||
| 1600 | Ga0495674_0016629 | |||
| 1601 | Ga0495674_0041539 | |||
| 1602 | Ga0495674_0059750 | |||
| 1603 | Ga0495674_0389475 | |||
| 1604 | Ga0495676_0000478 | |||
| 1605 | Ga0495676_0005837 | |||
| 1606 | Ga0495676_0093045 | |||
| 1607 | Ga0495676_0141292 | |||
| 1608 | Ga0495676_0182385 | |||
| 1609 | Ga0495680_0002155 | |||
| 1610 | Ga0495680_0004262 | |||
| 1611 | Ga0495680_0005727 | |||
| 1612 | Ga0495680_0006558 | |||
| 1613 | Ga0495680_0009281 | |||
| 1614 | Ga0495680_0010122 | |||
| 1615 | Ga0495680_0019225 | |||
| 1616 | Ga0495680_0025076 | |||
| 1617 | Ga0495680_0032136 | |||
| 1618 | Ga0495680_0097794 | |||
| 1619 | Ga0495675_0009854 | |||
| 1620 | Ga0495675_0041659 | |||
| 1621 | Ga0495675_0054353 | |||
| 1622 | Ga0495675_0163424 | |||
| 1623 | Ga0495673_0026705 | |||
| 1624 | Ga0495681_0087787 | |||
| 1625 | Ga0495684_0003349 | |||
| 1626 | Ga0495684_0012238 | |||
| 1627 | Ga0495684_0026162 | |||
| 1628 | Ga0495684_0033620 | |||
| 1629 | Ga0495684_0064635 | |||
| 1630 | Ga0495684_0076312 | |||
| 1631 | Ga0495684_0252568 | |||
| 1632 | Ga0495684_0259062 | |||
| 1633 | Ga0495684_0315066 | |||
| 1634 | Ga0495593_0001228 | |||
| 1635 | Ga0495593_0008486 | |||
| 1636 | Ga0495593_0047643 | |||
| 1637 | Ga0495602_0005728 | |||
| 1638 | Ga0495602_0028054 | |||
| 1639 | Ga0495602_0028844 | |||
| 1640 | Ga0495602_0106811 | |||
| 1641 | Ga0495614_0012072 | |||
| 1642 | Ga0496100_0006354 | |||
| 1643 | Ga0496100_0198861 | |||
| 1644 | Ga0496101_0111906 | |||
| 1645 | Ga0496101_0147404 | |||
| 1646 | Ga0496102_0155758 | |||
| 1647 | Ga0496104_0009114 | |||
| 1648 | Ga0496104_0039441 | |||
| 1649 | Ga0496104_0220347 | |||
| 1650 | Ga0496104_0571422 | |||
| 1651 | Ga0496105_0003118 | |||
| 1652 | Ga0496105_0032854 | |||
| 1653 | Ga0496106_0114518 | |||
| 1654 | Ga0496106_0116666 | |||
| 1655 | Ga0496106_0132321 | |||
| 1656 | Ga0496106_0187207 | |||
| 1657 | Ga0496106_0206568 | |||
| 1658 | Ga0496107_0232322 | |||
| 1659 | Ga0496108_0015217 | |||
| 1660 | Ga0496108_0068466 | |||
| 1661 | Ga0496108_0252696 | |||
| 1662 | Ga0496109_0173558 | |||
| 1663 | Ga0496109_0183422 | |||
| 1664 | Ga0496109_0293601 | |||
| 1665 | Ga0496109_0341671 | |||
| 1666 | Ga0496109_0360656 | |||
| 1667 | Ga0496109_0398259 | |||
| 1668 | Ga0496110_0119797 | |||
| 1669 | Ga0496110_0125738 | |||
| 1670 | Ga0496111_0146050 | |||
| 1671 | Ga0496112_0001084 | |||
| 1672 | Ga0496112_0223214 | |||
| 1673 | Ga0496112_0585463 | |||
| 1674 | Ga0496113_0141423 | |||
| 1675 | Ga0496113_0166636 | |||
| 1676 | Ga0496114_0180263 | |||
| 1677 | Ga0496114_0230442 | |||
| 1678 | Ga0496114_0389139 | |||
| 1679 | Ga0496115_0216089 | |||
| 1680 | Ga0496115_0413081 | |||
| 1681 | Ga0496125_0000574 | |||
| 1682 | Ga0501031_0002065 | |||
| 1683 | Ga0501033_0055224 | |||
| 1684 | Ga0501034_0710891 | |||
| 1685 | Ga0501036_0003896 | |||
| 1686 | Ga0501036_0035976 | |||
| 1687 | Ga0501036_0206738 | |||
| 1688 | Ga0501037_0012765 | |||
| 1689 | Ga0501038_0046127 | |||
| 1690 | Ga0501038_0220497 | |||
| 1691 | Ga0501039_0003050 | |||
| 1692 | Ga0501039_0046370 | |||
| 1693 | Ga0501040_0002380 | |||
| 1694 | Ga0501040_0006723 | |||
| 1695 | Ga0501040_0054555 | |||
| 1696 | Ga0501041_0000943 | |||
| 1697 | Ga0501041_0020859 | |||
| 1698 | Ga0501042_0000510 | |||
| 1699 | Ga0501042_0122988 | |||
| 1700 | Ga0501043_0038365 | |||
| 1701 | Ga0501043_0277043 | |||
| 1702 | Ga0501046_0000458 | |||
| 1703 | Ga0501046_0140984 | |||
| 1704 | Ga0501048_0039767 | |||
| 1705 | Ga0501048_0168988 | |||
| 1706 | Ga0501069_0139179 | |||
| 1707 | Ga0501071_0001850 | |||
| 1708 | Ga0501071_0076939 | |||
| 1709 | Ga0501072_0003100 | |||
| 1710 | Ga0501073_0142916 | |||
| 1711 | Ga0501074_0002795 | |||
| 1712 | Ga0501074_0010061 | |||
| 1713 | Ga0501075_0009015 | |||
| 1714 | Ga0501075_0040749 | |||
| 1715 | Ga0501075_0113719 | |||
| 1716 | Ga0501076_0004485 | |||
| 1717 | Ga0501076_0155011 | |||
| 1718 | Ga0501077_0001971 | |||
| 1719 | Ga0501079_0000220 | |||
| 1720 | Ga0501079_0050886 | |||
| 1721 | Ga0501079_0063185 | |||
| 1722 | Ga0501080_0087479 | |||
| 1723 | Ga0501080_0139279 | |||
| 1724 | Ga0501081_0002486 | |||
| 1725 | Ga0501081_0076693 | |||
| 1726 | Ga0501083_0198691 | |||
| 1727 | Ga0501035_0122930 | |||
| 1728 | Ga0501044_0211018 | |||
| 1729 | Ga0501045_0002537 | |||
| 1730 | Ga0501045_0006419 | |||
| 1731 | Ga0501045_0314685 | |||
| 1732 | nmdc:mga06r32_613022_c1 | |||
| 1733 | nmdc:mga08y16_196436_c1 | |||
| 1734 | nmdc:mga08y16_84408_c1 | |||
| 1735 | nmdc:mga0n895_11002_c1 | |||
| 1736 | nmdc:mga0rr50_18597_c1 | |||
| 1737 | Ga0495601_0001416 | |||
| 1738 | Ga0495601_0071886 | |||
| 1739 | Ga0495601_0095577 | |||
| 1740 | Ga0495601_0215658 | |||
| 1741 | Ga0495612_0004272 | |||
| 1742 | Ga0495612_0072580 | |||
| 1743 | Ga0495595_0001306 | |||
| 1744 | Ga0495595_0008392 | |||
| 1745 | Ga0495595_0032570 | |||
| 1746 | Ga0495619_0004523 | |||
| 1747 | Ga0495619_0072249 | |||
| 1748 | Ga0495619_0075126 | |||
| 1749 | Ga0495619_0162790 | |||
| 1750 | Ga0501084_0001665 | |||
| 1751 | Ga0501084_0003268 | |||
| 1752 | Ga0590071_004517 | |||
| 1753 | Ga0590074_010613 | |||
| 1754 | Ga0590077_003016 | |||
| 1755 | Ga0501082_0003933 | |||
| 1756 | Ga0501082_0082026 | |||
| 1757 | Ga0530510_0002641 | |||
| 1758 | 2509112777 | |||
| 1759 | 2520375493 | |||
| 1760 | 2524454203 | |||
| 1761 | 2524454399 | |||
| 1762 | 2623500827 | |||
| 1763 | 2719669013 | |||
| 1764 | 2720489707 | |||
| 1765 | 2720610439 | |||
| 1766 | 2720628983 | |||
| 1767 | 2720772968 | |||
| 1768 | 2723030394 | |||
| 1769 | 2723564756 | |||
| 1770 | 2723570277 | |||
| 1771 | 2724092997 | |||
| 1772 | 2724101824 | |||
| 1773 | 2724113379 | |||
| 1774 | 2730110927 | |||
| 1775 | 2838045419 | |||
| 1776 | 2838064502 | |||
| 1777 | 2842265619 | |||
| 1778 | 2842428331 | |||
| 1779 | 2842434945 | |||
| 1780 | 2842442193 | |||
| 1781 | 2842469277 | |||
| 1782 | 2856288248 | |||
| 1783 | 2883294553 | |||
| 1784 | 8005286014 | |||
| 1785 | 8005624463 | |||
| 1786 | 8054473621 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qjm-assembly2.cif.gz_B | crystal structure of an alpha/beta-hydrolase enzyme from chloroflexus sp. ms-g (202) | 0.9224 | 2 | 298 |
| 7qjm-assembly2.cif.gz_B | crystal structure of an alpha/beta-hydrolase enzyme from chloroflexus sp. ms-g (202) | 0.9134 | 2 | 298 |
| 7d79-assembly2.cif.gz_B-2 | the structure of dcsb complex with its substrate analogue | 0.9036 | 1 | 295 |
| 7d79-assembly2.cif.gz_C | the structure of dcsb complex with its substrate analogue | 0.9024 | 1 | 298 |
| 7d79-assembly1.cif.gz_A | the structure of dcsb complex with its substrate analogue | 0.9009 | 1 | 298 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2hdwB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9265 | 1 | 296 | 3.40.50.1820 |
| 2hdwB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8562 | 1 | 296 | 3.40.50.1820 |
| af_Q9FVR4_40_268_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8528 | 2 | 292 | 3.40.50.1820 |
| af_A0A0R0GYE0_51_217_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8512 | 1 | 159 | 3.40.50.1820 |
| af_A0A1D6K8I4_16_172_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.851 | 1 | 136 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535RIK3-F1-model_v4 | Acetylxylan esterase | 0.9884 | 1 | 112 |
GO:0016787
|
| AF-J2KRX6-F1-model_v4 | Alpha/beta superfamily hydrolase | 0.9867 | 1 | 296 |
GO:0016787
|
| AF-A0A370HCK3-F1-model_v4 | AB hydrolase-1 domain-containing protein | 0.9862 | 1 | 300 |
GO:0052689
|
| AF-A0A260UA11-F1-model_v4 | deleted | 0.9858 | 1 | 296 |
|
| AF-A0A7G1KXA7-F1-model_v4 | AB hydrolase-1 domain-containing protein | 0.9844 | 1 | 298 |
GO:0052689
|