F484979

General Info

Members Datasets Scaffolds Average Seq Length
895 315 1790 310

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10000730|Ga0207699_1000073012
Length 346
Sequence VTGDPSSGSSPSSRSAANEVDLSAIKTIPVARRPNKVRAEEFAHPPTGDRSFAAFLTSLPDVLVARDFLRVVDAIVAAARGQRGVVVMLGGHTVKTGLAPLLNDLMARRVITHVAMNGSASIHDFEIARFGGTSEDVAAGLRDGSFGMAEETGREMNDAFVRGMREERGMGEALGRALDEADRSGRLAHPELSVLLAAYRLGVPSSIHAALGAEIIHQHPAASGAAIGDTSHRDFRRLAHSLTTLDDGGVVLNLGSAVIMPEVFLKALTIARNLNGGRPRNFVTCDLDMQRHYRPRMNVVQRPTLEGGKGYEITGHHELMVPLLAWAVVERLDPASEPAENKNDRA

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
219 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
220 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
221 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
225 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
248 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
259 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
260 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
261 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
312 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
313 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.78
Rhizosphere 98.21
Stem 0
Stem Tuber 0
Unclassified 9.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10000730 3300025906 Bacteria 15708
2 JGI24737J22298_10027458 3300001990 Bacteria 1794
3 JGI25406J46586_10013091 3300003203 Bacteria 3578
4 rootL2_10120163 3300003322 Unclassified 2969
5 Ga0065715_10127110 3300005293 Bacteria 2094
6 Ga0065707_10005662 3300005295 Bacteria 4686
7 Ga0070658_10004750 3300005327 Bacteria 11055
8 Ga0070658_10016733 3300005327 Bacteria 5869
9 Ga0070658_10068654 3300005327 Bacteria 2898
10 Ga0070676_10013941 3300005328 Bacteria 4410
11 Ga0070676_10078320 3300005328 Bacteria 1999
12 Ga0070683_100001423 3300005329 Bacteria 18353
13 Ga0070683_100009888 3300005329 Bacteria 8174
14 Ga0070683_100011445 3300005329 Bacteria 7670
15 Ga0070683_100012124 3300005329 Bacteria 7481
16 Ga0070683_100014812 3300005329 Bacteria 6834
17 Ga0070683_100119687 3300005329 Bacteria 2487
18 Ga0070683_100191007 3300005329 Bacteria 1944
19 Ga0070690_100015589 3300005330 Bacteria 4539
20 Ga0070690_100022917 3300005330 Bacteria 3825
21 Ga0070670_100029158 3300005331 Bacteria 4749
22 Ga0070670_100067469 3300005331 Unclassified 3069
23 Ga0070670_100166486 3300005331 Bacteria 1911
24 Ga0070670_100223262 3300005331 Bacteria 1639
25 Ga0070677_10028296 3300005333 Archaea 2117
26 Ga0068869_100000983 3300005334 Bacteria 16534
27 Ga0070666_10211534 3300005335 Bacteria 1366
28 Ga0070680_100010579 3300005336 Bacteria 7117
29 Ga0070680_100011289 3300005336 Bacteria 6908
30 Ga0070680_100013197 3300005336 Bacteria 6431
31 Ga0070680_100014046 3300005336 Bacteria 6253
32 Ga0070680_100021926 3300005336 Bacteria 5079
33 Ga0070680_100042151 3300005336 Bacteria 3702
34 Ga0070680_100108503 3300005336 Bacteria 2309
35 Ga0070680_100168862 3300005336 Bacteria 1840
36 Ga0070680_100170129 3300005336 Bacteria 1833
37 Ga0070682_100118330 3300005337 Bacteria 1775
38 Ga0068868_100017098 3300005338 Bacteria 5397
39 Ga0068868_100316669 3300005338 Bacteria 1328
40 Ga0070660_100004754 3300005339 Bacteria 9395
41 Ga0070660_100130635 3300005339 Bacteria 2010
42 Ga0070660_100256520 3300005339 Bacteria 1427
43 Ga0070689_100032617 3300005340 Bacteria 3962
44 Ga0070689_100082763 3300005340 Bacteria 2521
45 Ga0070691_10003236 3300005341 Bacteria 7303
46 Ga0070691_10112760 3300005341 Bacteria 1362
47 Ga0070687_100031740 3300005343 Bacteria 2593
48 Ga0070687_100165584 3300005343 Bacteria 1311
49 Ga0070661_100001775 3300005344 Bacteria 14964
50 Ga0070661_100005740 3300005344 Bacteria 8546
51 Ga0070661_100010129 3300005344 Bacteria 6547
52 Ga0070661_100037982 3300005344 Bacteria 3504
53 Ga0070661_100246326 3300005344 Bacteria 1378
54 Ga0070692_10001819 3300005345 Bacteria 7985
55 Ga0070692_10009842 3300005345 Bacteria 4329
56 Ga0070668_100004128 3300005347 Bacteria 10754
57 Ga0070668_100023934 3300005347 Bacteria 4625
58 Ga0070668_100109341 3300005347 Bacteria 2199
59 Ga0070669_100000286 3300005353 Bacteria 39758
60 Ga0070669_100003078 3300005353 Bacteria 12003
61 Ga0070669_100020426 3300005353 Bacteria 4731
62 Ga0070669_100094551 3300005353 Bacteria 2246
63 Ga0070675_100001798 3300005354 Bacteria 15837
64 Ga0070675_100003416 3300005354 Bacteria 12024
65 Ga0070675_100011378 3300005354 Bacteria 6965
66 Ga0070675_100089438 3300005354 Unclassified 2578
67 Ga0070671_100017331 3300005355 Bacteria 5833
68 Ga0070671_100310295 3300005355 Bacteria 1344
69 Ga0070674_100045151 3300005356 Bacteria 3010
70 Ga0070673_100010493 3300005364 Bacteria 6273
71 Ga0070673_100018647 3300005364 Bacteria 4963
72 Ga0070688_100021612 3300005365 Bacteria 3760
73 Ga0070667_100018721 3300005367 Bacteria 5743
74 Ga0070667_100170618 3300005367 Bacteria 1920
75 Ga0070703_10000141 3300005406 Bacteria 37278
76 Ga0070709_10002224 3300005434 Bacteria 10510
77 Ga0070709_10005278 3300005434 Bacteria 6995
78 Ga0070709_10011472 3300005434 Bacteria 4941
79 Ga0070709_10152118 3300005434 Unclassified 1600
80 Ga0070714_100013770 3300005435 Bacteria 6484
81 Ga0070714_100018855 3300005435 Bacteria 5612
82 Ga0070714_100024188 3300005435 Bacteria 4997
83 Ga0070714_100027686 3300005435 Bacteria 4696
84 Ga0070714_100050909 3300005435 Bacteria 3530
85 Ga0070714_100151210 3300005435 Bacteria 2092
86 Ga0070713_100007028 3300005436 Bacteria 7862
87 Ga0070713_100015494 3300005436 Bacteria 5703
88 Ga0070713_100015584 3300005436 Bacteria 5692
89 Ga0070713_100041772 3300005436 Bacteria 3739
90 Ga0070711_100000044 3300005439 Bacteria 83348
91 Ga0070711_100115210 3300005439 Bacteria 1979
92 Ga0070705_100007013 3300005440 Bacteria 5540
93 Ga0070705_100007255 3300005440 Bacteria 5451
94 Ga0070705_100013408 3300005440 Bacteria 4193
95 Ga0070705_100029839 3300005440 Unclassified 3005
96 Ga0070705_100041902 3300005440 Bacteria 2614
97 Ga0070705_100071444 3300005440 Bacteria 2099
98 Ga0070700_100022231 3300005441 Bacteria 3696
99 Ga0070694_100001129 3300005444 Bacteria 15309
100 Ga0070694_100002113 3300005444 Bacteria 11777
101 Ga0070694_100006192 3300005444 Bacteria 7263
102 Ga0070694_100006812 3300005444 Bacteria 6942
103 Ga0070694_100023268 3300005444 Bacteria 3982
104 Ga0070694_100028597 3300005444 Unclassified 3629
105 Ga0070708_100000183 3300005445 Bacteria 45261
106 Ga0070708_100008720 3300005445 Bacteria 8148
107 Ga0070708_100016970 3300005445 Bacteria 6058
108 Ga0070708_100019701 3300005445 Bacteria 5674
109 Ga0070708_100030889 3300005445 Bacteria 4634
110 Ga0070708_100068966 3300005445 Bacteria 3179
111 Ga0070708_100119621 3300005445 Unclassified 2428
112 Ga0070708_100146490 3300005445 Unclassified 2194
113 Ga0070708_100179236 3300005445 Unclassified 1980
114 Ga0070708_100185667 3300005445 Bacteria 1944
115 Ga0070663_100047893 3300005455 Bacteria 3029
116 Ga0070678_100073774 3300005456 Bacteria 2562
117 Ga0070662_100000232 3300005457 Bacteria 32803
118 Ga0070662_100071902 3300005457 Bacteria 2552
119 Ga0070662_100166708 3300005457 Bacteria 1727
120 Ga0070681_10008126 3300005458 Bacteria 10269
121 Ga0070681_10008654 3300005458 Bacteria 9980
122 Ga0070681_10016922 3300005458 Bacteria 7284
123 Ga0070681_10028425 3300005458 Bacteria 5621
124 Ga0070681_10034392 3300005458 Bacteria 5088
125 Ga0070681_10044686 3300005458 Bacteria 4434
126 Ga0070681_10056215 3300005458 Bacteria 3917
127 Ga0070681_10098562 3300005458 Bacteria 2869
128 Ga0070681_10099636 3300005458 Bacteria 2851
129 Ga0070681_10144795 3300005458 Unclassified 2306
130 Ga0068867_100009283 3300005459 Bacteria 6942
131 Ga0068867_100160555 3300005459 Bacteria 1772
132 Ga0070685_10006098 3300005466 Bacteria 6143
133 Ga0070685_10006945 3300005466 Bacteria 5780
134 Ga0070685_10051141 3300005466 Bacteria 2389
135 Ga0070706_100012318 3300005467 Bacteria 7925
136 Ga0070706_100021112 3300005467 Bacteria 5996
137 Ga0070706_100029609 3300005467 Bacteria 5044
138 Ga0070706_100041675 3300005467 Unclassified 4239
139 Ga0070706_100056332 3300005467 Bacteria 3628
140 Ga0070706_100126835 3300005467 Bacteria 2380
141 Ga0070706_100141562 3300005467 Bacteria 2245
142 Ga0070707_100000266 3300005468 Bacteria 51948
143 Ga0070707_100072842 3300005468 Unclassified 3312
144 Ga0070707_100117171 3300005468 Bacteria 2585
145 Ga0070707_100136052 3300005468 Unclassified 2390
146 Ga0070707_100144113 3300005468 Bacteria 2319
147 Ga0070707_100176927 3300005468 Bacteria 2080
148 Ga0070707_100300542 3300005468 Unclassified 1560
149 Ga0070707_100365255 3300005468 Bacteria 1402
150 Ga0070698_100000177 3300005471 Bacteria 59810
151 Ga0070698_100000668 3300005471 Bacteria 36568
152 Ga0070698_100005944 3300005471 Bacteria 13310
153 Ga0070698_100017391 3300005471 Bacteria 7577
154 Ga0070698_100018882 3300005471 Bacteria 7254
155 Ga0070698_100027989 3300005471 Bacteria 5857
156 Ga0070698_100104722 3300005471 Unclassified 2799
157 Ga0070698_100142468 3300005471 Bacteria 2347
158 Ga0070698_100147825 3300005471 Bacteria 2298
159 Ga0070699_100020380 3300005518 Bacteria 5718
160 Ga0070699_100031009 3300005518 Bacteria 4616
161 Ga0070699_100065147 3300005518 Bacteria 3161
162 Ga0070699_100071650 3300005518 Bacteria 3014
163 Ga0070699_100258804 3300005518 Bacteria 1556
164 Ga0070699_100281450 3300005518 Bacteria 1490
165 Ga0070699_100543870 3300005518 Bacteria 1057
166 Ga0070679_100000482 3300005530 Bacteria 34169
167 Ga0070679_100005427 3300005530 Bacteria 11818
168 Ga0070679_100011080 3300005530 Bacteria 8578
169 Ga0070679_100011794 3300005530 Bacteria 8334
170 Ga0070679_100012244 3300005530 Bacteria 8194
171 Ga0070679_100020296 3300005530 Bacteria 6476
172 Ga0070679_100037764 3300005530 Bacteria 4799
173 Ga0070679_100064821 3300005530 Bacteria 3642
174 Ga0070679_100091060 3300005530 Bacteria 3038
175 Ga0070679_100103189 3300005530 Bacteria 2838
176 Ga0070679_100135372 3300005530 Bacteria 2445
177 Ga0070679_100182798 3300005530 Bacteria 2069
178 Ga0070679_100195747 3300005530 Bacteria 1989
179 Ga0070679_100202928 3300005530 Bacteria 1948
180 Ga0070684_100003547 3300005535 Bacteria 11726
181 Ga0070684_100009138 3300005535 Bacteria 7794
182 Ga0070684_100053400 3300005535 Bacteria 3518
183 Ga0070684_100110712 3300005535 Bacteria 2462
184 Ga0070684_100234071 3300005535 Bacteria 1677
185 Ga0070684_100391591 3300005535 Bacteria 1281
186 Ga0070697_100001834 3300005536 Bacteria 16238
187 Ga0070697_100003661 3300005536 Bacteria 11813
188 Ga0070697_100019308 3300005536 Bacteria 5383
189 Ga0070697_100026307 3300005536 Unclassified 4646
190 Ga0070697_100026355 3300005536 Bacteria 4643
191 Ga0070697_100377578 3300005536 Unclassified 1227
192 Ga0070697_100488848 3300005536 Bacteria 1075
193 Ga0068853_100005405 3300005539 Bacteria 10009
194 Ga0068853_100176680 3300005539 Unclassified 1934
195 Ga0068853_100178900 3300005539 Bacteria 1923
196 Ga0070672_100002105 3300005543 Bacteria 12559
197 Ga0070672_100028150 3300005543 Unclassified 4200
198 Ga0070672_100038736 3300005543 Bacteria 3645
199 Ga0070672_100104651 3300005543 Bacteria 2300
200 Ga0070672_100295346 3300005543 Bacteria 1372
201 Ga0070686_100000080 3300005544 Bacteria 70371
202 Ga0070686_100014652 3300005544 Bacteria 4524
203 Ga0070695_100000765 3300005545 Bacteria 17293
204 Ga0070695_100011121 3300005545 Bacteria 5379
205 Ga0070695_100018320 3300005545 Bacteria 4252
206 Ga0070695_100018856 3300005545 Bacteria 4193
207 Ga0070695_100119105 3300005545 Unclassified 1803
208 Ga0070695_100121357 3300005545 Bacteria 1788
209 Ga0070695_100210572 3300005545 Unclassified 1395
210 Ga0070696_100000194 3300005546 Bacteria 35764
211 Ga0070696_100000241 3300005546 Bacteria 32915
212 Ga0070696_100002516 3300005546 Bacteria 12137
213 Ga0070696_100015219 3300005546 Bacteria 5164
214 Ga0070696_100029304 3300005546 Unclassified 3761
215 Ga0070696_100088731 3300005546 Bacteria 2198
216 Ga0070696_100112955 3300005546 Bacteria 1958
217 Ga0070665_100125045 3300005548 Bacteria 2574
218 Ga0070704_100000123 3300005549 Bacteria 28063
219 Ga0070704_100007002 3300005549 Bacteria 6689
220 Ga0070704_100011688 3300005549 Bacteria 5393
221 Ga0070704_100045023 3300005549 Bacteria 3069
222 Ga0070704_100056240 3300005549 Bacteria 2793
223 Ga0068855_100013106 3300005563 Bacteria 9998
224 Ga0068855_100155311 3300005563 Unclassified 2600
225 Ga0068855_100318953 3300005563 Bacteria 1718
226 Ga0070664_100020824 3300005564 Bacteria 5402
227 Ga0070664_100036947 3300005564 Bacteria 4105
228 Ga0070664_100045601 3300005564 Bacteria 3702
229 Ga0070664_100060801 3300005564 Unclassified 3218
230 Ga0070664_100352805 3300005564 Bacteria 1338
231 Ga0068857_100012851 3300005577 Bacteria 7295
232 Ga0068857_100023156 3300005577 Bacteria 5465
233 Ga0068857_100065083 3300005577 Bacteria 3241
234 Ga0068857_100071754 3300005577 Bacteria 3086
235 Ga0068857_100116407 3300005577 Bacteria 2405
236 Ga0068854_100010221 3300005578 Bacteria 6081
237 Ga0068854_100021667 3300005578 Bacteria 4363
238 Ga0068854_100040580 3300005578 Bacteria 3284
239 Ga0068856_100058772 3300005614 Bacteria 3798
240 Ga0068856_100099724 3300005614 Bacteria 2896
241 Ga0070702_100210134 3300005615 Bacteria 1294
242 Ga0068852_100004338 3300005616 Bacteria 10011
243 Ga0068852_100006656 3300005616 Bacteria 8372
244 Ga0068852_100035002 3300005616 Bacteria 4184
245 Ga0068852_100088323 3300005616 Unclassified 2768
246 Ga0068852_100158777 3300005616 Bacteria 2109
247 Ga0068852_100160031 3300005616 Bacteria 2102
248 Ga0068859_100003185 3300005617 Bacteria 16692
249 Ga0068859_100045389 3300005617 Bacteria 4415
250 Ga0068859_100081284 3300005617 Unclassified 3283
251 Ga0068859_100610765 3300005617 Bacteria 1183
252 Ga0068864_100027015 3300005618 Bacteria 4843
253 Ga0068864_100216397 3300005618 Bacteria 1766
254 Ga0068866_10063158 3300005718 Bacteria 1929
255 Ga0068861_100001644 3300005719 Bacteria 14264
256 Ga0068861_100007574 3300005719 Bacteria 7448
257 Ga0068861_100021776 3300005719 Bacteria 4609
258 Ga0068851_10006225 3300005834 Bacteria 5444
259 Ga0068870_10003755 3300005840 Bacteria 6460
260 Ga0068863_100047794 3300005841 Bacteria 4058
261 Ga0068863_100120280 3300005841 Bacteria 2504
262 Ga0068860_100080328 3300005843 Bacteria 3101
263 Ga0068860_100320864 3300005843 Bacteria 1520
264 Ga0068862_100000767 3300005844 Bacteria 31967
265 Ga0068862_100002810 3300005844 Bacteria 15255
266 Ga0068862_100017050 3300005844 Bacteria 6043
267 Ga0081539_10000019 3300005985 Bacteria 369381
268 Ga0070717_10000856 3300006028 Bacteria 20172
269 Ga0070716_100210110 3300006173 Bacteria 1300
270 Ga0070712_100000815 3300006175 Bacteria 18501
271 Ga0068871_100146270 3300006358 Unclassified 2012
272 Ga0075428_100008620 3300006844 Bacteria 11313
273 Ga0075428_100031768 3300006844 Bacteria 5832
274 Ga0075428_100041765 3300006844 Bacteria 5042
275 Ga0075428_100045271 3300006844 Unclassified 4835
276 Ga0075428_100263071 3300006844 Unclassified 1857
277 Ga0075430_100003405 3300006846 Bacteria 13288
278 Ga0075430_100017629 3300006846 Bacteria 6080
279 Ga0075430_100019655 3300006846 Bacteria 5746
280 Ga0075430_100033573 3300006846 Bacteria 4355
281 Ga0075430_100059946 3300006846 Bacteria 3199
282 Ga0075430_100147316 3300006846 Unclassified 1961
283 Ga0075431_100008788 3300006847 Bacteria 10124
284 Ga0075431_100011511 3300006847 Bacteria 8921
285 Ga0075431_100012605 3300006847 Bacteria 8534
286 Ga0075431_100149740 3300006847 Bacteria 2403
287 Ga0075431_100153026 3300006847 Bacteria 2374
288 Ga0075431_100204494 3300006847 Bacteria 2019
289 Ga0075433_10007578 3300006852 Bacteria 8612
290 Ga0075433_10025029 3300006852 Bacteria 5044
291 Ga0075433_10025679 3300006852 Bacteria 4981
292 Ga0075433_10039423 3300006852 Bacteria 4085
293 Ga0075433_10042506 3300006852 Bacteria 3943
294 Ga0075433_10330661 3300006852 Unclassified 1348
295 Ga0075434_100003164 3300006871 Bacteria 14674
296 Ga0075434_100009436 3300006871 Bacteria 9096
297 Ga0075434_100010430 3300006871 Bacteria 8709
298 Ga0075434_100031574 3300006871 Bacteria 5222
299 Ga0075434_100044015 3300006871 Bacteria 4428
300 Ga0075434_100104795 3300006871 Bacteria 2838
301 Ga0075429_100001536 3300006880 Bacteria 18919
302 Ga0075429_100017553 3300006880 Bacteria 6188
303 Ga0075429_100032865 3300006880 Unclassified 4508
304 Ga0075429_100121449 3300006880 Bacteria 2284
305 Ga0075429_100317673 3300006880 Bacteria 1363
306 Ga0068865_100001192 3300006881 Bacteria 15118
307 Ga0068865_100153623 3300006881 Bacteria 1748
308 Ga0075436_100001128 3300006914 Bacteria 18049
309 Ga0075436_100017637 3300006914 Bacteria 4887
310 Ga0075436_100031275 3300006914 Bacteria 3664
311 Ga0097620_100003185 3300006931 Bacteria 16692
312 Ga0097620_100045391 3300006931 Bacteria 4415
313 Ga0097620_100081286 3300006931 Unclassified 3283
314 Ga0097620_100610797 3300006931 Bacteria 1183
315 Ga0075435_100064106 3300007076 Unclassified 2985
316 Ga0075435_100253858 3300007076 Bacteria 1497
317 Ga0099794_10000050 3300007265 Bacteria 47670
318 Ga0099794_10037785 3300007265 Bacteria 2287
319 Ga0099794_10046255 3300007265 Bacteria 2084
320 Ga0099794_10170149 3300007265 Unclassified 1110
321 Ga0105240_10000907 3300009093 Bacteria 52922
322 Ga0105240_10007075 3300009093 Bacteria 16359
323 Ga0105240_10019801 3300009093 Bacteria 8988
324 Ga0105240_10089117 3300009093 Bacteria 3774
325 Ga0105240_10112220 3300009093 Bacteria 3296
326 Ga0105240_10375319 3300009093 Bacteria 1607
327 Ga0111539_10184088 3300009094 Bacteria 2439
328 Ga0105245_10055871 3300009098 Bacteria 3547
329 Ga0114129_10017211 3300009147 Bacteria 10296
330 Ga0114129_10030901 3300009147 Bacteria 7575
331 Ga0114129_10091726 3300009147 Bacteria 4208
332 Ga0114129_10241965 3300009147 Bacteria 2425
333 Ga0114129_10320237 3300009147 Bacteria 2062
334 Ga0114129_10352065 3300009147 Unclassified 1951
335 Ga0105241_10057545 3300009174 Unclassified 2983
336 Ga0105241_10140954 3300009174 Bacteria 1963
337 Ga0105241_10180635 3300009174 Bacteria 1750
338 Ga0105242_10006347 3300009176 Bacteria 9106
339 Ga0105242_10022543 3300009176 Bacteria 4954
340 Ga0105242_10105639 3300009176 Bacteria 2392
341 Ga0105248_10034675 3300009177 Bacteria 5646
342 Ga0105248_10340857 3300009177 Bacteria 1688
343 Ga0105237_10000319 3300009545 Bacteria 67468
344 Ga0105238_10007618 3300009551 Bacteria 10847
345 Ga0105238_10192519 3300009551 Unclassified 2015
346 Ga0105238_10192520 3300009551 Bacteria 2015
347 Ga0105238_10291786 3300009551 Unclassified 1613
348 Ga0105249_10000186 3300009553 Bacteria 71781
349 Ga0105249_10000634 3300009553 Bacteria 32073
350 Ga0105249_10001368 3300009553 Bacteria 21324
351 Ga0105249_10054461 3300009553 Bacteria 3658
352 Ga0099796_10024603 3300010159 Bacteria 1892
353 Ga0105239_10041296 3300010375 Bacteria 5055
354 Ga0157373_10034298 3300013100 Bacteria 3645
355 Ga0157371_10004220 3300013102 Bacteria 12641
356 Ga0157370_10003141 3300013104 Bacteria 19564
357 Ga0157370_10004461 3300013104 Bacteria 16035
358 Ga0157370_10057835 3300013104 Bacteria 3685
359 Ga0157370_10207222 3300013104 Unclassified 1818
360 Ga0157370_10229431 3300013104 Bacteria 1719
361 Ga0157369_10002374 3300013105 Bacteria 22618
362 Ga0157369_10013585 3300013105 Bacteria 9208
363 Ga0157369_10169810 3300013105 Bacteria 2299
364 Ga0157369_10177642 3300013105 Bacteria 2241
365 Ga0157369_10185243 3300013105 Bacteria 2189
366 Ga0157369_10264846 3300013105 Bacteria 1792
367 Ga0157369_10379805 3300013105 Bacteria 1466
368 Ga0163162_10004889 3300013306 Bacteria 12920
369 Ga0163162_10050940 3300013306 Unclassified 4153
370 Ga0163162_10166403 3300013306 Bacteria 2329
371 Ga0157372_10003862 3300013307 Bacteria 16103
372 Ga0157372_10008985 3300013307 Bacteria 10621
373 Ga0157372_10018216 3300013307 Bacteria 7548
374 Ga0157372_10027444 3300013307 Bacteria 6201
375 Ga0157372_10038773 3300013307 Bacteria 5258
376 Ga0157372_10059334 3300013307 Bacteria 4279
377 Ga0157372_10103748 3300013307 Bacteria 3249
378 Ga0157372_10113474 3300013307 Bacteria 3106
379 Ga0157372_10161763 3300013307 Bacteria 2587
380 Ga0157372_10312364 3300013307 Bacteria 1830
381 Ga0157372_10450629 3300013307 Bacteria 1500
382 Ga0157372_10490243 3300013307 Bacteria 1433
383 Ga0157375_10026656 3300013308 Bacteria 5391
384 Ga0157375_10026771 3300013308 Bacteria 5381
385 Ga0157375_10040712 3300013308 Bacteria 4482
386 Ga0157375_10071329 3300013308 Bacteria 3487
387 Ga0157375_10406634 3300013308 Bacteria 1528
388 Ga0163163_10000841 3300014325 Bacteria 26081
389 Ga0157380_10001587 3300014326 Bacteria 14979
390 Ga0157380_10002221 3300014326 Bacteria 13060
391 Ga0157380_10072408 3300014326 Bacteria 2791
392 Ga0182008_10074099 3300014497 Bacteria 1675
393 Ga0157377_10014421 3300014745 Bacteria 4022
394 Ga0157379_10029096 3300014968 Bacteria 4913
395 Ga0157376_10008270 3300014969 Bacteria 7495
396 Ga0163161_10019704 3300017792 Bacteria 4732
397 Ga0197907_10955801 3300020069 Bacteria 1983
398 Ga0206354_10324332 3300020081 Bacteria 1379
399 Ga0213876_10005686 3300021384 Bacteria 6842
400 Ga0207697_10002385 3300025315 Bacteria 9784
401 Ga0207656_10012964 3300025321 Bacteria 3175
402 Ga0207653_10000129 3300025885 Bacteria 53779
403 Ga0207653_10009586 3300025885 Bacteria 3018
404 Ga0207682_10023996 3300025893 Archaea 2412
405 Ga0207642_10091621 3300025899 Bacteria 1503
406 Ga0207699_10005603 3300025906 Bacteria 6023
407 Ga0207699_10050743 3300025906 Unclassified 2448
408 Ga0207645_10002070 3300025907 Bacteria 16056
409 Ga0207645_10031721 3300025907 Bacteria 3398
410 Ga0207643_10003815 3300025908 Bacteria 8104
411 Ga0207705_10012284 3300025909 Bacteria 6188
412 Ga0207705_10012839 3300025909 Bacteria 6048
413 Ga0207705_10054912 3300025909 Bacteria 2871
414 Ga0207684_10006439 3300025910 Bacteria 10702
415 Ga0207684_10012715 3300025910 Bacteria 7306
416 Ga0207684_10038084 3300025910 Bacteria 4080
417 Ga0207684_10058170 3300025910 Unclassified 3280
418 Ga0207684_10106957 3300025910 Bacteria 2393
419 Ga0207684_10310641 3300025910 Bacteria 1359
420 Ga0207654_10072085 3300025911 Bacteria 2055
421 Ga0207707_10003518 3300025912 Bacteria 13869
422 Ga0207707_10004367 3300025912 Bacteria 12501
423 Ga0207707_10005269 3300025912 Bacteria 11323
424 Ga0207707_10019567 3300025912 Bacteria 5909
425 Ga0207707_10034748 3300025912 Bacteria 4410
426 Ga0207707_10045262 3300025912 Bacteria 3835
427 Ga0207707_10060522 3300025912 Bacteria 3294
428 Ga0207707_10097169 3300025912 Bacteria 2574
429 Ga0207707_10181865 3300025912 Bacteria 1835
430 Ga0207695_10002537 3300025913 Bacteria 26830
431 Ga0207695_10004743 3300025913 Bacteria 18400
432 Ga0207695_10075521 3300025913 Bacteria 3429
433 Ga0207695_10079292 3300025913 Bacteria 3329
434 Ga0207695_10132666 3300025913 Bacteria 2447
435 Ga0207695_10237829 3300025913 Bacteria 1723
436 Ga0207695_10240073 3300025913 Bacteria 1714
437 Ga0207671_10003085 3300025914 Bacteria 17005
438 Ga0207693_10005881 3300025915 Bacteria 10179
439 Ga0207693_10017051 3300025915 Bacteria 5797
440 Ga0207663_10001229 3300025916 Bacteria 11824
441 Ga0207660_10003524 3300025917 Bacteria 10197
442 Ga0207660_10004839 3300025917 Bacteria 8765
443 Ga0207660_10005733 3300025917 Bacteria 8056
444 Ga0207660_10007862 3300025917 Bacteria 6901
445 Ga0207660_10027572 3300025917 Bacteria 3877
446 Ga0207660_10033782 3300025917 Bacteria 3541
447 Ga0207660_10048011 3300025917 Unclassified 3020
448 Ga0207660_10060432 3300025917 Bacteria 2724
449 Ga0207660_10102931 3300025917 Bacteria 2135
450 Ga0207662_10004224 3300025918 Bacteria 7532
451 Ga0207662_10109770 3300025918 Bacteria 1719
452 Ga0207657_10002791 3300025919 Bacteria 18792
453 Ga0207657_10007054 3300025919 Bacteria 11544
454 Ga0207657_10038012 3300025919 Bacteria 4291
455 Ga0207649_10004679 3300025920 Bacteria 7404
456 Ga0207649_10005222 3300025920 Bacteria 7011
457 Ga0207649_10027828 3300025920 Bacteria 3323
458 Ga0207649_10028540 3300025920 Bacteria 3286
459 Ga0207649_10284076 3300025920 Bacteria 1204
460 Ga0207652_10012120 3300025921 Bacteria 6963
461 Ga0207652_10013567 3300025921 Bacteria 6591
462 Ga0207652_10013738 3300025921 Bacteria 6548
463 Ga0207652_10024282 3300025921 Bacteria 5028
464 Ga0207652_10057549 3300025921 Bacteria 3348
465 Ga0207652_10099836 3300025921 Bacteria 2562
466 Ga0207652_10114318 3300025921 Bacteria 2396
467 Ga0207652_10116348 3300025921 Bacteria 2375
468 Ga0207652_10307983 3300025921 Bacteria 1430
469 Ga0207652_10339104 3300025921 Bacteria 1357
470 Ga0207652_10348261 3300025921 Bacteria 1337
471 Ga0207652_10369841 3300025921 Bacteria 1294
472 Ga0207646_10002391 3300025922 Bacteria 22145
473 Ga0207646_10005847 3300025922 Bacteria 12859
474 Ga0207646_10006642 3300025922 Bacteria 11926
475 Ga0207646_10028728 3300025922 Bacteria 5060
476 Ga0207646_10035737 3300025922 Bacteria 4486
477 Ga0207646_10099063 3300025922 Bacteria 2612
478 Ga0207646_10103058 3300025922 Bacteria 2559
479 Ga0207646_10188962 3300025922 Unclassified 1860
480 Ga0207646_10302214 3300025922 Bacteria 1446
481 Ga0207681_10001254 3300025923 Bacteria 16359
482 Ga0207681_10001580 3300025923 Bacteria 14654
483 Ga0207681_10015268 3300025923 Bacteria 4788
484 Ga0207681_10180636 3300025923 Bacteria 1607
485 Ga0207694_10000051 3300025924 Bacteria 159252
486 Ga0207694_10018617 3300025924 Bacteria 5250
487 Ga0207694_10024763 3300025924 Unclassified 4559
488 Ga0207694_10094929 3300025924 Unclassified 2357
489 Ga0207650_10004257 3300025925 Bacteria 9767
490 Ga0207650_10101389 3300025925 Bacteria 2216
491 Ga0207659_10009540 3300025926 Bacteria 6071
492 Ga0207659_10024774 3300025926 Bacteria 4025
493 Ga0207659_10344496 3300025926 Bacteria 1235
494 Ga0207659_10362677 3300025926 Bacteria 1205
495 Ga0207700_10025824 3300025928 Unclassified 4087
496 Ga0207700_10030827 3300025928 Bacteria 3803
497 Ga0207664_10013254 3300025929 Bacteria 5910
498 Ga0207664_10025542 3300025929 Unclassified 4453
499 Ga0207664_10028309 3300025929 Bacteria 4258
500 Ga0207664_10100861 3300025929 Bacteria 2384
501 Ga0207664_10112956 3300025929 Bacteria 2262
502 Ga0207664_10412084 3300025929 Unclassified 1203
503 Ga0207644_10092012 3300025931 Bacteria 2262
504 Ga0207644_10220771 3300025931 Bacteria 1502
505 Ga0207690_10157544 3300025932 Bacteria 1689
506 Ga0207706_10001523 3300025933 Bacteria 23005
507 Ga0207706_10241053 3300025933 Bacteria 1580
508 Ga0207686_10037025 3300025934 Bacteria 2941
509 Ga0207686_10044069 3300025934 Bacteria 2737
510 Ga0207670_10008698 3300025936 Bacteria 5748
511 Ga0207670_10011081 3300025936 Bacteria 5219
512 Ga0207670_10026437 3300025936 Bacteria 3657
513 Ga0207669_10053508 3300025937 Bacteria 2432
514 Ga0207704_10078548 3300025938 Bacteria 2123
515 Ga0207665_10009089 3300025939 Bacteria 6524
516 Ga0207665_10058443 3300025939 Bacteria 2607
517 Ga0207691_10000329 3300025940 Bacteria 47290
518 Ga0207691_10013154 3300025940 Bacteria 7924
519 Ga0207691_10019319 3300025940 Bacteria 6449
520 Ga0207691_10063691 3300025940 Unclassified 3344
521 Ga0207691_10094458 3300025940 Bacteria 2676
522 Ga0207689_10009386 3300025942 Bacteria 8452
523 Ga0207661_10008356 3300025944 Bacteria 7393
524 Ga0207661_10012298 3300025944 Bacteria 6216
525 Ga0207661_10023464 3300025944 Bacteria 4661
526 Ga0207661_10048516 3300025944 Bacteria 3375
527 Ga0207661_10053974 3300025944 Bacteria 3218
528 Ga0207661_10075967 3300025944 Bacteria 2758
529 Ga0207661_10163569 3300025944 Bacteria 1932
530 Ga0207679_10003259 3300025945 Bacteria 10029
531 Ga0207679_10006747 3300025945 Bacteria 7273
532 Ga0207679_10011432 3300025945 Bacteria 5751
533 Ga0207679_10037261 3300025945 Bacteria 3456
534 Ga0207679_10056146 3300025945 Bacteria 2906
535 Ga0207679_10067466 3300025945 Bacteria 2684
536 Ga0207667_10056041 3300025949 Bacteria 4142
537 Ga0207667_10083565 3300025949 Bacteria 3306
538 Ga0207667_10090663 3300025949 Bacteria 3159
539 Ga0207667_10410533 3300025949 Bacteria 1378
540 Ga0207651_10057272 3300025960 Bacteria 2687
541 Ga0207712_10000218 3300025961 Bacteria 57087
542 Ga0207712_10000260 3300025961 Bacteria 51278
543 Ga0207712_10007431 3300025961 Bacteria 6917
544 Ga0207668_10007085 3300025972 Bacteria 6652
545 Ga0207668_10022985 3300025972 Unclassified 3999
546 Ga0207668_10087159 3300025972 Bacteria 2282
547 Ga0207640_10027021 3300025981 Bacteria 3493
548 Ga0207640_10030712 3300025981 Bacteria 3312
549 Ga0207640_10178618 3300025981 Bacteria 1589
550 Ga0207658_10030400 3300025986 Unclassified 3823
551 Ga0207658_10056799 3300025986 Bacteria 2906
552 Ga0207677_10007881 3300026023 Bacteria 5921
553 Ga0207639_10014784 3300026041 Bacteria 5498
554 Ga0207639_10040669 3300026041 Unclassified 3471
555 Ga0207639_10213513 3300026041 Bacteria 1662
556 Ga0207639_10353139 3300026041 Bacteria 1314
557 Ga0207678_10039415 3300026067 Bacteria 4101
558 Ga0207708_10004989 3300026075 Bacteria 9774
559 Ga0207708_10053876 3300026075 Bacteria 3066
560 Ga0207702_10009943 3300026078 Bacteria 7976
561 Ga0207702_10035453 3300026078 Bacteria 4172
562 Ga0207702_10200282 3300026078 Bacteria 1850
563 Ga0207702_10227274 3300026078 Bacteria 1742
564 Ga0207641_10020676 3300026088 Bacteria 5408
565 Ga0207648_10036875 3300026089 Unclassified 4307
566 Ga0207648_10044565 3300026089 Bacteria 3891
567 Ga0207648_10187329 3300026089 Bacteria 1833
568 Ga0207676_10021630 3300026095 Unclassified 4721
569 Ga0207676_10061618 3300026095 Bacteria 2971
570 Ga0207674_10000546 3300026116 Bacteria 49404
571 Ga0207674_10003558 3300026116 Bacteria 19004
572 Ga0207674_10029206 3300026116 Bacteria 5808
573 Ga0207674_10032824 3300026116 Bacteria 5442
574 Ga0207674_10078359 3300026116 Unclassified 3309
575 Ga0207674_10086222 3300026116 Bacteria 3135
576 Ga0207674_10143555 3300026116 Unclassified 2346
577 Ga0207674_10202155 3300026116 Bacteria 1936
578 Ga0207675_100000024 3300026118 Bacteria 114684
579 Ga0207675_100007357 3300026118 Bacteria 10403
580 Ga0207698_10013398 3300026142 Bacteria 5408
581 Ga0207698_10015268 3300026142 Bacteria 5140
582 Ga0207698_10020857 3300026142 Bacteria 4520
583 Ga0207698_10094604 3300026142 Bacteria 2457
584 Ga0207698_10355201 3300026142 Unclassified 1386
585 Ga0209588_1000631 3300027671 Bacteria 8901
586 Ga0209588_1002436 3300027671 Bacteria 5045
587 Ga0207428_10157352 3300027907 Bacteria 1727
588 Ga0268266_10026977 3300028379 Bacteria 4887
589 Ga0268266_10066718 3300028379 Bacteria 3113
590 Ga0268265_10000144 3300028380 Bacteria 90132
591 Ga0268265_10004810 3300028380 Bacteria 9310
592 Ga0268265_10008644 3300028380 Bacteria 6883
593 Ga0268264_10063194 3300028381 Bacteria 3111
594 Ga0268264_10333459 3300028381 Bacteria 1438
595 Ga0265332_10001162 3300031238 Bacteria 15236
596 Ga0265327_10016358 3300031251 Bacteria 4713
597 Ga0307408_100005865 3300031548 Bacteria 8175
598 Ga0307408_100012104 3300031548 Bacteria 5711
599 Ga0307408_100022179 3300031548 Bacteria 4310
600 Ga0307408_100127616 3300031548 Unclassified 1980
601 Ga0307408_100195194 3300031548 Bacteria 1634
602 Ga0307408_100244616 3300031548 Bacteria 1476
603 Ga0307405_10001226 3300031731 Bacteria 10670
604 Ga0307405_10002651 3300031731 Bacteria 7960
605 Ga0307405_10005972 3300031731 Bacteria 5942
606 Ga0307405_10047929 3300031731 Bacteria 2633
607 Ga0307405_10083043 3300031731 Unclassified 2099
608 Ga0307413_10001832 3300031824 Bacteria 8359
609 Ga0307413_10002645 3300031824 Bacteria 7333
610 Ga0307413_10004252 3300031824 Bacteria 6198
611 Ga0307413_10007219 3300031824 Bacteria 5141
612 Ga0307413_10030848 3300031824 Bacteria 3016
613 Ga0307410_10000198 3300031852 Bacteria 22528
614 Ga0307410_10010066 3300031852 Bacteria 5339
615 Ga0307410_10014331 3300031852 Bacteria 4661
616 Ga0307410_10144391 3300031852 Bacteria 1764
617 Ga0307406_10002122 3300031901 Bacteria 10792
618 Ga0307406_10004941 3300031901 Bacteria 7265
619 Ga0307406_10034734 3300031901 Bacteria 3095
620 Ga0307406_10142890 3300031901 Bacteria 1697
621 Ga0307407_10001339 3300031903 Bacteria 8842
622 Ga0307407_10016446 3300031903 Bacteria 3683
623 Ga0307407_10063355 3300031903 Bacteria 2168
624 Ga0307407_10213649 3300031903 Bacteria 1300
625 Ga0307412_10001486 3300031911 Bacteria 13032
626 Ga0307412_10019448 3300031911 Bacteria 4114
627 Ga0307412_10021455 3300031911 Bacteria 3946
628 Ga0307409_100026741 3300031995 Bacteria 4075
629 Ga0307409_100042698 3300031995 Bacteria 3398
630 Ga0307409_100062497 3300031995 Bacteria 2915
631 Ga0307409_100145034 3300031995 Bacteria 2051
632 Ga0307409_100166475 3300031995 Bacteria 1935
633 Ga0307416_100024724 3300032002 Bacteria 4390
634 Ga0307416_100039917 3300032002 Bacteria 3639
635 Ga0307416_100081639 3300032002 Bacteria 2734
636 Ga0307416_100292273 3300032002 Bacteria 1614
637 Ga0307416_100356897 3300032002 Bacteria 1482
638 Ga0307414_10000799 3300032004 Bacteria 16115
639 Ga0307414_10012799 3300032004 Bacteria 4977
640 Ga0307414_10030746 3300032004 Unclassified 3512
641 Ga0307414_10140566 3300032004 Bacteria 1890
642 Ga0307414_10171569 3300032004 Bacteria 1735
643 Ga0307414_10347612 3300032004 Unclassified 1272
644 Ga0307411_10000225 3300032005 Bacteria 18304
645 Ga0307411_10002477 3300032005 Bacteria 8186
646 Ga0307411_10005812 3300032005 Bacteria 6110
647 Ga0307411_10129027 3300032005 Bacteria 1844
648 Ga0307411_10272521 3300032005 Bacteria 1343
649 Ga0307415_100016248 3300032126 Bacteria 4432
650 Ga0307415_100044465 3300032126 Bacteria 2969
651 Ga0307415_100061091 3300032126 Bacteria 2607
652 Ga0373926_0001509 3300035083 Bacteria 7121
653 Ga0373934_0001641 3300035086 Bacteria 8203
654 Ga0373923_0021756 3300035111 Bacteria 2507
655 Ga0373945_0001275 3300035116 Bacteria 7648
656 Ga0373953_0034825 3300035117 Unclassified 1976
657 Ga0373956_0023270 3300035119 Bacteria 2657
658 Ga0373957_0116960 3300035120 Bacteria 1077
659 Ga0373943_0006267 3300035170 Bacteria 5344
660 Ga0373955_0008733 3300035172 Bacteria 4717
661 Ga0373955_0092288 3300035172 Bacteria 1727
662 Ga0373931_0186089 3300035691 Bacteria 1233
663 Ga0373935_0000703 3300035692 Bacteria 17772
664 Ga0373927_0001415 3300035695 Bacteria 18107
665 Ga0373927_0019393 3300035695 Bacteria 4460
666 Ga0373927_0120647 3300035695 Unclassified 1711
667 Ga0373933_0094317 3300035724 Bacteria 1850
668 Ga0373933_0172053 3300035724 Bacteria 1378
669 Ga0373947_0000375 3300035725 Bacteria 25325
670 Ga0373947_0038109 3300035725 Bacteria 2854
671 Ga0373937_0001799 3300036401 Bacteria 18009
672 Ga0373937_0002762 3300036401 Bacteria 14649
673 Ga0373937_0015520 3300036401 Bacteria 6739
674 Ga0373937_0034248 3300036401 Bacteria 4620
675 Ga0373937_0280774 3300036401 Bacteria 1573
676 Ga0373925_0001319 3300037068 Bacteria 21717
677 Ga0373925_0105454 3300037068 Unclassified 2172
678 Ga0395899_0008208 3300037312 Bacteria 8047
679 Ga0395899_0076972 3300037312 Bacteria 2434
680 Ga0395900_0010523 3300037418 Bacteria 9463
681 Ga0395898_0161404 3300037466 Bacteria 2144
682 Ga0395898_0206172 3300037466 Bacteria 1876
683 Ga0395898_0327450 3300037466 Unclassified 1461
684 Ga0395905_0014090 3300037471 Bacteria 7644
685 Ga0395905_0121012 3300037471 Bacteria 2460
686 Ga0395901_0004518 3300038443 Bacteria 14035
687 Ga0395901_0167214 3300038443 Bacteria 2308
688 Ga0400490_03967 3300038726 Bacteria 30300
689 Ga0400491_20377 3300038727 Bacteria 7784
690 Ga0400483_185667 3300039062 Bacteria 1405
691 Ga0400489_13798 3300039093 Bacteria 1240
692 Ga0436365_0197092 3300039437 Bacteria 5239
693 Ga0436365_0227961 3300039437 Bacteria 2869
694 Ga0436365_0372336 3300039437 Bacteria 5173
695 Ga0436361_0379987 3300039447 Bacteria 1412
696 Ga0436362_0219293 3300039453 Unclassified 4687
697 Ga0451577_0005262 3300042876 Bacteria 13301
698 Ga0451577_0040905 3300042876 Bacteria 4162
699 Ga0451577_0062107 3300042876 Bacteria 3331
700 Ga0451577_0063714 3300042876 Bacteria 3287
701 Ga0451577_0139634 3300042876 Bacteria 2177
702 Ga0466961_0004008 3300044693 Bacteria 9221
703 Ga0453684_0082926 3300044712 Bacteria 3992
704 Ga0453684_0357963 3300044712 Bacteria 1644
705 Ga0466957_0105908 3300044842 Bacteria 1778
706 Ga0466959_0321206 3300045049 Bacteria 1058
707 Ga0451576_0008481 3300045051 Bacteria 12063
708 Ga0451576_0010307 3300045051 Bacteria 10729
709 Ga0451576_0029080 3300045051 Bacteria 5914
710 Ga0451576_0070711 3300045051 Bacteria 3632
711 Ga0451576_0184531 3300045051 Bacteria 2178
712 Ga0451576_0366865 3300045051 Unclassified 1508
713 Ga0466958_0044189 3300045836 Bacteria 2685
714 Ga0466967_0007448 3300045976 Bacteria 7896
715 Ga0495592_0039782 3300046454 Bacteria 3531
716 Ga0495592_0199599 3300046454 Bacteria 1351
717 Ga0495603_0002712 3300046455 Bacteria 10439
718 Ga0495629_0012925 3300046459 Bacteria 6038
719 Ga0495629_0086786 3300046459 Unclassified 2183
720 Ga0495629_0288883 3300046459 Bacteria 1124
721 Ga0495651_0004388 3300046462 Bacteria 10801
722 Ga0495651_0040066 3300046462 Bacteria 3644
723 Ga0495653_0003330 3300046463 Bacteria 12909
724 Ga0495653_0034274 3300046463 Bacteria 4017
725 Ga0495653_0218584 3300046463 Bacteria 1282
726 Ga0495580_0002316 3300046472 Bacteria 16607
727 Ga0495580_0044007 3300046472 Bacteria 3176
728 Ga0495582_0002004 3300046473 Bacteria 11406
729 Ga0495639_0000327 3300046475 Bacteria 22890
730 Ga0495639_0027420 3300046475 Bacteria 2521
731 Ga0495664_0016862 3300046477 Bacteria 4170
732 Ga0495664_0072773 3300046477 Bacteria 2054
733 Ga0495594_0016715 3300046499 Bacteria 3867
734 Ga0495594_0131080 3300046499 Bacteria 1420
735 Ga0495608_0007295 3300046511 Bacteria 7817
736 Ga0495608_0029424 3300046511 Bacteria 3725
737 Ga0495608_0044748 3300046511 Bacteria 2953
738 Ga0495618_0063760 3300046514 Unclassified 2341
739 Ga0495628_0009887 3300046516 Bacteria 8121
740 Ga0495628_0011664 3300046516 Bacteria 7423
741 Ga0495628_0184032 3300046516 Bacteria 1579
742 Ga0495630_0000808 3300046517 Bacteria 21995
743 Ga0495630_0013458 3300046517 Bacteria 5950
744 Ga0495630_0053703 3300046517 Bacteria 3017
745 Ga0495630_0161560 3300046517 Bacteria 1706
746 Ga0495663_0009662 3300046525 Bacteria 2675
747 Ga0495666_0032079 3300046526 Bacteria 2573
748 Ga0495652_0010786 3300046529 Bacteria 8282
749 Ga0495652_0050770 3300046529 Bacteria 3545
750 Ga0495652_0055376 3300046529 Bacteria 3373
751 Ga0495652_0076675 3300046529 Unclassified 2773
752 Ga0495665_0000018 3300046531 Bacteria 62843
753 Ga0495665_0006265 3300046531 Bacteria 6417
754 Ga0495665_0028121 3300046531 Bacteria 3017
755 Ga0495640_0022101 3300046533 Bacteria 4658
756 Ga0495586_0014632 3300046535 Bacteria 4169
757 Ga0495586_0080216 3300046535 Bacteria 1792
758 Ga0495586_0082121 3300046535 Bacteria 1772
759 Ga0495587_0004782 3300046536 Bacteria 8893
760 Ga0495587_0026994 3300046536 Unclassified 3497
761 Ga0495587_0050172 3300046536 Bacteria 2469
762 Ga0495609_0058367 3300046538 Bacteria 1707
763 Ga0495645_0000473 3300046543 Bacteria 27840
764 Ga0495645_0001620 3300046543 Bacteria 15232
765 Ga0495645_0203699 3300046543 Bacteria 1340
766 Ga0495645_0268201 3300046543 Bacteria 1127
767 Ga0495645_0302483 3300046543 Bacteria 1044
768 Ga0495667_0008732 3300046559 Bacteria 6883
769 Ga0495634_0026984 3300046642 Bacteria 4002
770 Ga0495635_0002832 3300046663 Bacteria 11912
771 Ga0495659_0028763 3300046664 Bacteria 1925
772 Ga0495588_0002888 3300046674 Bacteria 7406
773 Ga0495657_0002692 3300046675 Bacteria 14841
774 Ga0495657_0020504 3300046675 Bacteria 4751
775 Ga0495599_0000535 3300046678 Bacteria 21854
776 Ga0495599_0005521 3300046678 Bacteria 7576
777 Ga0495599_0114836 3300046678 Bacteria 1675
778 Ga0495599_0142700 3300046678 Bacteria 1485
779 Ga0495623_0016336 3300046679 Bacteria 4794
780 Ga0495623_0034791 3300046679 Unclassified 3230
781 Ga0495623_0036342 3300046679 Bacteria 3156
782 Ga0495646_0083396 3300046680 Bacteria 1858
783 Ga0495646_0161277 3300046680 Bacteria 1241
784 Ga0495658_0000100 3300046683 Bacteria 45016
785 Ga0495613_0006699 3300046689 Bacteria 8599
786 Ga0495600_0005319 3300046809 Bacteria 7754
787 Ga0495581_0000398 3300047315 Bacteria 21794
788 Ga0495604_0000763 3300047317 Bacteria 27124
789 Ga0495604_0249320 3300047317 Bacteria 1211
790 Ga0495674_0002624 3300047319 Bacteria 17486
791 Ga0495674_0025364 3300047319 Bacteria 5436
792 Ga0495674_0175145 3300047319 Bacteria 1788
793 Ga0495680_0010187 3300047322 Bacteria 8398
794 Ga0495680_0021219 3300047322 Bacteria 5442
795 Ga0495680_0061115 3300047322 Bacteria 2899
796 Ga0495675_0022231 3300047444 Bacteria 4042
797 Ga0495675_0063687 3300047444 Bacteria 2333
798 Ga0495675_0190666 3300047444 Bacteria 1251
799 Ga0495684_0009046 3300047471 Bacteria 7688
800 Ga0495684_0011900 3300047471 Bacteria 6710
801 Ga0495684_0013660 3300047471 Bacteria 6253
802 Ga0495684_0038470 3300047471 Bacteria 3668
803 Ga0495684_0148103 3300047471 Bacteria 1757
804 Ga0495593_0000056 3300047673 Bacteria 47474
805 Ga0495593_0071788 3300047673 Bacteria 1798
806 Ga0495602_0003495 3300048088 Bacteria 16245
807 Ga0495602_0157012 3300048088 Bacteria 1780
808 Ga0495614_0000019 3300048089 Bacteria 49609
809 Ga0495614_0083569 3300048089 Bacteria 1385
810 Ga0496102_0070451 3300048905 Bacteria 3211
811 Ga0496104_0122857 3300048907 Bacteria 2493
812 Ga0496105_0345600 3300048908 Bacteria 1189
813 Ga0496109_0080552 3300048912 Bacteria 3000
814 Ga0496109_0140312 3300048912 Unclassified 2260
815 Ga0496113_0019741 3300048916 Bacteria 4723
816 Ga0496115_0449258 3300048918 Bacteria 1041
817 Ga0501031_0042160 3300049568 Bacteria 2980
818 Ga0501033_0006423 3300049570 Bacteria 9207
819 Ga0501033_0229241 3300049570 Bacteria 1320
820 Ga0501037_0324436 3300049573 Unclassified 1066
821 Ga0501038_0137124 3300049574 Bacteria 2004
822 Ga0501041_0177683 3300049577 Bacteria 1333
823 Ga0501042_0006394 3300049578 Bacteria 7638
824 Ga0501043_0014597 3300049579 Bacteria 6150
825 Ga0501047_0008497 3300049581 Bacteria 9685
826 Ga0501047_0119912 3300049581 Bacteria 2513
827 Ga0501047_0146171 3300049581 Bacteria 2241
828 Ga0501048_0046561 3300049582 Unclassified 3096
829 Ga0501048_0054406 3300049582 Bacteria 2843
830 Ga0501069_0175684 3300049585 Bacteria 1237
831 Ga0501070_0231605 3300049586 Bacteria 1513
832 Ga0501072_0064197 3300049588 Bacteria 2896
833 Ga0501074_0068303 3300049590 Bacteria 2555
834 Ga0501075_0279817 3300049591 Bacteria 1271
835 Ga0501076_0011437 3300049592 Bacteria 6611
836 Ga0501076_0212785 3300049592 Bacteria 1580
837 Ga0501081_0095796 3300049743 Bacteria 2093
838 Ga0501035_0002954 3300049822 Bacteria 16348
839 Ga0501035_0223618 3300049822 Bacteria 1606
840 Ga0501044_0048517 3300049823 Unclassified 4385
841 Ga0501045_0043456 3300049824 Bacteria 3272
842 nmdc:mga05p37_119369_c1 3300050507 Unclassified 3240
843 nmdc:mga05p37_17745_c1 3300050507 Bacteria 8588
844 nmdc:mga05p37_265134_c1 3300050507 Bacteria 2054
845 nmdc:mga05p37_279512_c2 3300050507 Bacteria 1466
846 nmdc:mga05p37_3614_c1 3300050507 Bacteria 18072
847 nmdc:mga05p37_400969_c1 3300050507 Unclassified 1601
848 nmdc:mga05p37_93447_c1 3300050507 Bacteria 3706
849 nmdc:mga09592_101241_c1 3300050508 Bacteria 2468
850 nmdc:mga09592_135992_c1 3300050508 Bacteria 2117
851 nmdc:mga09592_260961_c1 3300050508 Unclassified 1502
852 nmdc:mga09592_41487_c1 3300050508 Bacteria 3870
853 nmdc:mga0qj67_101063_c1 3300050509 Bacteria 2324
854 nmdc:mga0qj67_12188_c1 3300050509 Bacteria 6470
855 nmdc:mga0qj67_30130_c1 3300050509 Bacteria 4220
856 nmdc:mga0qj67_7179_c1 3300050509 Bacteria 8222
857 nmdc:mga06r32_127588_c1 3300050510 Bacteria 2514
858 nmdc:mga06r32_19606_c1 3300050510 Bacteria 6211
859 nmdc:mga06r32_209656_c1 3300050510 Bacteria 1936
860 nmdc:mga06r32_41337_c1 3300050510 Bacteria 4380
861 nmdc:mga06r32_67053_c1 3300050510 Bacteria 3464
862 nmdc:mga08y16_100155_c1 3300050511 Bacteria 3017
863 nmdc:mga08y16_245678_c1 3300050511 Archaea 1849
864 nmdc:mga0n895_122962_c1 3300050512 Bacteria 2617
865 nmdc:mga0n895_327330_c1 3300050512 Unclassified 1553
866 nmdc:mga0n895_430776_c1 3300050512 Bacteria 1333
867 nmdc:mga0n895_55553_c1 3300050512 Bacteria 3897
868 nmdc:mga0n895_754_c1 3300050512 Bacteria 22905
869 nmdc:mga0n895_83087_c1 3300050512 Bacteria 3194
870 nmdc:mga0rr50_158826_c1 3300050513 Bacteria 1833
871 nmdc:mga0rr50_26610_c1 3300050513 Bacteria 4039
872 nmdc:mga0rr50_293037_c1 3300050513 Bacteria 1360
873 nmdc:mga0rr50_322299_c1 3300050513 Bacteria 1296
874 nmdc:mga0rr50_37963_c1 3300050513 Bacteria 3481
875 nmdc:mga08x19_17232_c1 3300050514 Unclassified 4418
876 nmdc:mga08x19_19768_c1 3300050514 Bacteria 4138
877 nmdc:mga08x19_2685_c1 3300050514 Bacteria 10747
878 nmdc:mga08x19_92691_c1 3300050514 Bacteria 1996
879 nmdc:mga08x19_99943_c1 3300050514 Unclassified 1924
880 nmdc:mga0a205_113717_c1 3300050515 Bacteria 2606
881 nmdc:mga0a205_180596_c1 3300050515 Unclassified 2005
882 nmdc:mga0a205_21115_c1 3300050515 Bacteria 6157
883 nmdc:mga0a205_28122_c1 3300050515 Bacteria 5373
884 nmdc:mga0a205_342_c1 3300050515 Bacteria 35102
885 nmdc:mga0a205_35014_c1 3300050515 Bacteria 4821
886 nmdc:mga0a205_42712_c1 3300050515 Bacteria 4368
887 nmdc:mga0a205_66002_c1 3300050515 Bacteria 3497
888 nmdc:mga0a205_8774_c1 3300050515 Bacteria 9210
889 Ga0495601_0115873 3300053077 Bacteria 1737
890 Ga0495601_0181582 3300053077 Bacteria 1376
891 Ga0495612_0036991 3300053078 Bacteria 1981
892 Ga0495619_0005496 3300053085 Bacteria 8037
893 Ga0495619_0114181 3300053085 Bacteria 1848
894 Ga0501084_0092838 3300054114 Bacteria 2534
895 Ga0530510_0087901 3300061734 Bacteria 2265
896 Ga0207699_10000730
897 JGI24737J22298_10027458
898 JGI25406J46586_10013091
899 rootL2_10120163
900 Ga0065715_10127110
901 Ga0065707_10005662
902 Ga0070658_10004750
903 Ga0070658_10016733
904 Ga0070658_10068654
905 Ga0070676_10013941
906 Ga0070676_10078320
907 Ga0070683_100001423
908 Ga0070683_100009888
909 Ga0070683_100011445
910 Ga0070683_100012124
911 Ga0070683_100014812
912 Ga0070683_100119687
913 Ga0070683_100191007
914 Ga0070690_100015589
915 Ga0070690_100022917
916 Ga0070670_100029158
917 Ga0070670_100067469
918 Ga0070670_100166486
919 Ga0070670_100223262
920 Ga0070677_10028296
921 Ga0068869_100000983
922 Ga0070666_10211534
923 Ga0070680_100010579
924 Ga0070680_100011289
925 Ga0070680_100013197
926 Ga0070680_100014046
927 Ga0070680_100021926
928 Ga0070680_100042151
929 Ga0070680_100108503
930 Ga0070680_100168862
931 Ga0070680_100170129
932 Ga0070682_100118330
933 Ga0068868_100017098
934 Ga0068868_100316669
935 Ga0070660_100004754
936 Ga0070660_100130635
937 Ga0070660_100256520
938 Ga0070689_100032617
939 Ga0070689_100082763
940 Ga0070691_10003236
941 Ga0070691_10112760
942 Ga0070687_100031740
943 Ga0070687_100165584
944 Ga0070661_100001775
945 Ga0070661_100005740
946 Ga0070661_100010129
947 Ga0070661_100037982
948 Ga0070661_100246326
949 Ga0070692_10001819
950 Ga0070692_10009842
951 Ga0070668_100004128
952 Ga0070668_100023934
953 Ga0070668_100109341
954 Ga0070669_100000286
955 Ga0070669_100003078
956 Ga0070669_100020426
957 Ga0070669_100094551
958 Ga0070675_100001798
959 Ga0070675_100003416
960 Ga0070675_100011378
961 Ga0070675_100089438
962 Ga0070671_100017331
963 Ga0070671_100310295
964 Ga0070674_100045151
965 Ga0070673_100010493
966 Ga0070673_100018647
967 Ga0070688_100021612
968 Ga0070667_100018721
969 Ga0070667_100170618
970 Ga0070703_10000141
971 Ga0070709_10002224
972 Ga0070709_10005278
973 Ga0070709_10011472
974 Ga0070709_10152118
975 Ga0070714_100013770
976 Ga0070714_100018855
977 Ga0070714_100024188
978 Ga0070714_100027686
979 Ga0070714_100050909
980 Ga0070714_100151210
981 Ga0070713_100007028
982 Ga0070713_100015494
983 Ga0070713_100015584
984 Ga0070713_100041772
985 Ga0070711_100000044
986 Ga0070711_100115210
987 Ga0070705_100007013
988 Ga0070705_100007255
989 Ga0070705_100013408
990 Ga0070705_100029839
991 Ga0070705_100041902
992 Ga0070705_100071444
993 Ga0070700_100022231
994 Ga0070694_100001129
995 Ga0070694_100002113
996 Ga0070694_100006192
997 Ga0070694_100006812
998 Ga0070694_100023268
999 Ga0070694_100028597
1000 Ga0070708_100000183
1001 Ga0070708_100008720
1002 Ga0070708_100016970
1003 Ga0070708_100019701
1004 Ga0070708_100030889
1005 Ga0070708_100068966
1006 Ga0070708_100119621
1007 Ga0070708_100146490
1008 Ga0070708_100179236
1009 Ga0070708_100185667
1010 Ga0070663_100047893
1011 Ga0070678_100073774
1012 Ga0070662_100000232
1013 Ga0070662_100071902
1014 Ga0070662_100166708
1015 Ga0070681_10008126
1016 Ga0070681_10008654
1017 Ga0070681_10016922
1018 Ga0070681_10028425
1019 Ga0070681_10034392
1020 Ga0070681_10044686
1021 Ga0070681_10056215
1022 Ga0070681_10098562
1023 Ga0070681_10099636
1024 Ga0070681_10144795
1025 Ga0068867_100009283
1026 Ga0068867_100160555
1027 Ga0070685_10006098
1028 Ga0070685_10006945
1029 Ga0070685_10051141
1030 Ga0070706_100012318
1031 Ga0070706_100021112
1032 Ga0070706_100029609
1033 Ga0070706_100041675
1034 Ga0070706_100056332
1035 Ga0070706_100126835
1036 Ga0070706_100141562
1037 Ga0070707_100000266
1038 Ga0070707_100072842
1039 Ga0070707_100117171
1040 Ga0070707_100136052
1041 Ga0070707_100144113
1042 Ga0070707_100176927
1043 Ga0070707_100300542
1044 Ga0070707_100365255
1045 Ga0070698_100000177
1046 Ga0070698_100000668
1047 Ga0070698_100005944
1048 Ga0070698_100017391
1049 Ga0070698_100018882
1050 Ga0070698_100027989
1051 Ga0070698_100104722
1052 Ga0070698_100142468
1053 Ga0070698_100147825
1054 Ga0070699_100020380
1055 Ga0070699_100031009
1056 Ga0070699_100065147
1057 Ga0070699_100071650
1058 Ga0070699_100258804
1059 Ga0070699_100281450
1060 Ga0070699_100543870
1061 Ga0070679_100000482
1062 Ga0070679_100005427
1063 Ga0070679_100011080
1064 Ga0070679_100011794
1065 Ga0070679_100012244
1066 Ga0070679_100020296
1067 Ga0070679_100037764
1068 Ga0070679_100064821
1069 Ga0070679_100091060
1070 Ga0070679_100103189
1071 Ga0070679_100135372
1072 Ga0070679_100182798
1073 Ga0070679_100195747
1074 Ga0070679_100202928
1075 Ga0070684_100003547
1076 Ga0070684_100009138
1077 Ga0070684_100053400
1078 Ga0070684_100110712
1079 Ga0070684_100234071
1080 Ga0070684_100391591
1081 Ga0070697_100001834
1082 Ga0070697_100003661
1083 Ga0070697_100019308
1084 Ga0070697_100026307
1085 Ga0070697_100026355
1086 Ga0070697_100377578
1087 Ga0070697_100488848
1088 Ga0068853_100005405
1089 Ga0068853_100176680
1090 Ga0068853_100178900
1091 Ga0070672_100002105
1092 Ga0070672_100028150
1093 Ga0070672_100038736
1094 Ga0070672_100104651
1095 Ga0070672_100295346
1096 Ga0070686_100000080
1097 Ga0070686_100014652
1098 Ga0070695_100000765
1099 Ga0070695_100011121
1100 Ga0070695_100018320
1101 Ga0070695_100018856
1102 Ga0070695_100119105
1103 Ga0070695_100121357
1104 Ga0070695_100210572
1105 Ga0070696_100000194
1106 Ga0070696_100000241
1107 Ga0070696_100002516
1108 Ga0070696_100015219
1109 Ga0070696_100029304
1110 Ga0070696_100088731
1111 Ga0070696_100112955
1112 Ga0070665_100125045
1113 Ga0070704_100000123
1114 Ga0070704_100007002
1115 Ga0070704_100011688
1116 Ga0070704_100045023
1117 Ga0070704_100056240
1118 Ga0068855_100013106
1119 Ga0068855_100155311
1120 Ga0068855_100318953
1121 Ga0070664_100020824
1122 Ga0070664_100036947
1123 Ga0070664_100045601
1124 Ga0070664_100060801
1125 Ga0070664_100352805
1126 Ga0068857_100012851
1127 Ga0068857_100023156
1128 Ga0068857_100065083
1129 Ga0068857_100071754
1130 Ga0068857_100116407
1131 Ga0068854_100010221
1132 Ga0068854_100021667
1133 Ga0068854_100040580
1134 Ga0068856_100058772
1135 Ga0068856_100099724
1136 Ga0070702_100210134
1137 Ga0068852_100004338
1138 Ga0068852_100006656
1139 Ga0068852_100035002
1140 Ga0068852_100088323
1141 Ga0068852_100158777
1142 Ga0068852_100160031
1143 Ga0068859_100003185
1144 Ga0068859_100045389
1145 Ga0068859_100081284
1146 Ga0068859_100610765
1147 Ga0068864_100027015
1148 Ga0068864_100216397
1149 Ga0068866_10063158
1150 Ga0068861_100001644
1151 Ga0068861_100007574
1152 Ga0068861_100021776
1153 Ga0068851_10006225
1154 Ga0068870_10003755
1155 Ga0068863_100047794
1156 Ga0068863_100120280
1157 Ga0068860_100080328
1158 Ga0068860_100320864
1159 Ga0068862_100000767
1160 Ga0068862_100002810
1161 Ga0068862_100017050
1162 Ga0081539_10000019
1163 Ga0070717_10000856
1164 Ga0070716_100210110
1165 Ga0070712_100000815
1166 Ga0068871_100146270
1167 Ga0075428_100008620
1168 Ga0075428_100031768
1169 Ga0075428_100041765
1170 Ga0075428_100045271
1171 Ga0075428_100263071
1172 Ga0075430_100003405
1173 Ga0075430_100017629
1174 Ga0075430_100019655
1175 Ga0075430_100033573
1176 Ga0075430_100059946
1177 Ga0075430_100147316
1178 Ga0075431_100008788
1179 Ga0075431_100011511
1180 Ga0075431_100012605
1181 Ga0075431_100149740
1182 Ga0075431_100153026
1183 Ga0075431_100204494
1184 Ga0075433_10007578
1185 Ga0075433_10025029
1186 Ga0075433_10025679
1187 Ga0075433_10039423
1188 Ga0075433_10042506
1189 Ga0075433_10330661
1190 Ga0075434_100003164
1191 Ga0075434_100009436
1192 Ga0075434_100010430
1193 Ga0075434_100031574
1194 Ga0075434_100044015
1195 Ga0075434_100104795
1196 Ga0075429_100001536
1197 Ga0075429_100017553
1198 Ga0075429_100032865
1199 Ga0075429_100121449
1200 Ga0075429_100317673
1201 Ga0068865_100001192
1202 Ga0068865_100153623
1203 Ga0075436_100001128
1204 Ga0075436_100017637
1205 Ga0075436_100031275
1206 Ga0097620_100003185
1207 Ga0097620_100045391
1208 Ga0097620_100081286
1209 Ga0097620_100610797
1210 Ga0075435_100064106
1211 Ga0075435_100253858
1212 Ga0099794_10000050
1213 Ga0099794_10037785
1214 Ga0099794_10046255
1215 Ga0099794_10170149
1216 Ga0105240_10000907
1217 Ga0105240_10007075
1218 Ga0105240_10019801
1219 Ga0105240_10089117
1220 Ga0105240_10112220
1221 Ga0105240_10375319
1222 Ga0111539_10184088
1223 Ga0105245_10055871
1224 Ga0114129_10017211
1225 Ga0114129_10030901
1226 Ga0114129_10091726
1227 Ga0114129_10241965
1228 Ga0114129_10320237
1229 Ga0114129_10352065
1230 Ga0105241_10057545
1231 Ga0105241_10140954
1232 Ga0105241_10180635
1233 Ga0105242_10006347
1234 Ga0105242_10022543
1235 Ga0105242_10105639
1236 Ga0105248_10034675
1237 Ga0105248_10340857
1238 Ga0105237_10000319
1239 Ga0105238_10007618
1240 Ga0105238_10192519
1241 Ga0105238_10192520
1242 Ga0105238_10291786
1243 Ga0105249_10000186
1244 Ga0105249_10000634
1245 Ga0105249_10001368
1246 Ga0105249_10054461
1247 Ga0099796_10024603
1248 Ga0105239_10041296
1249 Ga0157373_10034298
1250 Ga0157371_10004220
1251 Ga0157370_10003141
1252 Ga0157370_10004461
1253 Ga0157370_10057835
1254 Ga0157370_10207222
1255 Ga0157370_10229431
1256 Ga0157369_10002374
1257 Ga0157369_10013585
1258 Ga0157369_10169810
1259 Ga0157369_10177642
1260 Ga0157369_10185243
1261 Ga0157369_10264846
1262 Ga0157369_10379805
1263 Ga0163162_10004889
1264 Ga0163162_10050940
1265 Ga0163162_10166403
1266 Ga0157372_10003862
1267 Ga0157372_10008985
1268 Ga0157372_10018216
1269 Ga0157372_10027444
1270 Ga0157372_10038773
1271 Ga0157372_10059334
1272 Ga0157372_10103748
1273 Ga0157372_10113474
1274 Ga0157372_10161763
1275 Ga0157372_10312364
1276 Ga0157372_10450629
1277 Ga0157372_10490243
1278 Ga0157375_10026656
1279 Ga0157375_10026771
1280 Ga0157375_10040712
1281 Ga0157375_10071329
1282 Ga0157375_10406634
1283 Ga0163163_10000841
1284 Ga0157380_10001587
1285 Ga0157380_10002221
1286 Ga0157380_10072408
1287 Ga0182008_10074099
1288 Ga0157377_10014421
1289 Ga0157379_10029096
1290 Ga0157376_10008270
1291 Ga0163161_10019704
1292 Ga0197907_10955801
1293 Ga0206354_10324332
1294 Ga0213876_10005686
1295 Ga0207697_10002385
1296 Ga0207656_10012964
1297 Ga0207653_10000129
1298 Ga0207653_10009586
1299 Ga0207682_10023996
1300 Ga0207642_10091621
1301 Ga0207699_10005603
1302 Ga0207699_10050743
1303 Ga0207645_10002070
1304 Ga0207645_10031721
1305 Ga0207643_10003815
1306 Ga0207705_10012284
1307 Ga0207705_10012839
1308 Ga0207705_10054912
1309 Ga0207684_10006439
1310 Ga0207684_10012715
1311 Ga0207684_10038084
1312 Ga0207684_10058170
1313 Ga0207684_10106957
1314 Ga0207684_10310641
1315 Ga0207654_10072085
1316 Ga0207707_10003518
1317 Ga0207707_10004367
1318 Ga0207707_10005269
1319 Ga0207707_10019567
1320 Ga0207707_10034748
1321 Ga0207707_10045262
1322 Ga0207707_10060522
1323 Ga0207707_10097169
1324 Ga0207707_10181865
1325 Ga0207695_10002537
1326 Ga0207695_10004743
1327 Ga0207695_10075521
1328 Ga0207695_10079292
1329 Ga0207695_10132666
1330 Ga0207695_10237829
1331 Ga0207695_10240073
1332 Ga0207671_10003085
1333 Ga0207693_10005881
1334 Ga0207693_10017051
1335 Ga0207663_10001229
1336 Ga0207660_10003524
1337 Ga0207660_10004839
1338 Ga0207660_10005733
1339 Ga0207660_10007862
1340 Ga0207660_10027572
1341 Ga0207660_10033782
1342 Ga0207660_10048011
1343 Ga0207660_10060432
1344 Ga0207660_10102931
1345 Ga0207662_10004224
1346 Ga0207662_10109770
1347 Ga0207657_10002791
1348 Ga0207657_10007054
1349 Ga0207657_10038012
1350 Ga0207649_10004679
1351 Ga0207649_10005222
1352 Ga0207649_10027828
1353 Ga0207649_10028540
1354 Ga0207649_10284076
1355 Ga0207652_10012120
1356 Ga0207652_10013567
1357 Ga0207652_10013738
1358 Ga0207652_10024282
1359 Ga0207652_10057549
1360 Ga0207652_10099836
1361 Ga0207652_10114318
1362 Ga0207652_10116348
1363 Ga0207652_10307983
1364 Ga0207652_10339104
1365 Ga0207652_10348261
1366 Ga0207652_10369841
1367 Ga0207646_10002391
1368 Ga0207646_10005847
1369 Ga0207646_10006642
1370 Ga0207646_10028728
1371 Ga0207646_10035737
1372 Ga0207646_10099063
1373 Ga0207646_10103058
1374 Ga0207646_10188962
1375 Ga0207646_10302214
1376 Ga0207681_10001254
1377 Ga0207681_10001580
1378 Ga0207681_10015268
1379 Ga0207681_10180636
1380 Ga0207694_10000051
1381 Ga0207694_10018617
1382 Ga0207694_10024763
1383 Ga0207694_10094929
1384 Ga0207650_10004257
1385 Ga0207650_10101389
1386 Ga0207659_10009540
1387 Ga0207659_10024774
1388 Ga0207659_10344496
1389 Ga0207659_10362677
1390 Ga0207700_10025824
1391 Ga0207700_10030827
1392 Ga0207664_10013254
1393 Ga0207664_10025542
1394 Ga0207664_10028309
1395 Ga0207664_10100861
1396 Ga0207664_10112956
1397 Ga0207664_10412084
1398 Ga0207644_10092012
1399 Ga0207644_10220771
1400 Ga0207690_10157544
1401 Ga0207706_10001523
1402 Ga0207706_10241053
1403 Ga0207686_10037025
1404 Ga0207686_10044069
1405 Ga0207670_10008698
1406 Ga0207670_10011081
1407 Ga0207670_10026437
1408 Ga0207669_10053508
1409 Ga0207704_10078548
1410 Ga0207665_10009089
1411 Ga0207665_10058443
1412 Ga0207691_10000329
1413 Ga0207691_10013154
1414 Ga0207691_10019319
1415 Ga0207691_10063691
1416 Ga0207691_10094458
1417 Ga0207689_10009386
1418 Ga0207661_10008356
1419 Ga0207661_10012298
1420 Ga0207661_10023464
1421 Ga0207661_10048516
1422 Ga0207661_10053974
1423 Ga0207661_10075967
1424 Ga0207661_10163569
1425 Ga0207679_10003259
1426 Ga0207679_10006747
1427 Ga0207679_10011432
1428 Ga0207679_10037261
1429 Ga0207679_10056146
1430 Ga0207679_10067466
1431 Ga0207667_10056041
1432 Ga0207667_10083565
1433 Ga0207667_10090663
1434 Ga0207667_10410533
1435 Ga0207651_10057272
1436 Ga0207712_10000218
1437 Ga0207712_10000260
1438 Ga0207712_10007431
1439 Ga0207668_10007085
1440 Ga0207668_10022985
1441 Ga0207668_10087159
1442 Ga0207640_10027021
1443 Ga0207640_10030712
1444 Ga0207640_10178618
1445 Ga0207658_10030400
1446 Ga0207658_10056799
1447 Ga0207677_10007881
1448 Ga0207639_10014784
1449 Ga0207639_10040669
1450 Ga0207639_10213513
1451 Ga0207639_10353139
1452 Ga0207678_10039415
1453 Ga0207708_10004989
1454 Ga0207708_10053876
1455 Ga0207702_10009943
1456 Ga0207702_10035453
1457 Ga0207702_10200282
1458 Ga0207702_10227274
1459 Ga0207641_10020676
1460 Ga0207648_10036875
1461 Ga0207648_10044565
1462 Ga0207648_10187329
1463 Ga0207676_10021630
1464 Ga0207676_10061618
1465 Ga0207674_10000546
1466 Ga0207674_10003558
1467 Ga0207674_10029206
1468 Ga0207674_10032824
1469 Ga0207674_10078359
1470 Ga0207674_10086222
1471 Ga0207674_10143555
1472 Ga0207674_10202155
1473 Ga0207675_100000024
1474 Ga0207675_100007357
1475 Ga0207698_10013398
1476 Ga0207698_10015268
1477 Ga0207698_10020857
1478 Ga0207698_10094604
1479 Ga0207698_10355201
1480 Ga0209588_1000631
1481 Ga0209588_1002436
1482 Ga0207428_10157352
1483 Ga0268266_10026977
1484 Ga0268266_10066718
1485 Ga0268265_10000144
1486 Ga0268265_10004810
1487 Ga0268265_10008644
1488 Ga0268264_10063194
1489 Ga0268264_10333459
1490 Ga0265332_10001162
1491 Ga0265327_10016358
1492 Ga0307408_100005865
1493 Ga0307408_100012104
1494 Ga0307408_100022179
1495 Ga0307408_100127616
1496 Ga0307408_100195194
1497 Ga0307408_100244616
1498 Ga0307405_10001226
1499 Ga0307405_10002651
1500 Ga0307405_10005972
1501 Ga0307405_10047929
1502 Ga0307405_10083043
1503 Ga0307413_10001832
1504 Ga0307413_10002645
1505 Ga0307413_10004252
1506 Ga0307413_10007219
1507 Ga0307413_10030848
1508 Ga0307410_10000198
1509 Ga0307410_10010066
1510 Ga0307410_10014331
1511 Ga0307410_10144391
1512 Ga0307406_10002122
1513 Ga0307406_10004941
1514 Ga0307406_10034734
1515 Ga0307406_10142890
1516 Ga0307407_10001339
1517 Ga0307407_10016446
1518 Ga0307407_10063355
1519 Ga0307407_10213649
1520 Ga0307412_10001486
1521 Ga0307412_10019448
1522 Ga0307412_10021455
1523 Ga0307409_100026741
1524 Ga0307409_100042698
1525 Ga0307409_100062497
1526 Ga0307409_100145034
1527 Ga0307409_100166475
1528 Ga0307416_100024724
1529 Ga0307416_100039917
1530 Ga0307416_100081639
1531 Ga0307416_100292273
1532 Ga0307416_100356897
1533 Ga0307414_10000799
1534 Ga0307414_10012799
1535 Ga0307414_10030746
1536 Ga0307414_10140566
1537 Ga0307414_10171569
1538 Ga0307414_10347612
1539 Ga0307411_10000225
1540 Ga0307411_10002477
1541 Ga0307411_10005812
1542 Ga0307411_10129027
1543 Ga0307411_10272521
1544 Ga0307415_100016248
1545 Ga0307415_100044465
1546 Ga0307415_100061091
1547 Ga0373926_0001509
1548 Ga0373934_0001641
1549 Ga0373923_0021756
1550 Ga0373945_0001275
1551 Ga0373953_0034825
1552 Ga0373956_0023270
1553 Ga0373957_0116960
1554 Ga0373943_0006267
1555 Ga0373955_0008733
1556 Ga0373955_0092288
1557 Ga0373931_0186089
1558 Ga0373935_0000703
1559 Ga0373927_0001415
1560 Ga0373927_0019393
1561 Ga0373927_0120647
1562 Ga0373933_0094317
1563 Ga0373933_0172053
1564 Ga0373947_0000375
1565 Ga0373947_0038109
1566 Ga0373937_0001799
1567 Ga0373937_0002762
1568 Ga0373937_0015520
1569 Ga0373937_0034248
1570 Ga0373937_0280774
1571 Ga0373925_0001319
1572 Ga0373925_0105454
1573 Ga0395899_0008208
1574 Ga0395899_0076972
1575 Ga0395900_0010523
1576 Ga0395898_0161404
1577 Ga0395898_0206172
1578 Ga0395898_0327450
1579 Ga0395905_0014090
1580 Ga0395905_0121012
1581 Ga0395901_0004518
1582 Ga0395901_0167214
1583 Ga0400490_03967
1584 Ga0400491_20377
1585 Ga0400483_185667
1586 Ga0400489_13798
1587 Ga0436365_0197092
1588 Ga0436365_0227961
1589 Ga0436365_0372336
1590 Ga0436361_0379987
1591 Ga0436362_0219293
1592 Ga0451577_0005262
1593 Ga0451577_0040905
1594 Ga0451577_0062107
1595 Ga0451577_0063714
1596 Ga0451577_0139634
1597 Ga0466961_0004008
1598 Ga0453684_0082926
1599 Ga0453684_0357963
1600 Ga0466957_0105908
1601 Ga0466959_0321206
1602 Ga0451576_0008481
1603 Ga0451576_0010307
1604 Ga0451576_0029080
1605 Ga0451576_0070711
1606 Ga0451576_0184531
1607 Ga0451576_0366865
1608 Ga0466958_0044189
1609 Ga0466967_0007448
1610 Ga0495592_0039782
1611 Ga0495592_0199599
1612 Ga0495603_0002712
1613 Ga0495629_0012925
1614 Ga0495629_0086786
1615 Ga0495629_0288883
1616 Ga0495651_0004388
1617 Ga0495651_0040066
1618 Ga0495653_0003330
1619 Ga0495653_0034274
1620 Ga0495653_0218584
1621 Ga0495580_0002316
1622 Ga0495580_0044007
1623 Ga0495582_0002004
1624 Ga0495639_0000327
1625 Ga0495639_0027420
1626 Ga0495664_0016862
1627 Ga0495664_0072773
1628 Ga0495594_0016715
1629 Ga0495594_0131080
1630 Ga0495608_0007295
1631 Ga0495608_0029424
1632 Ga0495608_0044748
1633 Ga0495618_0063760
1634 Ga0495628_0009887
1635 Ga0495628_0011664
1636 Ga0495628_0184032
1637 Ga0495630_0000808
1638 Ga0495630_0013458
1639 Ga0495630_0053703
1640 Ga0495630_0161560
1641 Ga0495663_0009662
1642 Ga0495666_0032079
1643 Ga0495652_0010786
1644 Ga0495652_0050770
1645 Ga0495652_0055376
1646 Ga0495652_0076675
1647 Ga0495665_0000018
1648 Ga0495665_0006265
1649 Ga0495665_0028121
1650 Ga0495640_0022101
1651 Ga0495586_0014632
1652 Ga0495586_0080216
1653 Ga0495586_0082121
1654 Ga0495587_0004782
1655 Ga0495587_0026994
1656 Ga0495587_0050172
1657 Ga0495609_0058367
1658 Ga0495645_0000473
1659 Ga0495645_0001620
1660 Ga0495645_0203699
1661 Ga0495645_0268201
1662 Ga0495645_0302483
1663 Ga0495667_0008732
1664 Ga0495634_0026984
1665 Ga0495635_0002832
1666 Ga0495659_0028763
1667 Ga0495588_0002888
1668 Ga0495657_0002692
1669 Ga0495657_0020504
1670 Ga0495599_0000535
1671 Ga0495599_0005521
1672 Ga0495599_0114836
1673 Ga0495599_0142700
1674 Ga0495623_0016336
1675 Ga0495623_0034791
1676 Ga0495623_0036342
1677 Ga0495646_0083396
1678 Ga0495646_0161277
1679 Ga0495658_0000100
1680 Ga0495613_0006699
1681 Ga0495600_0005319
1682 Ga0495581_0000398
1683 Ga0495604_0000763
1684 Ga0495604_0249320
1685 Ga0495674_0002624
1686 Ga0495674_0025364
1687 Ga0495674_0175145
1688 Ga0495680_0010187
1689 Ga0495680_0021219
1690 Ga0495680_0061115
1691 Ga0495675_0022231
1692 Ga0495675_0063687
1693 Ga0495675_0190666
1694 Ga0495684_0009046
1695 Ga0495684_0011900
1696 Ga0495684_0013660
1697 Ga0495684_0038470
1698 Ga0495684_0148103
1699 Ga0495593_0000056
1700 Ga0495593_0071788
1701 Ga0495602_0003495
1702 Ga0495602_0157012
1703 Ga0495614_0000019
1704 Ga0495614_0083569
1705 Ga0496102_0070451
1706 Ga0496104_0122857
1707 Ga0496105_0345600
1708 Ga0496109_0080552
1709 Ga0496109_0140312
1710 Ga0496113_0019741
1711 Ga0496115_0449258
1712 Ga0501031_0042160
1713 Ga0501033_0006423
1714 Ga0501033_0229241
1715 Ga0501037_0324436
1716 Ga0501038_0137124
1717 Ga0501041_0177683
1718 Ga0501042_0006394
1719 Ga0501043_0014597
1720 Ga0501047_0008497
1721 Ga0501047_0119912
1722 Ga0501047_0146171
1723 Ga0501048_0046561
1724 Ga0501048_0054406
1725 Ga0501069_0175684
1726 Ga0501070_0231605
1727 Ga0501072_0064197
1728 Ga0501074_0068303
1729 Ga0501075_0279817
1730 Ga0501076_0011437
1731 Ga0501076_0212785
1732 Ga0501081_0095796
1733 Ga0501035_0002954
1734 Ga0501035_0223618
1735 Ga0501044_0048517
1736 Ga0501045_0043456
1737 nmdc:mga05p37_119369_c1
1738 nmdc:mga05p37_17745_c1
1739 nmdc:mga05p37_265134_c1
1740 nmdc:mga05p37_279512_c2
1741 nmdc:mga05p37_3614_c1
1742 nmdc:mga05p37_400969_c1
1743 nmdc:mga05p37_93447_c1
1744 nmdc:mga09592_101241_c1
1745 nmdc:mga09592_135992_c1
1746 nmdc:mga09592_260961_c1
1747 nmdc:mga09592_41487_c1
1748 nmdc:mga0qj67_101063_c1
1749 nmdc:mga0qj67_12188_c1
1750 nmdc:mga0qj67_30130_c1
1751 nmdc:mga0qj67_7179_c1
1752 nmdc:mga06r32_127588_c1
1753 nmdc:mga06r32_19606_c1
1754 nmdc:mga06r32_209656_c1
1755 nmdc:mga06r32_41337_c1
1756 nmdc:mga06r32_67053_c1
1757 nmdc:mga08y16_100155_c1
1758 nmdc:mga08y16_245678_c1
1759 nmdc:mga0n895_122962_c1
1760 nmdc:mga0n895_327330_c1
1761 nmdc:mga0n895_430776_c1
1762 nmdc:mga0n895_55553_c1
1763 nmdc:mga0n895_754_c1
1764 nmdc:mga0n895_83087_c1
1765 nmdc:mga0rr50_158826_c1
1766 nmdc:mga0rr50_26610_c1
1767 nmdc:mga0rr50_293037_c1
1768 nmdc:mga0rr50_322299_c1
1769 nmdc:mga0rr50_37963_c1
1770 nmdc:mga08x19_17232_c1
1771 nmdc:mga08x19_19768_c1
1772 nmdc:mga08x19_2685_c1
1773 nmdc:mga08x19_92691_c1
1774 nmdc:mga08x19_99943_c1
1775 nmdc:mga0a205_113717_c1
1776 nmdc:mga0a205_180596_c1
1777 nmdc:mga0a205_21115_c1
1778 nmdc:mga0a205_28122_c1
1779 nmdc:mga0a205_342_c1
1780 nmdc:mga0a205_35014_c1
1781 nmdc:mga0a205_42712_c1
1782 nmdc:mga0a205_66002_c1
1783 nmdc:mga0a205_8774_c1
1784 Ga0495601_0115873
1785 Ga0495601_0181582
1786 Ga0495612_0036991
1787 Ga0495619_0005496
1788 Ga0495619_0114181
1789 Ga0501084_0092838
1790 Ga0530510_0087901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c2q-assembly1.cif.gz_A-2 crystal structure of conserved putative lor/sdh protein from methanococcus maripaludis s2 0.6469 33 279
2yk4-assembly1.cif.gz_A structure of neisseria los-specific sialyltransferase (nst). 0.6276 196 265
1v0v-assembly1.cif.gz_A phospholipase d from streptomyces sp. strain pmf soaked with the substrate dibutyrylphosphatidylcholine. 0.6247 176 234
6juy-assembly1.cif.gz_A crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.581 28 276
8cap-assembly2.cif.gz_B crystal structure of dehydrogenase domain of cylindrospermum stagnale nadph-oxidase 5 (nox5) in complex with cb28 0.5802 195 237
ID Description Score Start End Superfamily
1v0yA01 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.6249 176 234 3.30.870.10
af_E7F204_954_1172_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.5982 195 262 3.90.550.10
4dqkB03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.5953 195 283 3.40.50.80
af_Q54IX3_1327_1585_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.5849 181 267 3.40.50.150
af_Q60297_203_504_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.5789 181 268 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V7JT90-F1-model_v4 Uncharacterized protein 0.9629 140 280
AF-A0A7C0YJJ9-F1-model_v4 Uncharacterized protein 0.9586 139 283
AF-A0A838QLZ1-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9581 120 284
AF-A0A7W1SJN9-F1-model_v4 Deoxyhypusine synthase 0.9523 1 279
AF-A0A7Y2CJM3-F1-model_v4 Uncharacterized protein 0.9514 65 282

Map