F484857
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 891 | 388 | 847 | 456 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10000303|Ga0157378_1000030327 |
| Length | 519 |
| Sequence | MGDRGIRACRRRGQQWRGSLTGLAMKLHILGICGTFMGGVAALARELGETVEGSDANIYPPMSTQLEQLGIALKSGYRAEHLQPPPDLVIVGNALSRGNAAIEHMLDARLAYVSGPQWIGERVLATRRVFAVAGTHGKTTTTAMLTWILDACGRAPGFLIGGVPENFGVSARLGGATTSPAGGPSESASEVPPSSGAARHLLPPAGEGRFAPPAAADFVIEADEYDTAFFDKRSKFVHYRPTFAILNNLEYDHADIFPDVAAIQRQFHHLVRTVPANGRLIVNAEDERLAEVLAMGAWTPVTTFGIERGEWRARLLVADGSRFVVSRAGTELGEVRWNLLGRHNVMNALAALAAAEAGGADVARGMAALGDFASAKRRLELIGERGGIRVYDDFAHHPTAIATTLAGLRARVGAARILVGMEPRSNSMRLGAHADELAPSLRDADAVVFLQRPGLAWDAERVTGALGGRGRTAPSVDELIGALRRMVRSGDLVVFMSNGGFEDAPRRFVAALGSPTASE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 3 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 4 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 5 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 6 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 7 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 8 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 9 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 10 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 11 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 12 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 13 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 14 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 15 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 16 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 17 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 18 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 19 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 20 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 21 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 22 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 23 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 24 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 25 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 26 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 27 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 28 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 29 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 30 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 31 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 32 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 33 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 34 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 35 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 36 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 37 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 38 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 39 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 40 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 41 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 42 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 43 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 44 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 45 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 46 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 47 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 48 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 49 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 50 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 51 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 52 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 53 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 54 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 55 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 56 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 57 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 58 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 62 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 64 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 65 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 66 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 67 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 68 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 69 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 75 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 94 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 100 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 102 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 103 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 104 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 105 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 106 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 107 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 108 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 109 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 110 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 111 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 112 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 113 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 114 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 122 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 134 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 149 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 150 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 162 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 166 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 231 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 232 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 233 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 234 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 235 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 236 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 237 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 238 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 242 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 245 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 248 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 249 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 250 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 251 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 252 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 253 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 254 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 255 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 256 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 257 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 261 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 262 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 263 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 264 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 265 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 266 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 267 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 268 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 269 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 270 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 271 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 272 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 273 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 274 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 275 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 276 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 277 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 278 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 279 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 280 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 281 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 282 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 283 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 326 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 327 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 328 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 329 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 331 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 332 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 333 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 334 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 335 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 336 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 337 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 338 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 339 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 340 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 341 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 346 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 367 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 373 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 374 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 376 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 377 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 378 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 379 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 380 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 381 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 382 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 383 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 386 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 387 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 388 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.61 |
| Metatranscriptomes | 0.45 |
| Isolates | 4.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.8 |
| Nodule | 0 |
| Rhizoplane | 2.24 |
| Rhizosphere | 72.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1003916 | 3300001915 | Bacteria | 3420 |
| 2 | JGI24741J21665_1005429 | 3300001915 | Bacteria | 2667 |
| 3 | JGI24740J21852_10007790 | 3300001979 | Bacteria | 4326 |
| 4 | JGI24737J22298_10026793 | 3300001990 | Bacteria | 1819 |
| 5 | JGI24735J21928_10000400 | 3300002067 | Bacteria | 15108 |
| 6 | JGI25156J39149_1000651 | 3300002705 | Bacteria | 18978 |
| 7 | JGI25156J39149_1010869 | 3300002705 | Bacteria | 2104 |
| 8 | JGI25162J39368_1000239 | 3300002737 | Bacteria | 54751 |
| 9 | JGI25162J39368_1000249 | 3300002737 | Bacteria | 53308 |
| 10 | JGI25162J39368_1001238 | 3300002737 | Bacteria | 14708 |
| 11 | JGI25162J39368_1001419 | 3300002737 | Bacteria | 13022 |
| 12 | JGI25157J39369_1000517 | 3300002741 | Bacteria | 23601 |
| 13 | JGI25157J39369_1000663 | 3300002741 | Bacteria | 19030 |
| 14 | JGI25157J39369_1000720 | 3300002741 | Bacteria | 17683 |
| 15 | JGI25157J39369_1000892 | 3300002741 | Bacteria | 14365 |
| 16 | JGI25163J39215_1001261 | 3300002771 | Bacteria | 4605 |
| 17 | JGI25164J39214_1000004 | 3300002772 | Bacteria | 350814 |
| 18 | JGI25164J39214_1000200 | 3300002772 | Bacteria | 50877 |
| 19 | JGI25164J39214_1000605 | 3300002772 | Bacteria | 15553 |
| 20 | JGI25164J39214_1000678 | 3300002772 | Bacteria | 13611 |
| 21 | JGI25164J39214_1000780 | 3300002772 | Bacteria | 11529 |
| 22 | JGI25151J46595_10000118 | 3300003187 | Bacteria | 106502 |
| 23 | JGI25151J46595_10026595 | 3300003187 | Bacteria | 2332 |
| 24 | JGI25165J46597_1000319 | 3300003214 | Bacteria | 57885 |
| 25 | JGI25165J46597_1000464 | 3300003214 | Bacteria | 40116 |
| 26 | JGI25165J46597_1001411 | 3300003214 | Bacteria | 13022 |
| 27 | JGI25165J46597_1004393 | 3300003214 | Bacteria | 3050 |
| 28 | Ga0006562J51391_1035852 | 3300003578 | Bacteria | 12060 |
| 29 | Ga0006562J51391_1039498 | 3300003578 | Bacteria | 15759 |
| 30 | Ga0006562J51391_1039500 | 3300003578 | Bacteria | 10949 |
| 31 | Ga0055533_1002005 | 3300003756 | Bacteria | 4957 |
| 32 | Ga0055525_1000170 | 3300003759 | Bacteria | 82613 |
| 33 | Ga0055527_1000275 | 3300003760 | Bacteria | 30703 |
| 34 | Ga0055527_1000331 | 3300003760 | Bacteria | 25227 |
| 35 | Ga0055535_1000242 | 3300003761 | Bacteria | 57885 |
| 36 | Ga0055535_1000582 | 3300003761 | Bacteria | 30704 |
| 37 | Ga0055535_1000594 | 3300003761 | Bacteria | 29866 |
| 38 | Ga0055535_1000715 | 3300003761 | Bacteria | 25227 |
| 39 | Ga0055542_1000298 | 3300003762 | Bacteria | 55290 |
| 40 | Ga0055542_1000580 | 3300003762 | Bacteria | 31686 |
| 41 | Ga0055542_1000604 | 3300003762 | Bacteria | 30703 |
| 42 | Ga0055542_1000623 | 3300003762 | Bacteria | 29866 |
| 43 | Ga0055542_1000741 | 3300003762 | Bacteria | 25227 |
| 44 | Ga0055529_1000437 | 3300003763 | Bacteria | 41881 |
| 45 | Ga0055529_1000574 | 3300003763 | Bacteria | 29866 |
| 46 | Ga0055529_1000648 | 3300003763 | Bacteria | 25227 |
| 47 | Ga0055529_1000932 | 3300003763 | Bacteria | 15618 |
| 48 | Ga0055526_1000082 | 3300003771 | Bacteria | 87106 |
| 49 | Ga0055526_1012150 | 3300003771 | Bacteria | 3789 |
| 50 | Ga0055537_1000228 | 3300003773 | Bacteria | 41108 |
| 51 | Ga0055524_1000138 | 3300003775 | Bacteria | 87106 |
| 52 | Ga0055536_1007776 | 3300003781 | Bacteria | 4734 |
| 53 | Ga0055534_1000056 | 3300003784 | Bacteria | 87106 |
| 54 | Ga0055528_1000061 | 3300003790 | Bacteria | 87106 |
| 55 | Ga0055531_10005953 | 3300003794 | Bacteria | 7010 |
| 56 | Ga0065165_1000887 | 3300005262 | Bacteria | 38644 |
| 57 | Ga0065165_1001275 | 3300005262 | Bacteria | 28492 |
| 58 | Ga0065715_10027231 | 3300005293 | Bacteria | 2647 |
| 59 | Ga0070683_100049951 | 3300005329 | Bacteria | 3870 |
| 60 | Ga0070683_100052424 | 3300005329 | Bacteria | 3779 |
| 61 | Ga0070670_100065037 | 3300005331 | Bacteria | 3129 |
| 62 | Ga0070670_100103226 | 3300005331 | Bacteria | 2456 |
| 63 | Ga0070666_10000372 | 3300005335 | Bacteria | 28283 |
| 64 | Ga0070666_10009658 | 3300005335 | Bacteria | 6024 |
| 65 | Ga0070680_100002369 | 3300005336 | Bacteria | 13928 |
| 66 | Ga0070680_100005018 | 3300005336 | Bacteria | 9981 |
| 67 | Ga0070680_100007340 | 3300005336 | Bacteria | 8407 |
| 68 | Ga0070680_100010560 | 3300005336 | Bacteria | 7125 |
| 69 | Ga0070680_100050969 | 3300005336 | Bacteria | 3377 |
| 70 | Ga0070680_100157181 | 3300005336 | Bacteria | 1910 |
| 71 | Ga0070682_100009517 | 3300005337 | Bacteria | 5499 |
| 72 | Ga0070682_100033288 | 3300005337 | Bacteria | 3130 |
| 73 | Ga0068868_100041811 | 3300005338 | Bacteria | 3572 |
| 74 | Ga0070660_100022372 | 3300005339 | Bacteria | 4674 |
| 75 | Ga0070691_10015006 | 3300005341 | Bacteria | 3557 |
| 76 | Ga0070661_100001549 | 3300005344 | Bacteria | 15981 |
| 77 | Ga0070661_100010219 | 3300005344 | Bacteria | 6520 |
| 78 | Ga0070661_100010825 | 3300005344 | Bacteria | 6350 |
| 79 | Ga0070692_10000887 | 3300005345 | Bacteria | 10113 |
| 80 | Ga0070668_100044387 | 3300005347 | Bacteria | 3410 |
| 81 | Ga0070675_100121958 | 3300005354 | Bacteria | 2215 |
| 82 | Ga0070659_100161209 | 3300005366 | Bacteria | 1834 |
| 83 | Ga0070667_100000049 | 3300005367 | Bacteria | 158483 |
| 84 | Ga0070667_100000184 | 3300005367 | Bacteria | 75408 |
| 85 | Ga0070667_100005927 | 3300005367 | Bacteria | 10173 |
| 86 | Ga0070714_100000597 | 3300005435 | Bacteria | 25798 |
| 87 | Ga0070714_100001179 | 3300005435 | Bacteria | 18812 |
| 88 | Ga0070713_100001691 | 3300005436 | Bacteria | 14172 |
| 89 | Ga0070711_100074556 | 3300005439 | Bacteria | 2400 |
| 90 | Ga0070663_100000042 | 3300005455 | Bacteria | 57899 |
| 91 | Ga0070663_100003576 | 3300005455 | Bacteria | 8976 |
| 92 | Ga0070663_100003910 | 3300005455 | Bacteria | 8688 |
| 93 | Ga0070663_100058798 | 3300005455 | Bacteria | 2761 |
| 94 | Ga0070663_100084745 | 3300005455 | Bacteria | 2337 |
| 95 | Ga0070678_100139481 | 3300005456 | Bacteria | 1938 |
| 96 | Ga0070662_100038283 | 3300005457 | Bacteria | 3406 |
| 97 | Ga0070681_10000484 | 3300005458 | Bacteria | 32437 |
| 98 | Ga0070681_10000534 | 3300005458 | Bacteria | 31253 |
| 99 | Ga0070681_10000799 | 3300005458 | Bacteria | 26246 |
| 100 | Ga0070681_10016654 | 3300005458 | Bacteria | 7338 |
| 101 | Ga0070681_10142302 | 3300005458 | Bacteria | 2328 |
| 102 | Ga0070706_100023729 | 3300005467 | Bacteria | 5647 |
| 103 | Ga0070679_100000571 | 3300005530 | Bacteria | 31258 |
| 104 | Ga0070679_100001635 | 3300005530 | Bacteria | 20192 |
| 105 | Ga0070679_100011025 | 3300005530 | Bacteria | 8594 |
| 106 | Ga0070679_100015323 | 3300005530 | Bacteria | 7366 |
| 107 | Ga0070679_100070134 | 3300005530 | Bacteria | 3497 |
| 108 | Ga0070679_100183465 | 3300005530 | Bacteria | 2064 |
| 109 | Ga0070684_100018115 | 3300005535 | Bacteria | 5793 |
| 110 | Ga0070684_100051279 | 3300005535 | Bacteria | 3584 |
| 111 | Ga0070684_100144571 | 3300005535 | Bacteria | 2152 |
| 112 | Ga0068853_100002452 | 3300005539 | Bacteria | 13881 |
| 113 | Ga0068853_100004880 | 3300005539 | Bacteria | 10435 |
| 114 | Ga0068853_100005963 | 3300005539 | Bacteria | 9628 |
| 115 | Ga0068853_100034404 | 3300005539 | Bacteria | 4301 |
| 116 | Ga0068853_100065038 | 3300005539 | Bacteria | 3164 |
| 117 | Ga0068853_100113846 | 3300005539 | Bacteria | 2405 |
| 118 | Ga0068853_100219743 | 3300005539 | Bacteria | 1735 |
| 119 | Ga0070672_100029332 | 3300005543 | Bacteria | 4125 |
| 120 | Ga0070672_100076084 | 3300005543 | Bacteria | 2681 |
| 121 | Ga0070696_100009437 | 3300005546 | Bacteria | 6534 |
| 122 | Ga0070696_100012446 | 3300005546 | Bacteria | 5708 |
| 123 | Ga0070696_100048471 | 3300005546 | Bacteria | 2949 |
| 124 | Ga0070693_100003242 | 3300005547 | Bacteria | 7559 |
| 125 | Ga0070693_100012117 | 3300005547 | Bacteria | 4357 |
| 126 | Ga0070665_100000028 | 3300005548 | Bacteria | 351357 |
| 127 | Ga0070665_100023034 | 3300005548 | Bacteria | 6272 |
| 128 | Ga0070665_100036297 | 3300005548 | Bacteria | 4958 |
| 129 | Ga0070665_100052083 | 3300005548 | Bacteria | 4106 |
| 130 | Ga0070704_100004431 | 3300005549 | Bacteria | 8109 |
| 131 | Ga0068855_100003293 | 3300005563 | Bacteria | 19778 |
| 132 | Ga0068855_100006907 | 3300005563 | Bacteria | 13767 |
| 133 | Ga0068855_100008568 | 3300005563 | Bacteria | 12365 |
| 134 | Ga0068855_100155108 | 3300005563 | Bacteria | 2602 |
| 135 | Ga0068855_100197430 | 3300005563 | Bacteria | 2267 |
| 136 | Ga0068855_100227919 | 3300005563 | Bacteria | 2087 |
| 137 | Ga0070664_100034110 | 3300005564 | Bacteria | 4268 |
| 138 | Ga0068857_100020704 | 3300005577 | Bacteria | 5789 |
| 139 | Ga0068854_100000504 | 3300005578 | Bacteria | 23786 |
| 140 | Ga0068856_100000088 | 3300005614 | Bacteria | 85931 |
| 141 | Ga0068856_100013243 | 3300005614 | Bacteria | 7987 |
| 142 | Ga0068856_100022139 | 3300005614 | Bacteria | 6180 |
| 143 | Ga0068856_100065594 | 3300005614 | Bacteria | 3588 |
| 144 | Ga0068856_100095164 | 3300005614 | Bacteria | 2966 |
| 145 | Ga0068856_100135247 | 3300005614 | Bacteria | 2470 |
| 146 | Ga0068852_100040954 | 3300005616 | Bacteria | 3912 |
| 147 | Ga0068852_100063910 | 3300005616 | Bacteria | 3206 |
| 148 | Ga0068852_100128127 | 3300005616 | Bacteria | 2333 |
| 149 | Ga0068852_100130544 | 3300005616 | Bacteria | 2313 |
| 150 | Ga0068859_100198559 | 3300005617 | Bacteria | 2090 |
| 151 | Ga0068851_10013049 | 3300005834 | Bacteria | 3928 |
| 152 | Ga0068851_10025083 | 3300005834 | Bacteria | 2922 |
| 153 | Ga0068863_100033562 | 3300005841 | Bacteria | 4889 |
| 154 | Ga0068858_100000586 | 3300005842 | Bacteria | 38243 |
| 155 | Ga0068858_100013343 | 3300005842 | Bacteria | 7751 |
| 156 | Ga0068860_100017405 | 3300005843 | Bacteria | 7003 |
| 157 | Ga0068860_100076005 | 3300005843 | Bacteria | 3194 |
| 158 | Ga0068862_100000215 | 3300005844 | Bacteria | 64251 |
| 159 | Ga0081455_10172430 | 3300005937 | Bacteria | 1646 |
| 160 | Ga0075365_10008292 | 3300006038 | Bacteria | 5888 |
| 161 | Ga0075364_10001706 | 3300006051 | Bacteria | 12075 |
| 162 | Ga0070716_100014594 | 3300006173 | Bacteria | 4027 |
| 163 | Ga0097621_100002033 | 3300006237 | Bacteria | 13846 |
| 164 | Ga0097621_100023445 | 3300006237 | Bacteria | 4806 |
| 165 | Ga0097621_100046745 | 3300006237 | Bacteria | 3504 |
| 166 | Ga0068871_100002111 | 3300006358 | Bacteria | 13456 |
| 167 | Ga0068865_100001222 | 3300006881 | Bacteria | 14943 |
| 168 | Ga0075436_100003116 | 3300006914 | Bacteria | 11365 |
| 169 | Ga0075436_100014805 | 3300006914 | Bacteria | 5344 |
| 170 | Ga0097620_100198558 | 3300006931 | Bacteria | 2090 |
| 171 | Ga0075435_100002470 | 3300007076 | Bacteria | 12289 |
| 172 | Ga0099794_10005753 | 3300007265 | Bacteria | 4996 |
| 173 | Ga0099794_10008738 | 3300007265 | Bacteria | 4218 |
| 174 | Ga0105250_10046720 | 3300009092 | Bacteria | 1736 |
| 175 | Ga0105240_10002481 | 3300009093 | Bacteria | 29651 |
| 176 | Ga0105240_10007409 | 3300009093 | Bacteria | 15946 |
| 177 | Ga0105240_10007835 | 3300009093 | Bacteria | 15418 |
| 178 | Ga0105240_10008240 | 3300009093 | Bacteria | 14931 |
| 179 | Ga0105240_10011769 | 3300009093 | Bacteria | 12155 |
| 180 | Ga0105240_10063977 | 3300009093 | Bacteria | 4573 |
| 181 | Ga0105240_10102964 | 3300009093 | Bacteria | 3469 |
| 182 | Ga0105240_10200362 | 3300009093 | Bacteria | 2340 |
| 183 | Ga0105240_10225506 | 3300009093 | Bacteria | 2181 |
| 184 | Ga0105245_10054644 | 3300009098 | Bacteria | 3586 |
| 185 | Ga0105245_10054959 | 3300009098 | Bacteria | 3576 |
| 186 | Ga0105247_10004712 | 3300009101 | Bacteria | 8693 |
| 187 | Ga0105247_10012255 | 3300009101 | Bacteria | 5150 |
| 188 | Ga0105241_10012342 | 3300009174 | Bacteria | 6266 |
| 189 | Ga0105242_10004683 | 3300009176 | Bacteria | 10587 |
| 190 | Ga0105248_10000120 | 3300009177 | Bacteria | 89960 |
| 191 | Ga0105237_10000058 | 3300009545 | Bacteria | 146943 |
| 192 | Ga0105237_10028280 | 3300009545 | Bacteria | 5713 |
| 193 | Ga0105237_10029693 | 3300009545 | Bacteria | 5555 |
| 194 | Ga0105237_10075473 | 3300009545 | Bacteria | 3363 |
| 195 | Ga0105238_10010170 | 3300009551 | Bacteria | 9435 |
| 196 | Ga0105238_10012584 | 3300009551 | Bacteria | 8541 |
| 197 | Ga0105238_10015508 | 3300009551 | Bacteria | 7713 |
| 198 | Ga0105238_10054682 | 3300009551 | Bacteria | 4008 |
| 199 | Ga0105238_10139335 | 3300009551 | Bacteria | 2403 |
| 200 | Ga0105249_10001801 | 3300009553 | Bacteria | 18626 |
| 201 | Ga0105249_10030150 | 3300009553 | Bacteria | 4902 |
| 202 | Ga0105239_10001637 | 3300010375 | Bacteria | 29547 |
| 203 | Ga0105239_10047706 | 3300010375 | Bacteria | 4694 |
| 204 | Ga0105239_10151023 | 3300010375 | Bacteria | 2592 |
| 205 | Ga0157314_1000018 | 3300012500 | Bacteria | 16239 |
| 206 | Ga0157373_10007919 | 3300013100 | Bacteria | 7909 |
| 207 | Ga0157373_10019278 | 3300013100 | Bacteria | 4968 |
| 208 | Ga0157373_10034313 | 3300013100 | Bacteria | 3644 |
| 209 | Ga0157373_10078911 | 3300013100 | Bacteria | 2321 |
| 210 | Ga0157373_10161553 | 3300013100 | Bacteria | 1576 |
| 211 | Ga0157371_10010375 | 3300013102 | Bacteria | 7263 |
| 212 | Ga0157370_10006151 | 3300013104 | Bacteria | 13317 |
| 213 | Ga0157370_10007072 | 3300013104 | Bacteria | 12257 |
| 214 | Ga0157370_10007352 | 3300013104 | Bacteria | 12015 |
| 215 | Ga0157370_10009419 | 3300013104 | Bacteria | 10440 |
| 216 | Ga0157370_10032654 | 3300013104 | Bacteria | 5082 |
| 217 | Ga0157369_10000021 | 3300013105 | Bacteria | 239073 |
| 218 | Ga0157369_10010042 | 3300013105 | Bacteria | 10812 |
| 219 | Ga0157369_10031979 | 3300013105 | Bacteria | 5788 |
| 220 | Ga0157369_10086529 | 3300013105 | Bacteria | 3347 |
| 221 | Ga0157369_10199531 | 3300013105 | Bacteria | 2100 |
| 222 | Ga0157374_10004992 | 3300013296 | Bacteria | 11132 |
| 223 | Ga0157374_10122742 | 3300013296 | Bacteria | 2509 |
| 224 | Ga0157374_10191487 | 3300013296 | Bacteria | 2001 |
| 225 | Ga0157378_10000303 | 3300013297 | Bacteria | 47815 |
| 226 | Ga0163162_10000004 | 3300013306 | Bacteria | 505593 |
| 227 | Ga0163162_10006588 | 3300013306 | Bacteria | 11252 |
| 228 | Ga0157372_10005781 | 3300013307 | Bacteria | 13174 |
| 229 | Ga0157372_10006482 | 3300013307 | Bacteria | 12453 |
| 230 | Ga0157372_10006803 | 3300013307 | Bacteria | 12157 |
| 231 | Ga0157372_10017223 | 3300013307 | Bacteria | 7755 |
| 232 | Ga0157372_10024666 | 3300013307 | Bacteria | 6535 |
| 233 | Ga0157372_10193875 | 3300013307 | Bacteria | 2353 |
| 234 | Ga0157375_10000561 | 3300013308 | Bacteria | 33401 |
| 235 | Ga0157375_10005348 | 3300013308 | Bacteria | 11159 |
| 236 | Ga0163163_10003314 | 3300014325 | Bacteria | 13659 |
| 237 | Ga0163163_10005861 | 3300014325 | Bacteria | 10689 |
| 238 | Ga0163163_10019903 | 3300014325 | Bacteria | 6312 |
| 239 | Ga0182008_10003053 | 3300014497 | Bacteria | 10279 |
| 240 | Ga0182008_10008140 | 3300014497 | Bacteria | 5738 |
| 241 | Ga0157376_10003027 | 3300014969 | Bacteria | 11520 |
| 242 | Ga0157376_10010490 | 3300014969 | Bacteria | 6780 |
| 243 | Ga0182006_1000461 | 3300015261 | Bacteria | 31892 |
| 244 | Ga0182006_1001147 | 3300015261 | Bacteria | 16817 |
| 245 | Ga0182005_1001072 | 3300015265 | Bacteria | 11527 |
| 246 | Ga0182005_1001074 | 3300015265 | Bacteria | 11526 |
| 247 | Ga0182005_1001234 | 3300015265 | Bacteria | 10590 |
| 248 | Ga0183369_1011 | 3300015685 | Bacteria | 252490 |
| 249 | Ga0183368_1007 | 3300015687 | Bacteria | 405609 |
| 250 | Ga0183360_10003 | 3300015689 | Bacteria | 713221 |
| 251 | Ga0163161_10032354 | 3300017792 | Bacteria | 3733 |
| 252 | Ga0206354_10073408 | 3300020081 | Bacteria | 2428 |
| 253 | Ga0209760_102570 | 3300025207 | Bacteria | 1685 |
| 254 | Ga0209784_100163 | 3300025224 | Bacteria | 57927 |
| 255 | Ga0209674_100037 | 3300025226 | Bacteria | 404339 |
| 256 | Ga0209674_100058 | 3300025226 | Bacteria | 286902 |
| 257 | Ga0209674_103964 | 3300025226 | Bacteria | 2543 |
| 258 | Ga0209672_100043 | 3300025228 | Bacteria | 270302 |
| 259 | Ga0209672_100061 | 3300025228 | Bacteria | 206098 |
| 260 | Ga0209672_100659 | 3300025228 | Bacteria | 17551 |
| 261 | Ga0209672_101128 | 3300025228 | Bacteria | 11124 |
| 262 | Ga0209672_101385 | 3300025228 | Bacteria | 8982 |
| 263 | Ga0209563_100062 | 3300025230 | Bacteria | 264769 |
| 264 | Ga0207427_100031 | 3300025231 | Bacteria | 350866 |
| 265 | Ga0207427_100196 | 3300025231 | Bacteria | 57937 |
| 266 | Ga0207427_100258 | 3300025231 | Bacteria | 41628 |
| 267 | Ga0207427_100275 | 3300025231 | Bacteria | 38754 |
| 268 | Ga0209437_100061 | 3300025233 | Bacteria | 350866 |
| 269 | Ga0209437_100121 | 3300025233 | Bacteria | 202531 |
| 270 | Ga0209437_100132 | 3300025233 | Bacteria | 178495 |
| 271 | Ga0209437_100345 | 3300025233 | Bacteria | 54531 |
| 272 | Ga0209258_100054 | 3300025242 | Bacteria | 339063 |
| 273 | Ga0209258_100076 | 3300025242 | Bacteria | 270302 |
| 274 | Ga0209258_100097 | 3300025242 | Bacteria | 216963 |
| 275 | Ga0209258_100384 | 3300025242 | Bacteria | 56539 |
| 276 | Ga0209258_100514 | 3300025242 | Bacteria | 37294 |
| 277 | Ga0209258_100566 | 3300025242 | Bacteria | 31739 |
| 278 | Ga0209646_1001674 | 3300025246 | Bacteria | 5656 |
| 279 | Ga0209026_1000119 | 3300025250 | Bacteria | 130220 |
| 280 | Ga0209026_1000147 | 3300025250 | Bacteria | 111301 |
| 281 | Ga0209026_1000286 | 3300025250 | Bacteria | 57937 |
| 282 | Ga0209026_1000337 | 3300025250 | Bacteria | 45585 |
| 283 | Ga0209026_1000533 | 3300025250 | Bacteria | 26323 |
| 284 | Ga0209677_101125 | 3300025253 | Bacteria | 12537 |
| 285 | Ga0209148_1000047 | 3300025254 | Bacteria | 434369 |
| 286 | Ga0209148_1000063 | 3300025254 | Bacteria | 346881 |
| 287 | Ga0209148_1000066 | 3300025254 | Bacteria | 339063 |
| 288 | Ga0209148_1000082 | 3300025254 | Bacteria | 270302 |
| 289 | Ga0209148_1000614 | 3300025254 | Bacteria | 31739 |
| 290 | Ga0209148_1000912 | 3300025254 | Bacteria | 19949 |
| 291 | Ga0209759_1000730 | 3300025256 | Bacteria | 28802 |
| 292 | Ga0209759_1000858 | 3300025256 | Bacteria | 23567 |
| 293 | Ga0209759_1001948 | 3300025256 | Bacteria | 9984 |
| 294 | Ga0209759_1001982 | 3300025256 | Bacteria | 9812 |
| 295 | Ga0209129_1000331 | 3300025258 | Bacteria | 41001 |
| 296 | Ga0209129_1002368 | 3300025258 | Bacteria | 9292 |
| 297 | Ga0209233_1000076 | 3300025261 | Bacteria | 350866 |
| 298 | Ga0209233_1000100 | 3300025261 | Bacteria | 293905 |
| 299 | Ga0209233_1000112 | 3300025261 | Bacteria | 258251 |
| 300 | Ga0209233_1000114 | 3300025261 | Bacteria | 246083 |
| 301 | Ga0209233_1001928 | 3300025261 | Bacteria | 7927 |
| 302 | Ga0209233_1018396 | 3300025261 | Bacteria | 1881 |
| 303 | Ga0209565_1000002 | 3300025263 | Bacteria | 1423083 |
| 304 | Ga0209455_1000078 | 3300025272 | Bacteria | 270237 |
| 305 | Ga0209455_1000096 | 3300025272 | Bacteria | 217006 |
| 306 | Ga0209455_1000101 | 3300025272 | Bacteria | 206098 |
| 307 | Ga0209455_1000267 | 3300025272 | Bacteria | 58711 |
| 308 | Ga0209455_1000270 | 3300025272 | Bacteria | 57937 |
| 309 | Ga0209673_1000002 | 3300025273 | Bacteria | 1423083 |
| 310 | Ga0209130_1003339 | 3300025284 | Bacteria | 6903 |
| 311 | Ga0209675_1000002 | 3300025291 | Bacteria | 1423083 |
| 312 | Ga0209676_1000830 | 3300025292 | Bacteria | 40120 |
| 313 | Ga0209676_1002916 | 3300025292 | Bacteria | 11181 |
| 314 | Ga0209025_1000200 | 3300025294 | Bacteria | 146048 |
| 315 | Ga0209025_1009037 | 3300025294 | Bacteria | 7030 |
| 316 | Ga0209025_1035732 | 3300025294 | Bacteria | 2238 |
| 317 | Ga0209564_1000004 | 3300025295 | Bacteria | 1424639 |
| 318 | Ga0209564_1003164 | 3300025295 | Bacteria | 11586 |
| 319 | Ga0209758_1001065 | 3300025297 | Bacteria | 35722 |
| 320 | Ga0209050_1002489 | 3300025298 | Bacteria | 15573 |
| 321 | Ga0209256_1000004 | 3300025299 | Bacteria | 1424643 |
| 322 | Ga0209256_1004097 | 3300025299 | Bacteria | 9443 |
| 323 | Ga0209256_1004516 | 3300025299 | Bacteria | 8683 |
| 324 | Ga0207426_1003250 | 3300025302 | Bacteria | 9107 |
| 325 | Ga0209051_1008280 | 3300025303 | Bacteria | 5525 |
| 326 | Ga0209257_1000499 | 3300025304 | Bacteria | 70103 |
| 327 | Ga0209257_1003235 | 3300025304 | Bacteria | 14334 |
| 328 | Ga0209257_1004860 | 3300025304 | Bacteria | 9931 |
| 329 | Ga0207656_10002756 | 3300025321 | Bacteria | 5960 |
| 330 | Ga0207710_10002997 | 3300025900 | Bacteria | 7626 |
| 331 | Ga0207710_10006428 | 3300025900 | Bacteria | 5017 |
| 332 | Ga0207680_10007412 | 3300025903 | Bacteria | 5345 |
| 333 | Ga0207647_10000130 | 3300025904 | Bacteria | 58985 |
| 334 | Ga0207647_10000269 | 3300025904 | Bacteria | 42790 |
| 335 | Ga0207647_10002143 | 3300025904 | Bacteria | 15080 |
| 336 | Ga0207647_10011433 | 3300025904 | Bacteria | 6225 |
| 337 | Ga0207705_10000400 | 3300025909 | Bacteria | 38159 |
| 338 | Ga0207705_10004563 | 3300025909 | Bacteria | 10460 |
| 339 | Ga0207705_10013247 | 3300025909 | Bacteria | 5953 |
| 340 | Ga0207705_10086094 | 3300025909 | Bacteria | 2296 |
| 341 | Ga0207654_10005801 | 3300025911 | Bacteria | 6231 |
| 342 | Ga0207654_10030041 | 3300025911 | Bacteria | 2979 |
| 343 | Ga0207654_10068909 | 3300025911 | Bacteria | 2094 |
| 344 | Ga0207707_10000020 | 3300025912 | Bacteria | 205480 |
| 345 | Ga0207707_10000626 | 3300025912 | Bacteria | 35036 |
| 346 | Ga0207707_10003170 | 3300025912 | Bacteria | 14597 |
| 347 | Ga0207707_10007883 | 3300025912 | Bacteria | 9260 |
| 348 | Ga0207707_10012604 | 3300025912 | Bacteria | 7346 |
| 349 | Ga0207707_10017863 | 3300025912 | Bacteria | 6185 |
| 350 | Ga0207707_10056115 | 3300025912 | Bacteria | 3426 |
| 351 | Ga0207707_10114702 | 3300025912 | Bacteria | 2354 |
| 352 | Ga0207695_10000040 | 3300025913 | Bacteria | 452787 |
| 353 | Ga0207695_10000890 | 3300025913 | Bacteria | 54211 |
| 354 | Ga0207695_10001663 | 3300025913 | Bacteria | 35807 |
| 355 | Ga0207695_10001888 | 3300025913 | Bacteria | 32776 |
| 356 | Ga0207695_10002173 | 3300025913 | Bacteria | 29659 |
| 357 | Ga0207695_10002412 | 3300025913 | Bacteria | 27677 |
| 358 | Ga0207695_10003828 | 3300025913 | Bacteria | 20854 |
| 359 | Ga0207695_10022149 | 3300025913 | Bacteria | 7226 |
| 360 | Ga0207695_10024064 | 3300025913 | Bacteria | 6864 |
| 361 | Ga0207695_10037019 | 3300025913 | Bacteria | 5268 |
| 362 | Ga0207695_10041168 | 3300025913 | Bacteria | 4945 |
| 363 | Ga0207695_10049016 | 3300025913 | Bacteria | 4456 |
| 364 | Ga0207695_10084315 | 3300025913 | Bacteria | 3209 |
| 365 | Ga0207695_10120392 | 3300025913 | Bacteria | 2594 |
| 366 | Ga0207671_10000026 | 3300025914 | Bacteria | 268845 |
| 367 | Ga0207671_10000260 | 3300025914 | Bacteria | 79210 |
| 368 | Ga0207671_10001294 | 3300025914 | Bacteria | 29397 |
| 369 | Ga0207671_10005233 | 3300025914 | Bacteria | 12050 |
| 370 | Ga0207671_10005317 | 3300025914 | Bacteria | 11927 |
| 371 | Ga0207671_10050339 | 3300025914 | Bacteria | 3085 |
| 372 | Ga0207671_10152475 | 3300025914 | Bacteria | 1786 |
| 373 | Ga0207671_10204521 | 3300025914 | Bacteria | 1543 |
| 374 | Ga0207660_10000726 | 3300025917 | Bacteria | 21921 |
| 375 | Ga0207660_10000950 | 3300025917 | Bacteria | 19197 |
| 376 | Ga0207660_10005901 | 3300025917 | Bacteria | 7956 |
| 377 | Ga0207660_10006258 | 3300025917 | Bacteria | 7727 |
| 378 | Ga0207660_10008193 | 3300025917 | Bacteria | 6763 |
| 379 | Ga0207660_10036427 | 3300025917 | Bacteria | 3420 |
| 380 | Ga0207657_10008750 | 3300025919 | Bacteria | 10246 |
| 381 | Ga0207657_10011362 | 3300025919 | Bacteria | 8845 |
| 382 | Ga0207657_10037960 | 3300025919 | Bacteria | 4295 |
| 383 | Ga0207657_10044281 | 3300025919 | Bacteria | 3913 |
| 384 | Ga0207657_10081212 | 3300025919 | Bacteria | 2724 |
| 385 | Ga0207657_10095219 | 3300025919 | Bacteria | 2478 |
| 386 | Ga0207649_10005191 | 3300025920 | Bacteria | 7035 |
| 387 | Ga0207649_10005381 | 3300025920 | Bacteria | 6931 |
| 388 | Ga0207649_10016814 | 3300025920 | Bacteria | 4136 |
| 389 | Ga0207652_10000037 | 3300025921 | Bacteria | 134369 |
| 390 | Ga0207652_10000753 | 3300025921 | Bacteria | 31143 |
| 391 | Ga0207652_10002384 | 3300025921 | Bacteria | 15874 |
| 392 | Ga0207652_10007939 | 3300025921 | Bacteria | 8522 |
| 393 | Ga0207652_10012358 | 3300025921 | Bacteria | 6899 |
| 394 | Ga0207652_10024942 | 3300025921 | Bacteria | 4965 |
| 395 | Ga0207652_10063335 | 3300025921 | Bacteria | 3198 |
| 396 | Ga0207681_10027339 | 3300025923 | Bacteria | 3687 |
| 397 | Ga0207694_10001363 | 3300025924 | Bacteria | 21050 |
| 398 | Ga0207694_10002190 | 3300025924 | Bacteria | 16057 |
| 399 | Ga0207694_10003616 | 3300025924 | Bacteria | 12247 |
| 400 | Ga0207694_10072050 | 3300025924 | Bacteria | 2701 |
| 401 | Ga0207694_10094822 | 3300025924 | Bacteria | 2358 |
| 402 | Ga0207687_10082099 | 3300025927 | Bacteria | 2331 |
| 403 | Ga0207664_10000131 | 3300025929 | Bacteria | 65529 |
| 404 | Ga0207664_10000856 | 3300025929 | Bacteria | 20600 |
| 405 | Ga0207690_10000308 | 3300025932 | Bacteria | 33627 |
| 406 | Ga0207690_10000657 | 3300025932 | Bacteria | 22118 |
| 407 | Ga0207690_10005794 | 3300025932 | Bacteria | 7307 |
| 408 | Ga0207690_10019367 | 3300025932 | Bacteria | 4189 |
| 409 | Ga0207690_10044076 | 3300025932 | Bacteria | 2939 |
| 410 | Ga0207690_10059895 | 3300025932 | Bacteria | 2581 |
| 411 | Ga0207706_10070736 | 3300025933 | Bacteria | 3069 |
| 412 | Ga0207686_10002229 | 3300025934 | Bacteria | 10647 |
| 413 | Ga0207669_10046335 | 3300025937 | Bacteria | 2569 |
| 414 | Ga0207704_10001141 | 3300025938 | Bacteria | 11810 |
| 415 | Ga0207704_10007422 | 3300025938 | Bacteria | 5179 |
| 416 | Ga0207691_10022148 | 3300025940 | Bacteria | 5995 |
| 417 | Ga0207691_10150041 | 3300025940 | Bacteria | 2050 |
| 418 | Ga0207691_10180669 | 3300025940 | Bacteria | 1844 |
| 419 | Ga0207711_10001269 | 3300025941 | Bacteria | 23925 |
| 420 | Ga0207711_10189850 | 3300025941 | Bacteria | 1872 |
| 421 | Ga0207689_10018945 | 3300025942 | Bacteria | 5805 |
| 422 | Ga0207661_10004484 | 3300025944 | Bacteria | 9791 |
| 423 | Ga0207661_10104774 | 3300025944 | Bacteria | 2382 |
| 424 | Ga0207667_10000228 | 3300025949 | Bacteria | 78952 |
| 425 | Ga0207667_10000423 | 3300025949 | Bacteria | 57047 |
| 426 | Ga0207667_10000633 | 3300025949 | Bacteria | 45505 |
| 427 | Ga0207667_10012632 | 3300025949 | Bacteria | 9707 |
| 428 | Ga0207667_10014711 | 3300025949 | Bacteria | 8905 |
| 429 | Ga0207667_10016754 | 3300025949 | Bacteria | 8268 |
| 430 | Ga0207667_10019918 | 3300025949 | Bacteria | 7475 |
| 431 | Ga0207667_10051227 | 3300025949 | Bacteria | 4353 |
| 432 | Ga0207667_10053029 | 3300025949 | Bacteria | 4268 |
| 433 | Ga0207667_10060694 | 3300025949 | Bacteria | 3958 |
| 434 | Ga0207667_10075450 | 3300025949 | Bacteria | 3501 |
| 435 | Ga0207667_10208355 | 3300025949 | Bacteria | 2004 |
| 436 | Ga0207712_10000305 | 3300025961 | Bacteria | 45213 |
| 437 | Ga0207712_10000364 | 3300025961 | Bacteria | 40077 |
| 438 | Ga0207640_10000120 | 3300025981 | Bacteria | 59715 |
| 439 | Ga0207640_10001068 | 3300025981 | Bacteria | 15187 |
| 440 | Ga0207640_10001821 | 3300025981 | Bacteria | 11435 |
| 441 | Ga0207640_10019869 | 3300025981 | Bacteria | 3977 |
| 442 | Ga0207658_10000033 | 3300025986 | Bacteria | 158540 |
| 443 | Ga0207658_10000591 | 3300025986 | Bacteria | 32569 |
| 444 | Ga0207658_10004314 | 3300025986 | Bacteria | 9902 |
| 445 | Ga0207658_10063234 | 3300025986 | Bacteria | 2773 |
| 446 | Ga0207658_10068761 | 3300025986 | Bacteria | 2673 |
| 447 | Ga0207658_10139797 | 3300025986 | Bacteria | 1958 |
| 448 | Ga0207677_10030970 | 3300026023 | Bacteria | 3422 |
| 449 | Ga0207677_10104373 | 3300026023 | Bacteria | 2095 |
| 450 | Ga0207703_10000472 | 3300026035 | Bacteria | 42034 |
| 451 | Ga0207639_10001365 | 3300026041 | Bacteria | 16471 |
| 452 | Ga0207639_10002309 | 3300026041 | Bacteria | 12797 |
| 453 | Ga0207639_10004090 | 3300026041 | Bacteria | 9839 |
| 454 | Ga0207639_10012820 | 3300026041 | Bacteria | 5849 |
| 455 | Ga0207639_10020657 | 3300026041 | Bacteria | 4717 |
| 456 | Ga0207639_10102207 | 3300026041 | Bacteria | 2319 |
| 457 | Ga0207639_10122580 | 3300026041 | Bacteria | 2138 |
| 458 | Ga0207639_10159322 | 3300026041 | Bacteria | 1900 |
| 459 | Ga0207678_10000566 | 3300026067 | Bacteria | 33834 |
| 460 | Ga0207678_10007011 | 3300026067 | Bacteria | 10004 |
| 461 | Ga0207678_10009626 | 3300026067 | Bacteria | 8496 |
| 462 | Ga0207678_10010170 | 3300026067 | Bacteria | 8258 |
| 463 | Ga0207678_10017588 | 3300026067 | Bacteria | 6278 |
| 464 | Ga0207678_10018276 | 3300026067 | Bacteria | 6157 |
| 465 | Ga0207678_10105410 | 3300026067 | Bacteria | 2405 |
| 466 | Ga0207702_10000649 | 3300026078 | Bacteria | 37917 |
| 467 | Ga0207702_10001784 | 3300026078 | Bacteria | 21201 |
| 468 | Ga0207702_10003564 | 3300026078 | Bacteria | 14163 |
| 469 | Ga0207702_10004508 | 3300026078 | Bacteria | 12357 |
| 470 | Ga0207641_10054943 | 3300026088 | Bacteria | 3381 |
| 471 | Ga0207641_10068127 | 3300026088 | Bacteria | 3050 |
| 472 | Ga0207641_10128617 | 3300026088 | Bacteria | 2271 |
| 473 | Ga0207648_10018369 | 3300026089 | Bacteria | 6334 |
| 474 | Ga0207648_10174421 | 3300026089 | Bacteria | 1901 |
| 475 | Ga0207676_10018479 | 3300026095 | Bacteria | 5068 |
| 476 | Ga0207674_10000219 | 3300026116 | Bacteria | 71283 |
| 477 | Ga0207674_10015364 | 3300026116 | Bacteria | 8412 |
| 478 | Ga0207674_10021372 | 3300026116 | Bacteria | 6970 |
| 479 | Ga0207674_10025688 | 3300026116 | Bacteria | 6272 |
| 480 | Ga0207674_10032691 | 3300026116 | Bacteria | 5454 |
| 481 | Ga0207674_10255160 | 3300026116 | Bacteria | 1701 |
| 482 | Ga0207683_10071592 | 3300026121 | Bacteria | 3065 |
| 483 | Ga0207683_10243207 | 3300026121 | Bacteria | 1642 |
| 484 | Ga0207698_10000844 | 3300026142 | Bacteria | 17776 |
| 485 | Ga0207698_10007097 | 3300026142 | Bacteria | 7017 |
| 486 | Ga0207698_10049178 | 3300026142 | Bacteria | 3207 |
| 487 | Ga0209967_1000263 | 3300027364 | Bacteria | 7221 |
| 488 | Ga0209588_1008040 | 3300027671 | Bacteria | 3122 |
| 489 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 490 | Ga0268266_10000017 | 3300028379 | Bacteria | 607272 |
| 491 | Ga0268266_10025677 | 3300028379 | Bacteria | 5012 |
| 492 | Ga0268265_10002016 | 3300028380 | Bacteria | 15950 |
| 493 | Ga0268264_10004127 | 3300028381 | Bacteria | 12431 |
| 494 | Ga0268264_10100519 | 3300028381 | Bacteria | 2512 |
| 495 | Ga0268264_10112314 | 3300028381 | Bacteria | 2389 |
| 496 | Ga0307513_10156167 | 3300031456 | Bacteria | 2181 |
| 497 | Ga0307408_100026763 | 3300031548 | Bacteria | 3966 |
| 498 | Ga0307408_100041048 | 3300031548 | Bacteria | 3279 |
| 499 | Ga0307508_10009313 | 3300031616 | Bacteria | 9036 |
| 500 | Ga0316575_10020555 | 3300031665 | Bacteria | 2534 |
| 501 | Ga0316579_10031405 | 3300031691 | Bacteria | 2432 |
| 502 | Ga0316576_10010827 | 3300031727 | Bacteria | 5945 |
| 503 | Ga0316576_10033952 | 3300031727 | Bacteria | 3634 |
| 504 | Ga0316578_10019084 | 3300031728 | Bacteria | 3768 |
| 505 | Ga0307516_10013891 | 3300031730 | Bacteria | 8547 |
| 506 | Ga0307516_10036068 | 3300031730 | Bacteria | 4953 |
| 507 | Ga0307412_10001279 | 3300031911 | Bacteria | 14087 |
| 508 | Ga0307412_10016904 | 3300031911 | Bacteria | 4358 |
| 509 | Ga0307412_10081026 | 3300031911 | Bacteria | 2244 |
| 510 | Ga0307414_10005644 | 3300032004 | Bacteria | 6904 |
| 511 | Ga0307414_10015898 | 3300032004 | Bacteria | 4558 |
| 512 | Ga0307414_10016393 | 3300032004 | Bacteria | 4503 |
| 513 | Ga0307414_10085553 | 3300032004 | Bacteria | 2323 |
| 514 | Ga0373934_0012240 | 3300035086 | Bacteria | 3239 |
| 515 | Ga0373923_0042124 | 3300035111 | Bacteria | 1885 |
| 516 | Ga0373954_0000002 | 3300035118 | Bacteria | 147478 |
| 517 | Ga0316574_0088060 | 3300035398 | Bacteria | 1977 |
| 518 | Ga0316574_0095604 | 3300035398 | Bacteria | 1899 |
| 519 | Ga0373931_0022180 | 3300035691 | Bacteria | 3193 |
| 520 | Ga0373933_0005162 | 3300035724 | Bacteria | 7125 |
| 521 | Ga0316582_0020981 | 3300036647 | Bacteria | 3851 |
| 522 | Ga0316584_0076263 | 3300036712 | Bacteria | 2512 |
| 523 | Ga0316584_0182710 | 3300036712 | Bacteria | 1552 |
| 524 | Ga0373925_0113805 | 3300037068 | Bacteria | 2093 |
| 525 | Ga0395899_0000410 | 3300037312 | Bacteria | 50063 |
| 526 | Ga0395899_0019790 | 3300037312 | Bacteria | 5107 |
| 527 | Ga0395899_0029129 | 3300037312 | Bacteria | 4152 |
| 528 | Ga0395899_0029191 | 3300037312 | Bacteria | 4148 |
| 529 | Ga0395900_0000206 | 3300037418 | Bacteria | 92782 |
| 530 | Ga0395900_0000656 | 3300037418 | Bacteria | 46333 |
| 531 | Ga0395900_0001743 | 3300037418 | Bacteria | 25049 |
| 532 | Ga0395900_0006056 | 3300037418 | Bacteria | 12613 |
| 533 | Ga0395900_0158398 | 3300037418 | Bacteria | 2311 |
| 534 | Ga0395900_0283268 | 3300037418 | Bacteria | 1648 |
| 535 | Ga0395898_0000013 | 3300037466 | Bacteria | 458788 |
| 536 | Ga0395898_0000120 | 3300037466 | Bacteria | 209091 |
| 537 | Ga0395905_0007372 | 3300037471 | Bacteria | 10948 |
| 538 | Ga0395901_0001748 | 3300038443 | Bacteria | 22446 |
| 539 | Ga0395901_0061777 | 3300038443 | Bacteria | 3898 |
| 540 | Ga0395901_0067700 | 3300038443 | Bacteria | 3719 |
| 541 | Ga0395901_0083733 | 3300038443 | Bacteria | 3334 |
| 542 | Ga0395901_0089957 | 3300038443 | Bacteria | 3212 |
| 543 | Ga0395901_0125671 | 3300038443 | Bacteria | 2695 |
| 544 | Ga0395901_0170860 | 3300038443 | Bacteria | 2281 |
| 545 | Ga0395901_0215678 | 3300038443 | Bacteria | 2007 |
| 546 | Ga0436365_1537398 | 3300039437 | Bacteria | 2346 |
| 547 | Ga0439436_0000019 | 3300041404 | Bacteria | 70584 |
| 548 | Ga0439436_0019013 | 3300041404 | Bacteria | 2052 |
| 549 | Ga0439439_0000522 | 3300041406 | Bacteria | 6634 |
| 550 | Ga0439447_003268 | 3300041407 | Bacteria | 5765 |
| 551 | Ga0439465_0000101 | 3300041413 | Bacteria | 19683 |
| 552 | Ga0439465_0002026 | 3300041413 | Bacteria | 6654 |
| 553 | Ga0439465_0011345 | 3300041413 | Bacteria | 2796 |
| 554 | Ga0451793_0125667 | 3300041452 | Bacteria | 1575 |
| 555 | Ga0451797_0049457 | 3300041453 | Bacteria | 2189 |
| 556 | Ga0451802_0337161 | 3300041460 | Bacteria | 3238 |
| 557 | Ga0451837_0182006 | 3300041494 | Bacteria | 1989 |
| 558 | Ga0451837_1141630 | 3300041494 | Bacteria | 3802 |
| 559 | Ga0451843_0269584 | 3300041509 | Bacteria | 2805 |
| 560 | Ga0451853_0219664 | 3300041512 | Bacteria | 4147 |
| 561 | Ga0451853_3004224 | 3300041512 | Bacteria | 2237 |
| 562 | Ga0439437_006103 | 3300042000 | Bacteria | 1331 |
| 563 | Ga0439432_002874 | 3300042006 | Bacteria | 6419 |
| 564 | Ga0439432_009273 | 3300042006 | Bacteria | 3436 |
| 565 | Ga0439449_0012818 | 3300042007 | Bacteria | 3152 |
| 566 | Ga0450908_000141 | 3300042184 | Bacteria | 14773 |
| 567 | Ga0451577_0005118 | 3300042876 | Bacteria | 13510 |
| 568 | Ga0466969_0016507 | 3300044656 | Bacteria | 3863 |
| 569 | Ga0466972_0007010 | 3300044658 | Bacteria | 5653 |
| 570 | Ga0466975_0068618 | 3300044661 | Bacteria | 2532 |
| 571 | Ga0466982_0000017 | 3300044672 | Bacteria | 118868 |
| 572 | Ga0466965_0009624 | 3300044683 | Bacteria | 4495 |
| 573 | Ga0466966_0013312 | 3300044684 | Bacteria | 5445 |
| 574 | Ga0466966_0017909 | 3300044684 | Bacteria | 4677 |
| 575 | Ga0466966_0019558 | 3300044684 | Bacteria | 4455 |
| 576 | Ga0466966_0024936 | 3300044684 | Bacteria | 3910 |
| 577 | Ga0466966_0106706 | 3300044684 | Bacteria | 1728 |
| 578 | Ga0466961_0001089 | 3300044693 | Bacteria | 16718 |
| 579 | Ga0466961_0004931 | 3300044693 | Bacteria | 8390 |
| 580 | Ga0466961_0013367 | 3300044693 | Bacteria | 5254 |
| 581 | Ga0466971_0002114 | 3300044719 | Bacteria | 8416 |
| 582 | Ga0466971_0012172 | 3300044719 | Bacteria | 3770 |
| 583 | Ga0466968_0001344 | 3300044735 | Bacteria | 8769 |
| 584 | Ga0466968_0004145 | 3300044735 | Bacteria | 5398 |
| 585 | Ga0466968_0004722 | 3300044735 | Bacteria | 5104 |
| 586 | Ga0466970_0000349 | 3300044765 | Bacteria | 22379 |
| 587 | Ga0466970_0003722 | 3300044765 | Bacteria | 7453 |
| 588 | Ga0466970_0006542 | 3300044765 | Bacteria | 5825 |
| 589 | Ga0466970_0029488 | 3300044765 | Bacteria | 2888 |
| 590 | Ga0466957_0002466 | 3300044842 | Bacteria | 9940 |
| 591 | Ga0466960_0004458 | 3300044901 | Bacteria | 5473 |
| 592 | Ga0466959_0000848 | 3300045049 | Bacteria | 18039 |
| 593 | Ga0466959_0011074 | 3300045049 | Bacteria | 6471 |
| 594 | Ga0451576_0095186 | 3300045051 | Bacteria | 3097 |
| 595 | Ga0466958_0001914 | 3300045836 | Bacteria | 10190 |
| 596 | Ga0466958_0043763 | 3300045836 | Bacteria | 2697 |
| 597 | Ga0495617_000409 | 3300046452 | Bacteria | 23631 |
| 598 | Ga0495617_001258 | 3300046452 | Bacteria | 11372 |
| 599 | Ga0495603_0029470 | 3300046455 | Bacteria | 3309 |
| 600 | Ga0495638_0000252 | 3300046460 | Bacteria | 72913 |
| 601 | Ga0495638_0000361 | 3300046460 | Bacteria | 56377 |
| 602 | Ga0495638_0000949 | 3300046460 | Bacteria | 29412 |
| 603 | Ga0495638_0001133 | 3300046460 | Bacteria | 25778 |
| 604 | Ga0495638_0027185 | 3300046460 | Bacteria | 3705 |
| 605 | Ga0495650_0001191 | 3300046471 | Bacteria | 27568 |
| 606 | Ga0495650_0001431 | 3300046471 | Bacteria | 23089 |
| 607 | Ga0495580_0050301 | 3300046472 | Bacteria | 2947 |
| 608 | Ga0495585_0000024 | 3300046492 | Bacteria | 148384 |
| 609 | Ga0495585_0001595 | 3300046492 | Bacteria | 17521 |
| 610 | Ga0495607_0001268 | 3300046501 | Bacteria | 22571 |
| 611 | Ga0495607_0001396 | 3300046501 | Bacteria | 21504 |
| 612 | Ga0495607_0037446 | 3300046501 | Bacteria | 2914 |
| 613 | Ga0495583_0039245 | 3300046506 | Bacteria | 2231 |
| 614 | Ga0495606_0000849 | 3300046507 | Bacteria | 45936 |
| 615 | Ga0495606_0002137 | 3300046507 | Bacteria | 23864 |
| 616 | Ga0495606_0003479 | 3300046507 | Bacteria | 16682 |
| 617 | Ga0495606_0011896 | 3300046507 | Bacteria | 7040 |
| 618 | Ga0495610_0005438 | 3300046512 | Bacteria | 9050 |
| 619 | Ga0495616_0000831 | 3300046513 | Bacteria | 22547 |
| 620 | Ga0495616_0015899 | 3300046513 | Bacteria | 4172 |
| 621 | Ga0495620_0000889 | 3300046515 | Bacteria | 18374 |
| 622 | Ga0495620_0004160 | 3300046515 | Bacteria | 8203 |
| 623 | Ga0495631_0001428 | 3300046518 | Bacteria | 14508 |
| 624 | Ga0495632_0000005 | 3300046519 | Bacteria | 362872 |
| 625 | Ga0495632_0003976 | 3300046519 | Bacteria | 10244 |
| 626 | Ga0495632_0031217 | 3300046519 | Bacteria | 2756 |
| 627 | Ga0495637_0016087 | 3300046520 | Bacteria | 3501 |
| 628 | Ga0495648_0000485 | 3300046524 | Bacteria | 42709 |
| 629 | Ga0495648_0003467 | 3300046524 | Bacteria | 13867 |
| 630 | Ga0495663_0017205 | 3300046525 | Bacteria | 2049 |
| 631 | Ga0495609_0004319 | 3300046538 | Bacteria | 7810 |
| 632 | Ga0495621_0000071 | 3300046539 | Bacteria | 20126 |
| 633 | Ga0495622_0008038 | 3300046557 | Bacteria | 4890 |
| 634 | Ga0495633_0010517 | 3300046558 | Bacteria | 5044 |
| 635 | Ga0495668_0001633 | 3300046616 | Bacteria | 20937 |
| 636 | Ga0495611_0000005 | 3300046648 | Bacteria | 284271 |
| 637 | Ga0495611_0000450 | 3300046648 | Bacteria | 24925 |
| 638 | Ga0495625_0001159 | 3300046660 | Bacteria | 33975 |
| 639 | Ga0495625_0049664 | 3300046660 | Bacteria | 3014 |
| 640 | Ga0495625_0058723 | 3300046660 | Bacteria | 2732 |
| 641 | Ga0495661_0001759 | 3300046665 | Bacteria | 17418 |
| 642 | Ga0495658_0004487 | 3300046683 | Bacteria | 6868 |
| 643 | Ga0495658_0087600 | 3300046683 | Bacteria | 1839 |
| 644 | Ga0495670_0000663 | 3300046691 | Bacteria | 16457 |
| 645 | Ga0495670_0055490 | 3300046691 | Bacteria | 1986 |
| 646 | Ga0495671_0003260 | 3300046692 | Bacteria | 10071 |
| 647 | Ga0495671_0021078 | 3300046692 | Bacteria | 3428 |
| 648 | Ga0495649_0010720 | 3300046694 | Bacteria | 5397 |
| 649 | Ga0495589_0000389 | 3300046794 | Bacteria | 33643 |
| 650 | Ga0495660_0000655 | 3300046810 | Bacteria | 26804 |
| 651 | Ga0495660_0003414 | 3300046810 | Bacteria | 9832 |
| 652 | Ga0495604_0163723 | 3300047317 | Bacteria | 1570 |
| 653 | Ga0495636_0004874 | 3300047318 | Bacteria | 5256 |
| 654 | Ga0495636_0009636 | 3300047318 | Bacteria | 3804 |
| 655 | Ga0495672_0045597 | 3300047320 | Bacteria | 2622 |
| 656 | Ga0495680_0119704 | 3300047322 | Bacteria | 1945 |
| 657 | Ga0495683_0003102 | 3300047323 | Bacteria | 9738 |
| 658 | Ga0495679_000382 | 3300047446 | Bacteria | 33973 |
| 659 | Ga0495685_012325 | 3300047447 | Bacteria | 2896 |
| 660 | Ga0495673_0000038 | 3300047469 | Bacteria | 303785 |
| 661 | Ga0495673_0000685 | 3300047469 | Bacteria | 33195 |
| 662 | Ga0495673_0001420 | 3300047469 | Bacteria | 19197 |
| 663 | Ga0495686_0000050 | 3300047472 | Bacteria | 269010 |
| 664 | Ga0495686_0003791 | 3300047472 | Bacteria | 12840 |
| 665 | Ga0495686_0006806 | 3300047472 | Bacteria | 8675 |
| 666 | Ga0495686_0012650 | 3300047472 | Bacteria | 5896 |
| 667 | Ga0496100_0085615 | 3300048903 | Bacteria | 2139 |
| 668 | Ga0496101_0133859 | 3300048904 | Bacteria | 1884 |
| 669 | Ga0496102_0063280 | 3300048905 | Bacteria | 3387 |
| 670 | Ga0496102_0069440 | 3300048905 | Bacteria | 3234 |
| 671 | Ga0496104_0001740 | 3300048907 | Bacteria | 18804 |
| 672 | Ga0496104_0118543 | 3300048907 | Bacteria | 2541 |
| 673 | Ga0496105_0000024 | 3300048908 | Bacteria | 153740 |
| 674 | Ga0496105_0003721 | 3300048908 | Bacteria | 11354 |
| 675 | Ga0496106_0004672 | 3300048909 | Bacteria | 10156 |
| 676 | Ga0496108_0010770 | 3300048911 | Bacteria | 7423 |
| 677 | Ga0496112_0028515 | 3300048915 | Bacteria | 5389 |
| 678 | Ga0496113_0023533 | 3300048916 | Bacteria | 4368 |
| 679 | Ga0496115_0000076 | 3300048918 | Bacteria | 90063 |
| 680 | Ga0496115_0001176 | 3300048918 | Bacteria | 18772 |
| 681 | Ga0496115_0003968 | 3300048918 | Bacteria | 10674 |
| 682 | Ga0496115_0006604 | 3300048918 | Bacteria | 8501 |
| 683 | Ga0496115_0014844 | 3300048918 | Bacteria | 5908 |
| 684 | Ga0496116_0037978 | 3300048919 | Bacteria | 3351 |
| 685 | Ga0496116_0073665 | 3300048919 | Bacteria | 2151 |
| 686 | Ga0496117_0011491 | 3300048920 | Bacteria | 7926 |
| 687 | Ga0496117_0018758 | 3300048920 | Bacteria | 5714 |
| 688 | Ga0496117_0042644 | 3300048920 | Bacteria | 3309 |
| 689 | Ga0496117_0058459 | 3300048920 | Bacteria | 2670 |
| 690 | Ga0496118_0002146 | 3300048921 | Bacteria | 27521 |
| 691 | Ga0496118_0003339 | 3300048921 | Bacteria | 20305 |
| 692 | Ga0496118_0006168 | 3300048921 | Bacteria | 13286 |
| 693 | Ga0496118_0007238 | 3300048921 | Bacteria | 11841 |
| 694 | Ga0496118_0013900 | 3300048921 | Bacteria | 7572 |
| 695 | Ga0496118_0015640 | 3300048921 | Bacteria | 7010 |
| 696 | Ga0496119_0000725 | 3300048922 | Bacteria | 44399 |
| 697 | Ga0496119_0004544 | 3300048922 | Bacteria | 13750 |
| 698 | Ga0496119_0023306 | 3300048922 | Bacteria | 4397 |
| 699 | Ga0496120_0000821 | 3300048923 | Bacteria | 44390 |
| 700 | Ga0496120_0002936 | 3300048923 | Bacteria | 16270 |
| 701 | Ga0496121_0000785 | 3300048924 | Bacteria | 58011 |
| 702 | Ga0496121_0001206 | 3300048924 | Bacteria | 45212 |
| 703 | Ga0496121_0005164 | 3300048924 | Bacteria | 16951 |
| 704 | Ga0496121_0008379 | 3300048924 | Bacteria | 12189 |
| 705 | Ga0496121_0029483 | 3300048924 | Bacteria | 5072 |
| 706 | Ga0496121_0042594 | 3300048924 | Bacteria | 3945 |
| 707 | Ga0496121_0065825 | 3300048924 | Bacteria | 2946 |
| 708 | Ga0496121_0079696 | 3300048924 | Bacteria | 2599 |
| 709 | Ga0496122_0000710 | 3300048925 | Bacteria | 65728 |
| 710 | Ga0496122_0013782 | 3300048925 | Bacteria | 7878 |
| 711 | Ga0496122_0043368 | 3300048925 | Bacteria | 3526 |
| 712 | Ga0496122_0076751 | 3300048925 | Bacteria | 2350 |
| 713 | Ga0496123_0000104 | 3300048926 | Bacteria | 168230 |
| 714 | Ga0496123_0000323 | 3300048926 | Bacteria | 91212 |
| 715 | Ga0496123_0013735 | 3300048926 | Bacteria | 6770 |
| 716 | Ga0496123_0023025 | 3300048926 | Bacteria | 4782 |
| 717 | Ga0496125_0001643 | 3300048928 | Bacteria | 31509 |
| 718 | Ga0496125_0004570 | 3300048928 | Bacteria | 15867 |
| 719 | Ga0496126_0002348 | 3300048929 | Bacteria | 25869 |
| 720 | Ga0496126_0004216 | 3300048929 | Bacteria | 17325 |
| 721 | Ga0496126_0014412 | 3300048929 | Bacteria | 7993 |
| 722 | Ga0496126_0022143 | 3300048929 | Bacteria | 6191 |
| 723 | Ga0496126_0107565 | 3300048929 | Bacteria | 2432 |
| 724 | Ga0495678_001183 | 3300049459 | Bacteria | 21492 |
| 725 | Ga0495678_004683 | 3300049459 | Bacteria | 7829 |
| 726 | Ga0495682_0010218 | 3300049460 | Bacteria | 3645 |
| 727 | Ga0501290_001903 | 3300049513 | Bacteria | 2760 |
| 728 | Ga0501031_0003654 | 3300049568 | Bacteria | 9899 |
| 729 | Ga0501031_0031363 | 3300049568 | Bacteria | 3467 |
| 730 | Ga0501031_0078119 | 3300049568 | Bacteria | 2156 |
| 731 | Ga0501032_0005214 | 3300049569 | Bacteria | 9671 |
| 732 | Ga0501032_0011217 | 3300049569 | Bacteria | 6437 |
| 733 | Ga0501032_0017236 | 3300049569 | Bacteria | 5072 |
| 734 | Ga0501032_0044311 | 3300049569 | Bacteria | 3012 |
| 735 | Ga0501033_0001723 | 3300049570 | Bacteria | 19140 |
| 736 | Ga0501033_0019751 | 3300049570 | Bacteria | 5092 |
| 737 | Ga0501034_0007235 | 3300049571 | Bacteria | 11844 |
| 738 | Ga0501034_0007682 | 3300049571 | Bacteria | 11473 |
| 739 | Ga0501034_0014956 | 3300049571 | Bacteria | 7982 |
| 740 | Ga0501034_0091016 | 3300049571 | Bacteria | 3048 |
| 741 | Ga0501034_0092426 | 3300049571 | Bacteria | 3022 |
| 742 | Ga0501034_0096953 | 3300049571 | Bacteria | 2944 |
| 743 | Ga0501036_0001984 | 3300049572 | Bacteria | 15878 |
| 744 | Ga0501036_0011674 | 3300049572 | Bacteria | 7280 |
| 745 | Ga0501036_0017902 | 3300049572 | Bacteria | 5932 |
| 746 | Ga0501037_0006068 | 3300049573 | Bacteria | 8825 |
| 747 | Ga0501038_0001563 | 3300049574 | Bacteria | 21191 |
| 748 | Ga0501038_0006223 | 3300049574 | Bacteria | 11035 |
| 749 | Ga0501038_0026871 | 3300049574 | Bacteria | 5125 |
| 750 | Ga0501038_0032742 | 3300049574 | Bacteria | 4583 |
| 751 | Ga0501039_0006491 | 3300049575 | Bacteria | 8893 |
| 752 | Ga0501043_0007714 | 3300049579 | Bacteria | 8521 |
| 753 | Ga0501043_0023271 | 3300049579 | Bacteria | 4858 |
| 754 | Ga0501043_0061643 | 3300049579 | Bacteria | 2945 |
| 755 | Ga0501043_0105408 | 3300049579 | Bacteria | 2215 |
| 756 | Ga0501043_0118843 | 3300049579 | Bacteria | 2073 |
| 757 | Ga0501043_0172476 | 3300049579 | Bacteria | 1687 |
| 758 | Ga0501043_0201961 | 3300049579 | Bacteria | 1542 |
| 759 | Ga0501046_0003875 | 3300049580 | Bacteria | 13681 |
| 760 | Ga0501046_0004129 | 3300049580 | Bacteria | 13232 |
| 761 | Ga0501046_0017806 | 3300049580 | Bacteria | 5926 |
| 762 | Ga0501046_0087088 | 3300049580 | Bacteria | 2407 |
| 763 | Ga0501046_0125753 | 3300049580 | Bacteria | 1948 |
| 764 | Ga0501047_0000735 | 3300049581 | Bacteria | 34114 |
| 765 | Ga0501047_0001965 | 3300049581 | Bacteria | 19740 |
| 766 | Ga0501047_0003794 | 3300049581 | Bacteria | 14214 |
| 767 | Ga0501047_0005660 | 3300049581 | Bacteria | 11765 |
| 768 | Ga0501047_0007103 | 3300049581 | Bacteria | 10516 |
| 769 | Ga0501047_0013105 | 3300049581 | Bacteria | 7852 |
| 770 | Ga0501047_0020505 | 3300049581 | Bacteria | 6346 |
| 771 | Ga0501047_0022991 | 3300049581 | Bacteria | 5984 |
| 772 | Ga0501047_0090404 | 3300049581 | Bacteria | 2938 |
| 773 | Ga0501047_0141987 | 3300049581 | Bacteria | 2279 |
| 774 | Ga0501048_0074095 | 3300049582 | Bacteria | 2402 |
| 775 | Ga0501067_0047025 | 3300049583 | Bacteria | 2394 |
| 776 | Ga0501069_0000559 | 3300049585 | Bacteria | 17150 |
| 777 | Ga0501069_0002244 | 3300049585 | Bacteria | 9741 |
| 778 | Ga0501069_0004048 | 3300049585 | Bacteria | 7571 |
| 779 | Ga0501070_0001793 | 3300049586 | Bacteria | 18953 |
| 780 | Ga0501070_0003552 | 3300049586 | Bacteria | 13485 |
| 781 | Ga0501070_0005263 | 3300049586 | Bacteria | 11032 |
| 782 | Ga0501070_0011009 | 3300049586 | Bacteria | 7635 |
| 783 | Ga0501070_0053198 | 3300049586 | Bacteria | 3359 |
| 784 | Ga0501070_0112433 | 3300049586 | Bacteria | 2250 |
| 785 | Ga0501070_0113314 | 3300049586 | Bacteria | 2241 |
| 786 | Ga0501070_0249048 | 3300049586 | Bacteria | 1453 |
| 787 | Ga0501070_0253561 | 3300049586 | Bacteria | 1439 |
| 788 | Ga0501071_0010240 | 3300049587 | Bacteria | 6276 |
| 789 | Ga0501072_0014884 | 3300049588 | Bacteria | 5962 |
| 790 | Ga0501073_0001609 | 3300049589 | Bacteria | 16719 |
| 791 | Ga0501073_0006429 | 3300049589 | Bacteria | 8747 |
| 792 | Ga0501073_0009627 | 3300049589 | Bacteria | 7126 |
| 793 | Ga0501073_0065864 | 3300049589 | Bacteria | 2525 |
| 794 | Ga0501073_0085774 | 3300049589 | Bacteria | 2190 |
| 795 | Ga0501074_0000819 | 3300049590 | Bacteria | 19705 |
| 796 | Ga0501074_0043163 | 3300049590 | Bacteria | 3263 |
| 797 | Ga0501074_0078236 | 3300049590 | Bacteria | 2373 |
| 798 | Ga0501074_0105380 | 3300049590 | Bacteria | 2018 |
| 799 | Ga0501077_0005147 | 3300049593 | Bacteria | 7944 |
| 800 | Ga0501077_0024988 | 3300049593 | Bacteria | 3793 |
| 801 | Ga0501225_0009773 | 3300049705 | Bacteria | 2725 |
| 802 | Ga0501079_0007742 | 3300049741 | Bacteria | 8134 |
| 803 | Ga0501079_0044584 | 3300049741 | Bacteria | 3422 |
| 804 | Ga0501080_0007181 | 3300049742 | Bacteria | 10054 |
| 805 | Ga0501080_0008242 | 3300049742 | Bacteria | 9437 |
| 806 | Ga0501080_0013258 | 3300049742 | Bacteria | 7572 |
| 807 | Ga0501080_0016038 | 3300049742 | Bacteria | 6914 |
| 808 | Ga0501083_0003789 | 3300049744 | Bacteria | 10619 |
| 809 | Ga0501083_0010617 | 3300049744 | Bacteria | 6483 |
| 810 | Ga0501083_0130064 | 3300049744 | Bacteria | 1650 |
| 811 | Ga0501035_0021264 | 3300049822 | Bacteria | 5964 |
| 812 | Ga0501035_0043573 | 3300049822 | Bacteria | 4043 |
| 813 | Ga0501035_0089245 | 3300049822 | Bacteria | 2715 |
| 814 | Ga0501035_0133645 | 3300049822 | Bacteria | 2161 |
| 815 | Ga0501035_0133652 | 3300049822 | Bacteria | 2161 |
| 816 | Ga0501035_0175543 | 3300049822 | Bacteria | 1848 |
| 817 | Ga0501044_0004108 | 3300049823 | Bacteria | 16325 |
| 818 | Ga0501044_0006723 | 3300049823 | Bacteria | 12679 |
| 819 | Ga0501044_0007183 | 3300049823 | Bacteria | 12250 |
| 820 | Ga0501044_0009324 | 3300049823 | Bacteria | 10708 |
| 821 | Ga0501044_0020832 | 3300049823 | Bacteria | 6999 |
| 822 | Ga0501044_0031765 | 3300049823 | Bacteria | 5554 |
| 823 | Ga0501044_0033147 | 3300049823 | Bacteria | 5428 |
| 824 | Ga0501044_0105675 | 3300049823 | Bacteria | 2828 |
| 825 | nmdc:mga00v17_476_c1 | 3300050491 | Bacteria | 22518 |
| 826 | nmdc:mga04h51_10808_c1 | 3300050495 | Bacteria | 2517 |
| 827 | nmdc:mga08x19_55341_c1 | 3300050514 | Bacteria | 2557 |
| 828 | Ga0500610_0007052 | 3300053079 | Bacteria | 4775 |
| 829 | Ga0500643_000378 | 3300053087 | Bacteria | 34748 |
| 830 | Ga0500643_001849 | 3300053087 | Bacteria | 11549 |
| 831 | Ga0500651_0001642 | 3300053093 | Bacteria | 11382 |
| 832 | Ga0500651_0005370 | 3300053093 | Bacteria | 7312 |
| 833 | Ga0500555_009745 | 3300053103 | Bacteria | 2749 |
| 834 | Ga0500597_000153 | 3300053120 | Bacteria | 13817 |
| 835 | Ga0500568_0006147 | 3300053139 | Bacteria | 6074 |
| 836 | Ga0500634_0000363 | 3300053161 | Bacteria | 14395 |
| 837 | Ga0500645_001468 | 3300053730 | Bacteria | 11856 |
| 838 | Ga0501084_0026745 | 3300054114 | Bacteria | 4818 |
| 839 | Ga0501084_0027347 | 3300054114 | Bacteria | 4766 |
| 840 | Ga0501084_0108352 | 3300054114 | Bacteria | 2334 |
| 841 | Ga0501084_0127209 | 3300054114 | Bacteria | 2144 |
| 842 | Ga0501084_0137876 | 3300054114 | Bacteria | 2054 |
| 843 | Ga0501082_0000107 | 3300060353 | Bacteria | 65178 |
| 844 | Ga0501082_0050029 | 3300060353 | Bacteria | 3604 |
| 845 | Ga0501082_0067913 | 3300060353 | Bacteria | 3070 |
| 846 | Ga0466962_0002150 | 3300061719 | Bacteria | 9314 |
| 847 | Ga0466962_0025534 | 3300061719 | Bacteria | 2836 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047317 | Ga0495604_0163723 | Ga0495604_0163723_273_1553 | 386 |
| 2 | 3300036712 | Ga0316584_0182710 | Ga0316584_0182710_44_1345 | 394 |
| 3 | 3300002067 | JGI24735J21928_10000400 | JGI24735J21928_1000040010 | 405 |
| 4 | 3300026089 | Ga0207648_10174421 | Ga0207648_101744211 | 407 |
| 5 | 3300050514 | nmdc:mga08x19_55341_c1 | nmdc:mga08x19_55341_c1_13_1263 | 410 |
| 6 | 3300025921 | Ga0207652_10024942 | Ga0207652_100249422 | 411 |
| 7 | 3300060353 | Ga0501082_0050029 | Ga0501082_0050029_2279_3589 | 411 |
| 8 | 3300041452 | Ga0451793_0125667 | Ga0451793_0125667_121_1557 | 415 |
| 9 | 3300042000 | Ga0439437_006103 | Ga0439437_006103_57_1319 | 415 |
| 10 | 3300013104 | Ga0157370_10007352 | Ga0157370_100073524 | 416 |
| 11 | 3300015265 | Ga0182005_1001074 | Ga0182005_10010743 | 416 |
| 12 | 3300048919 | Ga0496116_0037978 | Ga0496116_0037978_1851_3209 | 416 |
| 13 | 3300048918 | Ga0496115_0000076 | Ga0496115_0000076_81189_82505 | 417 |
| 14 | 3300048929 | Ga0496126_0004216 | Ga0496126_0004216_8451_9767 | 417 |
| 15 | 3300049569 | Ga0501032_0044311 | Ga0501032_0044311_1611_2960 | 418 |
| 16 | 3300049571 | Ga0501034_0096953 | Ga0501034_0096953_997_2346 | 418 |
| 17 | 3300049579 | Ga0501043_0105408 | Ga0501043_0105408_263_1612 | 418 |
| 18 | 3300049580 | Ga0501046_0087088 | Ga0501046_0087088_173_1522 | 418 |
| 19 | 3300049581 | Ga0501047_0090404 | Ga0501047_0090404_997_2346 | 418 |
| 20 | 3300049586 | Ga0501070_0249048 | Ga0501070_0249048_73_1422 | 418 |
| 21 | 3300046519 | Ga0495632_0000005 | Ga0495632_0000005_354333_355691 | 419 |
| 22 | 3300005367 | Ga0070667_100005927 | Ga0070667_1000059278 | 420 |
| 23 | 3300005548 | Ga0070665_100000028 | Ga0070665_100000028196 | 420 |
| 24 | 3300025986 | Ga0207658_10004314 | Ga0207658_100043145 | 420 |
| 25 | 3300028379 | Ga0268266_10000017 | Ga0268266_10000017340 | 420 |
| 26 | 3300041494 | Ga0451837_0182006 | Ga0451837_0182006_509_1867 | 420 |
| 27 | 3300046492 | Ga0495585_0000024 | Ga0495585_0000024_139019_140377 | 420 |
| 28 | 3300046518 | Ga0495631_0001428 | Ga0495631_0001428_4904_6262 | 420 |
| 29 | 3300046524 | Ga0495648_0000485 | Ga0495648_0000485_7990_9348 | 420 |
| 30 | 3300046665 | Ga0495661_0001759 | Ga0495661_0001759_1568_2926 | 420 |
| 31 | 3300053730 | Ga0500645_001468 | Ga0500645_001468_7641_8999 | 420 |
| 32 | 3300041404 | Ga0439436_0019013 | Ga0439436_0019013_149_1540 | 421 |
| 33 | 3300005366 | Ga0070659_100161209 | Ga0070659_1001612092 | 422 |
| 34 | 3300013100 | Ga0157373_10078911 | Ga0157373_100789112 | 422 |
| 35 | 3300013306 | Ga0163162_10000004 | Ga0163162_10000004155 | 422 |
| 36 | 3300015689 | Ga0183360_10003 | Ga0183360_1000315 | 422 |
| 37 | 3300037418 | Ga0395900_0006056 | Ga0395900_0006056_7107_8561 | 422 |
| 38 | 3300044684 | Ga0466966_0013312 | Ga0466966_0013312_2053_3408 | 422 |
| 39 | 3300046507 | Ga0495606_0002137 | Ga0495606_0002137_14489_15847 | 422 |
| 40 | 3300046660 | Ga0495625_0058723 | Ga0495625_0058723_97_1455 | 422 |
| 41 | 3300006881 | Ga0068865_100001222 | Ga0068865_10000122212 | 423 |
| 42 | 3300009176 | Ga0105242_10004683 | Ga0105242_100046838 | 423 |
| 43 | 3300013104 | Ga0157370_10032654 | Ga0157370_100326543 | 423 |
| 44 | 3300013306 | Ga0163162_10006588 | Ga0163162_100065888 | 423 |
| 45 | 3300013308 | Ga0157375_10000561 | Ga0157375_1000056120 | 423 |
| 46 | 3300025904 | Ga0207647_10000130 | Ga0207647_1000013014 | 423 |
| 47 | 3300025934 | Ga0207686_10002229 | Ga0207686_1000222910 | 423 |
| 48 | 3300025938 | Ga0207704_10001141 | Ga0207704_1000114111 | 423 |
| 49 | 3300032004 | Ga0307414_10016393 | Ga0307414_100163933 | 423 |
| 50 | 3300035111 | Ga0373923_0042124 | Ga0373923_0042124_213_1604 | 423 |
| 51 | 3300048907 | Ga0496104_0001740 | Ga0496104_0001740_7666_9057 | 423 |
| 52 | 3300048908 | Ga0496105_0000024 | Ga0496105_0000024_7694_9085 | 423 |
| 53 | 3300048921 | Ga0496118_0003339 | Ga0496118_0003339_14173_15531 | 423 |
| 54 | 3300048924 | Ga0496121_0001206 | Ga0496121_0001206_35574_36932 | 423 |
| 55 | 3300048925 | Ga0496122_0043368 | Ga0496122_0043368_1112_2470 | 423 |
| 56 | 3300048928 | Ga0496125_0004570 | Ga0496125_0004570_13566_14924 | 423 |
| 57 | 3300050495 | nmdc:mga04h51_10808_c1 | nmdc:mga04h51_10808_c1_606_1898 | 423 |
| 58 | 3300009101 | Ga0105247_10004712 | Ga0105247_100047124 | 424 |
| 59 | 3300015261 | Ga0182006_1000461 | Ga0182006_100046110 | 424 |
| 60 | 3300015265 | Ga0182005_1001234 | Ga0182005_10012345 | 424 |
| 61 | 3300025900 | Ga0207710_10002997 | Ga0207710_100029975 | 424 |
| 62 | 3300046810 | Ga0495660_0003414 | Ga0495660_0003414_7875_9233 | 424 |
| 63 | 3300047469 | Ga0495673_0000038 | Ga0495673_0000038_7932_9290 | 424 |
| 64 | 3300048924 | Ga0496121_0005164 | Ga0496121_0005164_8170_9528 | 424 |
| 65 | 3300005539 | Ga0068853_100065038 | Ga0068853_1000650382 | 425 |
| 66 | 3300009098 | Ga0105245_10054644 | Ga0105245_100546443 | 425 |
| 67 | 3300025914 | Ga0207671_10005317 | Ga0207671_100053175 | 425 |
| 68 | 3300025927 | Ga0207687_10082099 | Ga0207687_100820991 | 425 |
| 69 | 3300026041 | Ga0207639_10001365 | Ga0207639_100013655 | 425 |
| 70 | 3300046683 | Ga0495658_0087600 | Ga0495658_0087600_16_1395 | 425 |
| 71 | 3300049571 | Ga0501034_0091016 | Ga0501034_0091016_599_1918 | 425 |
| 72 | 3300049586 | Ga0501070_0053198 | Ga0501070_0053198_746_2065 | 425 |
| 73 | 3300049590 | Ga0501074_0043163 | Ga0501074_0043163_830_2149 | 425 |
| 74 | 3300054114 | Ga0501084_0137876 | Ga0501084_0137876_543_1862 | 425 |
| 75 | 3300005344 | Ga0070661_100001549 | Ga0070661_1000015494 | 426 |
| 76 | 3300005563 | Ga0068855_100155108 | Ga0068855_1001551083 | 426 |
| 77 | 3300025913 | Ga0207695_10003828 | Ga0207695_1000382811 | 426 |
| 78 | 3300025920 | Ga0207649_10005381 | Ga0207649_100053818 | 426 |
| 79 | 3300025924 | Ga0207694_10094822 | Ga0207694_100948222 | 426 |
| 80 | 3300025949 | Ga0207667_10053029 | Ga0207667_100530293 | 426 |
| 81 | 3300025981 | Ga0207640_10019869 | Ga0207640_100198694 | 426 |
| 82 | 3300048907 | Ga0496104_0118543 | Ga0496104_0118543_16_1335 | 426 |
| 83 | 3300025298 | Ga0209050_1002489 | Ga0209050_100248912 | 427 |
| 84 | 3300025303 | Ga0209051_1008280 | Ga0209051_10082803 | 427 |
| 85 | 3300025304 | Ga0209257_1004860 | Ga0209257_10048603 | 427 |
| 86 | 3300041460 | Ga0451802_0337161 | Ga0451802_0337161_773_2245 | 427 |
| 87 | 3300003771 | Ga0055526_1000082 | Ga0055526_100008261 | 428 |
| 88 | 3300003773 | Ga0055537_1000228 | Ga0055537_100022821 | 428 |
| 89 | 3300003775 | Ga0055524_1000138 | Ga0055524_100013817 | 428 |
| 90 | 3300003784 | Ga0055534_1000056 | Ga0055534_100005617 | 428 |
| 91 | 3300003790 | Ga0055528_1000061 | Ga0055528_100006117 | 428 |
| 92 | 3300007265 | Ga0099794_10008738 | Ga0099794_100087383 | 428 |
| 93 | 3300009551 | Ga0105238_10010170 | Ga0105238_100101704 | 428 |
| 94 | 3300013105 | Ga0157369_10000021 | Ga0157369_1000002111 | 428 |
| 95 | 3300025263 | Ga0209565_1000002 | Ga0209565_100000216 | 428 |
| 96 | 3300025273 | Ga0209673_1000002 | Ga0209673_100000216 | 428 |
| 97 | 3300025291 | Ga0209675_1000002 | Ga0209675_100000216 | 428 |
| 98 | 3300025295 | Ga0209564_1000004 | Ga0209564_100000417 | 428 |
| 99 | 3300025299 | Ga0209256_1000004 | Ga0209256_100000417 | 428 |
| 100 | 3300025913 | Ga0207695_10037019 | Ga0207695_100370194 | 428 |
| 101 | 3300025914 | Ga0207671_10005233 | Ga0207671_100052334 | 428 |
| 102 | 3300025924 | Ga0207694_10001363 | Ga0207694_1000136314 | 428 |
| 103 | 3300003794 | Ga0055531_10005953 | Ga0055531_100059532 | 429 |
| 104 | 3300025294 | Ga0209025_1035732 | Ga0209025_10357322 | 429 |
| 105 | 3300025304 | Ga0209257_1000499 | Ga0209257_100049914 | 429 |
| 106 | 3300003578 | Ga0006562J51391_1035852 | Ga0006562J51391_10358527 | 430 |
| 107 | 3300047472 | Ga0495686_0000050 | Ga0495686_0000050_8125_9483 | 430 |
| 108 | 3300048920 | Ga0496117_0058459 | Ga0496117_0058459_156_1514 | 430 |
| 109 | 3300048921 | Ga0496118_0015640 | Ga0496118_0015640_1710_3068 | 430 |
| 110 | iso_pu_bacteria | 2643221559 | 2643816047 | 430 |
| 111 | iso_pu_bacteria | 2643221586 | 2643939123 | 430 |
| 112 | iso_pu_bacteria | 2643221612 | 2644077814 | 430 |
| 113 | iso_pu_bacteria | 2643221727 | 2644697085 | 430 |
| 114 | 3300046558 | Ga0495633_0010517 | Ga0495633_0010517_685_2040 | 431 |
| 115 | 3300049579 | Ga0501043_0023271 | Ga0501043_0023271_169_1617 | 431 |
| 116 | 3300049580 | Ga0501046_0004129 | Ga0501046_0004129_11464_12912 | 431 |
| 117 | 3300049582 | Ga0501048_0074095 | Ga0501048_0074095_21_1469 | 431 |
| 118 | 3300053161 | Ga0500634_0000363 | Ga0500634_0000363_12502_13857 | 431 |
| 119 | 3300013105 | Ga0157369_10010042 | Ga0157369_1001004210 | 432 |
| 120 | 3300025923 | Ga0207681_10027339 | Ga0207681_100273392 | 432 |
| 121 | 3300031691 | Ga0316579_10031405 | Ga0316579_100314053 | 432 |
| 122 | 3300031728 | Ga0316578_10019084 | Ga0316578_100190844 | 432 |
| 123 | 3300036647 | Ga0316582_0020981 | Ga0316582_0020981_55_1422 | 432 |
| 124 | 3300036712 | Ga0316584_0076263 | Ga0316584_0076263_445_1812 | 432 |
| 125 | 3300044658 | Ga0466972_0007010 | Ga0466972_0007010_1765_3201 | 432 |
| 126 | 3300044735 | Ga0466968_0001344 | Ga0466968_0001344_7348_8706 | 432 |
| 127 | 3300044765 | Ga0466970_0000349 | Ga0466970_0000349_9617_11053 | 432 |
| 128 | 3300049741 | Ga0501079_0044584 | Ga0501079_0044584_1574_2947 | 432 |
| 129 | 3300054114 | Ga0501084_0108352 | Ga0501084_0108352_520_1893 | 432 |
| 130 | 3300005336 | Ga0070680_100050969 | Ga0070680_1000509691 | 433 |
| 131 | 3300005530 | Ga0070679_100011025 | Ga0070679_1000110258 | 433 |
| 132 | 3300005549 | Ga0070704_100004431 | Ga0070704_1000044312 | 433 |
| 133 | 3300006173 | Ga0070716_100014594 | Ga0070716_1000145943 | 433 |
| 134 | 3300006914 | Ga0075436_100003116 | Ga0075436_1000031169 | 433 |
| 135 | 3300007265 | Ga0099794_10005753 | Ga0099794_100057533 | 433 |
| 136 | 3300025911 | Ga0207654_10005801 | Ga0207654_100058012 | 433 |
| 137 | 3300049568 | Ga0501031_0003654 | Ga0501031_0003654_2541_3989 | 433 |
| 138 | 3300049569 | Ga0501032_0017236 | Ga0501032_0017236_2731_4179 | 433 |
| 139 | 3300049570 | Ga0501033_0019751 | Ga0501033_0019751_1122_2570 | 433 |
| 140 | 3300049574 | Ga0501038_0001563 | Ga0501038_0001563_5029_6477 | 433 |
| 141 | 3300049581 | Ga0501047_0007103 | Ga0501047_0007103_322_1770 | 433 |
| 142 | 3300049589 | Ga0501073_0009627 | Ga0501073_0009627_3865_5313 | 433 |
| 143 | 3300005467 | Ga0070706_100023729 | Ga0070706_1000237292 | 434 |
| 144 | 3300005843 | Ga0068860_100017405 | Ga0068860_1000174057 | 434 |
| 145 | 3300006038 | Ga0075365_10008292 | Ga0075365_100082924 | 434 |
| 146 | 3300006051 | Ga0075364_10001706 | Ga0075364_100017065 | 434 |
| 147 | 3300013296 | Ga0157374_10004992 | Ga0157374_100049927 | 434 |
| 148 | 3300028381 | Ga0268264_10004127 | Ga0268264_100041276 | 434 |
| 149 | 3300032004 | Ga0307414_10085553 | Ga0307414_100855532 | 434 |
| 150 | 3300039437 | Ga0436365_1537398 | Ga0436365_1537398_69_1385 | 434 |
| 151 | 3300047472 | Ga0495686_0003791 | Ga0495686_0003791_8367_9725 | 434 |
| 152 | 3300048915 | Ga0496112_0028515 | Ga0496112_0028515_2228_3658 | 434 |
| 153 | 3300049579 | Ga0501043_0172476 | Ga0501043_0172476_314_1648 | 434 |
| 154 | 3300049580 | Ga0501046_0017806 | Ga0501046_0017806_2818_4149 | 434 |
| 155 | 3300049581 | Ga0501047_0000735 | Ga0501047_0000735_27448_28779 | 434 |
| 156 | 3300049742 | Ga0501080_0016038 | Ga0501080_0016038_5091_6422 | 434 |
| 157 | 3300050491 | nmdc:mga00v17_476_c1 | nmdc:mga00v17_476_c1_15451_16827 | 434 |
| 158 | 3300060353 | Ga0501082_0067913 | Ga0501082_0067913_1446_2777 | 434 |
| 159 | 3300005262 | Ga0065165_1000887 | Ga0065165_100088732 | 435 |
| 160 | 3300005331 | Ga0070670_100065037 | Ga0070670_1000650372 | 435 |
| 161 | 3300005530 | Ga0070679_100183465 | Ga0070679_1001834651 | 435 |
| 162 | 3300005546 | Ga0070696_100009437 | Ga0070696_1000094372 | 435 |
| 163 | 3300005614 | Ga0068856_100135247 | Ga0068856_1001352473 | 435 |
| 164 | 3300005834 | Ga0068851_10025083 | Ga0068851_100250832 | 435 |
| 165 | 3300005843 | Ga0068860_100076005 | Ga0068860_1000760053 | 435 |
| 166 | 3300025254 | Ga0209148_1000912 | Ga0209148_100091211 | 435 |
| 167 | 3300025302 | Ga0207426_1003250 | Ga0207426_10032507 | 435 |
| 168 | 3300025909 | Ga0207705_10086094 | Ga0207705_100860942 | 435 |
| 169 | 3300025912 | Ga0207707_10017863 | Ga0207707_100178637 | 435 |
| 170 | 3300025919 | Ga0207657_10011362 | Ga0207657_100113624 | 435 |
| 171 | 3300025949 | Ga0207667_10075450 | Ga0207667_100754503 | 435 |
| 172 | 3300026041 | Ga0207639_10102207 | Ga0207639_101022073 | 435 |
| 173 | 3300026116 | Ga0207674_10025688 | Ga0207674_100256882 | 435 |
| 174 | 3300028381 | Ga0268264_10112314 | Ga0268264_101123143 | 435 |
| 175 | 3300048909 | Ga0496106_0004672 | Ga0496106_0004672_1883_3241 | 435 |
| 176 | 3300048924 | Ga0496121_0065825 | Ga0496121_0065825_1040_2398 | 435 |
| 177 | 3300003187 | JGI25151J46595_10026595 | JGI25151J46595_100265951 | 436 |
| 178 | 3300003781 | Ga0055536_1007776 | Ga0055536_10077763 | 436 |
| 179 | 3300005335 | Ga0070666_10009658 | Ga0070666_100096584 | 436 |
| 180 | 3300013307 | Ga0157372_10017223 | Ga0157372_100172234 | 436 |
| 181 | 3300014497 | Ga0182008_10003053 | Ga0182008_100030539 | 436 |
| 182 | 3300015261 | Ga0182006_1001147 | Ga0182006_10011478 | 436 |
| 183 | 3300015265 | Ga0182005_1001072 | Ga0182005_10010729 | 436 |
| 184 | 3300015685 | Ga0183369_1011 | Ga0183369_101118 | 436 |
| 185 | 3300025284 | Ga0209130_1003339 | Ga0209130_10033395 | 436 |
| 186 | 3300025292 | Ga0209676_1000830 | Ga0209676_100083021 | 436 |
| 187 | 3300025294 | Ga0209025_1009037 | Ga0209025_10090373 | 436 |
| 188 | 3300025295 | Ga0209564_1003164 | Ga0209564_10031649 | 436 |
| 189 | 3300025299 | Ga0209256_1004097 | Ga0209256_10040978 | 436 |
| 190 | 3300025299 | Ga0209256_1004516 | Ga0209256_10045162 | 436 |
| 191 | 3300025304 | Ga0209257_1003235 | Ga0209257_10032359 | 436 |
| 192 | 3300031548 | Ga0307408_100041048 | Ga0307408_1000410482 | 436 |
| 193 | 3300031911 | Ga0307412_10016904 | Ga0307412_100169042 | 436 |
| 194 | 3300035398 | Ga0316574_0095604 | Ga0316574_0095604_410_1741 | 436 |
| 195 | 3300037312 | Ga0395899_0029191 | Ga0395899_0029191_2048_3406 | 436 |
| 196 | 3300037418 | Ga0395900_0001743 | Ga0395900_0001743_13621_14979 | 436 |
| 197 | 3300038443 | Ga0395901_0215678 | Ga0395901_0215678_264_1622 | 436 |
| 198 | 3300041404 | Ga0439436_0000019 | Ga0439436_0000019_7943_9301 | 436 |
| 199 | 3300041413 | Ga0439465_0011345 | Ga0439465_0011345_1151_2509 | 436 |
| 200 | 3300042184 | Ga0450908_000141 | Ga0450908_000141_8166_9524 | 436 |
| 201 | 3300046452 | Ga0495617_000409 | Ga0495617_000409_8117_9475 | 436 |
| 202 | 3300046501 | Ga0495607_0001268 | Ga0495607_0001268_7975_9333 | 436 |
| 203 | 3300046501 | Ga0495607_0037446 | Ga0495607_0037446_837_2195 | 436 |
| 204 | 3300046507 | Ga0495606_0011896 | Ga0495606_0011896_3704_5062 | 436 |
| 205 | 3300046512 | Ga0495610_0005438 | Ga0495610_0005438_2322_3680 | 436 |
| 206 | 3300046515 | Ga0495620_0000889 | Ga0495620_0000889_7953_9311 | 436 |
| 207 | 3300046694 | Ga0495649_0010720 | Ga0495649_0010720_3630_4988 | 436 |
| 208 | 3300048922 | Ga0496119_0023306 | Ga0496119_0023306_2959_4317 | 436 |
| 209 | 3300048925 | Ga0496122_0013782 | Ga0496122_0013782_6078_7436 | 436 |
| 210 | 3300048926 | Ga0496123_0013735 | Ga0496123_0013735_3227_4585 | 436 |
| 211 | 3300049569 | Ga0501032_0011217 | Ga0501032_0011217_4163_5548 | 436 |
| 212 | 3300049571 | Ga0501034_0007235 | Ga0501034_0007235_6424_7809 | 436 |
| 213 | 3300049572 | Ga0501036_0001984 | Ga0501036_0001984_10781_12166 | 436 |
| 214 | 3300049579 | Ga0501043_0007714 | Ga0501043_0007714_6280_7716 | 436 |
| 215 | 3300049579 | Ga0501043_0118843 | Ga0501043_0118843_622_2007 | 436 |
| 216 | 3300049581 | Ga0501047_0001965 | Ga0501047_0001965_6735_8120 | 436 |
| 217 | 3300049585 | Ga0501069_0002244 | Ga0501069_0002244_2054_3439 | 436 |
| 218 | 3300049586 | Ga0501070_0005263 | Ga0501070_0005263_4444_5829 | 436 |
| 219 | 3300049589 | Ga0501073_0006429 | Ga0501073_0006429_6386_7771 | 436 |
| 220 | 3300049590 | Ga0501074_0000819 | Ga0501074_0000819_6757_8142 | 436 |
| 221 | 3300049741 | Ga0501079_0007742 | Ga0501079_0007742_4909_6294 | 436 |
| 222 | 3300049742 | Ga0501080_0013258 | Ga0501080_0013258_2152_3537 | 436 |
| 223 | 3300049744 | Ga0501083_0003789 | Ga0501083_0003789_6669_8054 | 436 |
| 224 | 3300049822 | Ga0501035_0175543 | Ga0501035_0175543_446_1810 | 436 |
| 225 | 3300049823 | Ga0501044_0007183 | Ga0501044_0007183_6369_7754 | 436 |
| 226 | 3300054114 | Ga0501084_0026745 | Ga0501084_0026745_888_2273 | 436 |
| 227 | 3300002737 | JGI25162J39368_1000239 | JGI25162J39368_100023913 | 437 |
| 228 | 3300002741 | JGI25157J39369_1000720 | JGI25157J39369_100072014 | 437 |
| 229 | 3300002771 | JGI25163J39215_1001261 | JGI25163J39215_10012611 | 437 |
| 230 | 3300002772 | JGI25164J39214_1000200 | JGI25164J39214_100020040 | 437 |
| 231 | 3300002772 | JGI25164J39214_1000605 | JGI25164J39214_100060513 | 437 |
| 232 | 3300003214 | JGI25165J46597_1000319 | JGI25165J46597_100031913 | 437 |
| 233 | 3300003756 | Ga0055533_1002005 | Ga0055533_10020055 | 437 |
| 234 | 3300003761 | Ga0055535_1000242 | Ga0055535_100024213 | 437 |
| 235 | 3300003762 | Ga0055542_1000298 | Ga0055542_100029839 | 437 |
| 236 | 3300003763 | Ga0055529_1000437 | Ga0055529_100043713 | 437 |
| 237 | 3300005563 | Ga0068855_100003293 | Ga0068855_1000032937 | 437 |
| 238 | 3300005578 | Ga0068854_100000504 | Ga0068854_10000050415 | 437 |
| 239 | 3300009093 | Ga0105240_10102964 | Ga0105240_101029642 | 437 |
| 240 | 3300009545 | Ga0105237_10028280 | Ga0105237_100282804 | 437 |
| 241 | 3300013307 | Ga0157372_10006803 | Ga0157372_100068034 | 437 |
| 242 | 3300017792 | Ga0163161_10032354 | Ga0163161_100323543 | 437 |
| 243 | 3300025207 | Ga0209760_102570 | Ga0209760_1025702 | 437 |
| 244 | 3300025224 | Ga0209784_100163 | Ga0209784_10016342 | 437 |
| 245 | 3300025226 | Ga0209674_100037 | Ga0209674_100037346 | 437 |
| 246 | 3300025228 | Ga0209672_101128 | Ga0209672_1011282 | 437 |
| 247 | 3300025231 | Ga0207427_100196 | Ga0207427_10019642 | 437 |
| 248 | 3300025233 | Ga0209437_100345 | Ga0209437_10034510 | 437 |
| 249 | 3300025242 | Ga0209258_100384 | Ga0209258_10038413 | 437 |
| 250 | 3300025246 | Ga0209646_1001674 | Ga0209646_10016741 | 437 |
| 251 | 3300025250 | Ga0209026_1000286 | Ga0209026_100028642 | 437 |
| 252 | 3300025254 | Ga0209148_1000047 | Ga0209148_100004713 | 437 |
| 253 | 3300025256 | Ga0209759_1001948 | Ga0209759_10019487 | 437 |
| 254 | 3300025258 | Ga0209129_1000331 | Ga0209129_10003315 | 437 |
| 255 | 3300025261 | Ga0209233_1000100 | Ga0209233_1000100257 | 437 |
| 256 | 3300025272 | Ga0209455_1000270 | Ga0209455_100027042 | 437 |
| 257 | 3300025913 | Ga0207695_10041168 | Ga0207695_100411682 | 437 |
| 258 | 3300025949 | Ga0207667_10000228 | Ga0207667_1000022861 | 437 |
| 259 | 3300025981 | Ga0207640_10000120 | Ga0207640_1000012045 | 437 |
| 260 | 3300044683 | Ga0466965_0009624 | Ga0466965_0009624_1201_2556 | 437 |
| 261 | 3300044693 | Ga0466961_0004931 | Ga0466961_0004931_2526_3881 | 437 |
| 262 | 3300044842 | Ga0466957_0002466 | Ga0466957_0002466_2120_3475 | 437 |
| 263 | 3300045836 | Ga0466958_0001914 | Ga0466958_0001914_6710_8065 | 437 |
| 264 | 3300046507 | Ga0495606_0000849 | Ga0495606_0000849_7362_8717 | 437 |
| 265 | 3300046557 | Ga0495622_0008038 | Ga0495622_0008038_3078_4433 | 437 |
| 266 | 3300046660 | Ga0495625_0049664 | Ga0495625_0049664_987_2342 | 437 |
| 267 | 3300047320 | Ga0495672_0045597 | Ga0495672_0045597_912_2270 | 437 |
| 268 | 3300048903 | Ga0496100_0085615 | Ga0496100_0085615_249_1607 | 437 |
| 269 | 3300048918 | Ga0496115_0003968 | Ga0496115_0003968_9246_10601 | 437 |
| 270 | 3300048918 | Ga0496115_0014844 | Ga0496115_0014844_74_1429 | 437 |
| 271 | 3300048925 | Ga0496122_0076751 | Ga0496122_0076751_977_2335 | 437 |
| 272 | 3300048929 | Ga0496126_0014412 | Ga0496126_0014412_5560_6915 | 437 |
| 273 | 3300048929 | Ga0496126_0107565 | Ga0496126_0107565_956_2311 | 437 |
| 274 | 3300049459 | Ga0495678_004683 | Ga0495678_004683_4927_6282 | 437 |
| 275 | 3300061719 | Ga0466962_0025534 | Ga0466962_0025534_1063_2418 | 437 |
| 276 | 3300005458 | Ga0070681_10000799 | Ga0070681_1000079910 | 438 |
| 277 | 3300009093 | Ga0105240_10002481 | Ga0105240_1000248113 | 438 |
| 278 | 3300009093 | Ga0105240_10011769 | Ga0105240_1001176913 | 438 |
| 279 | 3300009093 | Ga0105240_10225506 | Ga0105240_102255064 | 438 |
| 280 | 3300009174 | Ga0105241_10012342 | Ga0105241_100123425 | 438 |
| 281 | 3300009551 | Ga0105238_10054682 | Ga0105238_100546825 | 438 |
| 282 | 3300010375 | Ga0105239_10001637 | Ga0105239_1000163714 | 438 |
| 283 | 3300025912 | Ga0207707_10000626 | Ga0207707_100006265 | 438 |
| 284 | 3300025913 | Ga0207695_10002173 | Ga0207695_1000217315 | 438 |
| 285 | 3300025913 | Ga0207695_10002412 | Ga0207695_1000241213 | 438 |
| 286 | 3300038443 | Ga0395901_0067700 | Ga0395901_0067700_1724_3112 | 438 |
| 287 | 3300041509 | Ga0451843_0269584 | Ga0451843_0269584_1001_2425 | 438 |
| 288 | 3300046460 | Ga0495638_0001133 | Ga0495638_0001133_14006_15364 | 438 |
| 289 | 3300048904 | Ga0496101_0133859 | Ga0496101_0133859_170_1525 | 438 |
| 290 | 3300048908 | Ga0496105_0003721 | Ga0496105_0003721_9096_10451 | 438 |
| 291 | 3300048918 | Ga0496115_0006604 | Ga0496115_0006604_2180_3535 | 438 |
| 292 | 3300048919 | Ga0496116_0073665 | Ga0496116_0073665_59_1414 | 438 |
| 293 | 3300048920 | Ga0496117_0011491 | Ga0496117_0011491_3345_4700 | 438 |
| 294 | 3300048920 | Ga0496117_0042644 | Ga0496117_0042644_1627_2982 | 438 |
| 295 | 3300048921 | Ga0496118_0007238 | Ga0496118_0007238_9793_11148 | 438 |
| 296 | 3300048922 | Ga0496119_0000725 | Ga0496119_0000725_33319_34674 | 438 |
| 297 | 3300048923 | Ga0496120_0000821 | Ga0496120_0000821_33310_34665 | 438 |
| 298 | 3300048929 | Ga0496126_0002348 | Ga0496126_0002348_18464_19819 | 438 |
| 299 | 3300053093 | Ga0500651_0005370 | Ga0500651_0005370_3053_4411 | 438 |
| 300 | 3300005457 | Ga0070662_100038283 | Ga0070662_1000382832 | 439 |
| 301 | 3300037312 | Ga0395899_0019790 | Ga0395899_0019790_53_1411 | 439 |
| 302 | 3300037418 | Ga0395900_0283268 | Ga0395900_0283268_14_1372 | 439 |
| 303 | 3300041453 | Ga0451797_0049457 | Ga0451797_0049457_136_1560 | 439 |
| 304 | 3300042006 | Ga0439432_002874 | Ga0439432_002874_4081_5514 | 439 |
| 305 | 3300046501 | Ga0495607_0001396 | Ga0495607_0001396_12476_13834 | 439 |
| 306 | 3300046519 | Ga0495632_0031217 | Ga0495632_0031217_984_2342 | 439 |
| 307 | 3300049586 | Ga0501070_0253561 | Ga0501070_0253561_23_1378 | 439 |
| 308 | 3300002741 | JGI25157J39369_1000892 | JGI25157J39369_10008926 | 440 |
| 309 | 3300005436 | Ga0070713_100001691 | Ga0070713_10000169110 | 440 |
| 310 | 3300005539 | Ga0068853_100005963 | Ga0068853_1000059633 | 440 |
| 311 | 3300013100 | Ga0157373_10161553 | Ga0157373_101615531 | 440 |
| 312 | 3300014497 | Ga0182008_10008140 | Ga0182008_100081405 | 440 |
| 313 | 3300025250 | Ga0209026_1000119 | Ga0209026_100011914 | 440 |
| 314 | 3300025932 | Ga0207690_10005794 | Ga0207690_100057942 | 440 |
| 315 | 3300025932 | Ga0207690_10044076 | Ga0207690_100440762 | 440 |
| 316 | 3300026142 | Ga0207698_10049178 | Ga0207698_100491783 | 440 |
| 317 | 3300038443 | Ga0395901_0001748 | Ga0395901_0001748_8857_10215 | 440 |
| 318 | 3300046452 | Ga0495617_001258 | Ga0495617_001258_7914_9272 | 440 |
| 319 | 3300046460 | Ga0495638_0000252 | Ga0495638_0000252_7914_9272 | 440 |
| 320 | 3300046506 | Ga0495583_0039245 | Ga0495583_0039245_265_1623 | 440 |
| 321 | 3300046513 | Ga0495616_0015899 | Ga0495616_0015899_1050_2408 | 440 |
| 322 | 3300046520 | Ga0495637_0016087 | Ga0495637_0016087_1693_3051 | 440 |
| 323 | 3300046538 | Ga0495609_0004319 | Ga0495609_0004319_3878_5236 | 440 |
| 324 | 3300046648 | Ga0495611_0000005 | Ga0495611_0000005_275001_276359 | 440 |
| 325 | 3300046660 | Ga0495625_0001159 | Ga0495625_0001159_7914_9272 | 440 |
| 326 | 3300046691 | Ga0495670_0000663 | Ga0495670_0000663_7361_8719 | 440 |
| 327 | 3300046692 | Ga0495671_0003260 | Ga0495671_0003260_7927_9285 | 440 |
| 328 | 3300046794 | Ga0495589_0000389 | Ga0495589_0000389_7914_9272 | 440 |
| 329 | 3300046810 | Ga0495660_0000655 | Ga0495660_0000655_17430_18788 | 440 |
| 330 | 3300047446 | Ga0495679_000382 | Ga0495679_000382_24702_26060 | 440 |
| 331 | 3300047469 | Ga0495673_0001420 | Ga0495673_0001420_9823_11181 | 440 |
| 332 | 3300049459 | Ga0495678_001183 | Ga0495678_001183_7930_9288 | 440 |
| 333 | 3300049460 | Ga0495682_0010218 | Ga0495682_0010218_681_2039 | 440 |
| 334 | 3300049572 | Ga0501036_0011674 | Ga0501036_0011674_3772_5142 | 440 |
| 335 | 3300049581 | Ga0501047_0141987 | Ga0501047_0141987_783_2153 | 440 |
| 336 | 3300049822 | Ga0501035_0133645 | Ga0501035_0133645_138_1508 | 440 |
| 337 | 3300049823 | Ga0501044_0006723 | Ga0501044_0006723_5985_7355 | 440 |
| 338 | 3300053087 | Ga0500643_000378 | Ga0500643_000378_7933_9291 | 440 |
| 339 | 3300053103 | Ga0500555_009745 | Ga0500555_009745_76_1434 | 440 |
| 340 | iso_pu_bacteria | 2747842501 | 2748018589 | 440 |
| 341 | 3300001990 | JGI24737J22298_10026793 | JGI24737J22298_100267932 | 441 |
| 342 | 3300005435 | Ga0070714_100001179 | Ga0070714_10000117918 | 441 |
| 343 | 3300005439 | Ga0070711_100074556 | Ga0070711_1000745562 | 441 |
| 344 | 3300005539 | Ga0068853_100002452 | Ga0068853_1000024525 | 441 |
| 345 | 3300005563 | Ga0068855_100227919 | Ga0068855_1002279192 | 441 |
| 346 | 3300005577 | Ga0068857_100020704 | Ga0068857_1000207046 | 441 |
| 347 | 3300005842 | Ga0068858_100013343 | Ga0068858_1000133432 | 441 |
| 348 | 3300009093 | Ga0105240_10007409 | Ga0105240_1000740910 | 441 |
| 349 | 3300009545 | Ga0105237_10000058 | Ga0105237_1000005812 | 441 |
| 350 | 3300009545 | Ga0105237_10075473 | Ga0105237_100754733 | 441 |
| 351 | 3300009553 | Ga0105249_10030150 | Ga0105249_100301504 | 441 |
| 352 | 3300010375 | Ga0105239_10151023 | Ga0105239_101510232 | 441 |
| 353 | 3300012500 | Ga0157314_1000018 | Ga0157314_100001812 | 441 |
| 354 | 3300013105 | Ga0157369_10199531 | Ga0157369_101995312 | 441 |
| 355 | 3300025911 | Ga0207654_10068909 | Ga0207654_100689092 | 441 |
| 356 | 3300025913 | Ga0207695_10000890 | Ga0207695_1000089040 | 441 |
| 357 | 3300025914 | Ga0207671_10000026 | Ga0207671_10000026236 | 441 |
| 358 | 3300025929 | Ga0207664_10000856 | Ga0207664_1000085610 | 441 |
| 359 | 3300025949 | Ga0207667_10000423 | Ga0207667_1000042343 | 441 |
| 360 | 3300026041 | Ga0207639_10004090 | Ga0207639_100040907 | 441 |
| 361 | 3300026116 | Ga0207674_10000219 | Ga0207674_1000021913 | 441 |
| 362 | 3300041407 | Ga0439447_003268 | Ga0439447_003268_4221_5582 | 441 |
| 363 | 3300046460 | Ga0495638_0000361 | Ga0495638_0000361_9210_10565 | 441 |
| 364 | 3300046616 | Ga0495668_0001633 | Ga0495668_0001633_18122_19483 | 441 |
| 365 | 3300048916 | Ga0496113_0023533 | Ga0496113_0023533_1491_2846 | 441 |
| 366 | 3300048918 | Ga0496115_0001176 | Ga0496115_0001176_6263_7618 | 441 |
| 367 | 3300048924 | Ga0496121_0042594 | Ga0496121_0042594_379_1740 | 441 |
| 368 | iso_pu_bacteria | 8002869464 | 8002869914 | 441 |
| 369 | 3300002705 | JGI25156J39149_1010869 | JGI25156J39149_10108691 | 442 |
| 370 | 3300002741 | JGI25157J39369_1000517 | JGI25157J39369_10005179 | 442 |
| 371 | 3300003759 | Ga0055525_1000170 | Ga0055525_100017059 | 442 |
| 372 | 3300003760 | Ga0055527_1000275 | Ga0055527_100027510 | 442 |
| 373 | 3300003761 | Ga0055535_1000582 | Ga0055535_100058210 | 442 |
| 374 | 3300003762 | Ga0055542_1000604 | Ga0055542_100060410 | 442 |
| 375 | 3300003763 | Ga0055529_1000932 | Ga0055529_100093210 | 442 |
| 376 | 3300005616 | Ga0068852_100128127 | Ga0068852_1001281272 | 442 |
| 377 | 3300013104 | Ga0157370_10006151 | Ga0157370_100061515 | 442 |
| 378 | 3300025228 | Ga0209672_100043 | Ga0209672_100043225 | 442 |
| 379 | 3300025230 | Ga0209563_100062 | Ga0209563_100062216 | 442 |
| 380 | 3300025242 | Ga0209258_100076 | Ga0209258_100076225 | 442 |
| 381 | 3300025250 | Ga0209026_1000533 | Ga0209026_100053311 | 442 |
| 382 | 3300025254 | Ga0209148_1000082 | Ga0209148_1000082225 | 442 |
| 383 | 3300025256 | Ga0209759_1000858 | Ga0209759_100085812 | 442 |
| 384 | 3300025272 | Ga0209455_1000078 | Ga0209455_1000078225 | 442 |
| 385 | 3300032004 | Ga0307414_10005644 | Ga0307414_100056447 | 442 |
| 386 | 3300038443 | Ga0395901_0083733 | Ga0395901_0083733_650_2035 | 442 |
| 387 | 3300048905 | Ga0496102_0063280 | Ga0496102_0063280_731_2098 | 442 |
| 388 | 3300048921 | Ga0496118_0013900 | Ga0496118_0013900_591_1958 | 442 |
| 389 | iso_pu_bacteria | 2643221573 | 2643881013 | 442 |
| 390 | iso_pu_bacteria | 2643221593 | 2643977605 | 442 |
| 391 | iso_pu_bacteria | 2643221720 | 2644661783 | 442 |
| 392 | iso_pu_bacteria | 2643221728 | 2644699925 | 442 |
| 393 | iso_pu_bacteria | 2747842428 | 2747950745 | 442 |
| 394 | iso_pu_bacteria | 2842757796 | 2842759102 | 442 |
| 395 | iso_pu_bacteria | 2941489479 | 2941492496 | 442 |
| 396 | iso_pu_bacteria | 2995948881 | 2995953244 | 442 |
| 397 | 3300005336 | Ga0070680_100002369 | Ga0070680_1000023699 | 443 |
| 398 | 3300005435 | Ga0070714_100000597 | Ga0070714_10000059711 | 443 |
| 399 | 3300005455 | Ga0070663_100003910 | Ga0070663_10000391010 | 443 |
| 400 | 3300005458 | Ga0070681_10000484 | Ga0070681_1000048420 | 443 |
| 401 | 3300005530 | Ga0070679_100001635 | Ga0070679_10000163511 | 443 |
| 402 | 3300005563 | Ga0068855_100008568 | Ga0068855_10000856812 | 443 |
| 403 | 3300005614 | Ga0068856_100013243 | Ga0068856_1000132436 | 443 |
| 404 | 3300013100 | Ga0157373_10007919 | Ga0157373_100079197 | 443 |
| 405 | 3300013104 | Ga0157370_10009419 | Ga0157370_100094194 | 443 |
| 406 | 3300013307 | Ga0157372_10005781 | Ga0157372_1000578110 | 443 |
| 407 | 3300025226 | Ga0209674_100058 | Ga0209674_10005812 | 443 |
| 408 | 3300025242 | Ga0209258_100514 | Ga0209258_1005146 | 443 |
| 409 | 3300025253 | Ga0209677_101125 | Ga0209677_10112512 | 443 |
| 410 | 3300025912 | Ga0207707_10000020 | Ga0207707_1000002011 | 443 |
| 411 | 3300025917 | Ga0207660_10000726 | Ga0207660_1000072616 | 443 |
| 412 | 3300025919 | Ga0207657_10095219 | Ga0207657_100952193 | 443 |
| 413 | 3300025921 | Ga0207652_10000037 | Ga0207652_10000037114 | 443 |
| 414 | 3300025929 | Ga0207664_10000131 | Ga0207664_1000013111 | 443 |
| 415 | 3300025949 | Ga0207667_10019918 | Ga0207667_100199186 | 443 |
| 416 | 3300025949 | Ga0207667_10208355 | Ga0207667_102083552 | 443 |
| 417 | 3300026067 | Ga0207678_10010170 | Ga0207678_100101703 | 443 |
| 418 | 3300026078 | Ga0207702_10001784 | Ga0207702_1000178413 | 443 |
| 419 | 3300031456 | Ga0307513_10156167 | Ga0307513_101561671 | 443 |
| 420 | 3300044661 | Ga0466975_0068618 | Ga0466975_0068618_775_2139 | 443 |
| 421 | 3300044684 | Ga0466966_0017909 | Ga0466966_0017909_162_1526 | 443 |
| 422 | 3300044693 | Ga0466961_0013367 | Ga0466961_0013367_2855_4219 | 443 |
| 423 | 3300045049 | Ga0466959_0000848 | Ga0466959_0000848_5860_7224 | 443 |
| 424 | 3300045836 | Ga0466958_0043763 | Ga0466958_0043763_758_2122 | 443 |
| 425 | 3300053093 | Ga0500651_0001642 | Ga0500651_0001642_7348_8763 | 443 |
| 426 | iso_pu_bacteria | 8021622325 | 8021624981 | 443 |
| 427 | 3300003187 | JGI25151J46595_10000118 | JGI25151J46595_1000011880 | 444 |
| 428 | 3300003762 | Ga0055542_1000580 | Ga0055542_100058012 | 444 |
| 429 | 3300005329 | Ga0070683_100049951 | Ga0070683_1000499513 | 444 |
| 430 | 3300005338 | Ga0068868_100041811 | Ga0068868_1000418113 | 444 |
| 431 | 3300005535 | Ga0070684_100018115 | Ga0070684_1000181154 | 444 |
| 432 | 3300005539 | Ga0068853_100219743 | Ga0068853_1002197431 | 444 |
| 433 | 3300006237 | Ga0097621_100002033 | Ga0097621_10000203316 | 444 |
| 434 | 3300006358 | Ga0068871_100002111 | Ga0068871_1000021115 | 444 |
| 435 | 3300014969 | Ga0157376_10010490 | Ga0157376_100104905 | 444 |
| 436 | 3300025228 | Ga0209672_101385 | Ga0209672_1013855 | 444 |
| 437 | 3300025242 | Ga0209258_100566 | Ga0209258_10056617 | 444 |
| 438 | 3300025254 | Ga0209148_1000614 | Ga0209148_100061417 | 444 |
| 439 | 3300025261 | Ga0209233_1018396 | Ga0209233_10183962 | 444 |
| 440 | 3300025294 | Ga0209025_1000200 | Ga0209025_10002006 | 444 |
| 441 | 3300025924 | Ga0207694_10003616 | Ga0207694_1000361610 | 444 |
| 442 | 3300025944 | Ga0207661_10104774 | Ga0207661_101047742 | 444 |
| 443 | 3300026023 | Ga0207677_10030970 | Ga0207677_100309703 | 444 |
| 444 | 3300026041 | Ga0207639_10122580 | Ga0207639_101225802 | 444 |
| 445 | 3300026041 | Ga0207639_10159322 | Ga0207639_101593222 | 444 |
| 446 | 3300031727 | Ga0316576_10033952 | Ga0316576_100339522 | 444 |
| 447 | 3300035691 | Ga0373931_0022180 | Ga0373931_0022180_1557_2924 | 444 |
| 448 | 3300041413 | Ga0439465_0000101 | Ga0439465_0000101_13291_14739 | 444 |
| 449 | 3300045051 | Ga0451576_0095186 | Ga0451576_0095186_568_1965 | 444 |
| 450 | 3300049571 | Ga0501034_0014956 | Ga0501034_0014956_6487_7956 | 444 |
| 451 | 3300049705 | Ga0501225_0009773 | Ga0501225_0009773_298_1668 | 444 |
| 452 | iso_pu_bacteria | 2571042365 | 2572255792 | 444 |
| 453 | iso_pu_bacteria | 2643221695 | 2644530079 | 444 |
| 454 | iso_pu_bacteria | 2895498888 | 2895501822 | 444 |
| 455 | iso_pu_bacteria | 2895511927 | 2895517622 | 444 |
| 456 | iso_pu_bacteria | 2895522137 | 2895525191 | 444 |
| 457 | iso_pu_bacteria | 2895525241 | 2895526129 | 444 |
| 458 | iso_pu_bacteria | 8003014200 | 8003017400 | 444 |
| 459 | 3300003771 | Ga0055526_1012150 | Ga0055526_10121503 | 445 |
| 460 | 3300005543 | Ga0070672_100076084 | Ga0070672_1000760842 | 445 |
| 461 | 3300013296 | Ga0157374_10191487 | Ga0157374_101914872 | 445 |
| 462 | 3300013308 | Ga0157375_10005348 | Ga0157375_1000534813 | 445 |
| 463 | 3300014325 | Ga0163163_10019903 | Ga0163163_100199036 | 445 |
| 464 | 3300025919 | Ga0207657_10081212 | Ga0207657_100812123 | 445 |
| 465 | 3300025921 | Ga0207652_10063335 | Ga0207652_100633352 | 445 |
| 466 | 3300025940 | Ga0207691_10150041 | Ga0207691_101500412 | 445 |
| 467 | 3300026088 | Ga0207641_10128617 | Ga0207641_101286171 | 445 |
| 468 | 3300027671 | Ga0209588_1008040 | Ga0209588_10080404 | 445 |
| 469 | 3300031911 | Ga0307412_10001279 | Ga0307412_1000127911 | 445 |
| 470 | 3300037312 | Ga0395899_0000410 | Ga0395899_0000410_10872_12236 | 445 |
| 471 | 3300037466 | Ga0395898_0000120 | Ga0395898_0000120_196856_198220 | 445 |
| 472 | 3300038443 | Ga0395901_0089957 | Ga0395901_0089957_1450_2814 | 445 |
| 473 | 3300041406 | Ga0439439_0000522 | Ga0439439_0000522_1912_3309 | 445 |
| 474 | 3300042007 | Ga0439449_0012818 | Ga0439449_0012818_361_1734 | 445 |
| 475 | 3300042876 | Ga0451577_0005118 | Ga0451577_0005118_5091_6467 | 445 |
| 476 | 3300044765 | Ga0466970_0003722 | Ga0466970_0003722_5693_7057 | 445 |
| 477 | 3300045049 | Ga0466959_0011074 | Ga0466959_0011074_44_1408 | 445 |
| 478 | 3300046525 | Ga0495663_0017205 | Ga0495663_0017205_116_1492 | 445 |
| 479 | 3300049513 | Ga0501290_001903 | Ga0501290_001903_1320_2696 | 445 |
| 480 | iso_pu_bacteria | 2884411467 | 2884411829 | 445 |
| 481 | iso_pu_bacteria | 2928963466 | 2928966677 | 445 |
| 482 | 3300005347 | Ga0070668_100044387 | Ga0070668_1000443871 | 446 |
| 483 | 3300005547 | Ga0070693_100012117 | Ga0070693_1000121174 | 446 |
| 484 | 3300005548 | Ga0070665_100036297 | Ga0070665_1000362974 | 446 |
| 485 | 3300005841 | Ga0068863_100033562 | Ga0068863_1000335624 | 446 |
| 486 | 3300005844 | Ga0068862_100000215 | Ga0068862_10000021546 | 446 |
| 487 | 3300025914 | Ga0207671_10050339 | Ga0207671_100503392 | 446 |
| 488 | 3300026088 | Ga0207641_10054943 | Ga0207641_100549432 | 446 |
| 489 | 3300026095 | Ga0207676_10018479 | Ga0207676_100184793 | 446 |
| 490 | 3300027364 | Ga0209967_1000263 | Ga0209967_10002635 | 446 |
| 491 | 3300028380 | Ga0268265_10002016 | Ga0268265_100020162 | 446 |
| 492 | 3300028381 | Ga0268264_10100519 | Ga0268264_101005193 | 446 |
| 493 | 3300031548 | Ga0307408_100026763 | Ga0307408_1000267631 | 446 |
| 494 | 3300031730 | Ga0307516_10013891 | Ga0307516_100138917 | 446 |
| 495 | 3300031911 | Ga0307412_10081026 | Ga0307412_100810261 | 446 |
| 496 | 3300032004 | Ga0307414_10015898 | Ga0307414_100158984 | 446 |
| 497 | 3300035086 | Ga0373934_0012240 | Ga0373934_0012240_650_2011 | 446 |
| 498 | 3300035118 | Ga0373954_0000002 | Ga0373954_0000002_79013_80374 | 446 |
| 499 | 3300035724 | Ga0373933_0005162 | Ga0373933_0005162_630_1991 | 446 |
| 500 | 3300037068 | Ga0373925_0113805 | Ga0373925_0113805_221_1612 | 446 |
| 501 | 3300041494 | Ga0451837_1141630 | Ga0451837_1141630_145_1557 | 446 |
| 502 | 3300046455 | Ga0495603_0029470 | Ga0495603_0029470_501_1892 | 446 |
| 503 | 3300046460 | Ga0495638_0027185 | Ga0495638_0027185_1449_2882 | 446 |
| 504 | 3300046472 | Ga0495580_0050301 | Ga0495580_0050301_388_1779 | 446 |
| 505 | 3300046539 | Ga0495621_0000071 | Ga0495621_0000071_8433_9812 | 446 |
| 506 | 3300046683 | Ga0495658_0004487 | Ga0495658_0004487_396_1787 | 446 |
| 507 | 3300047322 | Ga0495680_0119704 | Ga0495680_0119704_190_1581 | 446 |
| 508 | 3300048905 | Ga0496102_0069440 | Ga0496102_0069440_1067_2419 | 446 |
| 509 | 3300048921 | Ga0496118_0006168 | Ga0496118_0006168_6054_7406 | 446 |
| 510 | 3300048924 | Ga0496121_0029483 | Ga0496121_0029483_393_1757 | 446 |
| 511 | 3300048926 | Ga0496123_0023025 | Ga0496123_0023025_2749_4128 | 446 |
| 512 | 3300049572 | Ga0501036_0017902 | Ga0501036_0017902_1085_2491 | 446 |
| 513 | 3300049573 | Ga0501037_0006068 | Ga0501037_0006068_779_2185 | 446 |
| 514 | 3300049574 | Ga0501038_0032742 | Ga0501038_0032742_1510_2895 | 446 |
| 515 | 3300049579 | Ga0501043_0061643 | Ga0501043_0061643_954_2360 | 446 |
| 516 | 3300049589 | Ga0501073_0001609 | Ga0501073_0001609_4689_6056 | 446 |
| 517 | 3300049593 | Ga0501077_0005147 | Ga0501077_0005147_1901_3268 | 446 |
| 518 | 3300049823 | Ga0501044_0105675 | Ga0501044_0105675_767_2173 | 446 |
| 519 | 3300054114 | Ga0501084_0027347 | Ga0501084_0027347_894_2261 | 446 |
| 520 | iso_pu_bacteria | 2593339238 | 2595448975 | 446 |
| 521 | iso_pu_bacteria | 2593339239 | 2595452868 | 446 |
| 522 | iso_pu_bacteria | 2687453130 | 2687581692 | 446 |
| 523 | iso_pu_bacteria | 2718218334 | 2721029037 | 446 |
| 524 | iso_pu_bacteria | 2734482264 | 2735835383 | 446 |
| 525 | iso_pu_bacteria | 2738543009 | 2739229505 | 446 |
| 526 | iso_pu_bacteria | 2818991440 | 2819565118 | 446 |
| 527 | iso_pu_bacteria | 2842914999 | 2842917033 | 446 |
| 528 | iso_pu_bacteria | 2842918807 | 2842922539 | 446 |
| 529 | iso_pu_bacteria | 2884338543 | 2884342220 | 446 |
| 530 | iso_pu_bacteria | 2904463128 | 2904465354 | 446 |
| 531 | iso_pu_bacteria | 2919085039 | 2919087891 | 446 |
| 532 | iso_pu_bacteria | 2941471342 | 2941474676 | 446 |
| 533 | iso_pu_bacteria | 2953994433 | 2953996997 | 446 |
| 534 | 3300006914 | Ga0075436_100014805 | Ga0075436_1000148055 | 447 |
| 535 | 3300007076 | Ga0075435_100002470 | Ga0075435_10000247014 | 447 |
| 536 | 3300013100 | Ga0157373_10034313 | Ga0157373_100343133 | 447 |
| 537 | 3300031730 | Ga0307516_10036068 | Ga0307516_100360682 | 447 |
| 538 | 3300037418 | Ga0395900_0158398 | Ga0395900_0158398_189_1619 | 447 |
| 539 | 3300037471 | Ga0395905_0007372 | Ga0395905_0007372_2361_3791 | 447 |
| 540 | 3300041512 | Ga0451853_3004224 | Ga0451853_3004224_594_1949 | 447 |
| 541 | 3300046691 | Ga0495670_0055490 | Ga0495670_0055490_97_1527 | 447 |
| 542 | 3300047318 | Ga0495636_0004874 | Ga0495636_0004874_3498_4928 | 447 |
| 543 | 3300047447 | Ga0495685_012325 | Ga0495685_012325_1116_2564 | 447 |
| 544 | 3300005293 | Ga0065715_10027231 | Ga0065715_100272312 | 448 |
| 545 | 3300005331 | Ga0070670_100103226 | Ga0070670_1001032262 | 448 |
| 546 | 3300005354 | Ga0070675_100121958 | Ga0070675_1001219582 | 448 |
| 547 | 3300005367 | Ga0070667_100000049 | Ga0070667_1000000495 | 448 |
| 548 | 3300005367 | Ga0070667_100000184 | Ga0070667_1000001846 | 448 |
| 549 | 3300005539 | Ga0068853_100113846 | Ga0068853_1001138462 | 448 |
| 550 | 3300005548 | Ga0070665_100052083 | Ga0070665_1000520835 | 448 |
| 551 | 3300005617 | Ga0068859_100198559 | Ga0068859_1001985592 | 448 |
| 552 | 3300005937 | Ga0081455_10172430 | Ga0081455_101724301 | 448 |
| 553 | 3300006931 | Ga0097620_100198558 | Ga0097620_1001985582 | 448 |
| 554 | 3300009092 | Ga0105250_10046720 | Ga0105250_100467202 | 448 |
| 555 | 3300009098 | Ga0105245_10054959 | Ga0105245_100549594 | 448 |
| 556 | 3300009101 | Ga0105247_10012255 | Ga0105247_100122555 | 448 |
| 557 | 3300009177 | Ga0105248_10000120 | Ga0105248_1000012011 | 448 |
| 558 | 3300014325 | Ga0163163_10005861 | Ga0163163_100058615 | 448 |
| 559 | 3300025292 | Ga0209676_1002916 | Ga0209676_10029162 | 448 |
| 560 | 3300025900 | Ga0207710_10006428 | Ga0207710_100064285 | 448 |
| 561 | 3300025938 | Ga0207704_10007422 | Ga0207704_100074224 | 448 |
| 562 | 3300025941 | Ga0207711_10001269 | Ga0207711_1000126913 | 448 |
| 563 | 3300025941 | Ga0207711_10189850 | Ga0207711_101898502 | 448 |
| 564 | 3300025986 | Ga0207658_10000033 | Ga0207658_10000033145 | 448 |
| 565 | 3300025986 | Ga0207658_10000591 | Ga0207658_1000059129 | 448 |
| 566 | 3300026116 | Ga0207674_10032691 | Ga0207674_100326914 | 448 |
| 567 | 3300031727 | Ga0316576_10010827 | Ga0316576_100108275 | 448 |
| 568 | 3300035398 | Ga0316574_0088060 | Ga0316574_0088060_531_1898 | 448 |
| 569 | 3300041413 | Ga0439465_0002026 | Ga0439465_0002026_4379_5821 | 448 |
| 570 | 3300044656 | Ga0466969_0016507 | Ga0466969_0016507_1275_2768 | 448 |
| 571 | 3300044684 | Ga0466966_0024936 | Ga0466966_0024936_1689_3182 | 448 |
| 572 | 3300044719 | Ga0466971_0002114 | Ga0466971_0002114_4529_6022 | 448 |
| 573 | 3300044735 | Ga0466968_0004722 | Ga0466968_0004722_2359_3852 | 448 |
| 574 | 3300044765 | Ga0466970_0006542 | Ga0466970_0006542_3121_4614 | 448 |
| 575 | 3300047318 | Ga0495636_0009636 | Ga0495636_0009636_1562_2995 | 448 |
| 576 | 3300048911 | Ga0496108_0010770 | Ga0496108_0010770_22_1455 | 448 |
| 577 | 3300048920 | Ga0496117_0018758 | Ga0496117_0018758_3783_5147 | 448 |
| 578 | 3300048921 | Ga0496118_0002146 | Ga0496118_0002146_15803_17167 | 448 |
| 579 | 3300060353 | Ga0501082_0000107 | Ga0501082_0000107_41018_42376 | 448 |
| 580 | 3300002705 | JGI25156J39149_1000651 | JGI25156J39149_100065112 | 449 |
| 581 | 3300002737 | JGI25162J39368_1000249 | JGI25162J39368_10002497 | 449 |
| 582 | 3300002741 | JGI25157J39369_1000663 | JGI25157J39369_100066312 | 449 |
| 583 | 3300002772 | JGI25164J39214_1000004 | JGI25164J39214_100000412 | 449 |
| 584 | 3300003214 | JGI25165J46597_1000464 | JGI25165J46597_100046426 | 449 |
| 585 | 3300003578 | Ga0006562J51391_1039498 | Ga0006562J51391_10394987 | 449 |
| 586 | 3300003578 | Ga0006562J51391_1039500 | Ga0006562J51391_10395009 | 449 |
| 587 | 3300003760 | Ga0055527_1000331 | Ga0055527_100033110 | 449 |
| 588 | 3300003761 | Ga0055535_1000594 | Ga0055535_100059415 | 449 |
| 589 | 3300003761 | Ga0055535_1000715 | Ga0055535_100071510 | 449 |
| 590 | 3300003762 | Ga0055542_1000623 | Ga0055542_100062315 | 449 |
| 591 | 3300003762 | Ga0055542_1000741 | Ga0055542_100074110 | 449 |
| 592 | 3300003763 | Ga0055529_1000574 | Ga0055529_100057412 | 449 |
| 593 | 3300003763 | Ga0055529_1000648 | Ga0055529_100064812 | 449 |
| 594 | 3300005262 | Ga0065165_1001275 | Ga0065165_10012757 | 449 |
| 595 | 3300005337 | Ga0070682_100009517 | Ga0070682_1000095171 | 449 |
| 596 | 3300005455 | Ga0070663_100084745 | Ga0070663_1000847452 | 449 |
| 597 | 3300005458 | Ga0070681_10142302 | Ga0070681_101423022 | 449 |
| 598 | 3300005530 | Ga0070679_100070134 | Ga0070679_1000701343 | 449 |
| 599 | 3300005614 | Ga0068856_100095164 | Ga0068856_1000951643 | 449 |
| 600 | 3300013102 | Ga0157371_10010375 | Ga0157371_100103752 | 449 |
| 601 | 3300015687 | Ga0183368_1007 | Ga0183368_100713 | 449 |
| 602 | 3300025228 | Ga0209672_100061 | Ga0209672_10006112 | 449 |
| 603 | 3300025228 | Ga0209672_100659 | Ga0209672_1006595 | 449 |
| 604 | 3300025231 | Ga0207427_100031 | Ga0207427_100031292 | 449 |
| 605 | 3300025233 | Ga0209437_100061 | Ga0209437_10006112 | 449 |
| 606 | 3300025242 | Ga0209258_100054 | Ga0209258_10005412 | 449 |
| 607 | 3300025242 | Ga0209258_100097 | Ga0209258_10009712 | 449 |
| 608 | 3300025250 | Ga0209026_1000337 | Ga0209026_10003376 | 449 |
| 609 | 3300025254 | Ga0209148_1000063 | Ga0209148_100006312 | 449 |
| 610 | 3300025254 | Ga0209148_1000066 | Ga0209148_100006612 | 449 |
| 611 | 3300025256 | Ga0209759_1000730 | Ga0209759_100073015 | 449 |
| 612 | 3300025258 | Ga0209129_1002368 | Ga0209129_10023681 | 449 |
| 613 | 3300025261 | Ga0209233_1000076 | Ga0209233_1000076292 | 449 |
| 614 | 3300025272 | Ga0209455_1000096 | Ga0209455_100009612 | 449 |
| 615 | 3300025272 | Ga0209455_1000101 | Ga0209455_100010112 | 449 |
| 616 | 3300025297 | Ga0209758_1001065 | Ga0209758_100106531 | 449 |
| 617 | 3300025912 | Ga0207707_10114702 | Ga0207707_101147022 | 449 |
| 618 | 3300025913 | Ga0207695_10024064 | Ga0207695_100240642 | 449 |
| 619 | 3300025932 | Ga0207690_10019367 | Ga0207690_100193671 | 449 |
| 620 | 3300026067 | Ga0207678_10105410 | Ga0207678_101054102 | 449 |
| 621 | 3300031616 | Ga0307508_10009313 | Ga0307508_100093132 | 449 |
| 622 | 3300037312 | Ga0395899_0029129 | Ga0395899_0029129_248_1603 | 449 |
| 623 | 3300037418 | Ga0395900_0000206 | Ga0395900_0000206_80406_81761 | 449 |
| 624 | 3300037466 | Ga0395898_0000013 | Ga0395898_0000013_446365_447720 | 449 |
| 625 | 3300038443 | Ga0395901_0125671 | Ga0395901_0125671_60_1415 | 449 |
| 626 | 3300038443 | Ga0395901_0170860 | Ga0395901_0170860_383_1738 | 449 |
| 627 | 3300044672 | Ga0466982_0000017 | Ga0466982_0000017_13212_14582 | 449 |
| 628 | 3300044684 | Ga0466966_0019558 | Ga0466966_0019558_2531_3901 | 449 |
| 629 | 3300044693 | Ga0466961_0001089 | Ga0466961_0001089_9331_10686 | 449 |
| 630 | 3300044719 | Ga0466971_0012172 | Ga0466971_0012172_2378_3748 | 449 |
| 631 | 3300044735 | Ga0466968_0004145 | Ga0466968_0004145_3343_4713 | 449 |
| 632 | 3300044765 | Ga0466970_0029488 | Ga0466970_0029488_101_1471 | 449 |
| 633 | 3300044901 | Ga0466960_0004458 | Ga0466960_0004458_1942_3312 | 449 |
| 634 | 3300046460 | Ga0495638_0000949 | Ga0495638_0000949_9315_10670 | 449 |
| 635 | 3300046471 | Ga0495650_0001191 | Ga0495650_0001191_16858_18213 | 449 |
| 636 | 3300048922 | Ga0496119_0004544 | Ga0496119_0004544_3047_4402 | 449 |
| 637 | 3300048923 | Ga0496120_0002936 | Ga0496120_0002936_5342_6697 | 449 |
| 638 | 3300048924 | Ga0496121_0000785 | Ga0496121_0000785_9915_11270 | 449 |
| 639 | 3300048924 | Ga0496121_0079696 | Ga0496121_0079696_771_2126 | 449 |
| 640 | 3300048928 | Ga0496125_0001643 | Ga0496125_0001643_11069_12430 | 449 |
| 641 | 3300048929 | Ga0496126_0022143 | Ga0496126_0022143_3608_4963 | 449 |
| 642 | 3300049568 | Ga0501031_0031363 | Ga0501031_0031363_1012_2367 | 449 |
| 643 | 3300049568 | Ga0501031_0078119 | Ga0501031_0078119_36_1418 | 449 |
| 644 | 3300049574 | Ga0501038_0026871 | Ga0501038_0026871_142_1524 | 449 |
| 645 | 3300049580 | Ga0501046_0125753 | Ga0501046_0125753_396_1751 | 449 |
| 646 | 3300049581 | Ga0501047_0022991 | Ga0501047_0022991_711_2066 | 449 |
| 647 | 3300049589 | Ga0501073_0085774 | Ga0501073_0085774_95_1477 | 449 |
| 648 | 3300049822 | Ga0501035_0133652 | Ga0501035_0133652_109_1464 | 449 |
| 649 | 3300049823 | Ga0501044_0031765 | Ga0501044_0031765_3691_5046 | 449 |
| 650 | 3300061719 | Ga0466962_0002150 | Ga0466962_0002150_4744_6114 | 449 |
| 651 | 3300005335 | Ga0070666_10000372 | Ga0070666_100003725 | 450 |
| 652 | 3300005455 | Ga0070663_100003576 | Ga0070663_1000035768 | 450 |
| 653 | 3300005563 | Ga0068855_100197430 | Ga0068855_1001974302 | 450 |
| 654 | 3300005614 | Ga0068856_100000088 | Ga0068856_10000008851 | 450 |
| 655 | 3300005834 | Ga0068851_10013049 | Ga0068851_100130494 | 450 |
| 656 | 3300005842 | Ga0068858_100000586 | Ga0068858_10000058630 | 450 |
| 657 | 3300006237 | Ga0097621_100046745 | Ga0097621_1000467453 | 450 |
| 658 | 3300009093 | Ga0105240_10007835 | Ga0105240_100078359 | 450 |
| 659 | 3300009551 | Ga0105238_10012584 | Ga0105238_100125849 | 450 |
| 660 | 3300009551 | Ga0105238_10015508 | Ga0105238_100155084 | 450 |
| 661 | 3300013104 | Ga0157370_10007072 | Ga0157370_100070729 | 450 |
| 662 | 3300013307 | Ga0157372_10006482 | Ga0157372_1000648213 | 450 |
| 663 | 3300025261 | Ga0209233_1001928 | Ga0209233_10019285 | 450 |
| 664 | 3300025321 | Ga0207656_10002756 | Ga0207656_100027561 | 450 |
| 665 | 3300025903 | Ga0207680_10007412 | Ga0207680_100074124 | 450 |
| 666 | 3300025904 | Ga0207647_10000269 | Ga0207647_1000026915 | 450 |
| 667 | 3300025911 | Ga0207654_10030041 | Ga0207654_100300412 | 450 |
| 668 | 3300025913 | Ga0207695_10000040 | Ga0207695_10000040143 | 450 |
| 669 | 3300025913 | Ga0207695_10022149 | Ga0207695_100221493 | 450 |
| 670 | 3300025914 | Ga0207671_10152475 | Ga0207671_101524752 | 450 |
| 671 | 3300025914 | Ga0207671_10204521 | Ga0207671_102045212 | 450 |
| 672 | 3300025924 | Ga0207694_10002190 | Ga0207694_1000219010 | 450 |
| 673 | 3300025933 | Ga0207706_10070736 | Ga0207706_100707363 | 450 |
| 674 | 3300025949 | Ga0207667_10060694 | Ga0207667_100606944 | 450 |
| 675 | 3300025961 | Ga0207712_10000364 | Ga0207712_1000036417 | 450 |
| 676 | 3300025986 | Ga0207658_10068761 | Ga0207658_100687612 | 450 |
| 677 | 3300026035 | Ga0207703_10000472 | Ga0207703_1000047210 | 450 |
| 678 | 3300026041 | Ga0207639_10002309 | Ga0207639_1000230910 | 450 |
| 679 | 3300026067 | Ga0207678_10007011 | Ga0207678_100070114 | 450 |
| 680 | 3300026078 | Ga0207702_10000649 | Ga0207702_100006495 | 450 |
| 681 | 3300026116 | Ga0207674_10255160 | Ga0207674_102551601 | 450 |
| 682 | 3300028379 | Ga0268266_10000008 | Ga0268266_10000008235 | 450 |
| 683 | 3300037418 | Ga0395900_0000656 | Ga0395900_0000656_7748_9190 | 450 |
| 684 | 3300042006 | Ga0439432_009273 | Ga0439432_009273_568_2016 | 450 |
| 685 | 3300044684 | Ga0466966_0106706 | Ga0466966_0106706_224_1588 | 450 |
| 686 | 3300046471 | Ga0495650_0001431 | Ga0495650_0001431_8592_9950 | 450 |
| 687 | 3300046492 | Ga0495585_0001595 | Ga0495585_0001595_5664_7022 | 450 |
| 688 | 3300046507 | Ga0495606_0003479 | Ga0495606_0003479_7933_9291 | 450 |
| 689 | 3300046513 | Ga0495616_0000831 | Ga0495616_0000831_8033_9391 | 450 |
| 690 | 3300046515 | Ga0495620_0004160 | Ga0495620_0004160_1072_2430 | 450 |
| 691 | 3300046519 | Ga0495632_0003976 | Ga0495632_0003976_1478_2836 | 450 |
| 692 | 3300046524 | Ga0495648_0003467 | Ga0495648_0003467_6656_8014 | 450 |
| 693 | 3300046648 | Ga0495611_0000450 | Ga0495611_0000450_15047_16405 | 450 |
| 694 | 3300046692 | Ga0495671_0021078 | Ga0495671_0021078_213_1598 | 450 |
| 695 | 3300047323 | Ga0495683_0003102 | Ga0495683_0003102_2793_4151 | 450 |
| 696 | 3300047469 | Ga0495673_0000685 | Ga0495673_0000685_26957_28315 | 450 |
| 697 | 3300047472 | Ga0495686_0012650 | Ga0495686_0012650_1395_2753 | 450 |
| 698 | 3300048924 | Ga0496121_0008379 | Ga0496121_0008379_3020_4378 | 450 |
| 699 | 3300005614 | Ga0068856_100022139 | Ga0068856_1000221396 | 451 |
| 700 | 3300031665 | Ga0316575_10020555 | Ga0316575_100205552 | 451 |
| 701 | 3300002737 | JGI25162J39368_1001238 | JGI25162J39368_10012387 | 452 |
| 702 | 3300002737 | JGI25162J39368_1001419 | JGI25162J39368_100141911 | 452 |
| 703 | 3300002772 | JGI25164J39214_1000678 | JGI25164J39214_10006788 | 452 |
| 704 | 3300002772 | JGI25164J39214_1000780 | JGI25164J39214_10007803 | 452 |
| 705 | 3300003214 | JGI25165J46597_1001411 | JGI25165J46597_100141111 | 452 |
| 706 | 3300003214 | JGI25165J46597_1004393 | JGI25165J46597_10043933 | 452 |
| 707 | 3300005336 | Ga0070680_100010560 | Ga0070680_1000105602 | 452 |
| 708 | 3300005458 | Ga0070681_10016654 | Ga0070681_100166543 | 452 |
| 709 | 3300005530 | Ga0070679_100015323 | Ga0070679_1000153233 | 452 |
| 710 | 3300025226 | Ga0209674_103964 | Ga0209674_1039643 | 452 |
| 711 | 3300025231 | Ga0207427_100258 | Ga0207427_10025811 | 452 |
| 712 | 3300025231 | Ga0207427_100275 | Ga0207427_10027524 | 452 |
| 713 | 3300025233 | Ga0209437_100121 | Ga0209437_1001218 | 452 |
| 714 | 3300025233 | Ga0209437_100132 | Ga0209437_100132151 | 452 |
| 715 | 3300025261 | Ga0209233_1000112 | Ga0209233_100011212 | 452 |
| 716 | 3300025261 | Ga0209233_1000114 | Ga0209233_1000114204 | 452 |
| 717 | 3300025912 | Ga0207707_10012604 | Ga0207707_100126043 | 452 |
| 718 | 3300025917 | Ga0207660_10036427 | Ga0207660_100364273 | 452 |
| 719 | 3300025921 | Ga0207652_10012358 | Ga0207652_100123586 | 452 |
| 720 | 3300048925 | Ga0496122_0000710 | Ga0496122_0000710_59550_61013 | 452 |
| 721 | 3300048926 | Ga0496123_0000104 | Ga0496123_0000104_107211_108674 | 452 |
| 722 | 3300005543 | Ga0070672_100029332 | Ga0070672_1000293324 | 453 |
| 723 | 3300025919 | Ga0207657_10008750 | Ga0207657_1000875011 | 453 |
| 724 | 3300025932 | Ga0207690_10000308 | Ga0207690_1000030817 | 453 |
| 725 | 3300025940 | Ga0207691_10022148 | Ga0207691_100221483 | 453 |
| 726 | 3300025940 | Ga0207691_10180669 | Ga0207691_101806691 | 453 |
| 727 | 3300025942 | Ga0207689_10018945 | Ga0207689_100189451 | 453 |
| 728 | 3300025986 | Ga0207658_10063234 | Ga0207658_100632342 | 453 |
| 729 | 3300025986 | Ga0207658_10139797 | Ga0207658_101397971 | 453 |
| 730 | 3300026023 | Ga0207677_10104373 | Ga0207677_101043732 | 453 |
| 731 | 3300026089 | Ga0207648_10018369 | Ga0207648_100183694 | 453 |
| 732 | 3300041512 | Ga0451853_0219664 | Ga0451853_0219664_1973_3427 | 453 |
| 733 | 3300047472 | Ga0495686_0006806 | Ga0495686_0006806_1955_3403 | 453 |
| 734 | 3300053139 | Ga0500568_0006147 | Ga0500568_0006147_3322_4701 | 453 |
| 735 | 3300049569 | Ga0501032_0005214 | Ga0501032_0005214_5818_7209 | 454 |
| 736 | 3300049570 | Ga0501033_0001723 | Ga0501033_0001723_4059_5450 | 454 |
| 737 | 3300049571 | Ga0501034_0092426 | Ga0501034_0092426_1363_2754 | 454 |
| 738 | 3300049574 | Ga0501038_0006223 | Ga0501038_0006223_3827_5218 | 454 |
| 739 | 3300049575 | Ga0501039_0006491 | Ga0501039_0006491_7075_8466 | 454 |
| 740 | 3300049579 | Ga0501043_0201961 | Ga0501043_0201961_51_1442 | 454 |
| 741 | 3300049580 | Ga0501046_0003875 | Ga0501046_0003875_10063_11454 | 454 |
| 742 | 3300049581 | Ga0501047_0003794 | Ga0501047_0003794_156_1547 | 454 |
| 743 | 3300049742 | Ga0501080_0007181 | Ga0501080_0007181_8586_9977 | 454 |
| 744 | 3300049744 | Ga0501083_0130064 | Ga0501083_0130064_66_1457 | 454 |
| 745 | 3300049822 | Ga0501035_0089245 | Ga0501035_0089245_185_1663 | 454 |
| 746 | 3300049823 | Ga0501044_0033147 | Ga0501044_0033147_3546_4937 | 454 |
| 747 | 3300013296 | Ga0157374_10122742 | Ga0157374_101227422 | 455 |
| 748 | 3300025937 | Ga0207669_10046335 | Ga0207669_100463353 | 455 |
| 749 | 3300025949 | Ga0207667_10014711 | Ga0207667_100147113 | 455 |
| 750 | 3300026121 | Ga0207683_10071592 | Ga0207683_100715924 | 455 |
| 751 | 3300053087 | Ga0500643_001849 | Ga0500643_001849_3598_5064 | 455 |
| 752 | 3300053120 | Ga0500597_000153 | Ga0500597_000153_7208_8674 | 455 |
| 753 | 3300006237 | Ga0097621_100023445 | Ga0097621_1000234454 | 456 |
| 754 | 3300013297 | Ga0157378_10000303 | Ga0157378_1000030327 | 456 |
| 755 | 3300014969 | Ga0157376_10003027 | Ga0157376_100030274 | 456 |
| 756 | 3300049581 | Ga0501047_0005660 | Ga0501047_0005660_306_1766 | 456 |
| 757 | 3300049583 | Ga0501067_0047025 | Ga0501067_0047025_247_1698 | 456 |
| 758 | 3300049587 | Ga0501071_0010240 | Ga0501071_0010240_3974_5434 | 456 |
| 759 | 3300049588 | Ga0501072_0014884 | Ga0501072_0014884_4122_5573 | 456 |
| 760 | 3300049744 | Ga0501083_0010617 | Ga0501083_0010617_4323_5783 | 456 |
| 761 | 3300054114 | Ga0501084_0127209 | Ga0501084_0127209_601_2052 | 456 |
| 762 | 3300005455 | Ga0070663_100058798 | Ga0070663_1000587982 | 457 |
| 763 | 3300005546 | Ga0070696_100048471 | Ga0070696_1000484713 | 457 |
| 764 | 3300005547 | Ga0070693_100003242 | Ga0070693_1000032421 | 457 |
| 765 | 3300009093 | Ga0105240_10008240 | Ga0105240_100082405 | 457 |
| 766 | 3300009545 | Ga0105237_10029693 | Ga0105237_100296933 | 457 |
| 767 | 3300009551 | Ga0105238_10139335 | Ga0105238_101393352 | 457 |
| 768 | 3300013105 | Ga0157369_10086529 | Ga0157369_100865292 | 457 |
| 769 | 3300025250 | Ga0209026_1000147 | Ga0209026_100014748 | 457 |
| 770 | 3300025256 | Ga0209759_1001982 | Ga0209759_10019826 | 457 |
| 771 | 3300025272 | Ga0209455_1000267 | Ga0209455_100026745 | 457 |
| 772 | 3300025913 | Ga0207695_10001888 | Ga0207695_100018882 | 457 |
| 773 | 3300025914 | Ga0207671_10000260 | Ga0207671_1000026068 | 457 |
| 774 | 3300049571 | Ga0501034_0007682 | Ga0501034_0007682_7209_8705 | 457 |
| 775 | 3300049823 | Ga0501044_0004108 | Ga0501044_0004108_11242_12699 | 457 |
| 776 | iso_pu_bacteria | 2537561836 | 2538833242 | 457 |
| 777 | iso_pu_bacteria | 2643221562 | 2643832022 | 457 |
| 778 | iso_pu_bacteria | 2643221577 | 2643896342 | 457 |
| 779 | iso_pu_bacteria | 2643221685 | 2644478897 | 457 |
| 780 | iso_pu_bacteria | 2895395659 | 2895398360 | 457 |
| 781 | iso_pu_bacteria | 2939611941 | 2939614044 | 457 |
| 782 | 3300005337 | Ga0070682_100033288 | Ga0070682_1000332883 | 458 |
| 783 | 3300005456 | Ga0070678_100139481 | Ga0070678_1001394812 | 458 |
| 784 | 3300005539 | Ga0068853_100004880 | Ga0068853_1000048805 | 458 |
| 785 | 3300005548 | Ga0070665_100023034 | Ga0070665_1000230341 | 458 |
| 786 | 3300005563 | Ga0068855_100006907 | Ga0068855_1000069076 | 458 |
| 787 | 3300009553 | Ga0105249_10001801 | Ga0105249_1000180115 | 458 |
| 788 | 3300010375 | Ga0105239_10047706 | Ga0105239_100477064 | 458 |
| 789 | 3300014325 | Ga0163163_10003314 | Ga0163163_1000331410 | 458 |
| 790 | 3300025949 | Ga0207667_10012632 | Ga0207667_100126325 | 458 |
| 791 | 3300025961 | Ga0207712_10000305 | Ga0207712_1000030540 | 458 |
| 792 | 3300026088 | Ga0207641_10068127 | Ga0207641_100681273 | 458 |
| 793 | 3300026121 | Ga0207683_10243207 | Ga0207683_102432071 | 458 |
| 794 | 3300028379 | Ga0268266_10025677 | Ga0268266_100256773 | 458 |
| 795 | 3300049581 | Ga0501047_0013105 | Ga0501047_0013105_4749_6164 | 460 |
| 796 | 3300049585 | Ga0501069_0004048 | Ga0501069_0004048_1532_2947 | 460 |
| 797 | 3300049586 | Ga0501070_0003552 | Ga0501070_0003552_10992_12407 | 460 |
| 798 | 3300049589 | Ga0501073_0065864 | Ga0501073_0065864_951_2366 | 460 |
| 799 | 3300049590 | Ga0501074_0105380 | Ga0501074_0105380_165_1580 | 460 |
| 800 | 3300049822 | Ga0501035_0043573 | Ga0501035_0043573_2073_3488 | 460 |
| 801 | 3300049823 | Ga0501044_0009324 | Ga0501044_0009324_4507_5922 | 460 |
| 802 | 3300053079 | Ga0500610_0007052 | Ga0500610_0007052_2796_4256 | 462 |
| 803 | 3300005455 | Ga0070663_100000042 | Ga0070663_10000004238 | 463 |
| 804 | 3300025914 | Ga0207671_10001294 | Ga0207671_1000129415 | 463 |
| 805 | 3300026041 | Ga0207639_10020657 | Ga0207639_100206573 | 463 |
| 806 | 3300026067 | Ga0207678_10000566 | Ga0207678_1000056616 | 463 |
| 807 | 3300048926 | Ga0496123_0000323 | Ga0496123_0000323_40306_41850 | 463 |
| 808 | 3300005336 | Ga0070680_100005018 | Ga0070680_1000050183 | 464 |
| 809 | 3300005341 | Ga0070691_10015006 | Ga0070691_100150063 | 464 |
| 810 | 3300005344 | Ga0070661_100010219 | Ga0070661_1000102196 | 464 |
| 811 | 3300005345 | Ga0070692_10000887 | Ga0070692_1000088712 | 464 |
| 812 | 3300005616 | Ga0068852_100040954 | Ga0068852_1000409545 | 464 |
| 813 | 3300013105 | Ga0157369_10031979 | Ga0157369_100319795 | 464 |
| 814 | 3300013307 | Ga0157372_10024666 | Ga0157372_100246663 | 464 |
| 815 | 3300025909 | Ga0207705_10000400 | Ga0207705_1000040012 | 464 |
| 816 | 3300025913 | Ga0207695_10001663 | Ga0207695_1000166321 | 464 |
| 817 | 3300025917 | Ga0207660_10005901 | Ga0207660_100059015 | 464 |
| 818 | 3300025932 | Ga0207690_10000657 | Ga0207690_1000065716 | 464 |
| 819 | 3300025949 | Ga0207667_10000633 | Ga0207667_1000063312 | 464 |
| 820 | 3300025981 | Ga0207640_10001068 | Ga0207640_1000106810 | 464 |
| 821 | 3300026078 | Ga0207702_10004508 | Ga0207702_100045088 | 464 |
| 822 | 3300026142 | Ga0207698_10000844 | Ga0207698_100008448 | 464 |
| 823 | 3300049585 | Ga0501069_0000559 | Ga0501069_0000559_12366_13862 | 464 |
| 824 | 3300049586 | Ga0501070_0112433 | Ga0501070_0112433_38_1465 | 464 |
| 825 | 3300049593 | Ga0501077_0024988 | Ga0501077_0024988_1389_2816 | 464 |
| 826 | 3300001915 | JGI24741J21665_1003916 | JGI24741J21665_10039164 | 468 |
| 827 | 3300001915 | JGI24741J21665_1005429 | JGI24741J21665_10054292 | 468 |
| 828 | 3300001979 | JGI24740J21852_10007790 | JGI24740J21852_100077902 | 468 |
| 829 | 3300005329 | Ga0070683_100052424 | Ga0070683_1000524242 | 468 |
| 830 | 3300005336 | Ga0070680_100007340 | Ga0070680_1000073405 | 468 |
| 831 | 3300005336 | Ga0070680_100157181 | Ga0070680_1001571812 | 468 |
| 832 | 3300005339 | Ga0070660_100022372 | Ga0070660_1000223725 | 468 |
| 833 | 3300005344 | Ga0070661_100010825 | Ga0070661_1000108252 | 468 |
| 834 | 3300005458 | Ga0070681_10000534 | Ga0070681_1000053411 | 468 |
| 835 | 3300005530 | Ga0070679_100000571 | Ga0070679_10000057120 | 468 |
| 836 | 3300005535 | Ga0070684_100051279 | Ga0070684_1000512792 | 468 |
| 837 | 3300005535 | Ga0070684_100144571 | Ga0070684_1001445712 | 468 |
| 838 | 3300005539 | Ga0068853_100034404 | Ga0068853_1000344045 | 468 |
| 839 | 3300005546 | Ga0070696_100012446 | Ga0070696_1000124466 | 468 |
| 840 | 3300005564 | Ga0070664_100034110 | Ga0070664_1000341104 | 468 |
| 841 | 3300005614 | Ga0068856_100065594 | Ga0068856_1000655944 | 468 |
| 842 | 3300005616 | Ga0068852_100063910 | Ga0068852_1000639103 | 468 |
| 843 | 3300005616 | Ga0068852_100130544 | Ga0068852_1001305442 | 468 |
| 844 | 3300009093 | Ga0105240_10063977 | Ga0105240_100639773 | 468 |
| 845 | 3300009093 | Ga0105240_10200362 | Ga0105240_102003622 | 468 |
| 846 | 3300013100 | Ga0157373_10019278 | Ga0157373_100192785 | 468 |
| 847 | 3300013307 | Ga0157372_10193875 | Ga0157372_101938753 | 468 |
| 848 | 3300020081 | Ga0206354_10073408 | Ga0206354_100734083 | 468 |
| 849 | 3300025904 | Ga0207647_10002143 | Ga0207647_100021437 | 468 |
| 850 | 3300025904 | Ga0207647_10011433 | Ga0207647_100114336 | 468 |
| 851 | 3300025909 | Ga0207705_10004563 | Ga0207705_100045638 | 468 |
| 852 | 3300025909 | Ga0207705_10013247 | Ga0207705_100132472 | 468 |
| 853 | 3300025912 | Ga0207707_10003170 | Ga0207707_100031708 | 468 |
| 854 | 3300025912 | Ga0207707_10007883 | Ga0207707_100078832 | 468 |
| 855 | 3300025912 | Ga0207707_10056115 | Ga0207707_100561154 | 468 |
| 856 | 3300025913 | Ga0207695_10049016 | Ga0207695_100490163 | 468 |
| 857 | 3300025913 | Ga0207695_10084315 | Ga0207695_100843153 | 468 |
| 858 | 3300025913 | Ga0207695_10120392 | Ga0207695_101203923 | 468 |
| 859 | 3300025917 | Ga0207660_10000950 | Ga0207660_1000095011 | 468 |
| 860 | 3300025917 | Ga0207660_10006258 | Ga0207660_100062582 | 468 |
| 861 | 3300025917 | Ga0207660_10008193 | Ga0207660_100081933 | 468 |
| 862 | 3300025919 | Ga0207657_10037960 | Ga0207657_100379602 | 468 |
| 863 | 3300025919 | Ga0207657_10044281 | Ga0207657_100442815 | 468 |
| 864 | 3300025920 | Ga0207649_10005191 | Ga0207649_100051913 | 468 |
| 865 | 3300025920 | Ga0207649_10016814 | Ga0207649_100168146 | 468 |
| 866 | 3300025921 | Ga0207652_10000753 | Ga0207652_1000075319 | 468 |
| 867 | 3300025921 | Ga0207652_10002384 | Ga0207652_1000238415 | 468 |
| 868 | 3300025921 | Ga0207652_10007939 | Ga0207652_1000793912 | 468 |
| 869 | 3300025924 | Ga0207694_10072050 | Ga0207694_100720503 | 468 |
| 870 | 3300025932 | Ga0207690_10059895 | Ga0207690_100598953 | 468 |
| 871 | 3300025944 | Ga0207661_10004484 | Ga0207661_100044848 | 468 |
| 872 | 3300025949 | Ga0207667_10016754 | Ga0207667_1001675412 | 468 |
| 873 | 3300025949 | Ga0207667_10051227 | Ga0207667_100512275 | 468 |
| 874 | 3300025981 | Ga0207640_10001821 | Ga0207640_100018212 | 468 |
| 875 | 3300026041 | Ga0207639_10012820 | Ga0207639_100128202 | 468 |
| 876 | 3300026067 | Ga0207678_10009626 | Ga0207678_100096267 | 468 |
| 877 | 3300026067 | Ga0207678_10017588 | Ga0207678_100175888 | 468 |
| 878 | 3300026067 | Ga0207678_10018276 | Ga0207678_100182768 | 468 |
| 879 | 3300026078 | Ga0207702_10003564 | Ga0207702_100035647 | 468 |
| 880 | 3300026116 | Ga0207674_10015364 | Ga0207674_1001536412 | 468 |
| 881 | 3300026116 | Ga0207674_10021372 | Ga0207674_100213727 | 468 |
| 882 | 3300026142 | Ga0207698_10007097 | Ga0207698_100070973 | 468 |
| 883 | 3300038443 | Ga0395901_0061777 | Ga0395901_0061777_90_1613 | 468 |
| 884 | 3300049581 | Ga0501047_0020505 | Ga0501047_0020505_4212_5714 | 468 |
| 885 | 3300049586 | Ga0501070_0001793 | Ga0501070_0001793_4230_5732 | 468 |
| 886 | 3300049586 | Ga0501070_0011009 | Ga0501070_0011009_1780_3306 | 468 |
| 887 | 3300049586 | Ga0501070_0113314 | Ga0501070_0113314_418_1851 | 468 |
| 888 | 3300049590 | Ga0501074_0078236 | Ga0501074_0078236_52_1554 | 468 |
| 889 | 3300049742 | Ga0501080_0008242 | Ga0501080_0008242_4316_5818 | 468 |
| 890 | 3300049822 | Ga0501035_0021264 | Ga0501035_0021264_4221_5723 | 468 |
| 891 | 3300049823 | Ga0501044_0020832 | Ga0501044_0020832_3943_5445 | 468 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mvn-assembly1.cif.gz_A | crystal structure of a domain from a putative udp-n-acetylmuramate:l-alanyl-gamma-d-glutamyl-medo-diaminopimelate ligase from haemophilus ducreyi 35000hp | 0.9586 | 331 | 465 |
| 3mvn-assembly1.cif.gz_A | crystal structure of a domain from a putative udp-n-acetylmuramate:l-alanyl-gamma-d-glutamyl-medo-diaminopimelate ligase from haemophilus ducreyi 35000hp | 0.9435 | 331 | 465 |
| 5x6r-assembly1.cif.gz_A | crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 | 0.9368 | 2 | 31 |
| 3eag-assembly1.cif.gz_B | the crystal structure of udp-n-acetylmuramate:l-alanyl-gamma-d-glutamyl-meso-diaminopimelate ligase (mpl) from neisseria meningitides | 0.9249 | 2 | 330 |
| 6cau-assembly1.cif.gz_A | udp-n-acetylmuramate--alanine ligase from acinetobacter baumannii ab5075-uw with amppnp | 0.9194 | 2 | 328 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37773_314_451_3.90.190.20 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain | 0.9769 | 331 | 465 | 3.90.190.20 |
| 3hn7A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9622 | 1 | 90 | 3.40.50.720 |
| 3mvnA00 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain | 0.9546 | 331 | 465 | 3.90.190.20 |
| 3hn7A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9513 | 1 | 90 | 3.40.50.720 |
| af_P37773_314_451_3.90.190.20 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain | 0.9493 | 331 | 465 | 3.90.190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A855HIA3-F1-model_v4 | deleted | 1.001 | 1 | 104 |
|
| AF-A0A3C0GYS5-F1-model_v4 | deleted | 0.9868 | 1 | 74 |
|
| AF-A0A2X5SN44-F1-model_v4 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (EC 6.3.2.-) | 0.9864 | 1 | 90 |
GO:0009058
GO:0016881 |
| AF-A0A3G9ISN1-F1-model_v4 | deleted | 0.9858 | 1 | 467 |
|
| AF-M5CQ06-F1-model_v4 | deleted | 0.9851 | 2 | 468 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar