F484857

General Info

Members Datasets Scaffolds Average Seq Length
891 388 847 456

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10000303|Ga0157378_1000030327
Length 519
Sequence MGDRGIRACRRRGQQWRGSLTGLAMKLHILGICGTFMGGVAALARELGETVEGSDANIYPPMSTQLEQLGIALKSGYRAEHLQPPPDLVIVGNALSRGNAAIEHMLDARLAYVSGPQWIGERVLATRRVFAVAGTHGKTTTTAMLTWILDACGRAPGFLIGGVPENFGVSARLGGATTSPAGGPSESASEVPPSSGAARHLLPPAGEGRFAPPAAADFVIEADEYDTAFFDKRSKFVHYRPTFAILNNLEYDHADIFPDVAAIQRQFHHLVRTVPANGRLIVNAEDERLAEVLAMGAWTPVTTFGIERGEWRARLLVADGSRFVVSRAGTELGEVRWNLLGRHNVMNALAALAAAEAGGADVARGMAALGDFASAKRRLELIGERGGIRVYDDFAHHPTAIATTLAGLRARVGAARILVGMEPRSNSMRLGAHADELAPSLRDADAVVFLQRPGLAWDAERVTGALGGRGRTAPSVDELIGALRRMVRSGDLVVFMSNGGFEDAPRRFVAALGSPTASE

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
4 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
5 2643221559 Lysobacter sp. Root559 Isolate Unclassified
6 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
7 2643221573 Lysobacter sp. Root604 Isolate Unclassified
8 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
9 2643221586 Lysobacter sp. Root667 Isolate Unclassified
10 2643221593 Lysobacter sp. Root690 Isolate Unclassified
11 2643221612 Lysobacter sp. Root76 Isolate Unclassified
12 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
13 2643221695 Lysobacter sp. Root494 Isolate Unclassified
14 2643221720 Lysobacter sp. Root916 Isolate Unclassified
15 2643221727 Lysobacter sp. Root96 Isolate Unclassified
16 2643221728 Lysobacter sp. Root983 Isolate Unclassified
17 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
18 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
19 2734482264 Dyella sp. AD052 Isolate Unclassified
20 2738543009 Luteibacter sp. OK325 Isolate Unclassified
21 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
22 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
23 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
24 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
25 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
26 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
27 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
28 2884411467 Dyella sp. AD56 Isolate Rhizosphere
29 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
30 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
31 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
32 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
33 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
34 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
35 2919085039 Luteibacter sp. 1214 Isolate Unclassified
36 2928963466 Dyella japonica 1073 Isolate Unclassified
37 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
38 2941471342 Luteibacter sp. 621 Isolate Unclassified
39 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
40 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
41 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
42 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
43 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
44 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
45 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
46 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
47 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
48 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
49 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
50 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
51 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
52 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
53 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
54 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
55 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
56 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
57 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
58 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
59 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
60 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
61 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
62 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
63 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
64 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
65 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
66 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
67 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
68 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
69 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
70 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
71 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
72 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
73 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
77 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
78 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
79 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
80 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
81 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
82 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
83 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
84 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
85 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
86 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
87 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
88 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
89 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
90 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
91 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
92 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
93 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
94 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
95 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
96 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
97 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
98 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
99 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
100 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
101 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
102 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
103 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
104 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
105 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
106 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
107 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
108 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
109 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
112 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
122 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
147 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
148 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
149 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
150 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
154 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
160 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
162 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
163 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
166 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
167 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
168 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
180 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
231 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
232 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
233 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
234 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
238 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
239 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
244 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
245 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
248 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
249 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
250 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
254 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
255 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
256 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
257 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
258 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
259 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
260 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
261 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
264 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
265 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
266 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
267 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
268 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
269 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
270 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
271 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
272 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
273 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
274 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
275 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
276 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
277 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
278 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
279 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
280 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
281 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
282 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
283 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
284 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
285 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
286 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
287 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
288 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
289 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
290 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
294 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
295 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
296 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
297 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
298 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
299 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
300 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
301 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
302 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
303 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
304 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
305 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
311 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
312 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
313 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
314 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
315 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
316 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
317 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
318 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
319 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
320 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
321 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
322 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
330 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
331 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
332 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
333 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
334 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
335 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
336 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
337 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
338 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
339 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
340 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
341 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
342 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
343 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
344 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
345 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
346 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
359 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
362 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
363 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
364 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
365 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
366 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
367 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
368 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
369 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
370 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
372 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
373 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
374 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
375 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
376 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
377 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
378 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
379 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
380 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
381 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
382 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
383 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
384 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
385 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
386 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
387 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
388 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.61
Metatranscriptomes 0.45
Isolates 4.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.8
Nodule 0
Rhizoplane 2.24
Rhizosphere 72.39
Stem 0
Stem Tuber 0
Unclassified 11.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1003916 3300001915 Bacteria 3420
2 JGI24741J21665_1005429 3300001915 Bacteria 2667
3 JGI24740J21852_10007790 3300001979 Bacteria 4326
4 JGI24737J22298_10026793 3300001990 Bacteria 1819
5 JGI24735J21928_10000400 3300002067 Bacteria 15108
6 JGI25156J39149_1000651 3300002705 Bacteria 18978
7 JGI25156J39149_1010869 3300002705 Bacteria 2104
8 JGI25162J39368_1000239 3300002737 Bacteria 54751
9 JGI25162J39368_1000249 3300002737 Bacteria 53308
10 JGI25162J39368_1001238 3300002737 Bacteria 14708
11 JGI25162J39368_1001419 3300002737 Bacteria 13022
12 JGI25157J39369_1000517 3300002741 Bacteria 23601
13 JGI25157J39369_1000663 3300002741 Bacteria 19030
14 JGI25157J39369_1000720 3300002741 Bacteria 17683
15 JGI25157J39369_1000892 3300002741 Bacteria 14365
16 JGI25163J39215_1001261 3300002771 Bacteria 4605
17 JGI25164J39214_1000004 3300002772 Bacteria 350814
18 JGI25164J39214_1000200 3300002772 Bacteria 50877
19 JGI25164J39214_1000605 3300002772 Bacteria 15553
20 JGI25164J39214_1000678 3300002772 Bacteria 13611
21 JGI25164J39214_1000780 3300002772 Bacteria 11529
22 JGI25151J46595_10000118 3300003187 Bacteria 106502
23 JGI25151J46595_10026595 3300003187 Bacteria 2332
24 JGI25165J46597_1000319 3300003214 Bacteria 57885
25 JGI25165J46597_1000464 3300003214 Bacteria 40116
26 JGI25165J46597_1001411 3300003214 Bacteria 13022
27 JGI25165J46597_1004393 3300003214 Bacteria 3050
28 Ga0006562J51391_1035852 3300003578 Bacteria 12060
29 Ga0006562J51391_1039498 3300003578 Bacteria 15759
30 Ga0006562J51391_1039500 3300003578 Bacteria 10949
31 Ga0055533_1002005 3300003756 Bacteria 4957
32 Ga0055525_1000170 3300003759 Bacteria 82613
33 Ga0055527_1000275 3300003760 Bacteria 30703
34 Ga0055527_1000331 3300003760 Bacteria 25227
35 Ga0055535_1000242 3300003761 Bacteria 57885
36 Ga0055535_1000582 3300003761 Bacteria 30704
37 Ga0055535_1000594 3300003761 Bacteria 29866
38 Ga0055535_1000715 3300003761 Bacteria 25227
39 Ga0055542_1000298 3300003762 Bacteria 55290
40 Ga0055542_1000580 3300003762 Bacteria 31686
41 Ga0055542_1000604 3300003762 Bacteria 30703
42 Ga0055542_1000623 3300003762 Bacteria 29866
43 Ga0055542_1000741 3300003762 Bacteria 25227
44 Ga0055529_1000437 3300003763 Bacteria 41881
45 Ga0055529_1000574 3300003763 Bacteria 29866
46 Ga0055529_1000648 3300003763 Bacteria 25227
47 Ga0055529_1000932 3300003763 Bacteria 15618
48 Ga0055526_1000082 3300003771 Bacteria 87106
49 Ga0055526_1012150 3300003771 Bacteria 3789
50 Ga0055537_1000228 3300003773 Bacteria 41108
51 Ga0055524_1000138 3300003775 Bacteria 87106
52 Ga0055536_1007776 3300003781 Bacteria 4734
53 Ga0055534_1000056 3300003784 Bacteria 87106
54 Ga0055528_1000061 3300003790 Bacteria 87106
55 Ga0055531_10005953 3300003794 Bacteria 7010
56 Ga0065165_1000887 3300005262 Bacteria 38644
57 Ga0065165_1001275 3300005262 Bacteria 28492
58 Ga0065715_10027231 3300005293 Bacteria 2647
59 Ga0070683_100049951 3300005329 Bacteria 3870
60 Ga0070683_100052424 3300005329 Bacteria 3779
61 Ga0070670_100065037 3300005331 Bacteria 3129
62 Ga0070670_100103226 3300005331 Bacteria 2456
63 Ga0070666_10000372 3300005335 Bacteria 28283
64 Ga0070666_10009658 3300005335 Bacteria 6024
65 Ga0070680_100002369 3300005336 Bacteria 13928
66 Ga0070680_100005018 3300005336 Bacteria 9981
67 Ga0070680_100007340 3300005336 Bacteria 8407
68 Ga0070680_100010560 3300005336 Bacteria 7125
69 Ga0070680_100050969 3300005336 Bacteria 3377
70 Ga0070680_100157181 3300005336 Bacteria 1910
71 Ga0070682_100009517 3300005337 Bacteria 5499
72 Ga0070682_100033288 3300005337 Bacteria 3130
73 Ga0068868_100041811 3300005338 Bacteria 3572
74 Ga0070660_100022372 3300005339 Bacteria 4674
75 Ga0070691_10015006 3300005341 Bacteria 3557
76 Ga0070661_100001549 3300005344 Bacteria 15981
77 Ga0070661_100010219 3300005344 Bacteria 6520
78 Ga0070661_100010825 3300005344 Bacteria 6350
79 Ga0070692_10000887 3300005345 Bacteria 10113
80 Ga0070668_100044387 3300005347 Bacteria 3410
81 Ga0070675_100121958 3300005354 Bacteria 2215
82 Ga0070659_100161209 3300005366 Bacteria 1834
83 Ga0070667_100000049 3300005367 Bacteria 158483
84 Ga0070667_100000184 3300005367 Bacteria 75408
85 Ga0070667_100005927 3300005367 Bacteria 10173
86 Ga0070714_100000597 3300005435 Bacteria 25798
87 Ga0070714_100001179 3300005435 Bacteria 18812
88 Ga0070713_100001691 3300005436 Bacteria 14172
89 Ga0070711_100074556 3300005439 Bacteria 2400
90 Ga0070663_100000042 3300005455 Bacteria 57899
91 Ga0070663_100003576 3300005455 Bacteria 8976
92 Ga0070663_100003910 3300005455 Bacteria 8688
93 Ga0070663_100058798 3300005455 Bacteria 2761
94 Ga0070663_100084745 3300005455 Bacteria 2337
95 Ga0070678_100139481 3300005456 Bacteria 1938
96 Ga0070662_100038283 3300005457 Bacteria 3406
97 Ga0070681_10000484 3300005458 Bacteria 32437
98 Ga0070681_10000534 3300005458 Bacteria 31253
99 Ga0070681_10000799 3300005458 Bacteria 26246
100 Ga0070681_10016654 3300005458 Bacteria 7338
101 Ga0070681_10142302 3300005458 Bacteria 2328
102 Ga0070706_100023729 3300005467 Bacteria 5647
103 Ga0070679_100000571 3300005530 Bacteria 31258
104 Ga0070679_100001635 3300005530 Bacteria 20192
105 Ga0070679_100011025 3300005530 Bacteria 8594
106 Ga0070679_100015323 3300005530 Bacteria 7366
107 Ga0070679_100070134 3300005530 Bacteria 3497
108 Ga0070679_100183465 3300005530 Bacteria 2064
109 Ga0070684_100018115 3300005535 Bacteria 5793
110 Ga0070684_100051279 3300005535 Bacteria 3584
111 Ga0070684_100144571 3300005535 Bacteria 2152
112 Ga0068853_100002452 3300005539 Bacteria 13881
113 Ga0068853_100004880 3300005539 Bacteria 10435
114 Ga0068853_100005963 3300005539 Bacteria 9628
115 Ga0068853_100034404 3300005539 Bacteria 4301
116 Ga0068853_100065038 3300005539 Bacteria 3164
117 Ga0068853_100113846 3300005539 Bacteria 2405
118 Ga0068853_100219743 3300005539 Bacteria 1735
119 Ga0070672_100029332 3300005543 Bacteria 4125
120 Ga0070672_100076084 3300005543 Bacteria 2681
121 Ga0070696_100009437 3300005546 Bacteria 6534
122 Ga0070696_100012446 3300005546 Bacteria 5708
123 Ga0070696_100048471 3300005546 Bacteria 2949
124 Ga0070693_100003242 3300005547 Bacteria 7559
125 Ga0070693_100012117 3300005547 Bacteria 4357
126 Ga0070665_100000028 3300005548 Bacteria 351357
127 Ga0070665_100023034 3300005548 Bacteria 6272
128 Ga0070665_100036297 3300005548 Bacteria 4958
129 Ga0070665_100052083 3300005548 Bacteria 4106
130 Ga0070704_100004431 3300005549 Bacteria 8109
131 Ga0068855_100003293 3300005563 Bacteria 19778
132 Ga0068855_100006907 3300005563 Bacteria 13767
133 Ga0068855_100008568 3300005563 Bacteria 12365
134 Ga0068855_100155108 3300005563 Bacteria 2602
135 Ga0068855_100197430 3300005563 Bacteria 2267
136 Ga0068855_100227919 3300005563 Bacteria 2087
137 Ga0070664_100034110 3300005564 Bacteria 4268
138 Ga0068857_100020704 3300005577 Bacteria 5789
139 Ga0068854_100000504 3300005578 Bacteria 23786
140 Ga0068856_100000088 3300005614 Bacteria 85931
141 Ga0068856_100013243 3300005614 Bacteria 7987
142 Ga0068856_100022139 3300005614 Bacteria 6180
143 Ga0068856_100065594 3300005614 Bacteria 3588
144 Ga0068856_100095164 3300005614 Bacteria 2966
145 Ga0068856_100135247 3300005614 Bacteria 2470
146 Ga0068852_100040954 3300005616 Bacteria 3912
147 Ga0068852_100063910 3300005616 Bacteria 3206
148 Ga0068852_100128127 3300005616 Bacteria 2333
149 Ga0068852_100130544 3300005616 Bacteria 2313
150 Ga0068859_100198559 3300005617 Bacteria 2090
151 Ga0068851_10013049 3300005834 Bacteria 3928
152 Ga0068851_10025083 3300005834 Bacteria 2922
153 Ga0068863_100033562 3300005841 Bacteria 4889
154 Ga0068858_100000586 3300005842 Bacteria 38243
155 Ga0068858_100013343 3300005842 Bacteria 7751
156 Ga0068860_100017405 3300005843 Bacteria 7003
157 Ga0068860_100076005 3300005843 Bacteria 3194
158 Ga0068862_100000215 3300005844 Bacteria 64251
159 Ga0081455_10172430 3300005937 Bacteria 1646
160 Ga0075365_10008292 3300006038 Bacteria 5888
161 Ga0075364_10001706 3300006051 Bacteria 12075
162 Ga0070716_100014594 3300006173 Bacteria 4027
163 Ga0097621_100002033 3300006237 Bacteria 13846
164 Ga0097621_100023445 3300006237 Bacteria 4806
165 Ga0097621_100046745 3300006237 Bacteria 3504
166 Ga0068871_100002111 3300006358 Bacteria 13456
167 Ga0068865_100001222 3300006881 Bacteria 14943
168 Ga0075436_100003116 3300006914 Bacteria 11365
169 Ga0075436_100014805 3300006914 Bacteria 5344
170 Ga0097620_100198558 3300006931 Bacteria 2090
171 Ga0075435_100002470 3300007076 Bacteria 12289
172 Ga0099794_10005753 3300007265 Bacteria 4996
173 Ga0099794_10008738 3300007265 Bacteria 4218
174 Ga0105250_10046720 3300009092 Bacteria 1736
175 Ga0105240_10002481 3300009093 Bacteria 29651
176 Ga0105240_10007409 3300009093 Bacteria 15946
177 Ga0105240_10007835 3300009093 Bacteria 15418
178 Ga0105240_10008240 3300009093 Bacteria 14931
179 Ga0105240_10011769 3300009093 Bacteria 12155
180 Ga0105240_10063977 3300009093 Bacteria 4573
181 Ga0105240_10102964 3300009093 Bacteria 3469
182 Ga0105240_10200362 3300009093 Bacteria 2340
183 Ga0105240_10225506 3300009093 Bacteria 2181
184 Ga0105245_10054644 3300009098 Bacteria 3586
185 Ga0105245_10054959 3300009098 Bacteria 3576
186 Ga0105247_10004712 3300009101 Bacteria 8693
187 Ga0105247_10012255 3300009101 Bacteria 5150
188 Ga0105241_10012342 3300009174 Bacteria 6266
189 Ga0105242_10004683 3300009176 Bacteria 10587
190 Ga0105248_10000120 3300009177 Bacteria 89960
191 Ga0105237_10000058 3300009545 Bacteria 146943
192 Ga0105237_10028280 3300009545 Bacteria 5713
193 Ga0105237_10029693 3300009545 Bacteria 5555
194 Ga0105237_10075473 3300009545 Bacteria 3363
195 Ga0105238_10010170 3300009551 Bacteria 9435
196 Ga0105238_10012584 3300009551 Bacteria 8541
197 Ga0105238_10015508 3300009551 Bacteria 7713
198 Ga0105238_10054682 3300009551 Bacteria 4008
199 Ga0105238_10139335 3300009551 Bacteria 2403
200 Ga0105249_10001801 3300009553 Bacteria 18626
201 Ga0105249_10030150 3300009553 Bacteria 4902
202 Ga0105239_10001637 3300010375 Bacteria 29547
203 Ga0105239_10047706 3300010375 Bacteria 4694
204 Ga0105239_10151023 3300010375 Bacteria 2592
205 Ga0157314_1000018 3300012500 Bacteria 16239
206 Ga0157373_10007919 3300013100 Bacteria 7909
207 Ga0157373_10019278 3300013100 Bacteria 4968
208 Ga0157373_10034313 3300013100 Bacteria 3644
209 Ga0157373_10078911 3300013100 Bacteria 2321
210 Ga0157373_10161553 3300013100 Bacteria 1576
211 Ga0157371_10010375 3300013102 Bacteria 7263
212 Ga0157370_10006151 3300013104 Bacteria 13317
213 Ga0157370_10007072 3300013104 Bacteria 12257
214 Ga0157370_10007352 3300013104 Bacteria 12015
215 Ga0157370_10009419 3300013104 Bacteria 10440
216 Ga0157370_10032654 3300013104 Bacteria 5082
217 Ga0157369_10000021 3300013105 Bacteria 239073
218 Ga0157369_10010042 3300013105 Bacteria 10812
219 Ga0157369_10031979 3300013105 Bacteria 5788
220 Ga0157369_10086529 3300013105 Bacteria 3347
221 Ga0157369_10199531 3300013105 Bacteria 2100
222 Ga0157374_10004992 3300013296 Bacteria 11132
223 Ga0157374_10122742 3300013296 Bacteria 2509
224 Ga0157374_10191487 3300013296 Bacteria 2001
225 Ga0157378_10000303 3300013297 Bacteria 47815
226 Ga0163162_10000004 3300013306 Bacteria 505593
227 Ga0163162_10006588 3300013306 Bacteria 11252
228 Ga0157372_10005781 3300013307 Bacteria 13174
229 Ga0157372_10006482 3300013307 Bacteria 12453
230 Ga0157372_10006803 3300013307 Bacteria 12157
231 Ga0157372_10017223 3300013307 Bacteria 7755
232 Ga0157372_10024666 3300013307 Bacteria 6535
233 Ga0157372_10193875 3300013307 Bacteria 2353
234 Ga0157375_10000561 3300013308 Bacteria 33401
235 Ga0157375_10005348 3300013308 Bacteria 11159
236 Ga0163163_10003314 3300014325 Bacteria 13659
237 Ga0163163_10005861 3300014325 Bacteria 10689
238 Ga0163163_10019903 3300014325 Bacteria 6312
239 Ga0182008_10003053 3300014497 Bacteria 10279
240 Ga0182008_10008140 3300014497 Bacteria 5738
241 Ga0157376_10003027 3300014969 Bacteria 11520
242 Ga0157376_10010490 3300014969 Bacteria 6780
243 Ga0182006_1000461 3300015261 Bacteria 31892
244 Ga0182006_1001147 3300015261 Bacteria 16817
245 Ga0182005_1001072 3300015265 Bacteria 11527
246 Ga0182005_1001074 3300015265 Bacteria 11526
247 Ga0182005_1001234 3300015265 Bacteria 10590
248 Ga0183369_1011 3300015685 Bacteria 252490
249 Ga0183368_1007 3300015687 Bacteria 405609
250 Ga0183360_10003 3300015689 Bacteria 713221
251 Ga0163161_10032354 3300017792 Bacteria 3733
252 Ga0206354_10073408 3300020081 Bacteria 2428
253 Ga0209760_102570 3300025207 Bacteria 1685
254 Ga0209784_100163 3300025224 Bacteria 57927
255 Ga0209674_100037 3300025226 Bacteria 404339
256 Ga0209674_100058 3300025226 Bacteria 286902
257 Ga0209674_103964 3300025226 Bacteria 2543
258 Ga0209672_100043 3300025228 Bacteria 270302
259 Ga0209672_100061 3300025228 Bacteria 206098
260 Ga0209672_100659 3300025228 Bacteria 17551
261 Ga0209672_101128 3300025228 Bacteria 11124
262 Ga0209672_101385 3300025228 Bacteria 8982
263 Ga0209563_100062 3300025230 Bacteria 264769
264 Ga0207427_100031 3300025231 Bacteria 350866
265 Ga0207427_100196 3300025231 Bacteria 57937
266 Ga0207427_100258 3300025231 Bacteria 41628
267 Ga0207427_100275 3300025231 Bacteria 38754
268 Ga0209437_100061 3300025233 Bacteria 350866
269 Ga0209437_100121 3300025233 Bacteria 202531
270 Ga0209437_100132 3300025233 Bacteria 178495
271 Ga0209437_100345 3300025233 Bacteria 54531
272 Ga0209258_100054 3300025242 Bacteria 339063
273 Ga0209258_100076 3300025242 Bacteria 270302
274 Ga0209258_100097 3300025242 Bacteria 216963
275 Ga0209258_100384 3300025242 Bacteria 56539
276 Ga0209258_100514 3300025242 Bacteria 37294
277 Ga0209258_100566 3300025242 Bacteria 31739
278 Ga0209646_1001674 3300025246 Bacteria 5656
279 Ga0209026_1000119 3300025250 Bacteria 130220
280 Ga0209026_1000147 3300025250 Bacteria 111301
281 Ga0209026_1000286 3300025250 Bacteria 57937
282 Ga0209026_1000337 3300025250 Bacteria 45585
283 Ga0209026_1000533 3300025250 Bacteria 26323
284 Ga0209677_101125 3300025253 Bacteria 12537
285 Ga0209148_1000047 3300025254 Bacteria 434369
286 Ga0209148_1000063 3300025254 Bacteria 346881
287 Ga0209148_1000066 3300025254 Bacteria 339063
288 Ga0209148_1000082 3300025254 Bacteria 270302
289 Ga0209148_1000614 3300025254 Bacteria 31739
290 Ga0209148_1000912 3300025254 Bacteria 19949
291 Ga0209759_1000730 3300025256 Bacteria 28802
292 Ga0209759_1000858 3300025256 Bacteria 23567
293 Ga0209759_1001948 3300025256 Bacteria 9984
294 Ga0209759_1001982 3300025256 Bacteria 9812
295 Ga0209129_1000331 3300025258 Bacteria 41001
296 Ga0209129_1002368 3300025258 Bacteria 9292
297 Ga0209233_1000076 3300025261 Bacteria 350866
298 Ga0209233_1000100 3300025261 Bacteria 293905
299 Ga0209233_1000112 3300025261 Bacteria 258251
300 Ga0209233_1000114 3300025261 Bacteria 246083
301 Ga0209233_1001928 3300025261 Bacteria 7927
302 Ga0209233_1018396 3300025261 Bacteria 1881
303 Ga0209565_1000002 3300025263 Bacteria 1423083
304 Ga0209455_1000078 3300025272 Bacteria 270237
305 Ga0209455_1000096 3300025272 Bacteria 217006
306 Ga0209455_1000101 3300025272 Bacteria 206098
307 Ga0209455_1000267 3300025272 Bacteria 58711
308 Ga0209455_1000270 3300025272 Bacteria 57937
309 Ga0209673_1000002 3300025273 Bacteria 1423083
310 Ga0209130_1003339 3300025284 Bacteria 6903
311 Ga0209675_1000002 3300025291 Bacteria 1423083
312 Ga0209676_1000830 3300025292 Bacteria 40120
313 Ga0209676_1002916 3300025292 Bacteria 11181
314 Ga0209025_1000200 3300025294 Bacteria 146048
315 Ga0209025_1009037 3300025294 Bacteria 7030
316 Ga0209025_1035732 3300025294 Bacteria 2238
317 Ga0209564_1000004 3300025295 Bacteria 1424639
318 Ga0209564_1003164 3300025295 Bacteria 11586
319 Ga0209758_1001065 3300025297 Bacteria 35722
320 Ga0209050_1002489 3300025298 Bacteria 15573
321 Ga0209256_1000004 3300025299 Bacteria 1424643
322 Ga0209256_1004097 3300025299 Bacteria 9443
323 Ga0209256_1004516 3300025299 Bacteria 8683
324 Ga0207426_1003250 3300025302 Bacteria 9107
325 Ga0209051_1008280 3300025303 Bacteria 5525
326 Ga0209257_1000499 3300025304 Bacteria 70103
327 Ga0209257_1003235 3300025304 Bacteria 14334
328 Ga0209257_1004860 3300025304 Bacteria 9931
329 Ga0207656_10002756 3300025321 Bacteria 5960
330 Ga0207710_10002997 3300025900 Bacteria 7626
331 Ga0207710_10006428 3300025900 Bacteria 5017
332 Ga0207680_10007412 3300025903 Bacteria 5345
333 Ga0207647_10000130 3300025904 Bacteria 58985
334 Ga0207647_10000269 3300025904 Bacteria 42790
335 Ga0207647_10002143 3300025904 Bacteria 15080
336 Ga0207647_10011433 3300025904 Bacteria 6225
337 Ga0207705_10000400 3300025909 Bacteria 38159
338 Ga0207705_10004563 3300025909 Bacteria 10460
339 Ga0207705_10013247 3300025909 Bacteria 5953
340 Ga0207705_10086094 3300025909 Bacteria 2296
341 Ga0207654_10005801 3300025911 Bacteria 6231
342 Ga0207654_10030041 3300025911 Bacteria 2979
343 Ga0207654_10068909 3300025911 Bacteria 2094
344 Ga0207707_10000020 3300025912 Bacteria 205480
345 Ga0207707_10000626 3300025912 Bacteria 35036
346 Ga0207707_10003170 3300025912 Bacteria 14597
347 Ga0207707_10007883 3300025912 Bacteria 9260
348 Ga0207707_10012604 3300025912 Bacteria 7346
349 Ga0207707_10017863 3300025912 Bacteria 6185
350 Ga0207707_10056115 3300025912 Bacteria 3426
351 Ga0207707_10114702 3300025912 Bacteria 2354
352 Ga0207695_10000040 3300025913 Bacteria 452787
353 Ga0207695_10000890 3300025913 Bacteria 54211
354 Ga0207695_10001663 3300025913 Bacteria 35807
355 Ga0207695_10001888 3300025913 Bacteria 32776
356 Ga0207695_10002173 3300025913 Bacteria 29659
357 Ga0207695_10002412 3300025913 Bacteria 27677
358 Ga0207695_10003828 3300025913 Bacteria 20854
359 Ga0207695_10022149 3300025913 Bacteria 7226
360 Ga0207695_10024064 3300025913 Bacteria 6864
361 Ga0207695_10037019 3300025913 Bacteria 5268
362 Ga0207695_10041168 3300025913 Bacteria 4945
363 Ga0207695_10049016 3300025913 Bacteria 4456
364 Ga0207695_10084315 3300025913 Bacteria 3209
365 Ga0207695_10120392 3300025913 Bacteria 2594
366 Ga0207671_10000026 3300025914 Bacteria 268845
367 Ga0207671_10000260 3300025914 Bacteria 79210
368 Ga0207671_10001294 3300025914 Bacteria 29397
369 Ga0207671_10005233 3300025914 Bacteria 12050
370 Ga0207671_10005317 3300025914 Bacteria 11927
371 Ga0207671_10050339 3300025914 Bacteria 3085
372 Ga0207671_10152475 3300025914 Bacteria 1786
373 Ga0207671_10204521 3300025914 Bacteria 1543
374 Ga0207660_10000726 3300025917 Bacteria 21921
375 Ga0207660_10000950 3300025917 Bacteria 19197
376 Ga0207660_10005901 3300025917 Bacteria 7956
377 Ga0207660_10006258 3300025917 Bacteria 7727
378 Ga0207660_10008193 3300025917 Bacteria 6763
379 Ga0207660_10036427 3300025917 Bacteria 3420
380 Ga0207657_10008750 3300025919 Bacteria 10246
381 Ga0207657_10011362 3300025919 Bacteria 8845
382 Ga0207657_10037960 3300025919 Bacteria 4295
383 Ga0207657_10044281 3300025919 Bacteria 3913
384 Ga0207657_10081212 3300025919 Bacteria 2724
385 Ga0207657_10095219 3300025919 Bacteria 2478
386 Ga0207649_10005191 3300025920 Bacteria 7035
387 Ga0207649_10005381 3300025920 Bacteria 6931
388 Ga0207649_10016814 3300025920 Bacteria 4136
389 Ga0207652_10000037 3300025921 Bacteria 134369
390 Ga0207652_10000753 3300025921 Bacteria 31143
391 Ga0207652_10002384 3300025921 Bacteria 15874
392 Ga0207652_10007939 3300025921 Bacteria 8522
393 Ga0207652_10012358 3300025921 Bacteria 6899
394 Ga0207652_10024942 3300025921 Bacteria 4965
395 Ga0207652_10063335 3300025921 Bacteria 3198
396 Ga0207681_10027339 3300025923 Bacteria 3687
397 Ga0207694_10001363 3300025924 Bacteria 21050
398 Ga0207694_10002190 3300025924 Bacteria 16057
399 Ga0207694_10003616 3300025924 Bacteria 12247
400 Ga0207694_10072050 3300025924 Bacteria 2701
401 Ga0207694_10094822 3300025924 Bacteria 2358
402 Ga0207687_10082099 3300025927 Bacteria 2331
403 Ga0207664_10000131 3300025929 Bacteria 65529
404 Ga0207664_10000856 3300025929 Bacteria 20600
405 Ga0207690_10000308 3300025932 Bacteria 33627
406 Ga0207690_10000657 3300025932 Bacteria 22118
407 Ga0207690_10005794 3300025932 Bacteria 7307
408 Ga0207690_10019367 3300025932 Bacteria 4189
409 Ga0207690_10044076 3300025932 Bacteria 2939
410 Ga0207690_10059895 3300025932 Bacteria 2581
411 Ga0207706_10070736 3300025933 Bacteria 3069
412 Ga0207686_10002229 3300025934 Bacteria 10647
413 Ga0207669_10046335 3300025937 Bacteria 2569
414 Ga0207704_10001141 3300025938 Bacteria 11810
415 Ga0207704_10007422 3300025938 Bacteria 5179
416 Ga0207691_10022148 3300025940 Bacteria 5995
417 Ga0207691_10150041 3300025940 Bacteria 2050
418 Ga0207691_10180669 3300025940 Bacteria 1844
419 Ga0207711_10001269 3300025941 Bacteria 23925
420 Ga0207711_10189850 3300025941 Bacteria 1872
421 Ga0207689_10018945 3300025942 Bacteria 5805
422 Ga0207661_10004484 3300025944 Bacteria 9791
423 Ga0207661_10104774 3300025944 Bacteria 2382
424 Ga0207667_10000228 3300025949 Bacteria 78952
425 Ga0207667_10000423 3300025949 Bacteria 57047
426 Ga0207667_10000633 3300025949 Bacteria 45505
427 Ga0207667_10012632 3300025949 Bacteria 9707
428 Ga0207667_10014711 3300025949 Bacteria 8905
429 Ga0207667_10016754 3300025949 Bacteria 8268
430 Ga0207667_10019918 3300025949 Bacteria 7475
431 Ga0207667_10051227 3300025949 Bacteria 4353
432 Ga0207667_10053029 3300025949 Bacteria 4268
433 Ga0207667_10060694 3300025949 Bacteria 3958
434 Ga0207667_10075450 3300025949 Bacteria 3501
435 Ga0207667_10208355 3300025949 Bacteria 2004
436 Ga0207712_10000305 3300025961 Bacteria 45213
437 Ga0207712_10000364 3300025961 Bacteria 40077
438 Ga0207640_10000120 3300025981 Bacteria 59715
439 Ga0207640_10001068 3300025981 Bacteria 15187
440 Ga0207640_10001821 3300025981 Bacteria 11435
441 Ga0207640_10019869 3300025981 Bacteria 3977
442 Ga0207658_10000033 3300025986 Bacteria 158540
443 Ga0207658_10000591 3300025986 Bacteria 32569
444 Ga0207658_10004314 3300025986 Bacteria 9902
445 Ga0207658_10063234 3300025986 Bacteria 2773
446 Ga0207658_10068761 3300025986 Bacteria 2673
447 Ga0207658_10139797 3300025986 Bacteria 1958
448 Ga0207677_10030970 3300026023 Bacteria 3422
449 Ga0207677_10104373 3300026023 Bacteria 2095
450 Ga0207703_10000472 3300026035 Bacteria 42034
451 Ga0207639_10001365 3300026041 Bacteria 16471
452 Ga0207639_10002309 3300026041 Bacteria 12797
453 Ga0207639_10004090 3300026041 Bacteria 9839
454 Ga0207639_10012820 3300026041 Bacteria 5849
455 Ga0207639_10020657 3300026041 Bacteria 4717
456 Ga0207639_10102207 3300026041 Bacteria 2319
457 Ga0207639_10122580 3300026041 Bacteria 2138
458 Ga0207639_10159322 3300026041 Bacteria 1900
459 Ga0207678_10000566 3300026067 Bacteria 33834
460 Ga0207678_10007011 3300026067 Bacteria 10004
461 Ga0207678_10009626 3300026067 Bacteria 8496
462 Ga0207678_10010170 3300026067 Bacteria 8258
463 Ga0207678_10017588 3300026067 Bacteria 6278
464 Ga0207678_10018276 3300026067 Bacteria 6157
465 Ga0207678_10105410 3300026067 Bacteria 2405
466 Ga0207702_10000649 3300026078 Bacteria 37917
467 Ga0207702_10001784 3300026078 Bacteria 21201
468 Ga0207702_10003564 3300026078 Bacteria 14163
469 Ga0207702_10004508 3300026078 Bacteria 12357
470 Ga0207641_10054943 3300026088 Bacteria 3381
471 Ga0207641_10068127 3300026088 Bacteria 3050
472 Ga0207641_10128617 3300026088 Bacteria 2271
473 Ga0207648_10018369 3300026089 Bacteria 6334
474 Ga0207648_10174421 3300026089 Bacteria 1901
475 Ga0207676_10018479 3300026095 Bacteria 5068
476 Ga0207674_10000219 3300026116 Bacteria 71283
477 Ga0207674_10015364 3300026116 Bacteria 8412
478 Ga0207674_10021372 3300026116 Bacteria 6970
479 Ga0207674_10025688 3300026116 Bacteria 6272
480 Ga0207674_10032691 3300026116 Bacteria 5454
481 Ga0207674_10255160 3300026116 Bacteria 1701
482 Ga0207683_10071592 3300026121 Bacteria 3065
483 Ga0207683_10243207 3300026121 Bacteria 1642
484 Ga0207698_10000844 3300026142 Bacteria 17776
485 Ga0207698_10007097 3300026142 Bacteria 7017
486 Ga0207698_10049178 3300026142 Bacteria 3207
487 Ga0209967_1000263 3300027364 Bacteria 7221
488 Ga0209588_1008040 3300027671 Bacteria 3122
489 Ga0268266_10000008 3300028379 Bacteria 1161875
490 Ga0268266_10000017 3300028379 Bacteria 607272
491 Ga0268266_10025677 3300028379 Bacteria 5012
492 Ga0268265_10002016 3300028380 Bacteria 15950
493 Ga0268264_10004127 3300028381 Bacteria 12431
494 Ga0268264_10100519 3300028381 Bacteria 2512
495 Ga0268264_10112314 3300028381 Bacteria 2389
496 Ga0307513_10156167 3300031456 Bacteria 2181
497 Ga0307408_100026763 3300031548 Bacteria 3966
498 Ga0307408_100041048 3300031548 Bacteria 3279
499 Ga0307508_10009313 3300031616 Bacteria 9036
500 Ga0316575_10020555 3300031665 Bacteria 2534
501 Ga0316579_10031405 3300031691 Bacteria 2432
502 Ga0316576_10010827 3300031727 Bacteria 5945
503 Ga0316576_10033952 3300031727 Bacteria 3634
504 Ga0316578_10019084 3300031728 Bacteria 3768
505 Ga0307516_10013891 3300031730 Bacteria 8547
506 Ga0307516_10036068 3300031730 Bacteria 4953
507 Ga0307412_10001279 3300031911 Bacteria 14087
508 Ga0307412_10016904 3300031911 Bacteria 4358
509 Ga0307412_10081026 3300031911 Bacteria 2244
510 Ga0307414_10005644 3300032004 Bacteria 6904
511 Ga0307414_10015898 3300032004 Bacteria 4558
512 Ga0307414_10016393 3300032004 Bacteria 4503
513 Ga0307414_10085553 3300032004 Bacteria 2323
514 Ga0373934_0012240 3300035086 Bacteria 3239
515 Ga0373923_0042124 3300035111 Bacteria 1885
516 Ga0373954_0000002 3300035118 Bacteria 147478
517 Ga0316574_0088060 3300035398 Bacteria 1977
518 Ga0316574_0095604 3300035398 Bacteria 1899
519 Ga0373931_0022180 3300035691 Bacteria 3193
520 Ga0373933_0005162 3300035724 Bacteria 7125
521 Ga0316582_0020981 3300036647 Bacteria 3851
522 Ga0316584_0076263 3300036712 Bacteria 2512
523 Ga0316584_0182710 3300036712 Bacteria 1552
524 Ga0373925_0113805 3300037068 Bacteria 2093
525 Ga0395899_0000410 3300037312 Bacteria 50063
526 Ga0395899_0019790 3300037312 Bacteria 5107
527 Ga0395899_0029129 3300037312 Bacteria 4152
528 Ga0395899_0029191 3300037312 Bacteria 4148
529 Ga0395900_0000206 3300037418 Bacteria 92782
530 Ga0395900_0000656 3300037418 Bacteria 46333
531 Ga0395900_0001743 3300037418 Bacteria 25049
532 Ga0395900_0006056 3300037418 Bacteria 12613
533 Ga0395900_0158398 3300037418 Bacteria 2311
534 Ga0395900_0283268 3300037418 Bacteria 1648
535 Ga0395898_0000013 3300037466 Bacteria 458788
536 Ga0395898_0000120 3300037466 Bacteria 209091
537 Ga0395905_0007372 3300037471 Bacteria 10948
538 Ga0395901_0001748 3300038443 Bacteria 22446
539 Ga0395901_0061777 3300038443 Bacteria 3898
540 Ga0395901_0067700 3300038443 Bacteria 3719
541 Ga0395901_0083733 3300038443 Bacteria 3334
542 Ga0395901_0089957 3300038443 Bacteria 3212
543 Ga0395901_0125671 3300038443 Bacteria 2695
544 Ga0395901_0170860 3300038443 Bacteria 2281
545 Ga0395901_0215678 3300038443 Bacteria 2007
546 Ga0436365_1537398 3300039437 Bacteria 2346
547 Ga0439436_0000019 3300041404 Bacteria 70584
548 Ga0439436_0019013 3300041404 Bacteria 2052
549 Ga0439439_0000522 3300041406 Bacteria 6634
550 Ga0439447_003268 3300041407 Bacteria 5765
551 Ga0439465_0000101 3300041413 Bacteria 19683
552 Ga0439465_0002026 3300041413 Bacteria 6654
553 Ga0439465_0011345 3300041413 Bacteria 2796
554 Ga0451793_0125667 3300041452 Bacteria 1575
555 Ga0451797_0049457 3300041453 Bacteria 2189
556 Ga0451802_0337161 3300041460 Bacteria 3238
557 Ga0451837_0182006 3300041494 Bacteria 1989
558 Ga0451837_1141630 3300041494 Bacteria 3802
559 Ga0451843_0269584 3300041509 Bacteria 2805
560 Ga0451853_0219664 3300041512 Bacteria 4147
561 Ga0451853_3004224 3300041512 Bacteria 2237
562 Ga0439437_006103 3300042000 Bacteria 1331
563 Ga0439432_002874 3300042006 Bacteria 6419
564 Ga0439432_009273 3300042006 Bacteria 3436
565 Ga0439449_0012818 3300042007 Bacteria 3152
566 Ga0450908_000141 3300042184 Bacteria 14773
567 Ga0451577_0005118 3300042876 Bacteria 13510
568 Ga0466969_0016507 3300044656 Bacteria 3863
569 Ga0466972_0007010 3300044658 Bacteria 5653
570 Ga0466975_0068618 3300044661 Bacteria 2532
571 Ga0466982_0000017 3300044672 Bacteria 118868
572 Ga0466965_0009624 3300044683 Bacteria 4495
573 Ga0466966_0013312 3300044684 Bacteria 5445
574 Ga0466966_0017909 3300044684 Bacteria 4677
575 Ga0466966_0019558 3300044684 Bacteria 4455
576 Ga0466966_0024936 3300044684 Bacteria 3910
577 Ga0466966_0106706 3300044684 Bacteria 1728
578 Ga0466961_0001089 3300044693 Bacteria 16718
579 Ga0466961_0004931 3300044693 Bacteria 8390
580 Ga0466961_0013367 3300044693 Bacteria 5254
581 Ga0466971_0002114 3300044719 Bacteria 8416
582 Ga0466971_0012172 3300044719 Bacteria 3770
583 Ga0466968_0001344 3300044735 Bacteria 8769
584 Ga0466968_0004145 3300044735 Bacteria 5398
585 Ga0466968_0004722 3300044735 Bacteria 5104
586 Ga0466970_0000349 3300044765 Bacteria 22379
587 Ga0466970_0003722 3300044765 Bacteria 7453
588 Ga0466970_0006542 3300044765 Bacteria 5825
589 Ga0466970_0029488 3300044765 Bacteria 2888
590 Ga0466957_0002466 3300044842 Bacteria 9940
591 Ga0466960_0004458 3300044901 Bacteria 5473
592 Ga0466959_0000848 3300045049 Bacteria 18039
593 Ga0466959_0011074 3300045049 Bacteria 6471
594 Ga0451576_0095186 3300045051 Bacteria 3097
595 Ga0466958_0001914 3300045836 Bacteria 10190
596 Ga0466958_0043763 3300045836 Bacteria 2697
597 Ga0495617_000409 3300046452 Bacteria 23631
598 Ga0495617_001258 3300046452 Bacteria 11372
599 Ga0495603_0029470 3300046455 Bacteria 3309
600 Ga0495638_0000252 3300046460 Bacteria 72913
601 Ga0495638_0000361 3300046460 Bacteria 56377
602 Ga0495638_0000949 3300046460 Bacteria 29412
603 Ga0495638_0001133 3300046460 Bacteria 25778
604 Ga0495638_0027185 3300046460 Bacteria 3705
605 Ga0495650_0001191 3300046471 Bacteria 27568
606 Ga0495650_0001431 3300046471 Bacteria 23089
607 Ga0495580_0050301 3300046472 Bacteria 2947
608 Ga0495585_0000024 3300046492 Bacteria 148384
609 Ga0495585_0001595 3300046492 Bacteria 17521
610 Ga0495607_0001268 3300046501 Bacteria 22571
611 Ga0495607_0001396 3300046501 Bacteria 21504
612 Ga0495607_0037446 3300046501 Bacteria 2914
613 Ga0495583_0039245 3300046506 Bacteria 2231
614 Ga0495606_0000849 3300046507 Bacteria 45936
615 Ga0495606_0002137 3300046507 Bacteria 23864
616 Ga0495606_0003479 3300046507 Bacteria 16682
617 Ga0495606_0011896 3300046507 Bacteria 7040
618 Ga0495610_0005438 3300046512 Bacteria 9050
619 Ga0495616_0000831 3300046513 Bacteria 22547
620 Ga0495616_0015899 3300046513 Bacteria 4172
621 Ga0495620_0000889 3300046515 Bacteria 18374
622 Ga0495620_0004160 3300046515 Bacteria 8203
623 Ga0495631_0001428 3300046518 Bacteria 14508
624 Ga0495632_0000005 3300046519 Bacteria 362872
625 Ga0495632_0003976 3300046519 Bacteria 10244
626 Ga0495632_0031217 3300046519 Bacteria 2756
627 Ga0495637_0016087 3300046520 Bacteria 3501
628 Ga0495648_0000485 3300046524 Bacteria 42709
629 Ga0495648_0003467 3300046524 Bacteria 13867
630 Ga0495663_0017205 3300046525 Bacteria 2049
631 Ga0495609_0004319 3300046538 Bacteria 7810
632 Ga0495621_0000071 3300046539 Bacteria 20126
633 Ga0495622_0008038 3300046557 Bacteria 4890
634 Ga0495633_0010517 3300046558 Bacteria 5044
635 Ga0495668_0001633 3300046616 Bacteria 20937
636 Ga0495611_0000005 3300046648 Bacteria 284271
637 Ga0495611_0000450 3300046648 Bacteria 24925
638 Ga0495625_0001159 3300046660 Bacteria 33975
639 Ga0495625_0049664 3300046660 Bacteria 3014
640 Ga0495625_0058723 3300046660 Bacteria 2732
641 Ga0495661_0001759 3300046665 Bacteria 17418
642 Ga0495658_0004487 3300046683 Bacteria 6868
643 Ga0495658_0087600 3300046683 Bacteria 1839
644 Ga0495670_0000663 3300046691 Bacteria 16457
645 Ga0495670_0055490 3300046691 Bacteria 1986
646 Ga0495671_0003260 3300046692 Bacteria 10071
647 Ga0495671_0021078 3300046692 Bacteria 3428
648 Ga0495649_0010720 3300046694 Bacteria 5397
649 Ga0495589_0000389 3300046794 Bacteria 33643
650 Ga0495660_0000655 3300046810 Bacteria 26804
651 Ga0495660_0003414 3300046810 Bacteria 9832
652 Ga0495604_0163723 3300047317 Bacteria 1570
653 Ga0495636_0004874 3300047318 Bacteria 5256
654 Ga0495636_0009636 3300047318 Bacteria 3804
655 Ga0495672_0045597 3300047320 Bacteria 2622
656 Ga0495680_0119704 3300047322 Bacteria 1945
657 Ga0495683_0003102 3300047323 Bacteria 9738
658 Ga0495679_000382 3300047446 Bacteria 33973
659 Ga0495685_012325 3300047447 Bacteria 2896
660 Ga0495673_0000038 3300047469 Bacteria 303785
661 Ga0495673_0000685 3300047469 Bacteria 33195
662 Ga0495673_0001420 3300047469 Bacteria 19197
663 Ga0495686_0000050 3300047472 Bacteria 269010
664 Ga0495686_0003791 3300047472 Bacteria 12840
665 Ga0495686_0006806 3300047472 Bacteria 8675
666 Ga0495686_0012650 3300047472 Bacteria 5896
667 Ga0496100_0085615 3300048903 Bacteria 2139
668 Ga0496101_0133859 3300048904 Bacteria 1884
669 Ga0496102_0063280 3300048905 Bacteria 3387
670 Ga0496102_0069440 3300048905 Bacteria 3234
671 Ga0496104_0001740 3300048907 Bacteria 18804
672 Ga0496104_0118543 3300048907 Bacteria 2541
673 Ga0496105_0000024 3300048908 Bacteria 153740
674 Ga0496105_0003721 3300048908 Bacteria 11354
675 Ga0496106_0004672 3300048909 Bacteria 10156
676 Ga0496108_0010770 3300048911 Bacteria 7423
677 Ga0496112_0028515 3300048915 Bacteria 5389
678 Ga0496113_0023533 3300048916 Bacteria 4368
679 Ga0496115_0000076 3300048918 Bacteria 90063
680 Ga0496115_0001176 3300048918 Bacteria 18772
681 Ga0496115_0003968 3300048918 Bacteria 10674
682 Ga0496115_0006604 3300048918 Bacteria 8501
683 Ga0496115_0014844 3300048918 Bacteria 5908
684 Ga0496116_0037978 3300048919 Bacteria 3351
685 Ga0496116_0073665 3300048919 Bacteria 2151
686 Ga0496117_0011491 3300048920 Bacteria 7926
687 Ga0496117_0018758 3300048920 Bacteria 5714
688 Ga0496117_0042644 3300048920 Bacteria 3309
689 Ga0496117_0058459 3300048920 Bacteria 2670
690 Ga0496118_0002146 3300048921 Bacteria 27521
691 Ga0496118_0003339 3300048921 Bacteria 20305
692 Ga0496118_0006168 3300048921 Bacteria 13286
693 Ga0496118_0007238 3300048921 Bacteria 11841
694 Ga0496118_0013900 3300048921 Bacteria 7572
695 Ga0496118_0015640 3300048921 Bacteria 7010
696 Ga0496119_0000725 3300048922 Bacteria 44399
697 Ga0496119_0004544 3300048922 Bacteria 13750
698 Ga0496119_0023306 3300048922 Bacteria 4397
699 Ga0496120_0000821 3300048923 Bacteria 44390
700 Ga0496120_0002936 3300048923 Bacteria 16270
701 Ga0496121_0000785 3300048924 Bacteria 58011
702 Ga0496121_0001206 3300048924 Bacteria 45212
703 Ga0496121_0005164 3300048924 Bacteria 16951
704 Ga0496121_0008379 3300048924 Bacteria 12189
705 Ga0496121_0029483 3300048924 Bacteria 5072
706 Ga0496121_0042594 3300048924 Bacteria 3945
707 Ga0496121_0065825 3300048924 Bacteria 2946
708 Ga0496121_0079696 3300048924 Bacteria 2599
709 Ga0496122_0000710 3300048925 Bacteria 65728
710 Ga0496122_0013782 3300048925 Bacteria 7878
711 Ga0496122_0043368 3300048925 Bacteria 3526
712 Ga0496122_0076751 3300048925 Bacteria 2350
713 Ga0496123_0000104 3300048926 Bacteria 168230
714 Ga0496123_0000323 3300048926 Bacteria 91212
715 Ga0496123_0013735 3300048926 Bacteria 6770
716 Ga0496123_0023025 3300048926 Bacteria 4782
717 Ga0496125_0001643 3300048928 Bacteria 31509
718 Ga0496125_0004570 3300048928 Bacteria 15867
719 Ga0496126_0002348 3300048929 Bacteria 25869
720 Ga0496126_0004216 3300048929 Bacteria 17325
721 Ga0496126_0014412 3300048929 Bacteria 7993
722 Ga0496126_0022143 3300048929 Bacteria 6191
723 Ga0496126_0107565 3300048929 Bacteria 2432
724 Ga0495678_001183 3300049459 Bacteria 21492
725 Ga0495678_004683 3300049459 Bacteria 7829
726 Ga0495682_0010218 3300049460 Bacteria 3645
727 Ga0501290_001903 3300049513 Bacteria 2760
728 Ga0501031_0003654 3300049568 Bacteria 9899
729 Ga0501031_0031363 3300049568 Bacteria 3467
730 Ga0501031_0078119 3300049568 Bacteria 2156
731 Ga0501032_0005214 3300049569 Bacteria 9671
732 Ga0501032_0011217 3300049569 Bacteria 6437
733 Ga0501032_0017236 3300049569 Bacteria 5072
734 Ga0501032_0044311 3300049569 Bacteria 3012
735 Ga0501033_0001723 3300049570 Bacteria 19140
736 Ga0501033_0019751 3300049570 Bacteria 5092
737 Ga0501034_0007235 3300049571 Bacteria 11844
738 Ga0501034_0007682 3300049571 Bacteria 11473
739 Ga0501034_0014956 3300049571 Bacteria 7982
740 Ga0501034_0091016 3300049571 Bacteria 3048
741 Ga0501034_0092426 3300049571 Bacteria 3022
742 Ga0501034_0096953 3300049571 Bacteria 2944
743 Ga0501036_0001984 3300049572 Bacteria 15878
744 Ga0501036_0011674 3300049572 Bacteria 7280
745 Ga0501036_0017902 3300049572 Bacteria 5932
746 Ga0501037_0006068 3300049573 Bacteria 8825
747 Ga0501038_0001563 3300049574 Bacteria 21191
748 Ga0501038_0006223 3300049574 Bacteria 11035
749 Ga0501038_0026871 3300049574 Bacteria 5125
750 Ga0501038_0032742 3300049574 Bacteria 4583
751 Ga0501039_0006491 3300049575 Bacteria 8893
752 Ga0501043_0007714 3300049579 Bacteria 8521
753 Ga0501043_0023271 3300049579 Bacteria 4858
754 Ga0501043_0061643 3300049579 Bacteria 2945
755 Ga0501043_0105408 3300049579 Bacteria 2215
756 Ga0501043_0118843 3300049579 Bacteria 2073
757 Ga0501043_0172476 3300049579 Bacteria 1687
758 Ga0501043_0201961 3300049579 Bacteria 1542
759 Ga0501046_0003875 3300049580 Bacteria 13681
760 Ga0501046_0004129 3300049580 Bacteria 13232
761 Ga0501046_0017806 3300049580 Bacteria 5926
762 Ga0501046_0087088 3300049580 Bacteria 2407
763 Ga0501046_0125753 3300049580 Bacteria 1948
764 Ga0501047_0000735 3300049581 Bacteria 34114
765 Ga0501047_0001965 3300049581 Bacteria 19740
766 Ga0501047_0003794 3300049581 Bacteria 14214
767 Ga0501047_0005660 3300049581 Bacteria 11765
768 Ga0501047_0007103 3300049581 Bacteria 10516
769 Ga0501047_0013105 3300049581 Bacteria 7852
770 Ga0501047_0020505 3300049581 Bacteria 6346
771 Ga0501047_0022991 3300049581 Bacteria 5984
772 Ga0501047_0090404 3300049581 Bacteria 2938
773 Ga0501047_0141987 3300049581 Bacteria 2279
774 Ga0501048_0074095 3300049582 Bacteria 2402
775 Ga0501067_0047025 3300049583 Bacteria 2394
776 Ga0501069_0000559 3300049585 Bacteria 17150
777 Ga0501069_0002244 3300049585 Bacteria 9741
778 Ga0501069_0004048 3300049585 Bacteria 7571
779 Ga0501070_0001793 3300049586 Bacteria 18953
780 Ga0501070_0003552 3300049586 Bacteria 13485
781 Ga0501070_0005263 3300049586 Bacteria 11032
782 Ga0501070_0011009 3300049586 Bacteria 7635
783 Ga0501070_0053198 3300049586 Bacteria 3359
784 Ga0501070_0112433 3300049586 Bacteria 2250
785 Ga0501070_0113314 3300049586 Bacteria 2241
786 Ga0501070_0249048 3300049586 Bacteria 1453
787 Ga0501070_0253561 3300049586 Bacteria 1439
788 Ga0501071_0010240 3300049587 Bacteria 6276
789 Ga0501072_0014884 3300049588 Bacteria 5962
790 Ga0501073_0001609 3300049589 Bacteria 16719
791 Ga0501073_0006429 3300049589 Bacteria 8747
792 Ga0501073_0009627 3300049589 Bacteria 7126
793 Ga0501073_0065864 3300049589 Bacteria 2525
794 Ga0501073_0085774 3300049589 Bacteria 2190
795 Ga0501074_0000819 3300049590 Bacteria 19705
796 Ga0501074_0043163 3300049590 Bacteria 3263
797 Ga0501074_0078236 3300049590 Bacteria 2373
798 Ga0501074_0105380 3300049590 Bacteria 2018
799 Ga0501077_0005147 3300049593 Bacteria 7944
800 Ga0501077_0024988 3300049593 Bacteria 3793
801 Ga0501225_0009773 3300049705 Bacteria 2725
802 Ga0501079_0007742 3300049741 Bacteria 8134
803 Ga0501079_0044584 3300049741 Bacteria 3422
804 Ga0501080_0007181 3300049742 Bacteria 10054
805 Ga0501080_0008242 3300049742 Bacteria 9437
806 Ga0501080_0013258 3300049742 Bacteria 7572
807 Ga0501080_0016038 3300049742 Bacteria 6914
808 Ga0501083_0003789 3300049744 Bacteria 10619
809 Ga0501083_0010617 3300049744 Bacteria 6483
810 Ga0501083_0130064 3300049744 Bacteria 1650
811 Ga0501035_0021264 3300049822 Bacteria 5964
812 Ga0501035_0043573 3300049822 Bacteria 4043
813 Ga0501035_0089245 3300049822 Bacteria 2715
814 Ga0501035_0133645 3300049822 Bacteria 2161
815 Ga0501035_0133652 3300049822 Bacteria 2161
816 Ga0501035_0175543 3300049822 Bacteria 1848
817 Ga0501044_0004108 3300049823 Bacteria 16325
818 Ga0501044_0006723 3300049823 Bacteria 12679
819 Ga0501044_0007183 3300049823 Bacteria 12250
820 Ga0501044_0009324 3300049823 Bacteria 10708
821 Ga0501044_0020832 3300049823 Bacteria 6999
822 Ga0501044_0031765 3300049823 Bacteria 5554
823 Ga0501044_0033147 3300049823 Bacteria 5428
824 Ga0501044_0105675 3300049823 Bacteria 2828
825 nmdc:mga00v17_476_c1 3300050491 Bacteria 22518
826 nmdc:mga04h51_10808_c1 3300050495 Bacteria 2517
827 nmdc:mga08x19_55341_c1 3300050514 Bacteria 2557
828 Ga0500610_0007052 3300053079 Bacteria 4775
829 Ga0500643_000378 3300053087 Bacteria 34748
830 Ga0500643_001849 3300053087 Bacteria 11549
831 Ga0500651_0001642 3300053093 Bacteria 11382
832 Ga0500651_0005370 3300053093 Bacteria 7312
833 Ga0500555_009745 3300053103 Bacteria 2749
834 Ga0500597_000153 3300053120 Bacteria 13817
835 Ga0500568_0006147 3300053139 Bacteria 6074
836 Ga0500634_0000363 3300053161 Bacteria 14395
837 Ga0500645_001468 3300053730 Bacteria 11856
838 Ga0501084_0026745 3300054114 Bacteria 4818
839 Ga0501084_0027347 3300054114 Bacteria 4766
840 Ga0501084_0108352 3300054114 Bacteria 2334
841 Ga0501084_0127209 3300054114 Bacteria 2144
842 Ga0501084_0137876 3300054114 Bacteria 2054
843 Ga0501082_0000107 3300060353 Bacteria 65178
844 Ga0501082_0050029 3300060353 Bacteria 3604
845 Ga0501082_0067913 3300060353 Bacteria 3070
846 Ga0466962_0002150 3300061719 Bacteria 9314
847 Ga0466962_0025534 3300061719 Bacteria 2836

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047317 Ga0495604_0163723 Ga0495604_0163723_273_1553 386
2 3300036712 Ga0316584_0182710 Ga0316584_0182710_44_1345 394
3 3300002067 JGI24735J21928_10000400 JGI24735J21928_1000040010 405
4 3300026089 Ga0207648_10174421 Ga0207648_101744211 407
5 3300050514 nmdc:mga08x19_55341_c1 nmdc:mga08x19_55341_c1_13_1263 410
6 3300025921 Ga0207652_10024942 Ga0207652_100249422 411
7 3300060353 Ga0501082_0050029 Ga0501082_0050029_2279_3589 411
8 3300041452 Ga0451793_0125667 Ga0451793_0125667_121_1557 415
9 3300042000 Ga0439437_006103 Ga0439437_006103_57_1319 415
10 3300013104 Ga0157370_10007352 Ga0157370_100073524 416
11 3300015265 Ga0182005_1001074 Ga0182005_10010743 416
12 3300048919 Ga0496116_0037978 Ga0496116_0037978_1851_3209 416
13 3300048918 Ga0496115_0000076 Ga0496115_0000076_81189_82505 417
14 3300048929 Ga0496126_0004216 Ga0496126_0004216_8451_9767 417
15 3300049569 Ga0501032_0044311 Ga0501032_0044311_1611_2960 418
16 3300049571 Ga0501034_0096953 Ga0501034_0096953_997_2346 418
17 3300049579 Ga0501043_0105408 Ga0501043_0105408_263_1612 418
18 3300049580 Ga0501046_0087088 Ga0501046_0087088_173_1522 418
19 3300049581 Ga0501047_0090404 Ga0501047_0090404_997_2346 418
20 3300049586 Ga0501070_0249048 Ga0501070_0249048_73_1422 418
21 3300046519 Ga0495632_0000005 Ga0495632_0000005_354333_355691 419
22 3300005367 Ga0070667_100005927 Ga0070667_1000059278 420
23 3300005548 Ga0070665_100000028 Ga0070665_100000028196 420
24 3300025986 Ga0207658_10004314 Ga0207658_100043145 420
25 3300028379 Ga0268266_10000017 Ga0268266_10000017340 420
26 3300041494 Ga0451837_0182006 Ga0451837_0182006_509_1867 420
27 3300046492 Ga0495585_0000024 Ga0495585_0000024_139019_140377 420
28 3300046518 Ga0495631_0001428 Ga0495631_0001428_4904_6262 420
29 3300046524 Ga0495648_0000485 Ga0495648_0000485_7990_9348 420
30 3300046665 Ga0495661_0001759 Ga0495661_0001759_1568_2926 420
31 3300053730 Ga0500645_001468 Ga0500645_001468_7641_8999 420
32 3300041404 Ga0439436_0019013 Ga0439436_0019013_149_1540 421
33 3300005366 Ga0070659_100161209 Ga0070659_1001612092 422
34 3300013100 Ga0157373_10078911 Ga0157373_100789112 422
35 3300013306 Ga0163162_10000004 Ga0163162_10000004155 422
36 3300015689 Ga0183360_10003 Ga0183360_1000315 422
37 3300037418 Ga0395900_0006056 Ga0395900_0006056_7107_8561 422
38 3300044684 Ga0466966_0013312 Ga0466966_0013312_2053_3408 422
39 3300046507 Ga0495606_0002137 Ga0495606_0002137_14489_15847 422
40 3300046660 Ga0495625_0058723 Ga0495625_0058723_97_1455 422
41 3300006881 Ga0068865_100001222 Ga0068865_10000122212 423
42 3300009176 Ga0105242_10004683 Ga0105242_100046838 423
43 3300013104 Ga0157370_10032654 Ga0157370_100326543 423
44 3300013306 Ga0163162_10006588 Ga0163162_100065888 423
45 3300013308 Ga0157375_10000561 Ga0157375_1000056120 423
46 3300025904 Ga0207647_10000130 Ga0207647_1000013014 423
47 3300025934 Ga0207686_10002229 Ga0207686_1000222910 423
48 3300025938 Ga0207704_10001141 Ga0207704_1000114111 423
49 3300032004 Ga0307414_10016393 Ga0307414_100163933 423
50 3300035111 Ga0373923_0042124 Ga0373923_0042124_213_1604 423
51 3300048907 Ga0496104_0001740 Ga0496104_0001740_7666_9057 423
52 3300048908 Ga0496105_0000024 Ga0496105_0000024_7694_9085 423
53 3300048921 Ga0496118_0003339 Ga0496118_0003339_14173_15531 423
54 3300048924 Ga0496121_0001206 Ga0496121_0001206_35574_36932 423
55 3300048925 Ga0496122_0043368 Ga0496122_0043368_1112_2470 423
56 3300048928 Ga0496125_0004570 Ga0496125_0004570_13566_14924 423
57 3300050495 nmdc:mga04h51_10808_c1 nmdc:mga04h51_10808_c1_606_1898 423
58 3300009101 Ga0105247_10004712 Ga0105247_100047124 424
59 3300015261 Ga0182006_1000461 Ga0182006_100046110 424
60 3300015265 Ga0182005_1001234 Ga0182005_10012345 424
61 3300025900 Ga0207710_10002997 Ga0207710_100029975 424
62 3300046810 Ga0495660_0003414 Ga0495660_0003414_7875_9233 424
63 3300047469 Ga0495673_0000038 Ga0495673_0000038_7932_9290 424
64 3300048924 Ga0496121_0005164 Ga0496121_0005164_8170_9528 424
65 3300005539 Ga0068853_100065038 Ga0068853_1000650382 425
66 3300009098 Ga0105245_10054644 Ga0105245_100546443 425
67 3300025914 Ga0207671_10005317 Ga0207671_100053175 425
68 3300025927 Ga0207687_10082099 Ga0207687_100820991 425
69 3300026041 Ga0207639_10001365 Ga0207639_100013655 425
70 3300046683 Ga0495658_0087600 Ga0495658_0087600_16_1395 425
71 3300049571 Ga0501034_0091016 Ga0501034_0091016_599_1918 425
72 3300049586 Ga0501070_0053198 Ga0501070_0053198_746_2065 425
73 3300049590 Ga0501074_0043163 Ga0501074_0043163_830_2149 425
74 3300054114 Ga0501084_0137876 Ga0501084_0137876_543_1862 425
75 3300005344 Ga0070661_100001549 Ga0070661_1000015494 426
76 3300005563 Ga0068855_100155108 Ga0068855_1001551083 426
77 3300025913 Ga0207695_10003828 Ga0207695_1000382811 426
78 3300025920 Ga0207649_10005381 Ga0207649_100053818 426
79 3300025924 Ga0207694_10094822 Ga0207694_100948222 426
80 3300025949 Ga0207667_10053029 Ga0207667_100530293 426
81 3300025981 Ga0207640_10019869 Ga0207640_100198694 426
82 3300048907 Ga0496104_0118543 Ga0496104_0118543_16_1335 426
83 3300025298 Ga0209050_1002489 Ga0209050_100248912 427
84 3300025303 Ga0209051_1008280 Ga0209051_10082803 427
85 3300025304 Ga0209257_1004860 Ga0209257_10048603 427
86 3300041460 Ga0451802_0337161 Ga0451802_0337161_773_2245 427
87 3300003771 Ga0055526_1000082 Ga0055526_100008261 428
88 3300003773 Ga0055537_1000228 Ga0055537_100022821 428
89 3300003775 Ga0055524_1000138 Ga0055524_100013817 428
90 3300003784 Ga0055534_1000056 Ga0055534_100005617 428
91 3300003790 Ga0055528_1000061 Ga0055528_100006117 428
92 3300007265 Ga0099794_10008738 Ga0099794_100087383 428
93 3300009551 Ga0105238_10010170 Ga0105238_100101704 428
94 3300013105 Ga0157369_10000021 Ga0157369_1000002111 428
95 3300025263 Ga0209565_1000002 Ga0209565_100000216 428
96 3300025273 Ga0209673_1000002 Ga0209673_100000216 428
97 3300025291 Ga0209675_1000002 Ga0209675_100000216 428
98 3300025295 Ga0209564_1000004 Ga0209564_100000417 428
99 3300025299 Ga0209256_1000004 Ga0209256_100000417 428
100 3300025913 Ga0207695_10037019 Ga0207695_100370194 428
101 3300025914 Ga0207671_10005233 Ga0207671_100052334 428
102 3300025924 Ga0207694_10001363 Ga0207694_1000136314 428
103 3300003794 Ga0055531_10005953 Ga0055531_100059532 429
104 3300025294 Ga0209025_1035732 Ga0209025_10357322 429
105 3300025304 Ga0209257_1000499 Ga0209257_100049914 429
106 3300003578 Ga0006562J51391_1035852 Ga0006562J51391_10358527 430
107 3300047472 Ga0495686_0000050 Ga0495686_0000050_8125_9483 430
108 3300048920 Ga0496117_0058459 Ga0496117_0058459_156_1514 430
109 3300048921 Ga0496118_0015640 Ga0496118_0015640_1710_3068 430
110 iso_pu_bacteria 2643221559 2643816047 430
111 iso_pu_bacteria 2643221586 2643939123 430
112 iso_pu_bacteria 2643221612 2644077814 430
113 iso_pu_bacteria 2643221727 2644697085 430
114 3300046558 Ga0495633_0010517 Ga0495633_0010517_685_2040 431
115 3300049579 Ga0501043_0023271 Ga0501043_0023271_169_1617 431
116 3300049580 Ga0501046_0004129 Ga0501046_0004129_11464_12912 431
117 3300049582 Ga0501048_0074095 Ga0501048_0074095_21_1469 431
118 3300053161 Ga0500634_0000363 Ga0500634_0000363_12502_13857 431
119 3300013105 Ga0157369_10010042 Ga0157369_1001004210 432
120 3300025923 Ga0207681_10027339 Ga0207681_100273392 432
121 3300031691 Ga0316579_10031405 Ga0316579_100314053 432
122 3300031728 Ga0316578_10019084 Ga0316578_100190844 432
123 3300036647 Ga0316582_0020981 Ga0316582_0020981_55_1422 432
124 3300036712 Ga0316584_0076263 Ga0316584_0076263_445_1812 432
125 3300044658 Ga0466972_0007010 Ga0466972_0007010_1765_3201 432
126 3300044735 Ga0466968_0001344 Ga0466968_0001344_7348_8706 432
127 3300044765 Ga0466970_0000349 Ga0466970_0000349_9617_11053 432
128 3300049741 Ga0501079_0044584 Ga0501079_0044584_1574_2947 432
129 3300054114 Ga0501084_0108352 Ga0501084_0108352_520_1893 432
130 3300005336 Ga0070680_100050969 Ga0070680_1000509691 433
131 3300005530 Ga0070679_100011025 Ga0070679_1000110258 433
132 3300005549 Ga0070704_100004431 Ga0070704_1000044312 433
133 3300006173 Ga0070716_100014594 Ga0070716_1000145943 433
134 3300006914 Ga0075436_100003116 Ga0075436_1000031169 433
135 3300007265 Ga0099794_10005753 Ga0099794_100057533 433
136 3300025911 Ga0207654_10005801 Ga0207654_100058012 433
137 3300049568 Ga0501031_0003654 Ga0501031_0003654_2541_3989 433
138 3300049569 Ga0501032_0017236 Ga0501032_0017236_2731_4179 433
139 3300049570 Ga0501033_0019751 Ga0501033_0019751_1122_2570 433
140 3300049574 Ga0501038_0001563 Ga0501038_0001563_5029_6477 433
141 3300049581 Ga0501047_0007103 Ga0501047_0007103_322_1770 433
142 3300049589 Ga0501073_0009627 Ga0501073_0009627_3865_5313 433
143 3300005467 Ga0070706_100023729 Ga0070706_1000237292 434
144 3300005843 Ga0068860_100017405 Ga0068860_1000174057 434
145 3300006038 Ga0075365_10008292 Ga0075365_100082924 434
146 3300006051 Ga0075364_10001706 Ga0075364_100017065 434
147 3300013296 Ga0157374_10004992 Ga0157374_100049927 434
148 3300028381 Ga0268264_10004127 Ga0268264_100041276 434
149 3300032004 Ga0307414_10085553 Ga0307414_100855532 434
150 3300039437 Ga0436365_1537398 Ga0436365_1537398_69_1385 434
151 3300047472 Ga0495686_0003791 Ga0495686_0003791_8367_9725 434
152 3300048915 Ga0496112_0028515 Ga0496112_0028515_2228_3658 434
153 3300049579 Ga0501043_0172476 Ga0501043_0172476_314_1648 434
154 3300049580 Ga0501046_0017806 Ga0501046_0017806_2818_4149 434
155 3300049581 Ga0501047_0000735 Ga0501047_0000735_27448_28779 434
156 3300049742 Ga0501080_0016038 Ga0501080_0016038_5091_6422 434
157 3300050491 nmdc:mga00v17_476_c1 nmdc:mga00v17_476_c1_15451_16827 434
158 3300060353 Ga0501082_0067913 Ga0501082_0067913_1446_2777 434
159 3300005262 Ga0065165_1000887 Ga0065165_100088732 435
160 3300005331 Ga0070670_100065037 Ga0070670_1000650372 435
161 3300005530 Ga0070679_100183465 Ga0070679_1001834651 435
162 3300005546 Ga0070696_100009437 Ga0070696_1000094372 435
163 3300005614 Ga0068856_100135247 Ga0068856_1001352473 435
164 3300005834 Ga0068851_10025083 Ga0068851_100250832 435
165 3300005843 Ga0068860_100076005 Ga0068860_1000760053 435
166 3300025254 Ga0209148_1000912 Ga0209148_100091211 435
167 3300025302 Ga0207426_1003250 Ga0207426_10032507 435
168 3300025909 Ga0207705_10086094 Ga0207705_100860942 435
169 3300025912 Ga0207707_10017863 Ga0207707_100178637 435
170 3300025919 Ga0207657_10011362 Ga0207657_100113624 435
171 3300025949 Ga0207667_10075450 Ga0207667_100754503 435
172 3300026041 Ga0207639_10102207 Ga0207639_101022073 435
173 3300026116 Ga0207674_10025688 Ga0207674_100256882 435
174 3300028381 Ga0268264_10112314 Ga0268264_101123143 435
175 3300048909 Ga0496106_0004672 Ga0496106_0004672_1883_3241 435
176 3300048924 Ga0496121_0065825 Ga0496121_0065825_1040_2398 435
177 3300003187 JGI25151J46595_10026595 JGI25151J46595_100265951 436
178 3300003781 Ga0055536_1007776 Ga0055536_10077763 436
179 3300005335 Ga0070666_10009658 Ga0070666_100096584 436
180 3300013307 Ga0157372_10017223 Ga0157372_100172234 436
181 3300014497 Ga0182008_10003053 Ga0182008_100030539 436
182 3300015261 Ga0182006_1001147 Ga0182006_10011478 436
183 3300015265 Ga0182005_1001072 Ga0182005_10010729 436
184 3300015685 Ga0183369_1011 Ga0183369_101118 436
185 3300025284 Ga0209130_1003339 Ga0209130_10033395 436
186 3300025292 Ga0209676_1000830 Ga0209676_100083021 436
187 3300025294 Ga0209025_1009037 Ga0209025_10090373 436
188 3300025295 Ga0209564_1003164 Ga0209564_10031649 436
189 3300025299 Ga0209256_1004097 Ga0209256_10040978 436
190 3300025299 Ga0209256_1004516 Ga0209256_10045162 436
191 3300025304 Ga0209257_1003235 Ga0209257_10032359 436
192 3300031548 Ga0307408_100041048 Ga0307408_1000410482 436
193 3300031911 Ga0307412_10016904 Ga0307412_100169042 436
194 3300035398 Ga0316574_0095604 Ga0316574_0095604_410_1741 436
195 3300037312 Ga0395899_0029191 Ga0395899_0029191_2048_3406 436
196 3300037418 Ga0395900_0001743 Ga0395900_0001743_13621_14979 436
197 3300038443 Ga0395901_0215678 Ga0395901_0215678_264_1622 436
198 3300041404 Ga0439436_0000019 Ga0439436_0000019_7943_9301 436
199 3300041413 Ga0439465_0011345 Ga0439465_0011345_1151_2509 436
200 3300042184 Ga0450908_000141 Ga0450908_000141_8166_9524 436
201 3300046452 Ga0495617_000409 Ga0495617_000409_8117_9475 436
202 3300046501 Ga0495607_0001268 Ga0495607_0001268_7975_9333 436
203 3300046501 Ga0495607_0037446 Ga0495607_0037446_837_2195 436
204 3300046507 Ga0495606_0011896 Ga0495606_0011896_3704_5062 436
205 3300046512 Ga0495610_0005438 Ga0495610_0005438_2322_3680 436
206 3300046515 Ga0495620_0000889 Ga0495620_0000889_7953_9311 436
207 3300046694 Ga0495649_0010720 Ga0495649_0010720_3630_4988 436
208 3300048922 Ga0496119_0023306 Ga0496119_0023306_2959_4317 436
209 3300048925 Ga0496122_0013782 Ga0496122_0013782_6078_7436 436
210 3300048926 Ga0496123_0013735 Ga0496123_0013735_3227_4585 436
211 3300049569 Ga0501032_0011217 Ga0501032_0011217_4163_5548 436
212 3300049571 Ga0501034_0007235 Ga0501034_0007235_6424_7809 436
213 3300049572 Ga0501036_0001984 Ga0501036_0001984_10781_12166 436
214 3300049579 Ga0501043_0007714 Ga0501043_0007714_6280_7716 436
215 3300049579 Ga0501043_0118843 Ga0501043_0118843_622_2007 436
216 3300049581 Ga0501047_0001965 Ga0501047_0001965_6735_8120 436
217 3300049585 Ga0501069_0002244 Ga0501069_0002244_2054_3439 436
218 3300049586 Ga0501070_0005263 Ga0501070_0005263_4444_5829 436
219 3300049589 Ga0501073_0006429 Ga0501073_0006429_6386_7771 436
220 3300049590 Ga0501074_0000819 Ga0501074_0000819_6757_8142 436
221 3300049741 Ga0501079_0007742 Ga0501079_0007742_4909_6294 436
222 3300049742 Ga0501080_0013258 Ga0501080_0013258_2152_3537 436
223 3300049744 Ga0501083_0003789 Ga0501083_0003789_6669_8054 436
224 3300049822 Ga0501035_0175543 Ga0501035_0175543_446_1810 436
225 3300049823 Ga0501044_0007183 Ga0501044_0007183_6369_7754 436
226 3300054114 Ga0501084_0026745 Ga0501084_0026745_888_2273 436
227 3300002737 JGI25162J39368_1000239 JGI25162J39368_100023913 437
228 3300002741 JGI25157J39369_1000720 JGI25157J39369_100072014 437
229 3300002771 JGI25163J39215_1001261 JGI25163J39215_10012611 437
230 3300002772 JGI25164J39214_1000200 JGI25164J39214_100020040 437
231 3300002772 JGI25164J39214_1000605 JGI25164J39214_100060513 437
232 3300003214 JGI25165J46597_1000319 JGI25165J46597_100031913 437
233 3300003756 Ga0055533_1002005 Ga0055533_10020055 437
234 3300003761 Ga0055535_1000242 Ga0055535_100024213 437
235 3300003762 Ga0055542_1000298 Ga0055542_100029839 437
236 3300003763 Ga0055529_1000437 Ga0055529_100043713 437
237 3300005563 Ga0068855_100003293 Ga0068855_1000032937 437
238 3300005578 Ga0068854_100000504 Ga0068854_10000050415 437
239 3300009093 Ga0105240_10102964 Ga0105240_101029642 437
240 3300009545 Ga0105237_10028280 Ga0105237_100282804 437
241 3300013307 Ga0157372_10006803 Ga0157372_100068034 437
242 3300017792 Ga0163161_10032354 Ga0163161_100323543 437
243 3300025207 Ga0209760_102570 Ga0209760_1025702 437
244 3300025224 Ga0209784_100163 Ga0209784_10016342 437
245 3300025226 Ga0209674_100037 Ga0209674_100037346 437
246 3300025228 Ga0209672_101128 Ga0209672_1011282 437
247 3300025231 Ga0207427_100196 Ga0207427_10019642 437
248 3300025233 Ga0209437_100345 Ga0209437_10034510 437
249 3300025242 Ga0209258_100384 Ga0209258_10038413 437
250 3300025246 Ga0209646_1001674 Ga0209646_10016741 437
251 3300025250 Ga0209026_1000286 Ga0209026_100028642 437
252 3300025254 Ga0209148_1000047 Ga0209148_100004713 437
253 3300025256 Ga0209759_1001948 Ga0209759_10019487 437
254 3300025258 Ga0209129_1000331 Ga0209129_10003315 437
255 3300025261 Ga0209233_1000100 Ga0209233_1000100257 437
256 3300025272 Ga0209455_1000270 Ga0209455_100027042 437
257 3300025913 Ga0207695_10041168 Ga0207695_100411682 437
258 3300025949 Ga0207667_10000228 Ga0207667_1000022861 437
259 3300025981 Ga0207640_10000120 Ga0207640_1000012045 437
260 3300044683 Ga0466965_0009624 Ga0466965_0009624_1201_2556 437
261 3300044693 Ga0466961_0004931 Ga0466961_0004931_2526_3881 437
262 3300044842 Ga0466957_0002466 Ga0466957_0002466_2120_3475 437
263 3300045836 Ga0466958_0001914 Ga0466958_0001914_6710_8065 437
264 3300046507 Ga0495606_0000849 Ga0495606_0000849_7362_8717 437
265 3300046557 Ga0495622_0008038 Ga0495622_0008038_3078_4433 437
266 3300046660 Ga0495625_0049664 Ga0495625_0049664_987_2342 437
267 3300047320 Ga0495672_0045597 Ga0495672_0045597_912_2270 437
268 3300048903 Ga0496100_0085615 Ga0496100_0085615_249_1607 437
269 3300048918 Ga0496115_0003968 Ga0496115_0003968_9246_10601 437
270 3300048918 Ga0496115_0014844 Ga0496115_0014844_74_1429 437
271 3300048925 Ga0496122_0076751 Ga0496122_0076751_977_2335 437
272 3300048929 Ga0496126_0014412 Ga0496126_0014412_5560_6915 437
273 3300048929 Ga0496126_0107565 Ga0496126_0107565_956_2311 437
274 3300049459 Ga0495678_004683 Ga0495678_004683_4927_6282 437
275 3300061719 Ga0466962_0025534 Ga0466962_0025534_1063_2418 437
276 3300005458 Ga0070681_10000799 Ga0070681_1000079910 438
277 3300009093 Ga0105240_10002481 Ga0105240_1000248113 438
278 3300009093 Ga0105240_10011769 Ga0105240_1001176913 438
279 3300009093 Ga0105240_10225506 Ga0105240_102255064 438
280 3300009174 Ga0105241_10012342 Ga0105241_100123425 438
281 3300009551 Ga0105238_10054682 Ga0105238_100546825 438
282 3300010375 Ga0105239_10001637 Ga0105239_1000163714 438
283 3300025912 Ga0207707_10000626 Ga0207707_100006265 438
284 3300025913 Ga0207695_10002173 Ga0207695_1000217315 438
285 3300025913 Ga0207695_10002412 Ga0207695_1000241213 438
286 3300038443 Ga0395901_0067700 Ga0395901_0067700_1724_3112 438
287 3300041509 Ga0451843_0269584 Ga0451843_0269584_1001_2425 438
288 3300046460 Ga0495638_0001133 Ga0495638_0001133_14006_15364 438
289 3300048904 Ga0496101_0133859 Ga0496101_0133859_170_1525 438
290 3300048908 Ga0496105_0003721 Ga0496105_0003721_9096_10451 438
291 3300048918 Ga0496115_0006604 Ga0496115_0006604_2180_3535 438
292 3300048919 Ga0496116_0073665 Ga0496116_0073665_59_1414 438
293 3300048920 Ga0496117_0011491 Ga0496117_0011491_3345_4700 438
294 3300048920 Ga0496117_0042644 Ga0496117_0042644_1627_2982 438
295 3300048921 Ga0496118_0007238 Ga0496118_0007238_9793_11148 438
296 3300048922 Ga0496119_0000725 Ga0496119_0000725_33319_34674 438
297 3300048923 Ga0496120_0000821 Ga0496120_0000821_33310_34665 438
298 3300048929 Ga0496126_0002348 Ga0496126_0002348_18464_19819 438
299 3300053093 Ga0500651_0005370 Ga0500651_0005370_3053_4411 438
300 3300005457 Ga0070662_100038283 Ga0070662_1000382832 439
301 3300037312 Ga0395899_0019790 Ga0395899_0019790_53_1411 439
302 3300037418 Ga0395900_0283268 Ga0395900_0283268_14_1372 439
303 3300041453 Ga0451797_0049457 Ga0451797_0049457_136_1560 439
304 3300042006 Ga0439432_002874 Ga0439432_002874_4081_5514 439
305 3300046501 Ga0495607_0001396 Ga0495607_0001396_12476_13834 439
306 3300046519 Ga0495632_0031217 Ga0495632_0031217_984_2342 439
307 3300049586 Ga0501070_0253561 Ga0501070_0253561_23_1378 439
308 3300002741 JGI25157J39369_1000892 JGI25157J39369_10008926 440
309 3300005436 Ga0070713_100001691 Ga0070713_10000169110 440
310 3300005539 Ga0068853_100005963 Ga0068853_1000059633 440
311 3300013100 Ga0157373_10161553 Ga0157373_101615531 440
312 3300014497 Ga0182008_10008140 Ga0182008_100081405 440
313 3300025250 Ga0209026_1000119 Ga0209026_100011914 440
314 3300025932 Ga0207690_10005794 Ga0207690_100057942 440
315 3300025932 Ga0207690_10044076 Ga0207690_100440762 440
316 3300026142 Ga0207698_10049178 Ga0207698_100491783 440
317 3300038443 Ga0395901_0001748 Ga0395901_0001748_8857_10215 440
318 3300046452 Ga0495617_001258 Ga0495617_001258_7914_9272 440
319 3300046460 Ga0495638_0000252 Ga0495638_0000252_7914_9272 440
320 3300046506 Ga0495583_0039245 Ga0495583_0039245_265_1623 440
321 3300046513 Ga0495616_0015899 Ga0495616_0015899_1050_2408 440
322 3300046520 Ga0495637_0016087 Ga0495637_0016087_1693_3051 440
323 3300046538 Ga0495609_0004319 Ga0495609_0004319_3878_5236 440
324 3300046648 Ga0495611_0000005 Ga0495611_0000005_275001_276359 440
325 3300046660 Ga0495625_0001159 Ga0495625_0001159_7914_9272 440
326 3300046691 Ga0495670_0000663 Ga0495670_0000663_7361_8719 440
327 3300046692 Ga0495671_0003260 Ga0495671_0003260_7927_9285 440
328 3300046794 Ga0495589_0000389 Ga0495589_0000389_7914_9272 440
329 3300046810 Ga0495660_0000655 Ga0495660_0000655_17430_18788 440
330 3300047446 Ga0495679_000382 Ga0495679_000382_24702_26060 440
331 3300047469 Ga0495673_0001420 Ga0495673_0001420_9823_11181 440
332 3300049459 Ga0495678_001183 Ga0495678_001183_7930_9288 440
333 3300049460 Ga0495682_0010218 Ga0495682_0010218_681_2039 440
334 3300049572 Ga0501036_0011674 Ga0501036_0011674_3772_5142 440
335 3300049581 Ga0501047_0141987 Ga0501047_0141987_783_2153 440
336 3300049822 Ga0501035_0133645 Ga0501035_0133645_138_1508 440
337 3300049823 Ga0501044_0006723 Ga0501044_0006723_5985_7355 440
338 3300053087 Ga0500643_000378 Ga0500643_000378_7933_9291 440
339 3300053103 Ga0500555_009745 Ga0500555_009745_76_1434 440
340 iso_pu_bacteria 2747842501 2748018589 440
341 3300001990 JGI24737J22298_10026793 JGI24737J22298_100267932 441
342 3300005435 Ga0070714_100001179 Ga0070714_10000117918 441
343 3300005439 Ga0070711_100074556 Ga0070711_1000745562 441
344 3300005539 Ga0068853_100002452 Ga0068853_1000024525 441
345 3300005563 Ga0068855_100227919 Ga0068855_1002279192 441
346 3300005577 Ga0068857_100020704 Ga0068857_1000207046 441
347 3300005842 Ga0068858_100013343 Ga0068858_1000133432 441
348 3300009093 Ga0105240_10007409 Ga0105240_1000740910 441
349 3300009545 Ga0105237_10000058 Ga0105237_1000005812 441
350 3300009545 Ga0105237_10075473 Ga0105237_100754733 441
351 3300009553 Ga0105249_10030150 Ga0105249_100301504 441
352 3300010375 Ga0105239_10151023 Ga0105239_101510232 441
353 3300012500 Ga0157314_1000018 Ga0157314_100001812 441
354 3300013105 Ga0157369_10199531 Ga0157369_101995312 441
355 3300025911 Ga0207654_10068909 Ga0207654_100689092 441
356 3300025913 Ga0207695_10000890 Ga0207695_1000089040 441
357 3300025914 Ga0207671_10000026 Ga0207671_10000026236 441
358 3300025929 Ga0207664_10000856 Ga0207664_1000085610 441
359 3300025949 Ga0207667_10000423 Ga0207667_1000042343 441
360 3300026041 Ga0207639_10004090 Ga0207639_100040907 441
361 3300026116 Ga0207674_10000219 Ga0207674_1000021913 441
362 3300041407 Ga0439447_003268 Ga0439447_003268_4221_5582 441
363 3300046460 Ga0495638_0000361 Ga0495638_0000361_9210_10565 441
364 3300046616 Ga0495668_0001633 Ga0495668_0001633_18122_19483 441
365 3300048916 Ga0496113_0023533 Ga0496113_0023533_1491_2846 441
366 3300048918 Ga0496115_0001176 Ga0496115_0001176_6263_7618 441
367 3300048924 Ga0496121_0042594 Ga0496121_0042594_379_1740 441
368 iso_pu_bacteria 8002869464 8002869914 441
369 3300002705 JGI25156J39149_1010869 JGI25156J39149_10108691 442
370 3300002741 JGI25157J39369_1000517 JGI25157J39369_10005179 442
371 3300003759 Ga0055525_1000170 Ga0055525_100017059 442
372 3300003760 Ga0055527_1000275 Ga0055527_100027510 442
373 3300003761 Ga0055535_1000582 Ga0055535_100058210 442
374 3300003762 Ga0055542_1000604 Ga0055542_100060410 442
375 3300003763 Ga0055529_1000932 Ga0055529_100093210 442
376 3300005616 Ga0068852_100128127 Ga0068852_1001281272 442
377 3300013104 Ga0157370_10006151 Ga0157370_100061515 442
378 3300025228 Ga0209672_100043 Ga0209672_100043225 442
379 3300025230 Ga0209563_100062 Ga0209563_100062216 442
380 3300025242 Ga0209258_100076 Ga0209258_100076225 442
381 3300025250 Ga0209026_1000533 Ga0209026_100053311 442
382 3300025254 Ga0209148_1000082 Ga0209148_1000082225 442
383 3300025256 Ga0209759_1000858 Ga0209759_100085812 442
384 3300025272 Ga0209455_1000078 Ga0209455_1000078225 442
385 3300032004 Ga0307414_10005644 Ga0307414_100056447 442
386 3300038443 Ga0395901_0083733 Ga0395901_0083733_650_2035 442
387 3300048905 Ga0496102_0063280 Ga0496102_0063280_731_2098 442
388 3300048921 Ga0496118_0013900 Ga0496118_0013900_591_1958 442
389 iso_pu_bacteria 2643221573 2643881013 442
390 iso_pu_bacteria 2643221593 2643977605 442
391 iso_pu_bacteria 2643221720 2644661783 442
392 iso_pu_bacteria 2643221728 2644699925 442
393 iso_pu_bacteria 2747842428 2747950745 442
394 iso_pu_bacteria 2842757796 2842759102 442
395 iso_pu_bacteria 2941489479 2941492496 442
396 iso_pu_bacteria 2995948881 2995953244 442
397 3300005336 Ga0070680_100002369 Ga0070680_1000023699 443
398 3300005435 Ga0070714_100000597 Ga0070714_10000059711 443
399 3300005455 Ga0070663_100003910 Ga0070663_10000391010 443
400 3300005458 Ga0070681_10000484 Ga0070681_1000048420 443
401 3300005530 Ga0070679_100001635 Ga0070679_10000163511 443
402 3300005563 Ga0068855_100008568 Ga0068855_10000856812 443
403 3300005614 Ga0068856_100013243 Ga0068856_1000132436 443
404 3300013100 Ga0157373_10007919 Ga0157373_100079197 443
405 3300013104 Ga0157370_10009419 Ga0157370_100094194 443
406 3300013307 Ga0157372_10005781 Ga0157372_1000578110 443
407 3300025226 Ga0209674_100058 Ga0209674_10005812 443
408 3300025242 Ga0209258_100514 Ga0209258_1005146 443
409 3300025253 Ga0209677_101125 Ga0209677_10112512 443
410 3300025912 Ga0207707_10000020 Ga0207707_1000002011 443
411 3300025917 Ga0207660_10000726 Ga0207660_1000072616 443
412 3300025919 Ga0207657_10095219 Ga0207657_100952193 443
413 3300025921 Ga0207652_10000037 Ga0207652_10000037114 443
414 3300025929 Ga0207664_10000131 Ga0207664_1000013111 443
415 3300025949 Ga0207667_10019918 Ga0207667_100199186 443
416 3300025949 Ga0207667_10208355 Ga0207667_102083552 443
417 3300026067 Ga0207678_10010170 Ga0207678_100101703 443
418 3300026078 Ga0207702_10001784 Ga0207702_1000178413 443
419 3300031456 Ga0307513_10156167 Ga0307513_101561671 443
420 3300044661 Ga0466975_0068618 Ga0466975_0068618_775_2139 443
421 3300044684 Ga0466966_0017909 Ga0466966_0017909_162_1526 443
422 3300044693 Ga0466961_0013367 Ga0466961_0013367_2855_4219 443
423 3300045049 Ga0466959_0000848 Ga0466959_0000848_5860_7224 443
424 3300045836 Ga0466958_0043763 Ga0466958_0043763_758_2122 443
425 3300053093 Ga0500651_0001642 Ga0500651_0001642_7348_8763 443
426 iso_pu_bacteria 8021622325 8021624981 443
427 3300003187 JGI25151J46595_10000118 JGI25151J46595_1000011880 444
428 3300003762 Ga0055542_1000580 Ga0055542_100058012 444
429 3300005329 Ga0070683_100049951 Ga0070683_1000499513 444
430 3300005338 Ga0068868_100041811 Ga0068868_1000418113 444
431 3300005535 Ga0070684_100018115 Ga0070684_1000181154 444
432 3300005539 Ga0068853_100219743 Ga0068853_1002197431 444
433 3300006237 Ga0097621_100002033 Ga0097621_10000203316 444
434 3300006358 Ga0068871_100002111 Ga0068871_1000021115 444
435 3300014969 Ga0157376_10010490 Ga0157376_100104905 444
436 3300025228 Ga0209672_101385 Ga0209672_1013855 444
437 3300025242 Ga0209258_100566 Ga0209258_10056617 444
438 3300025254 Ga0209148_1000614 Ga0209148_100061417 444
439 3300025261 Ga0209233_1018396 Ga0209233_10183962 444
440 3300025294 Ga0209025_1000200 Ga0209025_10002006 444
441 3300025924 Ga0207694_10003616 Ga0207694_1000361610 444
442 3300025944 Ga0207661_10104774 Ga0207661_101047742 444
443 3300026023 Ga0207677_10030970 Ga0207677_100309703 444
444 3300026041 Ga0207639_10122580 Ga0207639_101225802 444
445 3300026041 Ga0207639_10159322 Ga0207639_101593222 444
446 3300031727 Ga0316576_10033952 Ga0316576_100339522 444
447 3300035691 Ga0373931_0022180 Ga0373931_0022180_1557_2924 444
448 3300041413 Ga0439465_0000101 Ga0439465_0000101_13291_14739 444
449 3300045051 Ga0451576_0095186 Ga0451576_0095186_568_1965 444
450 3300049571 Ga0501034_0014956 Ga0501034_0014956_6487_7956 444
451 3300049705 Ga0501225_0009773 Ga0501225_0009773_298_1668 444
452 iso_pu_bacteria 2571042365 2572255792 444
453 iso_pu_bacteria 2643221695 2644530079 444
454 iso_pu_bacteria 2895498888 2895501822 444
455 iso_pu_bacteria 2895511927 2895517622 444
456 iso_pu_bacteria 2895522137 2895525191 444
457 iso_pu_bacteria 2895525241 2895526129 444
458 iso_pu_bacteria 8003014200 8003017400 444
459 3300003771 Ga0055526_1012150 Ga0055526_10121503 445
460 3300005543 Ga0070672_100076084 Ga0070672_1000760842 445
461 3300013296 Ga0157374_10191487 Ga0157374_101914872 445
462 3300013308 Ga0157375_10005348 Ga0157375_1000534813 445
463 3300014325 Ga0163163_10019903 Ga0163163_100199036 445
464 3300025919 Ga0207657_10081212 Ga0207657_100812123 445
465 3300025921 Ga0207652_10063335 Ga0207652_100633352 445
466 3300025940 Ga0207691_10150041 Ga0207691_101500412 445
467 3300026088 Ga0207641_10128617 Ga0207641_101286171 445
468 3300027671 Ga0209588_1008040 Ga0209588_10080404 445
469 3300031911 Ga0307412_10001279 Ga0307412_1000127911 445
470 3300037312 Ga0395899_0000410 Ga0395899_0000410_10872_12236 445
471 3300037466 Ga0395898_0000120 Ga0395898_0000120_196856_198220 445
472 3300038443 Ga0395901_0089957 Ga0395901_0089957_1450_2814 445
473 3300041406 Ga0439439_0000522 Ga0439439_0000522_1912_3309 445
474 3300042007 Ga0439449_0012818 Ga0439449_0012818_361_1734 445
475 3300042876 Ga0451577_0005118 Ga0451577_0005118_5091_6467 445
476 3300044765 Ga0466970_0003722 Ga0466970_0003722_5693_7057 445
477 3300045049 Ga0466959_0011074 Ga0466959_0011074_44_1408 445
478 3300046525 Ga0495663_0017205 Ga0495663_0017205_116_1492 445
479 3300049513 Ga0501290_001903 Ga0501290_001903_1320_2696 445
480 iso_pu_bacteria 2884411467 2884411829 445
481 iso_pu_bacteria 2928963466 2928966677 445
482 3300005347 Ga0070668_100044387 Ga0070668_1000443871 446
483 3300005547 Ga0070693_100012117 Ga0070693_1000121174 446
484 3300005548 Ga0070665_100036297 Ga0070665_1000362974 446
485 3300005841 Ga0068863_100033562 Ga0068863_1000335624 446
486 3300005844 Ga0068862_100000215 Ga0068862_10000021546 446
487 3300025914 Ga0207671_10050339 Ga0207671_100503392 446
488 3300026088 Ga0207641_10054943 Ga0207641_100549432 446
489 3300026095 Ga0207676_10018479 Ga0207676_100184793 446
490 3300027364 Ga0209967_1000263 Ga0209967_10002635 446
491 3300028380 Ga0268265_10002016 Ga0268265_100020162 446
492 3300028381 Ga0268264_10100519 Ga0268264_101005193 446
493 3300031548 Ga0307408_100026763 Ga0307408_1000267631 446
494 3300031730 Ga0307516_10013891 Ga0307516_100138917 446
495 3300031911 Ga0307412_10081026 Ga0307412_100810261 446
496 3300032004 Ga0307414_10015898 Ga0307414_100158984 446
497 3300035086 Ga0373934_0012240 Ga0373934_0012240_650_2011 446
498 3300035118 Ga0373954_0000002 Ga0373954_0000002_79013_80374 446
499 3300035724 Ga0373933_0005162 Ga0373933_0005162_630_1991 446
500 3300037068 Ga0373925_0113805 Ga0373925_0113805_221_1612 446
501 3300041494 Ga0451837_1141630 Ga0451837_1141630_145_1557 446
502 3300046455 Ga0495603_0029470 Ga0495603_0029470_501_1892 446
503 3300046460 Ga0495638_0027185 Ga0495638_0027185_1449_2882 446
504 3300046472 Ga0495580_0050301 Ga0495580_0050301_388_1779 446
505 3300046539 Ga0495621_0000071 Ga0495621_0000071_8433_9812 446
506 3300046683 Ga0495658_0004487 Ga0495658_0004487_396_1787 446
507 3300047322 Ga0495680_0119704 Ga0495680_0119704_190_1581 446
508 3300048905 Ga0496102_0069440 Ga0496102_0069440_1067_2419 446
509 3300048921 Ga0496118_0006168 Ga0496118_0006168_6054_7406 446
510 3300048924 Ga0496121_0029483 Ga0496121_0029483_393_1757 446
511 3300048926 Ga0496123_0023025 Ga0496123_0023025_2749_4128 446
512 3300049572 Ga0501036_0017902 Ga0501036_0017902_1085_2491 446
513 3300049573 Ga0501037_0006068 Ga0501037_0006068_779_2185 446
514 3300049574 Ga0501038_0032742 Ga0501038_0032742_1510_2895 446
515 3300049579 Ga0501043_0061643 Ga0501043_0061643_954_2360 446
516 3300049589 Ga0501073_0001609 Ga0501073_0001609_4689_6056 446
517 3300049593 Ga0501077_0005147 Ga0501077_0005147_1901_3268 446
518 3300049823 Ga0501044_0105675 Ga0501044_0105675_767_2173 446
519 3300054114 Ga0501084_0027347 Ga0501084_0027347_894_2261 446
520 iso_pu_bacteria 2593339238 2595448975 446
521 iso_pu_bacteria 2593339239 2595452868 446
522 iso_pu_bacteria 2687453130 2687581692 446
523 iso_pu_bacteria 2718218334 2721029037 446
524 iso_pu_bacteria 2734482264 2735835383 446
525 iso_pu_bacteria 2738543009 2739229505 446
526 iso_pu_bacteria 2818991440 2819565118 446
527 iso_pu_bacteria 2842914999 2842917033 446
528 iso_pu_bacteria 2842918807 2842922539 446
529 iso_pu_bacteria 2884338543 2884342220 446
530 iso_pu_bacteria 2904463128 2904465354 446
531 iso_pu_bacteria 2919085039 2919087891 446
532 iso_pu_bacteria 2941471342 2941474676 446
533 iso_pu_bacteria 2953994433 2953996997 446
534 3300006914 Ga0075436_100014805 Ga0075436_1000148055 447
535 3300007076 Ga0075435_100002470 Ga0075435_10000247014 447
536 3300013100 Ga0157373_10034313 Ga0157373_100343133 447
537 3300031730 Ga0307516_10036068 Ga0307516_100360682 447
538 3300037418 Ga0395900_0158398 Ga0395900_0158398_189_1619 447
539 3300037471 Ga0395905_0007372 Ga0395905_0007372_2361_3791 447
540 3300041512 Ga0451853_3004224 Ga0451853_3004224_594_1949 447
541 3300046691 Ga0495670_0055490 Ga0495670_0055490_97_1527 447
542 3300047318 Ga0495636_0004874 Ga0495636_0004874_3498_4928 447
543 3300047447 Ga0495685_012325 Ga0495685_012325_1116_2564 447
544 3300005293 Ga0065715_10027231 Ga0065715_100272312 448
545 3300005331 Ga0070670_100103226 Ga0070670_1001032262 448
546 3300005354 Ga0070675_100121958 Ga0070675_1001219582 448
547 3300005367 Ga0070667_100000049 Ga0070667_1000000495 448
548 3300005367 Ga0070667_100000184 Ga0070667_1000001846 448
549 3300005539 Ga0068853_100113846 Ga0068853_1001138462 448
550 3300005548 Ga0070665_100052083 Ga0070665_1000520835 448
551 3300005617 Ga0068859_100198559 Ga0068859_1001985592 448
552 3300005937 Ga0081455_10172430 Ga0081455_101724301 448
553 3300006931 Ga0097620_100198558 Ga0097620_1001985582 448
554 3300009092 Ga0105250_10046720 Ga0105250_100467202 448
555 3300009098 Ga0105245_10054959 Ga0105245_100549594 448
556 3300009101 Ga0105247_10012255 Ga0105247_100122555 448
557 3300009177 Ga0105248_10000120 Ga0105248_1000012011 448
558 3300014325 Ga0163163_10005861 Ga0163163_100058615 448
559 3300025292 Ga0209676_1002916 Ga0209676_10029162 448
560 3300025900 Ga0207710_10006428 Ga0207710_100064285 448
561 3300025938 Ga0207704_10007422 Ga0207704_100074224 448
562 3300025941 Ga0207711_10001269 Ga0207711_1000126913 448
563 3300025941 Ga0207711_10189850 Ga0207711_101898502 448
564 3300025986 Ga0207658_10000033 Ga0207658_10000033145 448
565 3300025986 Ga0207658_10000591 Ga0207658_1000059129 448
566 3300026116 Ga0207674_10032691 Ga0207674_100326914 448
567 3300031727 Ga0316576_10010827 Ga0316576_100108275 448
568 3300035398 Ga0316574_0088060 Ga0316574_0088060_531_1898 448
569 3300041413 Ga0439465_0002026 Ga0439465_0002026_4379_5821 448
570 3300044656 Ga0466969_0016507 Ga0466969_0016507_1275_2768 448
571 3300044684 Ga0466966_0024936 Ga0466966_0024936_1689_3182 448
572 3300044719 Ga0466971_0002114 Ga0466971_0002114_4529_6022 448
573 3300044735 Ga0466968_0004722 Ga0466968_0004722_2359_3852 448
574 3300044765 Ga0466970_0006542 Ga0466970_0006542_3121_4614 448
575 3300047318 Ga0495636_0009636 Ga0495636_0009636_1562_2995 448
576 3300048911 Ga0496108_0010770 Ga0496108_0010770_22_1455 448
577 3300048920 Ga0496117_0018758 Ga0496117_0018758_3783_5147 448
578 3300048921 Ga0496118_0002146 Ga0496118_0002146_15803_17167 448
579 3300060353 Ga0501082_0000107 Ga0501082_0000107_41018_42376 448
580 3300002705 JGI25156J39149_1000651 JGI25156J39149_100065112 449
581 3300002737 JGI25162J39368_1000249 JGI25162J39368_10002497 449
582 3300002741 JGI25157J39369_1000663 JGI25157J39369_100066312 449
583 3300002772 JGI25164J39214_1000004 JGI25164J39214_100000412 449
584 3300003214 JGI25165J46597_1000464 JGI25165J46597_100046426 449
585 3300003578 Ga0006562J51391_1039498 Ga0006562J51391_10394987 449
586 3300003578 Ga0006562J51391_1039500 Ga0006562J51391_10395009 449
587 3300003760 Ga0055527_1000331 Ga0055527_100033110 449
588 3300003761 Ga0055535_1000594 Ga0055535_100059415 449
589 3300003761 Ga0055535_1000715 Ga0055535_100071510 449
590 3300003762 Ga0055542_1000623 Ga0055542_100062315 449
591 3300003762 Ga0055542_1000741 Ga0055542_100074110 449
592 3300003763 Ga0055529_1000574 Ga0055529_100057412 449
593 3300003763 Ga0055529_1000648 Ga0055529_100064812 449
594 3300005262 Ga0065165_1001275 Ga0065165_10012757 449
595 3300005337 Ga0070682_100009517 Ga0070682_1000095171 449
596 3300005455 Ga0070663_100084745 Ga0070663_1000847452 449
597 3300005458 Ga0070681_10142302 Ga0070681_101423022 449
598 3300005530 Ga0070679_100070134 Ga0070679_1000701343 449
599 3300005614 Ga0068856_100095164 Ga0068856_1000951643 449
600 3300013102 Ga0157371_10010375 Ga0157371_100103752 449
601 3300015687 Ga0183368_1007 Ga0183368_100713 449
602 3300025228 Ga0209672_100061 Ga0209672_10006112 449
603 3300025228 Ga0209672_100659 Ga0209672_1006595 449
604 3300025231 Ga0207427_100031 Ga0207427_100031292 449
605 3300025233 Ga0209437_100061 Ga0209437_10006112 449
606 3300025242 Ga0209258_100054 Ga0209258_10005412 449
607 3300025242 Ga0209258_100097 Ga0209258_10009712 449
608 3300025250 Ga0209026_1000337 Ga0209026_10003376 449
609 3300025254 Ga0209148_1000063 Ga0209148_100006312 449
610 3300025254 Ga0209148_1000066 Ga0209148_100006612 449
611 3300025256 Ga0209759_1000730 Ga0209759_100073015 449
612 3300025258 Ga0209129_1002368 Ga0209129_10023681 449
613 3300025261 Ga0209233_1000076 Ga0209233_1000076292 449
614 3300025272 Ga0209455_1000096 Ga0209455_100009612 449
615 3300025272 Ga0209455_1000101 Ga0209455_100010112 449
616 3300025297 Ga0209758_1001065 Ga0209758_100106531 449
617 3300025912 Ga0207707_10114702 Ga0207707_101147022 449
618 3300025913 Ga0207695_10024064 Ga0207695_100240642 449
619 3300025932 Ga0207690_10019367 Ga0207690_100193671 449
620 3300026067 Ga0207678_10105410 Ga0207678_101054102 449
621 3300031616 Ga0307508_10009313 Ga0307508_100093132 449
622 3300037312 Ga0395899_0029129 Ga0395899_0029129_248_1603 449
623 3300037418 Ga0395900_0000206 Ga0395900_0000206_80406_81761 449
624 3300037466 Ga0395898_0000013 Ga0395898_0000013_446365_447720 449
625 3300038443 Ga0395901_0125671 Ga0395901_0125671_60_1415 449
626 3300038443 Ga0395901_0170860 Ga0395901_0170860_383_1738 449
627 3300044672 Ga0466982_0000017 Ga0466982_0000017_13212_14582 449
628 3300044684 Ga0466966_0019558 Ga0466966_0019558_2531_3901 449
629 3300044693 Ga0466961_0001089 Ga0466961_0001089_9331_10686 449
630 3300044719 Ga0466971_0012172 Ga0466971_0012172_2378_3748 449
631 3300044735 Ga0466968_0004145 Ga0466968_0004145_3343_4713 449
632 3300044765 Ga0466970_0029488 Ga0466970_0029488_101_1471 449
633 3300044901 Ga0466960_0004458 Ga0466960_0004458_1942_3312 449
634 3300046460 Ga0495638_0000949 Ga0495638_0000949_9315_10670 449
635 3300046471 Ga0495650_0001191 Ga0495650_0001191_16858_18213 449
636 3300048922 Ga0496119_0004544 Ga0496119_0004544_3047_4402 449
637 3300048923 Ga0496120_0002936 Ga0496120_0002936_5342_6697 449
638 3300048924 Ga0496121_0000785 Ga0496121_0000785_9915_11270 449
639 3300048924 Ga0496121_0079696 Ga0496121_0079696_771_2126 449
640 3300048928 Ga0496125_0001643 Ga0496125_0001643_11069_12430 449
641 3300048929 Ga0496126_0022143 Ga0496126_0022143_3608_4963 449
642 3300049568 Ga0501031_0031363 Ga0501031_0031363_1012_2367 449
643 3300049568 Ga0501031_0078119 Ga0501031_0078119_36_1418 449
644 3300049574 Ga0501038_0026871 Ga0501038_0026871_142_1524 449
645 3300049580 Ga0501046_0125753 Ga0501046_0125753_396_1751 449
646 3300049581 Ga0501047_0022991 Ga0501047_0022991_711_2066 449
647 3300049589 Ga0501073_0085774 Ga0501073_0085774_95_1477 449
648 3300049822 Ga0501035_0133652 Ga0501035_0133652_109_1464 449
649 3300049823 Ga0501044_0031765 Ga0501044_0031765_3691_5046 449
650 3300061719 Ga0466962_0002150 Ga0466962_0002150_4744_6114 449
651 3300005335 Ga0070666_10000372 Ga0070666_100003725 450
652 3300005455 Ga0070663_100003576 Ga0070663_1000035768 450
653 3300005563 Ga0068855_100197430 Ga0068855_1001974302 450
654 3300005614 Ga0068856_100000088 Ga0068856_10000008851 450
655 3300005834 Ga0068851_10013049 Ga0068851_100130494 450
656 3300005842 Ga0068858_100000586 Ga0068858_10000058630 450
657 3300006237 Ga0097621_100046745 Ga0097621_1000467453 450
658 3300009093 Ga0105240_10007835 Ga0105240_100078359 450
659 3300009551 Ga0105238_10012584 Ga0105238_100125849 450
660 3300009551 Ga0105238_10015508 Ga0105238_100155084 450
661 3300013104 Ga0157370_10007072 Ga0157370_100070729 450
662 3300013307 Ga0157372_10006482 Ga0157372_1000648213 450
663 3300025261 Ga0209233_1001928 Ga0209233_10019285 450
664 3300025321 Ga0207656_10002756 Ga0207656_100027561 450
665 3300025903 Ga0207680_10007412 Ga0207680_100074124 450
666 3300025904 Ga0207647_10000269 Ga0207647_1000026915 450
667 3300025911 Ga0207654_10030041 Ga0207654_100300412 450
668 3300025913 Ga0207695_10000040 Ga0207695_10000040143 450
669 3300025913 Ga0207695_10022149 Ga0207695_100221493 450
670 3300025914 Ga0207671_10152475 Ga0207671_101524752 450
671 3300025914 Ga0207671_10204521 Ga0207671_102045212 450
672 3300025924 Ga0207694_10002190 Ga0207694_1000219010 450
673 3300025933 Ga0207706_10070736 Ga0207706_100707363 450
674 3300025949 Ga0207667_10060694 Ga0207667_100606944 450
675 3300025961 Ga0207712_10000364 Ga0207712_1000036417 450
676 3300025986 Ga0207658_10068761 Ga0207658_100687612 450
677 3300026035 Ga0207703_10000472 Ga0207703_1000047210 450
678 3300026041 Ga0207639_10002309 Ga0207639_1000230910 450
679 3300026067 Ga0207678_10007011 Ga0207678_100070114 450
680 3300026078 Ga0207702_10000649 Ga0207702_100006495 450
681 3300026116 Ga0207674_10255160 Ga0207674_102551601 450
682 3300028379 Ga0268266_10000008 Ga0268266_10000008235 450
683 3300037418 Ga0395900_0000656 Ga0395900_0000656_7748_9190 450
684 3300042006 Ga0439432_009273 Ga0439432_009273_568_2016 450
685 3300044684 Ga0466966_0106706 Ga0466966_0106706_224_1588 450
686 3300046471 Ga0495650_0001431 Ga0495650_0001431_8592_9950 450
687 3300046492 Ga0495585_0001595 Ga0495585_0001595_5664_7022 450
688 3300046507 Ga0495606_0003479 Ga0495606_0003479_7933_9291 450
689 3300046513 Ga0495616_0000831 Ga0495616_0000831_8033_9391 450
690 3300046515 Ga0495620_0004160 Ga0495620_0004160_1072_2430 450
691 3300046519 Ga0495632_0003976 Ga0495632_0003976_1478_2836 450
692 3300046524 Ga0495648_0003467 Ga0495648_0003467_6656_8014 450
693 3300046648 Ga0495611_0000450 Ga0495611_0000450_15047_16405 450
694 3300046692 Ga0495671_0021078 Ga0495671_0021078_213_1598 450
695 3300047323 Ga0495683_0003102 Ga0495683_0003102_2793_4151 450
696 3300047469 Ga0495673_0000685 Ga0495673_0000685_26957_28315 450
697 3300047472 Ga0495686_0012650 Ga0495686_0012650_1395_2753 450
698 3300048924 Ga0496121_0008379 Ga0496121_0008379_3020_4378 450
699 3300005614 Ga0068856_100022139 Ga0068856_1000221396 451
700 3300031665 Ga0316575_10020555 Ga0316575_100205552 451
701 3300002737 JGI25162J39368_1001238 JGI25162J39368_10012387 452
702 3300002737 JGI25162J39368_1001419 JGI25162J39368_100141911 452
703 3300002772 JGI25164J39214_1000678 JGI25164J39214_10006788 452
704 3300002772 JGI25164J39214_1000780 JGI25164J39214_10007803 452
705 3300003214 JGI25165J46597_1001411 JGI25165J46597_100141111 452
706 3300003214 JGI25165J46597_1004393 JGI25165J46597_10043933 452
707 3300005336 Ga0070680_100010560 Ga0070680_1000105602 452
708 3300005458 Ga0070681_10016654 Ga0070681_100166543 452
709 3300005530 Ga0070679_100015323 Ga0070679_1000153233 452
710 3300025226 Ga0209674_103964 Ga0209674_1039643 452
711 3300025231 Ga0207427_100258 Ga0207427_10025811 452
712 3300025231 Ga0207427_100275 Ga0207427_10027524 452
713 3300025233 Ga0209437_100121 Ga0209437_1001218 452
714 3300025233 Ga0209437_100132 Ga0209437_100132151 452
715 3300025261 Ga0209233_1000112 Ga0209233_100011212 452
716 3300025261 Ga0209233_1000114 Ga0209233_1000114204 452
717 3300025912 Ga0207707_10012604 Ga0207707_100126043 452
718 3300025917 Ga0207660_10036427 Ga0207660_100364273 452
719 3300025921 Ga0207652_10012358 Ga0207652_100123586 452
720 3300048925 Ga0496122_0000710 Ga0496122_0000710_59550_61013 452
721 3300048926 Ga0496123_0000104 Ga0496123_0000104_107211_108674 452
722 3300005543 Ga0070672_100029332 Ga0070672_1000293324 453
723 3300025919 Ga0207657_10008750 Ga0207657_1000875011 453
724 3300025932 Ga0207690_10000308 Ga0207690_1000030817 453
725 3300025940 Ga0207691_10022148 Ga0207691_100221483 453
726 3300025940 Ga0207691_10180669 Ga0207691_101806691 453
727 3300025942 Ga0207689_10018945 Ga0207689_100189451 453
728 3300025986 Ga0207658_10063234 Ga0207658_100632342 453
729 3300025986 Ga0207658_10139797 Ga0207658_101397971 453
730 3300026023 Ga0207677_10104373 Ga0207677_101043732 453
731 3300026089 Ga0207648_10018369 Ga0207648_100183694 453
732 3300041512 Ga0451853_0219664 Ga0451853_0219664_1973_3427 453
733 3300047472 Ga0495686_0006806 Ga0495686_0006806_1955_3403 453
734 3300053139 Ga0500568_0006147 Ga0500568_0006147_3322_4701 453
735 3300049569 Ga0501032_0005214 Ga0501032_0005214_5818_7209 454
736 3300049570 Ga0501033_0001723 Ga0501033_0001723_4059_5450 454
737 3300049571 Ga0501034_0092426 Ga0501034_0092426_1363_2754 454
738 3300049574 Ga0501038_0006223 Ga0501038_0006223_3827_5218 454
739 3300049575 Ga0501039_0006491 Ga0501039_0006491_7075_8466 454
740 3300049579 Ga0501043_0201961 Ga0501043_0201961_51_1442 454
741 3300049580 Ga0501046_0003875 Ga0501046_0003875_10063_11454 454
742 3300049581 Ga0501047_0003794 Ga0501047_0003794_156_1547 454
743 3300049742 Ga0501080_0007181 Ga0501080_0007181_8586_9977 454
744 3300049744 Ga0501083_0130064 Ga0501083_0130064_66_1457 454
745 3300049822 Ga0501035_0089245 Ga0501035_0089245_185_1663 454
746 3300049823 Ga0501044_0033147 Ga0501044_0033147_3546_4937 454
747 3300013296 Ga0157374_10122742 Ga0157374_101227422 455
748 3300025937 Ga0207669_10046335 Ga0207669_100463353 455
749 3300025949 Ga0207667_10014711 Ga0207667_100147113 455
750 3300026121 Ga0207683_10071592 Ga0207683_100715924 455
751 3300053087 Ga0500643_001849 Ga0500643_001849_3598_5064 455
752 3300053120 Ga0500597_000153 Ga0500597_000153_7208_8674 455
753 3300006237 Ga0097621_100023445 Ga0097621_1000234454 456
754 3300013297 Ga0157378_10000303 Ga0157378_1000030327 456
755 3300014969 Ga0157376_10003027 Ga0157376_100030274 456
756 3300049581 Ga0501047_0005660 Ga0501047_0005660_306_1766 456
757 3300049583 Ga0501067_0047025 Ga0501067_0047025_247_1698 456
758 3300049587 Ga0501071_0010240 Ga0501071_0010240_3974_5434 456
759 3300049588 Ga0501072_0014884 Ga0501072_0014884_4122_5573 456
760 3300049744 Ga0501083_0010617 Ga0501083_0010617_4323_5783 456
761 3300054114 Ga0501084_0127209 Ga0501084_0127209_601_2052 456
762 3300005455 Ga0070663_100058798 Ga0070663_1000587982 457
763 3300005546 Ga0070696_100048471 Ga0070696_1000484713 457
764 3300005547 Ga0070693_100003242 Ga0070693_1000032421 457
765 3300009093 Ga0105240_10008240 Ga0105240_100082405 457
766 3300009545 Ga0105237_10029693 Ga0105237_100296933 457
767 3300009551 Ga0105238_10139335 Ga0105238_101393352 457
768 3300013105 Ga0157369_10086529 Ga0157369_100865292 457
769 3300025250 Ga0209026_1000147 Ga0209026_100014748 457
770 3300025256 Ga0209759_1001982 Ga0209759_10019826 457
771 3300025272 Ga0209455_1000267 Ga0209455_100026745 457
772 3300025913 Ga0207695_10001888 Ga0207695_100018882 457
773 3300025914 Ga0207671_10000260 Ga0207671_1000026068 457
774 3300049571 Ga0501034_0007682 Ga0501034_0007682_7209_8705 457
775 3300049823 Ga0501044_0004108 Ga0501044_0004108_11242_12699 457
776 iso_pu_bacteria 2537561836 2538833242 457
777 iso_pu_bacteria 2643221562 2643832022 457
778 iso_pu_bacteria 2643221577 2643896342 457
779 iso_pu_bacteria 2643221685 2644478897 457
780 iso_pu_bacteria 2895395659 2895398360 457
781 iso_pu_bacteria 2939611941 2939614044 457
782 3300005337 Ga0070682_100033288 Ga0070682_1000332883 458
783 3300005456 Ga0070678_100139481 Ga0070678_1001394812 458
784 3300005539 Ga0068853_100004880 Ga0068853_1000048805 458
785 3300005548 Ga0070665_100023034 Ga0070665_1000230341 458
786 3300005563 Ga0068855_100006907 Ga0068855_1000069076 458
787 3300009553 Ga0105249_10001801 Ga0105249_1000180115 458
788 3300010375 Ga0105239_10047706 Ga0105239_100477064 458
789 3300014325 Ga0163163_10003314 Ga0163163_1000331410 458
790 3300025949 Ga0207667_10012632 Ga0207667_100126325 458
791 3300025961 Ga0207712_10000305 Ga0207712_1000030540 458
792 3300026088 Ga0207641_10068127 Ga0207641_100681273 458
793 3300026121 Ga0207683_10243207 Ga0207683_102432071 458
794 3300028379 Ga0268266_10025677 Ga0268266_100256773 458
795 3300049581 Ga0501047_0013105 Ga0501047_0013105_4749_6164 460
796 3300049585 Ga0501069_0004048 Ga0501069_0004048_1532_2947 460
797 3300049586 Ga0501070_0003552 Ga0501070_0003552_10992_12407 460
798 3300049589 Ga0501073_0065864 Ga0501073_0065864_951_2366 460
799 3300049590 Ga0501074_0105380 Ga0501074_0105380_165_1580 460
800 3300049822 Ga0501035_0043573 Ga0501035_0043573_2073_3488 460
801 3300049823 Ga0501044_0009324 Ga0501044_0009324_4507_5922 460
802 3300053079 Ga0500610_0007052 Ga0500610_0007052_2796_4256 462
803 3300005455 Ga0070663_100000042 Ga0070663_10000004238 463
804 3300025914 Ga0207671_10001294 Ga0207671_1000129415 463
805 3300026041 Ga0207639_10020657 Ga0207639_100206573 463
806 3300026067 Ga0207678_10000566 Ga0207678_1000056616 463
807 3300048926 Ga0496123_0000323 Ga0496123_0000323_40306_41850 463
808 3300005336 Ga0070680_100005018 Ga0070680_1000050183 464
809 3300005341 Ga0070691_10015006 Ga0070691_100150063 464
810 3300005344 Ga0070661_100010219 Ga0070661_1000102196 464
811 3300005345 Ga0070692_10000887 Ga0070692_1000088712 464
812 3300005616 Ga0068852_100040954 Ga0068852_1000409545 464
813 3300013105 Ga0157369_10031979 Ga0157369_100319795 464
814 3300013307 Ga0157372_10024666 Ga0157372_100246663 464
815 3300025909 Ga0207705_10000400 Ga0207705_1000040012 464
816 3300025913 Ga0207695_10001663 Ga0207695_1000166321 464
817 3300025917 Ga0207660_10005901 Ga0207660_100059015 464
818 3300025932 Ga0207690_10000657 Ga0207690_1000065716 464
819 3300025949 Ga0207667_10000633 Ga0207667_1000063312 464
820 3300025981 Ga0207640_10001068 Ga0207640_1000106810 464
821 3300026078 Ga0207702_10004508 Ga0207702_100045088 464
822 3300026142 Ga0207698_10000844 Ga0207698_100008448 464
823 3300049585 Ga0501069_0000559 Ga0501069_0000559_12366_13862 464
824 3300049586 Ga0501070_0112433 Ga0501070_0112433_38_1465 464
825 3300049593 Ga0501077_0024988 Ga0501077_0024988_1389_2816 464
826 3300001915 JGI24741J21665_1003916 JGI24741J21665_10039164 468
827 3300001915 JGI24741J21665_1005429 JGI24741J21665_10054292 468
828 3300001979 JGI24740J21852_10007790 JGI24740J21852_100077902 468
829 3300005329 Ga0070683_100052424 Ga0070683_1000524242 468
830 3300005336 Ga0070680_100007340 Ga0070680_1000073405 468
831 3300005336 Ga0070680_100157181 Ga0070680_1001571812 468
832 3300005339 Ga0070660_100022372 Ga0070660_1000223725 468
833 3300005344 Ga0070661_100010825 Ga0070661_1000108252 468
834 3300005458 Ga0070681_10000534 Ga0070681_1000053411 468
835 3300005530 Ga0070679_100000571 Ga0070679_10000057120 468
836 3300005535 Ga0070684_100051279 Ga0070684_1000512792 468
837 3300005535 Ga0070684_100144571 Ga0070684_1001445712 468
838 3300005539 Ga0068853_100034404 Ga0068853_1000344045 468
839 3300005546 Ga0070696_100012446 Ga0070696_1000124466 468
840 3300005564 Ga0070664_100034110 Ga0070664_1000341104 468
841 3300005614 Ga0068856_100065594 Ga0068856_1000655944 468
842 3300005616 Ga0068852_100063910 Ga0068852_1000639103 468
843 3300005616 Ga0068852_100130544 Ga0068852_1001305442 468
844 3300009093 Ga0105240_10063977 Ga0105240_100639773 468
845 3300009093 Ga0105240_10200362 Ga0105240_102003622 468
846 3300013100 Ga0157373_10019278 Ga0157373_100192785 468
847 3300013307 Ga0157372_10193875 Ga0157372_101938753 468
848 3300020081 Ga0206354_10073408 Ga0206354_100734083 468
849 3300025904 Ga0207647_10002143 Ga0207647_100021437 468
850 3300025904 Ga0207647_10011433 Ga0207647_100114336 468
851 3300025909 Ga0207705_10004563 Ga0207705_100045638 468
852 3300025909 Ga0207705_10013247 Ga0207705_100132472 468
853 3300025912 Ga0207707_10003170 Ga0207707_100031708 468
854 3300025912 Ga0207707_10007883 Ga0207707_100078832 468
855 3300025912 Ga0207707_10056115 Ga0207707_100561154 468
856 3300025913 Ga0207695_10049016 Ga0207695_100490163 468
857 3300025913 Ga0207695_10084315 Ga0207695_100843153 468
858 3300025913 Ga0207695_10120392 Ga0207695_101203923 468
859 3300025917 Ga0207660_10000950 Ga0207660_1000095011 468
860 3300025917 Ga0207660_10006258 Ga0207660_100062582 468
861 3300025917 Ga0207660_10008193 Ga0207660_100081933 468
862 3300025919 Ga0207657_10037960 Ga0207657_100379602 468
863 3300025919 Ga0207657_10044281 Ga0207657_100442815 468
864 3300025920 Ga0207649_10005191 Ga0207649_100051913 468
865 3300025920 Ga0207649_10016814 Ga0207649_100168146 468
866 3300025921 Ga0207652_10000753 Ga0207652_1000075319 468
867 3300025921 Ga0207652_10002384 Ga0207652_1000238415 468
868 3300025921 Ga0207652_10007939 Ga0207652_1000793912 468
869 3300025924 Ga0207694_10072050 Ga0207694_100720503 468
870 3300025932 Ga0207690_10059895 Ga0207690_100598953 468
871 3300025944 Ga0207661_10004484 Ga0207661_100044848 468
872 3300025949 Ga0207667_10016754 Ga0207667_1001675412 468
873 3300025949 Ga0207667_10051227 Ga0207667_100512275 468
874 3300025981 Ga0207640_10001821 Ga0207640_100018212 468
875 3300026041 Ga0207639_10012820 Ga0207639_100128202 468
876 3300026067 Ga0207678_10009626 Ga0207678_100096267 468
877 3300026067 Ga0207678_10017588 Ga0207678_100175888 468
878 3300026067 Ga0207678_10018276 Ga0207678_100182768 468
879 3300026078 Ga0207702_10003564 Ga0207702_100035647 468
880 3300026116 Ga0207674_10015364 Ga0207674_1001536412 468
881 3300026116 Ga0207674_10021372 Ga0207674_100213727 468
882 3300026142 Ga0207698_10007097 Ga0207698_100070973 468
883 3300038443 Ga0395901_0061777 Ga0395901_0061777_90_1613 468
884 3300049581 Ga0501047_0020505 Ga0501047_0020505_4212_5714 468
885 3300049586 Ga0501070_0001793 Ga0501070_0001793_4230_5732 468
886 3300049586 Ga0501070_0011009 Ga0501070_0011009_1780_3306 468
887 3300049586 Ga0501070_0113314 Ga0501070_0113314_418_1851 468
888 3300049590 Ga0501074_0078236 Ga0501074_0078236_52_1554 468
889 3300049742 Ga0501080_0008242 Ga0501080_0008242_4316_5818 468
890 3300049822 Ga0501035_0021264 Ga0501035_0021264_4221_5723 468
891 3300049823 Ga0501044_0020832 Ga0501044_0020832_3943_5445 468

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01225

Mur_ligase

Mur ligase family, catalytic domain

26

127

0.97

PF02875

Mur_ligase_C

Mur ligase, glutamate ligase domain

377

499

0.88

PF08245

Mur_ligase_M

Mur ligase middle domain

208

355

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mvn-assembly1.cif.gz_A crystal structure of a domain from a putative udp-n-acetylmuramate:l-alanyl-gamma-d-glutamyl-medo-diaminopimelate ligase from haemophilus ducreyi 35000hp 0.9586 331 465
3mvn-assembly1.cif.gz_A crystal structure of a domain from a putative udp-n-acetylmuramate:l-alanyl-gamma-d-glutamyl-medo-diaminopimelate ligase from haemophilus ducreyi 35000hp 0.9435 331 465
5x6r-assembly1.cif.gz_A crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 0.9368 2 31
3eag-assembly1.cif.gz_B the crystal structure of udp-n-acetylmuramate:l-alanyl-gamma-d-glutamyl-meso-diaminopimelate ligase (mpl) from neisseria meningitides 0.9249 2 330
6cau-assembly1.cif.gz_A udp-n-acetylmuramate--alanine ligase from acinetobacter baumannii ab5075-uw with amppnp 0.9194 2 328
ID Description Score Start End Superfamily
af_P37773_314_451_3.90.190.20 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.9769 331 465 3.90.190.20
3hn7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9622 1 90 3.40.50.720
3mvnA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.9546 331 465 3.90.190.20
3hn7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9513 1 90 3.40.50.720
af_P37773_314_451_3.90.190.20 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.9493 331 465 3.90.190.20
ID Description Score Start End GO Terms
AF-A0A855HIA3-F1-model_v4 deleted 1.001 1 104
AF-A0A3C0GYS5-F1-model_v4 deleted 0.9868 1 74
AF-A0A2X5SN44-F1-model_v4 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (EC 6.3.2.-) 0.9864 1 90 GO:0009058
GO:0016881
AF-A0A3G9ISN1-F1-model_v4 deleted 0.9858 1 467
AF-M5CQ06-F1-model_v4 deleted 0.9851 2 468

Feature Viewer

pLDDT pTM Quality
91.02 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map