F484849

General Info

Members Datasets Scaffolds Average Seq Length
891 357 870 566

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100003049|Ga0070683_10000304915
Length 637
Sequence LRMEGNGGKGWADCGMRGRPVDTGVRFLAYFYSMKIALAQQNYHIGNFEENARKILEGIAQAKKAGAELVVFSEMSVCGYPPRDFLEFGDFIAQCYAAVDRIRQEADTIGVIIGAPVRNPNKEGKDLFNAALLLYEKEIKGVAHKTCLPNYDVFDDYRYFEPAYEWKVIPFKGKKIALTVCEDIWNLGDNPLYRVCPMDQLIRQHPDLMINISASRKEVVRANVLKYHLPMYYCNAVGAQTEIVFDGGSLIYDAAGRLVRELNYFEEDFAVVPVPHPVPPLYEELLPGLSVAINQPDPEDEIGSGVPGAGASRTEVRASKVPAVFDKDMRVSKQNSPERILQYLTDDRNIGQIRRALLLGIRDYFSKMGFSKAVIASSGGVDSAVTLALACEALGAANVRAVLLPSAYSSGHSVSDAEQLSRNLGNPYDIIPIREVYEALLHALKPAFTGKGSGSGGQEGQEIGLAEENLQSRARGNILMGLANKFGYVMLNTSNKSELATGYGTLYGDMAGGLSVLGDVYKGQVYALARDINRDGEIIPLNILSKAPSAELRPGQKDSDSLPEYDILDKVLYQYIERRQGPKEIIALGIDEELVRRILRLVNTSEYKRNQFCPIIRVSTKAFGVGRRVPIVGKYLS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
4 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
5 2818991444 Filimonas endophytica 3197 Isolate Unclassified
6 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
7 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
8 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
9 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
10 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
11 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
12 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
13 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
14 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
15 2914759650 Rhizosphaericola mali Isolate Rhizosphere
16 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
17 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
18 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
19 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
20 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
21 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
22 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
23 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
24 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
40 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
41 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
139 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
140 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
142 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
204 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
205 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
206 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
207 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
210 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
213 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
214 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
219 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
220 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
221 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
225 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
229 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
241 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
242 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
243 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
244 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
248 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
249 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
250 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
251 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
267 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
271 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
272 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
284 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
285 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
301 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
302 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
305 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
306 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
307 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
308 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
309 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
310 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
311 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
312 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
313 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
314 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
315 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
316 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
317 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
318 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
319 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
320 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
324 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
325 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
326 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
330 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
331 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
332 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
333 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
334 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
340 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
341 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
342 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
343 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
344 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
345 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
346 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
347 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
348 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
349 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
350 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
351 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
352 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
353 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
356 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
357 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 0
Isolates 2.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.16
Nodule 0
Rhizoplane 0.34
Rhizosphere 89.23
Stem 0
Stem Tuber 0
Unclassified 5.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663468 2162886007 Bacteria 272152
2 JGI24740J21852_10014062 3300001979 Unclassified 2965
3 JGI24739J22299_10000257 3300001989 Bacteria 17846
4 JGI25154J39366_1000002 3300002738 Bacteria 466942
5 JGI25406J46586_10005984 3300003203 Bacteria 5625
6 JGI25153J46596_10000187 3300003215 Bacteria 60030
7 rootH1_10041871 3300003316 Bacteria 3331
8 rootH2_10012018 3300003320 Bacteria 28153
9 rootH2_10034401 3300003320 Bacteria 6996
10 rootH2_10133206 3300003320 Bacteria 8189
11 rootL2_10017890 3300003322 Bacteria 11966
12 rootL2_10096669 3300003322 Bacteria 2077
13 rootL2_10189327 3300003322 Bacteria 5463
14 rootH1_10001200 3300003323 Bacteria 6332
15 rootH1_10004531 3300003323 Bacteria 21017
16 rootH1_10021532 3300003323 Bacteria 20565
17 rootH1_10097586 3300003323 Bacteria 2522
18 rootH1_10117601 3300003323 Bacteria 6301
19 JGI25160J50197_1002523 3300003354 Bacteria 8483
20 JGI25160J50197_1002636 3300003354 Bacteria 8267
21 Ga0055542_1003866 3300003762 Bacteria 3859
22 Ga0055526_1025514 3300003771 Bacteria 1895
23 Ga0055528_1000338 3300003790 Bacteria 39174
24 Ga0055528_1000600 3300003790 Bacteria 27092
25 Ga0055530_10001956 3300003791 Bacteria 14038
26 Ga0055531_10000014 3300003794 Bacteria 184532
27 Ga0065165_1000100 3300005262 Bacteria 141963
28 Ga0065714_10002439 3300005288 Bacteria 22682
29 Ga0065704_10070133 3300005289 Bacteria 1266035
30 Ga0065704_10073387 3300005289 Bacteria 7218
31 Ga0065704_10074690 3300005289 Bacteria 6066
32 Ga0065712_10001246 3300005290 Bacteria 8768
33 Ga0065707_10098632 3300005295 Bacteria 3070
34 Ga0070658_10029501 3300005327 Bacteria 4407
35 Ga0070658_10061489 3300005327 Bacteria 3060
36 Ga0070658_10063179 3300005327 Unclassified 3018
37 Ga0070676_10000064 3300005328 Bacteria 35148
38 Ga0070676_10066737 3300005328 Unclassified 2150
39 Ga0070683_100000508 3300005329 Bacteria 27277
40 Ga0070683_100002318 3300005329 Bacteria 15100
41 Ga0070683_100003049 3300005329 Bacteria 13472
42 Ga0070683_100023175 3300005329 Bacteria 5552
43 Ga0070683_100034025 3300005329 Bacteria 4652
44 Ga0070683_100095607 3300005329 Bacteria 2794
45 Ga0070690_100031981 3300005330 Bacteria 3282
46 Ga0070670_100034247 3300005331 Unclassified 4371
47 Ga0070670_100055395 3300005331 Bacteria 3404
48 Ga0068869_100000739 3300005334 Bacteria 18576
49 Ga0068869_100005945 3300005334 Bacteria 7712
50 Ga0068869_100006962 3300005334 Bacteria 7196
51 Ga0068869_100015990 3300005334 Bacteria 5050
52 Ga0070666_10000301 3300005335 Bacteria 31985
53 Ga0070666_10002049 3300005335 Bacteria 12241
54 Ga0070666_10047511 3300005335 Bacteria 2882
55 Ga0070680_100008330 3300005336 Bacteria 7934
56 Ga0070680_100084125 3300005336 Bacteria 2627
57 Ga0070680_100120681 3300005336 Unclassified 2188
58 Ga0070682_100000074 3300005337 Bacteria 91549
59 Ga0070682_100003881 3300005337 Bacteria 8291
60 Ga0070682_100046639 3300005337 Bacteria 2690
61 Ga0068868_100000543 3300005338 Bacteria 25349
62 Ga0068868_100002193 3300005338 Bacteria 13467
63 Ga0068868_100010528 3300005338 Bacteria 6701
64 Ga0068868_100032037 3300005338 Bacteria 4042
65 Ga0070660_100000647 3300005339 Bacteria 23049
66 Ga0070660_100029929 3300005339 Bacteria 4082
67 Ga0070660_100062577 3300005339 Bacteria 2891
68 Ga0070689_100004881 3300005340 Bacteria 9104
69 Ga0070687_100015930 3300005343 Bacteria 3412
70 Ga0070687_100022966 3300005343 Bacteria 2958
71 Ga0070661_100000111 3300005344 Bacteria 68066
72 Ga0070661_100012082 3300005344 Bacteria 6035
73 Ga0070668_100015362 3300005347 Bacteria 5722
74 Ga0070669_100012807 3300005353 Bacteria 5955
75 Ga0070669_100013584 3300005353 Bacteria 5789
76 Ga0070669_100016100 3300005353 Bacteria 5333
77 Ga0070675_100001118 3300005354 Bacteria 19352
78 Ga0070675_100010008 3300005354 Bacteria 7395
79 Ga0070671_100007427 3300005355 Bacteria 8760
80 Ga0070671_100016684 3300005355 Bacteria 5938
81 Ga0070674_100050497 3300005356 Bacteria 2863
82 Ga0070673_100000197 3300005364 Bacteria 29830
83 Ga0070673_100005388 3300005364 Bacteria 8179
84 Ga0070673_100019747 3300005364 Bacteria 4845
85 Ga0070673_100021118 3300005364 Bacteria 4711
86 Ga0070673_100080466 3300005364 Bacteria 2640
87 Ga0070688_100012988 3300005365 Bacteria 4686
88 Ga0070659_100004285 3300005366 Bacteria 10184
89 Ga0070659_100011665 3300005366 Bacteria 6503
90 Ga0070659_100018906 3300005366 Bacteria 5205
91 Ga0070659_100160722 3300005366 Bacteria 1836
92 Ga0070667_100000240 3300005367 Bacteria 62100
93 Ga0070667_100005088 3300005367 Bacteria 11005
94 Ga0070667_100128198 3300005367 Bacteria 2213
95 Ga0070713_100044714 3300005436 Bacteria 3626
96 Ga0070678_100019833 3300005456 Bacteria 4396
97 Ga0070662_100007893 3300005457 Bacteria 6918
98 Ga0070662_100054931 3300005457 Bacteria 2887
99 Ga0070662_100057633 3300005457 Bacteria 2823
100 Ga0070681_10011071 3300005458 Bacteria 8921
101 Ga0070681_10205905 3300005458 Unclassified 1884
102 Ga0068867_100005824 3300005459 Bacteria 8741
103 Ga0068867_100007586 3300005459 Bacteria 7677
104 Ga0068867_100018353 3300005459 Bacteria 4971
105 Ga0068867_100043071 3300005459 Bacteria 3304
106 Ga0068867_100157477 3300005459 Bacteria 1789
107 Ga0070685_10021575 3300005466 Unclassified 3502
108 Ga0070698_100001074 3300005471 Bacteria 30038
109 Ga0070698_100020355 3300005471 Bacteria 6954
110 Ga0070698_100025699 3300005471 Bacteria 6135
111 Ga0070679_100001516 3300005530 Bacteria 20680
112 Ga0070679_100052432 3300005530 Bacteria 4063
113 Ga0070679_100113173 3300005530 Bacteria 2699
114 Ga0070684_100001291 3300005535 Bacteria 17946
115 Ga0070684_100002976 3300005535 Bacteria 12607
116 Ga0070684_100009202 3300005535 Bacteria 7772
117 Ga0068853_100007168 3300005539 Bacteria 8923
118 Ga0068853_100007589 3300005539 Bacteria 8685
119 Ga0068853_100009547 3300005539 Bacteria 7816
120 Ga0068853_100020882 3300005539 Bacteria 5448
121 Ga0068853_100023897 3300005539 Bacteria 5122
122 Ga0068853_100034559 3300005539 Bacteria 4292
123 Ga0068853_100045683 3300005539 Unclassified 3752
124 Ga0068853_100078295 3300005539 Bacteria 2889
125 Ga0068853_100117153 3300005539 Bacteria 2372
126 Ga0068853_100132223 3300005539 Unclassified 2235
127 Ga0068853_100177439 3300005539 Bacteria 1931
128 Ga0070672_100013181 3300005543 Bacteria 5831
129 Ga0070672_100061639 3300005543 Unclassified 2957
130 Ga0070693_100005061 3300005547 Bacteria 6300
131 Ga0070665_100000002 3300005548 Bacteria 849037
132 Ga0070665_100008108 3300005548 Bacteria 10633
133 Ga0070665_100027148 3300005548 Bacteria 5766
134 Ga0070665_100036782 3300005548 Bacteria 4923
135 Ga0070665_100115026 3300005548 Unclassified 2693
136 Ga0068855_100000145 3300005563 Bacteria 91452
137 Ga0068855_100003314 3300005563 Bacteria 19707
138 Ga0068855_100016778 3300005563 Bacteria 8806
139 Ga0068855_100027195 3300005563 Bacteria 6844
140 Ga0068855_100031140 3300005563 Bacteria 6372
141 Ga0070664_100000243 3300005564 Bacteria 39166
142 Ga0070664_100000575 3300005564 Bacteria 27949
143 Ga0070664_100034619 3300005564 Bacteria 4237
144 Ga0070664_100036167 3300005564 Bacteria 4148
145 Ga0070664_100073457 3300005564 Bacteria 2934
146 Ga0068857_100014392 3300005577 Bacteria 6897
147 Ga0068857_100058242 3300005577 Bacteria 3430
148 Ga0068857_100087478 3300005577 Bacteria 2787
149 Ga0068857_100089760 3300005577 Bacteria 2750
150 Ga0068854_100023435 3300005578 Bacteria 4217
151 Ga0068854_100097467 3300005578 Bacteria 2198
152 Ga0068856_100001817 3300005614 Bacteria 22288
153 Ga0068856_100054687 3300005614 Bacteria 3938
154 Ga0068856_100056388 3300005614 Bacteria 3877
155 Ga0068856_100087457 3300005614 Bacteria 3098
156 Ga0068852_100001462 3300005616 Bacteria 15970
157 Ga0068852_100003210 3300005616 Bacteria 11418
158 Ga0068852_100011285 3300005616 Bacteria 6719
159 Ga0068852_100029755 3300005616 Bacteria 4489
160 Ga0068852_100038683 3300005616 Bacteria 4011
161 Ga0068852_100077578 3300005616 Unclassified 2937
162 Ga0068859_100000006 3300005617 Bacteria 421509
163 Ga0068859_100001697 3300005617 Bacteria 22427
164 Ga0068859_100006362 3300005617 Bacteria 11981
165 Ga0068859_100006790 3300005617 Bacteria 11629
166 Ga0068859_100018396 3300005617 Bacteria 7024
167 Ga0068859_100039325 3300005617 Bacteria 4744
168 Ga0068859_100042435 3300005617 Bacteria 4568
169 Ga0068859_100260678 3300005617 Bacteria 1825
170 Ga0068864_100030070 3300005618 Bacteria 4603
171 Ga0068864_100030464 3300005618 Bacteria 4573
172 Ga0068864_100065161 3300005618 Bacteria 3161
173 Ga0068861_100002834 3300005719 Bacteria 11403
174 Ga0068861_100007430 3300005719 Bacteria 7511
175 Ga0068861_100007576 3300005719 Bacteria 7445
176 Ga0068851_10000010 3300005834 Bacteria 202121
177 Ga0068851_10001240 3300005834 Bacteria 11085
178 Ga0068870_10007549 3300005840 Bacteria 4853
179 Ga0068870_10008140 3300005840 Bacteria 4700
180 Ga0068863_100014068 3300005841 Bacteria 7710
181 Ga0068863_100015478 3300005841 Bacteria 7331
182 Ga0068863_100023628 3300005841 Bacteria 5869
183 Ga0068858_100000889 3300005842 Bacteria 31013
184 Ga0068858_100011681 3300005842 Bacteria 8281
185 Ga0068860_100000003 3300005843 Bacteria 575741
186 Ga0068860_100001345 3300005843 Bacteria 26726
187 Ga0068860_100002872 3300005843 Bacteria 17875
188 Ga0068860_100004206 3300005843 Bacteria 14751
189 Ga0068860_100007629 3300005843 Bacteria 10824
190 Ga0068860_100011297 3300005843 Bacteria 8798
191 Ga0068862_100006209 3300005844 Bacteria 9952
192 Ga0068862_100007876 3300005844 Bacteria 8815
193 Ga0081540_1003918 3300005983 Bacteria 11589
194 Ga0081539_10000085 3300005985 Bacteria 217816
195 Ga0081539_10001707 3300005985 Bacteria 35373
196 Ga0081539_10014329 3300005985 Bacteria 5873
197 Ga0070717_10000648 3300006028 Bacteria 22345
198 Ga0075366_10012766 3300006195 Bacteria 4772
199 Ga0075366_10028353 3300006195 Bacteria 3286
200 Ga0097621_100001013 3300006237 Bacteria 19778
201 Ga0097621_100001217 3300006237 Bacteria 17815
202 Ga0097621_100020381 3300006237 Bacteria 5108
203 Ga0097621_100049975 3300006237 Bacteria 3399
204 Ga0097621_100057071 3300006237 Bacteria 3191
205 Ga0097621_100077093 3300006237 Bacteria 2766
206 Ga0097621_100083120 3300006237 Unclassified 2668
207 Ga0068871_100003639 3300006358 Bacteria 10589
208 Ga0068871_100007102 3300006358 Bacteria 7984
209 Ga0068871_100016955 3300006358 Bacteria 5500
210 Ga0068871_100025182 3300006358 Bacteria 4625
211 Ga0068871_100051945 3300006358 Bacteria 3318
212 Ga0068871_100133533 3300006358 Unclassified 2106
213 Ga0075428_100012683 3300006844 Bacteria 9372
214 Ga0075428_100095861 3300006844 Unclassified 3234
215 Ga0075430_100006312 3300006846 Bacteria 10000
216 Ga0075431_100085335 3300006847 Bacteria 3259
217 Ga0075433_10006563 3300006852 Bacteria 9209
218 Ga0075434_100001986 3300006871 Bacteria 17749
219 Ga0075434_100034087 3300006871 Bacteria 5026
220 Ga0075429_100000533 3300006880 Bacteria 28947
221 Ga0075429_100035556 3300006880 Bacteria 4333
222 Ga0068865_100000491 3300006881 Bacteria 22178
223 Ga0068865_100050338 3300006881 Bacteria 2877
224 Ga0068865_100096012 3300006881 Bacteria 2161
225 Ga0068865_100123175 3300006881 Bacteria 1931
226 Ga0075436_100037970 3300006914 Bacteria 3324
227 Ga0097620_100000006 3300006931 Bacteria 421509
228 Ga0097620_100001697 3300006931 Bacteria 22427
229 Ga0097620_100006362 3300006931 Bacteria 11981
230 Ga0097620_100006790 3300006931 Bacteria 11629
231 Ga0097620_100018396 3300006931 Bacteria 7024
232 Ga0097620_100039324 3300006931 Bacteria 4744
233 Ga0097620_100042435 3300006931 Bacteria 4568
234 Ga0097620_100260671 3300006931 Bacteria 1825
235 Ga0075435_100000289 3300007076 Bacteria 31160
236 Ga0105240_10000001 3300009093 Bacteria 2887840
237 Ga0105240_10000020 3300009093 Bacteria 399699
238 Ga0105240_10000367 3300009093 Bacteria 84666
239 Ga0105240_10000457 3300009093 Bacteria 75275
240 Ga0105240_10000487 3300009093 Bacteria 73453
241 Ga0105240_10004986 3300009093 Bacteria 19945
242 Ga0105240_10006862 3300009093 Bacteria 16644
243 Ga0105240_10010712 3300009093 Bacteria 12865
244 Ga0105240_10046442 3300009093 Bacteria 5503
245 Ga0105240_10060472 3300009093 Bacteria 4723
246 Ga0111539_10016272 3300009094 Bacteria 9223
247 Ga0111539_10052998 3300009094 Bacteria 4829
248 Ga0111539_10079509 3300009094 Bacteria 3857
249 Ga0111539_10194366 3300009094 Bacteria 2367
250 Ga0105247_10005318 3300009101 Bacteria 8116
251 Ga0114129_10018174 3300009147 Bacteria 10010
252 Ga0114129_10047706 3300009147 Bacteria 6017
253 Ga0105241_10003231 3300009174 Bacteria 12123
254 Ga0105241_10003877 3300009174 Bacteria 11089
255 Ga0105241_10038676 3300009174 Bacteria 3597
256 Ga0105242_10006871 3300009176 Bacteria 8776
257 Ga0105242_10010685 3300009176 Bacteria 7048
258 Ga0105242_10036072 3300009176 Bacteria 3965
259 Ga0105248_10016053 3300009177 Bacteria 8243
260 Ga0105237_10003940 3300009545 Bacteria 17384
261 Ga0105237_10011351 3300009545 Bacteria 9426
262 Ga0105237_10014983 3300009545 Bacteria 8081
263 Ga0105237_10045165 3300009545 Bacteria 4434
264 Ga0105237_10047857 3300009545 Bacteria 4299
265 Ga0105237_10053020 3300009545 Bacteria 4069
266 Ga0105237_10148535 3300009545 Bacteria 2339
267 Ga0105237_10209197 3300009545 Bacteria 1951
268 Ga0105238_10010193 3300009551 Bacteria 9423
269 Ga0105249_10001044 3300009553 Bacteria 24495
270 Ga0105249_10002600 3300009553 Bacteria 15643
271 Ga0105249_10003251 3300009553 Bacteria 14076
272 Ga0105249_10013188 3300009553 Bacteria 7293
273 Ga0105249_10018872 3300009553 Bacteria 6145
274 Ga0105249_10025989 3300009553 Bacteria 5273
275 Ga0105249_10085511 3300009553 Bacteria 2939
276 Ga0105249_10138193 3300009553 Bacteria 2334
277 Ga0105249_10200827 3300009553 Bacteria 1951
278 Ga0105239_10000283 3300010375 Bacteria 74612
279 Ga0105239_10000631 3300010375 Bacteria 50176
280 Ga0105239_10002212 3300010375 Bacteria 24980
281 Ga0105239_10002422 3300010375 Bacteria 23765
282 Ga0105239_10041719 3300010375 Bacteria 5028
283 Ga0105246_10009216 3300011119 Bacteria 6078
284 Ga0105246_10056558 3300011119 Bacteria 2712
285 Ga0157373_10004089 3300013100 Bacteria 10989
286 Ga0157373_10008404 3300013100 Bacteria 7664
287 Ga0157373_10013073 3300013100 Bacteria 6091
288 Ga0157373_10021959 3300013100 Bacteria 4631
289 Ga0157373_10027803 3300013100 Bacteria 4080
290 Ga0157371_10000868 3300013102 Bacteria 34292
291 Ga0157371_10001718 3300013102 Bacteria 22261
292 Ga0157371_10007543 3300013102 Bacteria 8796
293 Ga0157371_10009380 3300013102 Bacteria 7707
294 Ga0157371_10013075 3300013102 Bacteria 6319
295 Ga0157371_10014951 3300013102 Bacteria 5840
296 Ga0157371_10027230 3300013102 Bacteria 4148
297 Ga0157371_10045155 3300013102 Bacteria 3136
298 Ga0157371_10079944 3300013102 Unclassified 2315
299 Ga0157370_10000313 3300013104 Bacteria 60838
300 Ga0157370_10000628 3300013104 Bacteria 43950
301 Ga0157370_10001571 3300013104 Bacteria 28252
302 Ga0157370_10026250 3300013104 Bacteria 5755
303 Ga0157370_10049874 3300013104 Bacteria 4003
304 Ga0157370_10106726 3300013104 Unclassified 2620
305 Ga0157369_10015080 3300013105 Bacteria 8723
306 Ga0157369_10042857 3300013105 Bacteria 4936
307 Ga0157374_10000013 3300013296 Bacteria 461240
308 Ga0157374_10006867 3300013296 Bacteria 9682
309 Ga0157374_10008233 3300013296 Bacteria 8909
310 Ga0157374_10045714 3300013296 Bacteria 4052
311 Ga0157378_10008769 3300013297 Bacteria 8804
312 Ga0157378_10019118 3300013297 Bacteria 6019
313 Ga0157378_10025790 3300013297 Bacteria 5178
314 Ga0157378_10045323 3300013297 Bacteria 3907
315 Ga0157378_10048499 3300013297 Bacteria 3777
316 Ga0163162_10000175 3300013306 Bacteria 59209
317 Ga0163162_10000244 3300013306 Bacteria 49260
318 Ga0163162_10001206 3300013306 Bacteria 24134
319 Ga0163162_10001299 3300013306 Bacteria 23358
320 Ga0163162_10002221 3300013306 Bacteria 18233
321 Ga0163162_10004298 3300013306 Bacteria 13710
322 Ga0163162_10006923 3300013306 Bacteria 10993
323 Ga0163162_10013139 3300013306 Bacteria 8084
324 Ga0163162_10018140 3300013306 Bacteria 6890
325 Ga0163162_10059758 3300013306 Bacteria 3845
326 Ga0163162_10061209 3300013306 Bacteria 3802
327 Ga0157372_10004707 3300013307 Bacteria 14494
328 Ga0157372_10006438 3300013307 Bacteria 12502
329 Ga0157372_10010278 3300013307 Bacteria 9942
330 Ga0157372_10014609 3300013307 Bacteria 8400
331 Ga0157372_10028658 3300013307 Bacteria 6079
332 Ga0157372_10090212 3300013307 Bacteria 3484
333 Ga0157372_10116165 3300013307 Bacteria 3068
334 Ga0157372_10161543 3300013307 Bacteria 2589
335 Ga0157372_10245278 3300013307 Unclassified 2079
336 Ga0157375_10005169 3300013308 Bacteria 11323
337 Ga0157375_10007261 3300013308 Bacteria 9694
338 Ga0157375_10027672 3300013308 Bacteria 5303
339 Ga0157375_10035262 3300013308 Bacteria 4773
340 Ga0157375_10056528 3300013308 Bacteria 3875
341 Ga0157375_10064390 3300013308 Unclassified 3650
342 Ga0157375_10102667 3300013308 Bacteria 2945
343 Ga0157375_10124458 3300013308 Bacteria 2692
344 Ga0157375_10185909 3300013308 Bacteria 2231
345 Ga0163163_10000202 3300014325 Bacteria 61701
346 Ga0163163_10015385 3300014325 Bacteria 7072
347 Ga0163163_10255936 3300014325 Bacteria 1802
348 Ga0157380_10001220 3300014326 Bacteria 16666
349 Ga0157380_10002444 3300014326 Bacteria 12518
350 Ga0157380_10004286 3300014326 Bacteria 9876
351 Ga0157380_10033908 3300014326 Bacteria 3934
352 Ga0157377_10004071 3300014745 Bacteria 6673
353 Ga0157377_10019477 3300014745 Bacteria 3546
354 Ga0157379_10001465 3300014968 Bacteria 19448
355 Ga0157379_10019036 3300014968 Bacteria 6061
356 Ga0157379_10021198 3300014968 Bacteria 5751
357 Ga0157379_10026553 3300014968 Bacteria 5154
358 Ga0157376_10000842 3300014969 Bacteria 20112
359 Ga0157376_10003024 3300014969 Bacteria 11531
360 Ga0157376_10003719 3300014969 Bacteria 10545
361 Ga0157376_10028267 3300014969 Bacteria 4456
362 Ga0157376_10070217 3300014969 Bacteria 2972
363 Ga0157376_10080508 3300014969 Bacteria 2794
364 Ga0157376_10080737 3300014969 Bacteria 2791
365 Ga0182007_10008552 3300015262 Bacteria 4194
366 Ga0182005_1000061 3300015265 Bacteria 98415
367 Ga0163161_10018794 3300017792 Bacteria 4844
368 Ga0163161_10044659 3300017792 Bacteria 3192
369 Ga0163161_10071142 3300017792 Bacteria 2545
370 Ga0213876_10006792 3300021384 Bacteria 6249
371 Ga0209436_101437 3300025208 Bacteria 8344
372 Ga0209258_100029 3300025242 Bacteria 490648
373 Ga0209646_1000005 3300025246 Bacteria 717627
374 Ga0209646_1001757 3300025246 Bacteria 5460
375 Ga0209026_1000587 3300025250 Bacteria 23729
376 Ga0209148_1000089 3300025254 Bacteria 253548
377 Ga0209673_1000049 3300025273 Bacteria 286207
378 Ga0209564_1013600 3300025295 Bacteria 3438
379 Ga0209564_1014874 3300025295 Bacteria 3205
380 Ga0209758_1000346 3300025297 Bacteria 84821
381 Ga0209758_1025236 3300025297 Bacteria 2614
382 Ga0209050_1000272 3300025298 Bacteria 110636
383 Ga0207426_1000059 3300025302 Bacteria 363842
384 Ga0207426_1000233 3300025302 Bacteria 127848
385 Ga0207426_1000381 3300025302 Bacteria 76038
386 Ga0207426_1001075 3300025302 Bacteria 25593
387 Ga0207426_1010995 3300025302 Bacteria 3476
388 Ga0209257_1000004 3300025304 Bacteria 1678347
389 Ga0207656_10000157 3300025321 Bacteria 25236
390 Ga0207680_10000855 3300025903 Bacteria 14362
391 Ga0207680_10001858 3300025903 Bacteria 9924
392 Ga0207647_10000096 3300025904 Bacteria 67468
393 Ga0207647_10007138 3300025904 Bacteria 8101
394 Ga0207647_10011414 3300025904 Bacteria 6232
395 Ga0207647_10056788 3300025904 Bacteria 2401
396 Ga0207685_10017549 3300025905 Unclassified 2317
397 Ga0207645_10000326 3300025907 Bacteria 39738
398 Ga0207643_10015731 3300025908 Unclassified 4120
399 Ga0207643_10019405 3300025908 Bacteria 3725
400 Ga0207705_10009499 3300025909 Bacteria 7076
401 Ga0207705_10026743 3300025909 Bacteria 4112
402 Ga0207705_10044637 3300025909 Bacteria 3185
403 Ga0207705_10097636 3300025909 Bacteria 2158
404 Ga0207705_10108977 3300025909 Bacteria 2044
405 Ga0207654_10001346 3300025911 Bacteria 13038
406 Ga0207654_10001813 3300025911 Bacteria 11092
407 Ga0207695_10000001 3300025913 Bacteria 2888630
408 Ga0207695_10000020 3300025913 Bacteria 723025
409 Ga0207695_10000051 3300025913 Bacteria 399641
410 Ga0207695_10000056 3300025913 Bacteria 382433
411 Ga0207695_10000066 3300025913 Bacteria 334103
412 Ga0207695_10000081 3300025913 Bacteria 284797
413 Ga0207695_10000156 3300025913 Bacteria 204576
414 Ga0207695_10000550 3300025913 Bacteria 77346
415 Ga0207695_10001892 3300025913 Bacteria 32670
416 Ga0207695_10009054 3300025913 Bacteria 12373
417 Ga0207695_10049095 3300025913 Bacteria 4451
418 Ga0207671_10000025 3300025914 Bacteria 271617
419 Ga0207671_10007052 3300025914 Bacteria 9839
420 Ga0207671_10024135 3300025914 Bacteria 4576
421 Ga0207671_10027684 3300025914 Bacteria 4237
422 Ga0207671_10030857 3300025914 Bacteria 3995
423 Ga0207671_10104978 3300025914 Unclassified 2143
424 Ga0207660_10007760 3300025917 Bacteria 6948
425 Ga0207660_10026465 3300025917 Bacteria 3951
426 Ga0207662_10003292 3300025918 Bacteria 8290
427 Ga0207662_10030141 3300025918 Bacteria 3147
428 Ga0207657_10005023 3300025919 Bacteria 13884
429 Ga0207657_10011902 3300025919 Bacteria 8609
430 Ga0207657_10029703 3300025919 Bacteria 4971
431 Ga0207649_10002398 3300025920 Bacteria 10509
432 Ga0207652_10000187 3300025921 Bacteria 65282
433 Ga0207652_10000198 3300025921 Bacteria 63388
434 Ga0207652_10004623 3300025921 Bacteria 11155
435 Ga0207681_10002024 3300025923 Bacteria 13028
436 Ga0207694_10011093 3300025924 Bacteria 6806
437 Ga0207650_10014874 3300025925 Bacteria 5414
438 Ga0207650_10066726 3300025925 Bacteria 2699
439 Ga0207659_10027778 3300025926 Bacteria 3836
440 Ga0207659_10030533 3300025926 Bacteria 3684
441 Ga0207700_10022968 3300025928 Bacteria 4289
442 Ga0207644_10008865 3300025931 Bacteria 6589
443 Ga0207690_10001171 3300025932 Bacteria 16575
444 Ga0207690_10002934 3300025932 Bacteria 10277
445 Ga0207690_10040708 3300025932 Bacteria 3040
446 Ga0207690_10045051 3300025932 Bacteria 2912
447 Ga0207706_10005261 3300025933 Bacteria 12070
448 Ga0207706_10009268 3300025933 Bacteria 9042
449 Ga0207706_10035062 3300025933 Bacteria 4463
450 Ga0207706_10050715 3300025933 Bacteria 3667
451 Ga0207706_10051143 3300025933 Bacteria 3650
452 Ga0207686_10001189 3300025934 Bacteria 15075
453 Ga0207670_10002141 3300025936 Bacteria 10336
454 Ga0207670_10013100 3300025936 Bacteria 4879
455 Ga0207670_10032418 3300025936 Bacteria 3360
456 Ga0207670_10076597 3300025936 Bacteria 2328
457 Ga0207669_10011591 3300025937 Bacteria 4298
458 Ga0207669_10026030 3300025937 Bacteria 3174
459 Ga0207669_10111164 3300025937 Bacteria 1837
460 Ga0207704_10002375 3300025938 Bacteria 8459
461 Ga0207704_10014903 3300025938 Bacteria 3944
462 Ga0207704_10040783 3300025938 Bacteria 2717
463 Ga0207704_10072337 3300025938 Bacteria 2191
464 Ga0207704_10080648 3300025938 Unclassified 2101
465 Ga0207691_10000076 3300025940 Bacteria 83005
466 Ga0207691_10027218 3300025940 Bacteria 5364
467 Ga0207691_10029891 3300025940 Bacteria 5096
468 Ga0207691_10143076 3300025940 Bacteria 2106
469 Ga0207689_10000210 3300025942 Bacteria 51572
470 Ga0207689_10001060 3300025942 Bacteria 26468
471 Ga0207689_10002845 3300025942 Bacteria 15974
472 Ga0207689_10002851 3300025942 Bacteria 15954
473 Ga0207689_10005578 3300025942 Bacteria 11228
474 Ga0207689_10007781 3300025942 Bacteria 9379
475 Ga0207689_10023684 3300025942 Bacteria 5149
476 Ga0207689_10024801 3300025942 Bacteria 5028
477 Ga0207689_10040931 3300025942 Bacteria 3834
478 Ga0207661_10000669 3300025944 Bacteria 22178
479 Ga0207661_10011967 3300025944 Bacteria 6302
480 Ga0207661_10033981 3300025944 Bacteria 3961
481 Ga0207661_10062118 3300025944 Bacteria 3021
482 Ga0207679_10000091 3300025945 Bacteria 78725
483 Ga0207679_10004528 3300025945 Bacteria 8660
484 Ga0207679_10054054 3300025945 Bacteria 2954
485 Ga0207667_10000492 3300025949 Bacteria 52207
486 Ga0207667_10002366 3300025949 Bacteria 23615
487 Ga0207667_10005458 3300025949 Bacteria 15498
488 Ga0207667_10027086 3300025949 Bacteria 6249
489 Ga0207667_10048616 3300025949 Bacteria 4484
490 Ga0207667_10138552 3300025949 Bacteria 2505
491 Ga0207651_10014260 3300025960 Bacteria 4581
492 Ga0207651_10014270 3300025960 Bacteria 4580
493 Ga0207651_10058053 3300025960 Bacteria 2673
494 Ga0207651_10106870 3300025960 Bacteria 2090
495 Ga0207712_10001457 3300025961 Bacteria 16141
496 Ga0207712_10002253 3300025961 Bacteria 12531
497 Ga0207712_10003884 3300025961 Bacteria 9442
498 Ga0207712_10006568 3300025961 Bacteria 7340
499 Ga0207712_10013777 3300025961 Bacteria 5186
500 Ga0207712_10014032 3300025961 Bacteria 5143
501 Ga0207712_10066574 3300025961 Unclassified 2575
502 Ga0207668_10014583 3300025972 Bacteria 4864
503 Ga0207658_10008424 3300025986 Bacteria 7019
504 Ga0207658_10079544 3300025986 Bacteria 2508
505 Ga0207677_10004007 3300026023 Bacteria 7860
506 Ga0207677_10007307 3300026023 Bacteria 6101
507 Ga0207677_10009204 3300026023 Bacteria 5546
508 Ga0207677_10017223 3300026023 Bacteria 4302
509 Ga0207703_10004255 3300026035 Bacteria 11782
510 Ga0207703_10030625 3300026035 Bacteria 4254
511 Ga0207639_10001896 3300026041 Bacteria 14035
512 Ga0207639_10004353 3300026041 Bacteria 9553
513 Ga0207639_10004753 3300026041 Bacteria 9148
514 Ga0207639_10016310 3300026041 Bacteria 5253
515 Ga0207639_10098604 3300026041 Bacteria 2356
516 Ga0207639_10137223 3300026041 Bacteria 2033
517 Ga0207678_10009466 3300026067 Bacteria 8570
518 Ga0207708_10017202 3300026075 Bacteria 5442
519 Ga0207702_10008275 3300026078 Bacteria 8788
520 Ga0207702_10067987 3300026078 Unclassified 3060
521 Ga0207702_10128423 3300026078 Bacteria 2278
522 Ga0207641_10002685 3300026088 Bacteria 16230
523 Ga0207641_10002871 3300026088 Bacteria 15625
524 Ga0207641_10009891 3300026088 Bacteria 7852
525 Ga0207641_10030841 3300026088 Bacteria 4443
526 Ga0207641_10118440 3300026088 Bacteria 2359
527 Ga0207641_10160467 3300026088 Bacteria 2044
528 Ga0207648_10002106 3300026089 Bacteria 21685
529 Ga0207648_10003360 3300026089 Bacteria 16813
530 Ga0207648_10005153 3300026089 Bacteria 13235
531 Ga0207648_10008642 3300026089 Bacteria 9835
532 Ga0207648_10014835 3300026089 Bacteria 7186
533 Ga0207648_10018365 3300026089 Bacteria 6334
534 Ga0207648_10058255 3300026089 Bacteria 3369
535 Ga0207648_10161143 3300026089 Bacteria 1981
536 Ga0207648_10179063 3300026089 Bacteria 1876
537 Ga0207676_10003274 3300026095 Bacteria 11514
538 Ga0207676_10024425 3300026095 Bacteria 4472
539 Ga0207676_10083396 3300026095 Bacteria 2603
540 Ga0207676_10084450 3300026095 Bacteria 2588
541 Ga0207676_10173889 3300026095 Unclassified 1879
542 Ga0207674_10005257 3300026116 Bacteria 15410
543 Ga0207674_10049020 3300026116 Bacteria 4321
544 Ga0207674_10073409 3300026116 Bacteria 3435
545 Ga0207674_10132858 3300026116 Unclassified 2451
546 Ga0207675_100000085 3300026118 Bacteria 73716
547 Ga0207675_100011340 3300026118 Bacteria 8340
548 Ga0207675_100029953 3300026118 Bacteria 5066
549 Ga0207675_100031240 3300026118 Bacteria 4960
550 Ga0207683_10001248 3300026121 Bacteria 23074
551 Ga0207683_10074800 3300026121 Bacteria 2998
552 Ga0207683_10101930 3300026121 Bacteria 2563
553 Ga0207698_10003249 3300026142 Bacteria 9765
554 Ga0207698_10075369 3300026142 Bacteria 2696
555 Ga0207428_10037266 3300027907 Bacteria 3957
556 Ga0268266_10000022 3300028379 Bacteria 508060
557 Ga0268266_10021289 3300028379 Bacteria 5524
558 Ga0268266_10033089 3300028379 Bacteria 4396
559 Ga0268265_10004802 3300028380 Bacteria 9318
560 Ga0268265_10005023 3300028380 Bacteria 9078
561 Ga0268264_10000082 3300028381 Bacteria 246913
562 Ga0268264_10004566 3300028381 Bacteria 11791
563 Ga0268264_10004767 3300028381 Bacteria 11512
564 Ga0268264_10005045 3300028381 Bacteria 11175
565 Ga0268264_10005982 3300028381 Bacteria 10303
566 Ga0268264_10008916 3300028381 Bacteria 8321
567 Ga0268264_10009473 3300028381 Bacteria 8065
568 Ga0268264_10075400 3300028381 Bacteria 2868
569 Ga0265326_10006563 3300028558 Bacteria 3604
570 Ga0265334_10006112 3300028573 Bacteria 5218
571 Ga0265318_10001041 3300028577 Bacteria 17593
572 Ga0265318_10007156 3300028577 Bacteria 5072
573 Ga0307517_10075895 3300028786 Bacteria 2942
574 Ga0307515_10000001 3300028794 Bacteria 4259510
575 Ga0307515_10000021 3300028794 Bacteria 406008
576 Ga0265338_10000053 3300028800 Bacteria 208184
577 Ga0265338_10000442 3300028800 Bacteria 74078
578 Ga0265338_10027407 3300028800 Bacteria 5717
579 Ga0265324_10013370 3300029957 Bacteria 3065
580 Ga0307511_10000027 3300030521 Bacteria 109500
581 Ga0265332_10040388 3300031238 Bacteria 2020
582 Ga0265320_10000776 3300031240 Bacteria 24440
583 Ga0265320_10003809 3300031240 Bacteria 10011
584 Ga0265320_10028679 3300031240 Bacteria 2887
585 Ga0265339_10008119 3300031249 Bacteria 6704
586 Ga0265331_10018911 3300031250 Bacteria 3562
587 Ga0265331_10020100 3300031250 Bacteria 3434
588 Ga0265327_10000059 3300031251 Bacteria 236935
589 Ga0265327_10000098 3300031251 Bacteria 190693
590 Ga0265327_10000142 3300031251 Bacteria 157436
591 Ga0265327_10000338 3300031251 Bacteria 88898
592 Ga0265327_10002348 3300031251 Bacteria 20176
593 Ga0265327_10006052 3300031251 Bacteria 9815
594 Ga0265327_10012078 3300031251 Bacteria 5865
595 Ga0265327_10031964 3300031251 Bacteria 2952
596 Ga0307509_10042858 3300031507 Bacteria 4900
597 Ga0307509_10120494 3300031507 Bacteria 2602
598 Ga0307408_100000017 3300031548 Bacteria 355890
599 Ga0265313_10003199 3300031595 Bacteria 13483
600 Ga0265313_10009844 3300031595 Bacteria 6151
601 Ga0265313_10020490 3300031595 Bacteria 3646
602 Ga0307508_10000157 3300031616 Bacteria 81275
603 Ga0307508_10003578 3300031616 Bacteria 15652
604 Ga0307508_10042451 3300031616 Bacteria 4080
605 Ga0265314_10000517 3300031711 Bacteria 49904
606 Ga0265314_10002697 3300031711 Bacteria 17782
607 Ga0265314_10005415 3300031711 Bacteria 11533
608 Ga0265314_10007159 3300031711 Bacteria 9715
609 Ga0316578_10028658 3300031728 Bacteria 3155
610 Ga0307516_10001138 3300031730 Bacteria 37091
611 Ga0307516_10033453 3300031730 Bacteria 5172
612 Ga0307410_10000060 3300031852 Bacteria 38643
613 Ga0307412_10007777 3300031911 Bacteria 6098
614 Ga0307409_100000021 3300031995 Bacteria 54572
615 Ga0307409_100118982 3300031995 Bacteria 2233
616 Ga0307414_10018010 3300032004 Bacteria 4336
617 Ga0307414_10043941 3300032004 Bacteria 3047
618 Ga0307415_100103944 3300032126 Bacteria 2091
619 Ga0316585_10004580 3300032137 Bacteria 3859
620 Ga0307510_10029575 3300033180 Bacteria 6232
621 Ga0373956_0017169 3300035119 Bacteria 3049
622 Ga0373937_0003368 3300036401 Bacteria 13412
623 Ga0373937_0130081 3300036401 Bacteria 2351
624 Ga0316584_0130916 3300036712 Bacteria 1874
625 Ga0395899_0003604 3300037312 Bacteria 12245
626 Ga0395899_0007612 3300037312 Bacteria 8353
627 Ga0395900_0064447 3300037418 Bacteria 3765
628 Ga0395900_0095736 3300037418 Bacteria 3050
629 Ga0395898_0003818 3300037466 Bacteria 16686
630 Ga0395905_0003378 3300037471 Bacteria 17099
631 Ga0395905_0043377 3300037471 Bacteria 4220
632 Ga0395905_0064357 3300037471 Bacteria 3431
633 Ga0395901_0006287 3300038443 Bacteria 12032
634 Ga0395901_0015165 3300038443 Bacteria 7837
635 Ga0395901_0064480 3300038443 Bacteria 3814
636 Ga0400489_60531 3300039093 Bacteria 11725
637 Ga0436365_0561939 3300039437 Bacteria 12472
638 Ga0436362_0034638 3300039453 Bacteria 6719
639 Ga0439465_0026797 3300041413 Bacteria 1824
640 Ga0439431_0002168 3300041997 Bacteria 4325
641 Ga0439445_0008793 3300042004 Bacteria 2370
642 Ga0439449_0013031 3300042007 Bacteria 3127
643 Ga0451577_0000066 3300042876 Bacteria 257650
644 Ga0451577_0000715 3300042876 Bacteria 51599
645 Ga0451577_0001301 3300042876 Bacteria 34324
646 Ga0451577_0008541 3300042876 Bacteria 9963
647 Ga0451577_0150905 3300042876 Bacteria 2091
648 Ga0466969_0004160 3300044656 Bacteria 7683
649 Ga0466969_0043480 3300044656 Bacteria 2239
650 Ga0466972_0000067 3300044658 Bacteria 102835
651 Ga0466972_0000471 3300044658 Bacteria 20416
652 Ga0453683_0000010 3300044673 Bacteria 470890
653 Ga0453683_0000174 3300044673 Bacteria 89378
654 Ga0453683_0000658 3300044673 Bacteria 36964
655 Ga0453683_0109688 3300044673 Unclassified 1735
656 Ga0466961_0021360 3300044693 Bacteria 4167
657 Ga0453684_0000167 3300044712 Bacteria 290200
658 Ga0453684_0000199 3300044712 Bacteria 264155
659 Ga0453684_0000206 3300044712 Bacteria 257650
660 Ga0453684_0000527 3300044712 Bacteria 146072
661 Ga0453684_0002293 3300044712 Bacteria 47018
662 Ga0453684_0005060 3300044712 Bacteria 26712
663 Ga0453684_0008138 3300044712 Bacteria 18929
664 Ga0453684_0033409 3300044712 Bacteria 7175
665 Ga0453684_0061508 3300044712 Bacteria 4820
666 Ga0453684_0065790 3300044712 Bacteria 4621
667 Ga0453684_0068355 3300044712 Bacteria 4512
668 Ga0453684_0069808 3300044712 Bacteria 4454
669 Ga0453684_0073927 3300044712 Bacteria 4295
670 Ga0453684_0155404 3300044712 Bacteria 2713
671 Ga0466968_0026127 3300044735 Bacteria 2395
672 Ga0466970_0001874 3300044765 Bacteria 10173
673 Ga0466957_0005323 3300044842 Bacteria 7218
674 Ga0466957_0064342 3300044842 Bacteria 2256
675 Ga0466960_0034600 3300044901 Bacteria 2356
676 Ga0466959_0000004 3300045049 Bacteria 216815
677 Ga0451576_0000003 3300045051 Bacteria 1550573
678 Ga0451576_0000072 3300045051 Bacteria 257650
679 Ga0451576_0000211 3300045051 Bacteria 146199
680 Ga0451576_0002546 3300045051 Bacteria 26948
681 Ga0451576_0007445 3300045051 Bacteria 13081
682 Ga0451576_0008410 3300045051 Bacteria 12113
683 Ga0451576_0034805 3300045051 Bacteria 5348
684 Ga0451576_0227615 3300045051 Bacteria 1947
685 Ga0466967_0002472 3300045976 Bacteria 11524
686 Ga0495638_0016791 3300046460 Bacteria 4896
687 Ga0495638_0054016 3300046460 Bacteria 2499
688 Ga0495651_0013727 3300046462 Bacteria 6263
689 Ga0495650_0006702 3300046471 Bacteria 7132
690 Ga0495606_0004080 3300046507 Bacteria 14847
691 Ga0495608_0035325 3300046511 Bacteria 3372
692 Ga0495630_0006610 3300046517 Bacteria 8262
693 Ga0495648_0007376 3300046524 Bacteria 8810
694 Ga0495640_0067516 3300046533 Bacteria 2408
695 Ga0495586_0024780 3300046535 Bacteria 3209
696 Ga0495633_0000025 3300046558 Bacteria 218627
697 Ga0495668_0000106 3300046616 Bacteria 133476
698 Ga0495668_0000450 3300046616 Bacteria 52543
699 Ga0495668_0002015 3300046616 Bacteria 17737
700 Ga0495668_0038502 3300046616 Unclassified 2671
701 Ga0495634_0013547 3300046642 Bacteria 5889
702 Ga0495611_0000941 3300046648 Bacteria 15637
703 Ga0495611_0028384 3300046648 Bacteria 2450
704 Ga0495661_0000134 3300046665 Bacteria 87487
705 Ga0495661_0062610 3300046665 Bacteria 2203
706 Ga0495636_0000053 3300047318 Bacteria 50598
707 Ga0495674_0037712 3300047319 Bacteria 4342
708 Ga0495672_0010771 3300047320 Bacteria 6490
709 Ga0495672_0044167 3300047320 Bacteria 2675
710 Ga0495672_0050373 3300047320 Bacteria 2458
711 Ga0495680_0056007 3300047322 Bacteria 3055
712 Ga0495687_000179 3300047443 Bacteria 92387
713 Ga0495684_0052003 3300047471 Unclassified 3126
714 Ga0495686_0000010 3300047472 Bacteria 573229
715 Ga0495686_0000234 3300047472 Bacteria 101539
716 Ga0496110_0082616 3300048913 Bacteria 2865
717 Ga0496114_0007992 3300048917 Bacteria 8368
718 Ga0496115_0003173 3300048918 Bacteria 11811
719 Ga0496121_0000008 3300048924 Bacteria 843593
720 Ga0501298_001052 3300049521 Bacteria 3963
721 Ga0501300_004061 3300049523 Bacteria 2176
722 Ga0501031_0002615 3300049568 Bacteria 11464
723 Ga0501031_0018278 3300049568 Bacteria 4562
724 Ga0501031_0024214 3300049568 Bacteria 3957
725 Ga0501032_0000217 3300049569 Bacteria 47829
726 Ga0501032_0001195 3300049569 Bacteria 20751
727 Ga0501032_0003483 3300049569 Bacteria 12039
728 Ga0501033_0032084 3300049570 Bacteria 3943
729 Ga0501033_0041909 3300049570 Bacteria 3414
730 Ga0501033_0041960 3300049570 Bacteria 3412
731 Ga0501034_0000002 3300049571 Bacteria 565510
732 Ga0501034_0012357 3300049571 Bacteria 8821
733 Ga0501034_0014290 3300049571 Bacteria 8182
734 Ga0501034_0025757 3300049571 Bacteria 5990
735 Ga0501034_0043401 3300049571 Bacteria 4551
736 Ga0501034_0057476 3300049571 Bacteria 3911
737 Ga0501034_0099040 3300049571 Bacteria 2910
738 Ga0501036_0005480 3300049572 Bacteria 10289
739 Ga0501036_0030967 3300049572 Bacteria 4520
740 Ga0501037_0002354 3300049573 Bacteria 13658
741 Ga0501037_0012007 3300049573 Bacteria 6381
742 Ga0501037_0012433 3300049573 Bacteria 6270
743 Ga0501037_0021086 3300049573 Bacteria 4814
744 Ga0501037_0032373 3300049573 Bacteria 3861
745 Ga0501038_0007129 3300049574 Bacteria 10328
746 Ga0501038_0007354 3300049574 Bacteria 10160
747 Ga0501038_0009728 3300049574 Bacteria 8814
748 Ga0501038_0125845 3300049574 Bacteria 2109
749 Ga0501039_0023211 3300049575 Bacteria 4760
750 Ga0501039_0043183 3300049575 Bacteria 3483
751 Ga0501040_0025376 3300049576 Bacteria 3984
752 Ga0501041_0000594 3300049577 Bacteria 18940
753 Ga0501041_0005816 3300049577 Bacteria 7211
754 Ga0501041_0015782 3300049577 Bacteria 4487
755 Ga0501042_0000558 3300049578 Bacteria 19687
756 Ga0501042_0001734 3300049578 Bacteria 13044
757 Ga0501043_0004768 3300049579 Bacteria 10991
758 Ga0501043_0019201 3300049579 Bacteria 5366
759 Ga0501043_0022871 3300049579 Bacteria 4901
760 Ga0501043_0088472 3300049579 Bacteria 2434
761 Ga0501046_0003832 3300049580 Bacteria 13761
762 Ga0501046_0046776 3300049580 Bacteria 3432
763 Ga0501046_0096338 3300049580 Bacteria 2273
764 Ga0501046_0121450 3300049580 Bacteria 1987
765 Ga0501047_0005502 3300049581 Bacteria 11919
766 Ga0501047_0016087 3300049581 Bacteria 7135
767 Ga0501047_0017253 3300049581 Bacteria 6912
768 Ga0501047_0043705 3300049581 Bacteria 4328
769 Ga0501047_0071769 3300049581 Bacteria 3333
770 Ga0501047_0128522 3300049581 Bacteria 2414
771 Ga0501047_0131699 3300049581 Bacteria 2381
772 Ga0501048_0001510 3300049582 Bacteria 17615
773 Ga0501048_0024656 3300049582 Bacteria 4389
774 Ga0501068_0007261 3300049584 Bacteria 6137
775 Ga0501068_0016073 3300049584 Bacteria 4311
776 Ga0501068_0134101 3300049584 Bacteria 1550
777 Ga0501069_0002839 3300049585 Bacteria 8866
778 Ga0501069_0044659 3300049585 Bacteria 2453
779 Ga0501069_0045631 3300049585 Bacteria 2428
780 Ga0501071_0002824 3300049587 Bacteria 10696
781 Ga0501072_0007190 3300049588 Bacteria 8446
782 Ga0501073_0014754 3300049589 Bacteria 5674
783 Ga0501073_0038951 3300049589 Bacteria 3370
784 Ga0501073_0105094 3300049589 Bacteria 1959
785 Ga0501074_0006351 3300049590 Bacteria 8536
786 Ga0501074_0007078 3300049590 Bacteria 8105
787 Ga0501075_0006319 3300049591 Bacteria 8139
788 Ga0501075_0085837 3300049591 Bacteria 2384
789 Ga0501076_0004849 3300049592 Bacteria 9606
790 Ga0501077_0001830 3300049593 Bacteria 12862
791 Ga0501077_0005539 3300049593 Bacteria 7684
792 Ga0501217_002332 3300049661 Bacteria 3723
793 Ga0501223_002818 3300049663 Bacteria 3812
794 Ga0501224_000940 3300049664 Bacteria 3755
795 Ga0501235_002213 3300049669 Bacteria 4182
796 Ga0501242_000064 3300049674 Bacteria 6749
797 Ga0501243_002883 3300049675 Bacteria 2532
798 Ga0501257_006948 3300049686 Bacteria 2521
799 Ga0501259_001123 3300049688 Bacteria 4465
800 Ga0501219_000112 3300049703 Bacteria 14228
801 Ga0501221_001922 3300049704 Bacteria 3467
802 Ga0501225_0002455 3300049705 Bacteria 5733
803 Ga0501225_0005485 3300049705 Bacteria 3721
804 Ga0501245_000056 3300049708 Bacteria 10539
805 Ga0501079_0004520 3300049741 Bacteria 10317
806 Ga0501079_0027471 3300049741 Bacteria 4363
807 Ga0501080_0006199 3300049742 Bacteria 10734
808 Ga0501080_0017939 3300049742 Bacteria 6550
809 Ga0501080_0034263 3300049742 Bacteria 4739
810 Ga0501080_0068159 3300049742 Bacteria 3310
811 Ga0501080_0076898 3300049742 Bacteria 3104
812 Ga0501081_0001351 3300049743 Bacteria 14971
813 Ga0501083_0011750 3300049744 Bacteria 6138
814 Ga0501083_0016781 3300049744 Bacteria 5114
815 Ga0501083_0030105 3300049744 Bacteria 3730
816 Ga0501083_0043366 3300049744 Bacteria 3048
817 Ga0501241_003638 3300049758 Bacteria 2908
818 Ga0501282_002657 3300049778 Bacteria 1938
819 Ga0501035_0003562 3300049822 Bacteria 14872
820 Ga0501035_0011451 3300049822 Bacteria 8223
821 Ga0501035_0026868 3300049822 Bacteria 5264
822 Ga0501035_0058755 3300049822 Bacteria 3426
823 Ga0501035_0073639 3300049822 Bacteria 3022
824 Ga0501035_0082404 3300049822 Bacteria 2839
825 Ga0501035_0099067 3300049822 Bacteria 2559
826 Ga0501035_0102051 3300049822 Bacteria 2517
827 Ga0501044_0000299 3300049823 Bacteria 62791
828 Ga0501044_0000920 3300049823 Bacteria 35464
829 Ga0501044_0002188 3300049823 Bacteria 22426
830 Ga0501044_0012419 3300049823 Bacteria 9222
831 Ga0501044_0028417 3300049823 Bacteria 5903
832 Ga0501044_0036018 3300049823 Bacteria 5178
833 Ga0501044_0083841 3300049823 Bacteria 3222
834 Ga0501044_0087540 3300049823 Bacteria 3146
835 Ga0501044_0108763 3300049823 Bacteria 2782
836 Ga0501045_0010793 3300049824 Bacteria 6402
837 Ga0501045_0016750 3300049824 Bacteria 5206
838 Ga0501284_00086 3300050005 Bacteria 22701
839 nmdc:mga05p37_46504_c1 3300050507 Bacteria 5336
840 nmdc:mga09592_31590_c1 3300050508 Bacteria 4413
841 nmdc:mga0qj67_11847_c1 3300050509 Bacteria 6546
842 nmdc:mga06r32_33770_c1 3300050510 Bacteria 4820
843 nmdc:mga08y16_47954_c1 3300050511 Bacteria 4471
844 nmdc:mga08y16_5833_c1 3300050511 Bacteria 12904
845 nmdc:mga0n895_20_c1 3300050512 Bacteria 94193
846 nmdc:mga0rr50_304_c1 3300050513 Bacteria 26740
847 nmdc:mga08x19_64455_c1 3300050514 Bacteria 2379
848 nmdc:mga0a205_626_c1 3300050515 Bacteria 28071
849 Ga0500578_0000010 3300053086 Bacteria 217642
850 Ga0500578_0018344 3300053086 Bacteria 4497
851 Ga0500644_0000039 3300053088 Bacteria 78834
852 Ga0500583_0000064 3300053092 Bacteria 66001
853 Ga0500583_0000683 3300053092 Bacteria 9939
854 Ga0500562_000005 3300053108 Bacteria 266746
855 Ga0500607_036339 3300053121 Bacteria 2690
856 Ga0500642_0002743 3300053130 Bacteria 5215
857 Ga0500658_0000972 3300053134 Bacteria 11681
858 Ga0500568_0002456 3300053139 Bacteria 10896
859 Ga0500577_0001411 3300053142 Bacteria 6157
860 Ga0500590_012391 3300053148 Bacteria 4347
861 Ga0500616_0000626 3300053153 Bacteria 42914
862 Ga0500622_0000151 3300053156 Bacteria 73392
863 Ga0500622_0009287 3300053156 Bacteria 5451
864 Ga0500622_0009662 3300053156 Bacteria 5331
865 Ga0500627_0018755 3300053158 Bacteria 2744
866 Ga0500611_000039 3300053727 Bacteria 68825
867 Ga0501084_0040020 3300054114 Bacteria 3920
868 Ga0501084_0044804 3300054114 Bacteria 3703
869 Ga0500661_008248 3300055283 Bacteria 1915
870 Ga0501082_0004014 3300060353 Bacteria 12843

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10179063 Ga0207648_101790632 440
2 3300049584 Ga0501068_0134101 Ga0501068_0134101_32_1450 442
3 3300049589 Ga0501073_0105094 Ga0501073_0105094_561_1946 446
4 3300049778 Ga0501282_002657 Ga0501282_002657_424_1908 451
5 3300049572 Ga0501036_0030967 Ga0501036_0030967_3078_4481 453
6 3300009545 Ga0105237_10148535 Ga0105237_101485351 460
7 3300013306 Ga0163162_10000244 Ga0163162_1000024431 463
8 3300044901 Ga0466960_0034600 Ga0466960_0034600_839_2332 463
9 3300025932 Ga0207690_10040708 Ga0207690_100407083 467
10 3300014325 Ga0163163_10255936 Ga0163163_102559362 476
11 3300054114 Ga0501084_0040020 Ga0501084_0040020_12_1589 476
12 3300009174 Ga0105241_10003231 Ga0105241_100032318 479
13 3300009545 Ga0105237_10014983 Ga0105237_100149832 479
14 3300049822 Ga0501035_0073639 Ga0501035_0073639_1408_3003 488
15 3300025913 Ga0207695_10000001 Ga0207695_1000000128 494
16 3300005459 Ga0068867_100157477 Ga0068867_1001574771 495
17 3300046460 Ga0495638_0054016 Ga0495638_0054016_647_2359 495
18 3300046665 Ga0495661_0062610 Ga0495661_0062610_310_1959 499
19 3300046665 Ga0495661_0000134 Ga0495661_0000134_15603_17252 500
20 3300049568 Ga0501031_0018278 Ga0501031_0018278_999_2657 501
21 3300049574 Ga0501038_0009728 Ga0501038_0009728_2515_4173 501
22 3300049575 Ga0501039_0023211 Ga0501039_0023211_441_2099 501
23 3300049576 Ga0501040_0025376 Ga0501040_0025376_620_2278 501
24 3300049577 Ga0501041_0015782 Ga0501041_0015782_2153_3811 501
25 3300049578 Ga0501042_0000558 Ga0501042_0000558_620_2278 501
26 3300049582 Ga0501048_0024656 Ga0501048_0024656_2061_3719 501
27 3300049587 Ga0501071_0002824 Ga0501071_0002824_982_2640 501
28 3300049588 Ga0501072_0007190 Ga0501072_0007190_5726_7384 501
29 3300049590 Ga0501074_0006351 Ga0501074_0006351_3758_5416 501
30 3300049591 Ga0501075_0006319 Ga0501075_0006319_5723_7381 501
31 3300049592 Ga0501076_0004849 Ga0501076_0004849_746_2404 501
32 3300049675 Ga0501243_002883 Ga0501243_002883_789_2489 501
33 3300049741 Ga0501079_0004520 Ga0501079_0004520_8124_9782 501
34 3300049742 Ga0501080_0006199 Ga0501080_0006199_5740_7398 501
35 3300049743 Ga0501081_0001351 Ga0501081_0001351_5699_7357 501
36 3300049824 Ga0501045_0010793 Ga0501045_0010793_1130_2788 501
37 3300060353 Ga0501082_0004014 Ga0501082_0004014_8376_10034 501
38 3300006881 Ga0068865_100000491 Ga0068865_10000049110 502
39 3300025938 Ga0207704_10002375 Ga0207704_100023753 502
40 3300025942 Ga0207689_10000210 Ga0207689_100002104 502
41 3300026089 Ga0207648_10003360 Ga0207648_100033609 502
42 3300036712 Ga0316584_0130916 Ga0316584_0130916_30_1625 502
43 3300046462 Ga0495651_0013727 Ga0495651_0013727_3420_5060 503
44 3300049568 Ga0501031_0024214 Ga0501031_0024214_1448_3070 504
45 3300049570 Ga0501033_0032084 Ga0501033_0032084_968_2590 504
46 3300049571 Ga0501034_0025757 Ga0501034_0025757_1812_3434 504
47 3300049573 Ga0501037_0012433 Ga0501037_0012433_3912_5534 504
48 3300049574 Ga0501038_0125845 Ga0501038_0125845_322_1944 504
49 3300049577 Ga0501041_0000594 Ga0501041_0000594_12695_14317 504
50 3300049577 Ga0501041_0005816 Ga0501041_0005816_4834_6456 504
51 3300049579 Ga0501043_0004768 Ga0501043_0004768_4168_5790 504
52 3300049579 Ga0501043_0022871 Ga0501043_0022871_35_1657 504
53 3300049580 Ga0501046_0046776 Ga0501046_0046776_319_1941 504
54 3300049581 Ga0501047_0071769 Ga0501047_0071769_273_1895 504
55 3300049584 Ga0501068_0007261 Ga0501068_0007261_4291_5913 504
56 3300049584 Ga0501068_0016073 Ga0501068_0016073_1198_2820 504
57 3300049585 Ga0501069_0002839 Ga0501069_0002839_3896_5518 504
58 3300049585 Ga0501069_0044659 Ga0501069_0044659_782_2404 504
59 3300049589 Ga0501073_0038951 Ga0501073_0038951_1062_2684 504
60 3300049590 Ga0501074_0007078 Ga0501074_0007078_3007_4629 504
61 3300049591 Ga0501075_0085837 Ga0501075_0085837_301_1923 504
62 3300049593 Ga0501077_0001830 Ga0501077_0001830_5547_7169 504
63 3300049593 Ga0501077_0005539 Ga0501077_0005539_1872_3494 504
64 3300049741 Ga0501079_0027471 Ga0501079_0027471_2551_4173 504
65 3300049742 Ga0501080_0017939 Ga0501080_0017939_1262_2884 504
66 3300049744 Ga0501083_0030105 Ga0501083_0030105_937_2559 504
67 3300049823 Ga0501044_0087540 Ga0501044_0087540_1358_2980 504
68 3300049824 Ga0501045_0016750 Ga0501045_0016750_1827_3449 504
69 3300006852 Ga0075433_10006563 Ga0075433_100065639 512
70 3300006871 Ga0075434_100001986 Ga0075434_10000198616 512
71 3300007076 Ga0075435_100000289 Ga0075435_10000028931 512
72 3300050512 nmdc:mga0n895_20_c1 nmdc:mga0n895_20_c1_31653_33428 512
73 3300050513 nmdc:mga0rr50_304_c1 nmdc:mga0rr50_304_c1_12057_13832 512
74 3300050515 nmdc:mga0a205_626_c1 nmdc:mga0a205_626_c1_14976_16751 512
75 3300044712 Ga0453684_0008138 Ga0453684_0008138_5195_6850 513
76 3300044712 Ga0453684_0065790 Ga0453684_0065790_934_2589 513
77 3300049581 Ga0501047_0128522 Ga0501047_0128522_230_1960 513
78 3300049823 Ga0501044_0108763 Ga0501044_0108763_815_2545 513
79 3300013296 Ga0157374_10008233 Ga0157374_100082332 514
80 3300025246 Ga0209646_1001757 Ga0209646_10017575 514
81 3300042876 Ga0451577_0008541 Ga0451577_0008541_1823_3466 514
82 3300044658 Ga0466972_0000471 Ga0466972_0000471_8543_10258 514
83 3300044712 Ga0453684_0000199 Ga0453684_0000199_164596_166239 514
84 3300049823 Ga0501044_0002188 Ga0501044_0002188_4704_6371 514
85 3300053086 Ga0500578_0018344 Ga0500578_0018344_1302_3017 514
86 3300005563 Ga0068855_100016778 Ga0068855_1000167786 515
87 3300009093 Ga0105240_10000001 Ga0105240_1000000128 515
88 3300009174 Ga0105241_10038676 Ga0105241_100386764 515
89 3300009545 Ga0105237_10047857 Ga0105237_100478572 515
90 3300025949 Ga0207667_10005458 Ga0207667_1000545810 515
91 3300026041 Ga0207639_10137223 Ga0207639_101372232 515
92 3300028558 Ga0265326_10006563 Ga0265326_100065632 515
93 3300029957 Ga0265324_10013370 Ga0265324_100133702 515
94 3300031711 Ga0265314_10000517 Ga0265314_1000051718 515
95 3300044656 Ga0466969_0004160 Ga0466969_0004160_450_2168 515
96 3300044842 Ga0466957_0005323 Ga0466957_0005323_1485_3206 515
97 3300044842 Ga0466957_0064342 Ga0466957_0064342_30_1745 515
98 3300045049 Ga0466959_0000004 Ga0466959_0000004_23019_24737 515
99 3300049581 Ga0501047_0016087 Ga0501047_0016087_1520_3235 515
100 3300049581 Ga0501047_0043705 Ga0501047_0043705_1769_3484 515
101 3300049822 Ga0501035_0102051 Ga0501035_0102051_658_2373 515
102 3300049823 Ga0501044_0012419 Ga0501044_0012419_380_2095 515
103 3300053086 Ga0500578_0000010 Ga0500578_0000010_156111_157826 515
104 3300053092 Ga0500583_0000064 Ga0500583_0000064_19236_20951 515
105 3300053092 Ga0500583_0000683 Ga0500583_0000683_2131_3846 515
106 iso_pu_bacteria 2786546940 2788436694 515
107 3300003322 rootL2_10189327 rootL2_101893275 516
108 3300028577 Ga0265318_10007156 Ga0265318_100071563 516
109 3300031240 Ga0265320_10003809 Ga0265320_100038094 516
110 3300031548 Ga0307408_100000017 Ga0307408_100000017186 516
111 3300031852 Ga0307410_10000060 Ga0307410_1000006033 516
112 3300031911 Ga0307412_10007777 Ga0307412_100077775 516
113 3300031995 Ga0307409_100000021 Ga0307409_10000002131 516
114 3300042876 Ga0451577_0001301 Ga0451577_0001301_22808_24451 516
115 3300045051 Ga0451576_0227615 Ga0451576_0227615_143_1786 516
116 3300049573 Ga0501037_0032373 Ga0501037_0032373_493_2145 516
117 3300049581 Ga0501047_0017253 Ga0501047_0017253_2198_3850 516
118 3300049581 Ga0501047_0131699 Ga0501047_0131699_184_1818 516
119 3300049705 Ga0501225_0002455 Ga0501225_0002455_741_2456 516
120 3300049823 Ga0501044_0028417 Ga0501044_0028417_1299_2951 516
121 3300003323 rootH1_10021532 rootH1_1002153216 517
122 3300006195 Ga0075366_10028353 Ga0075366_100283531 517
123 3300009147 Ga0114129_10018174 Ga0114129_100181746 517
124 3300010375 Ga0105239_10002212 Ga0105239_1000221214 517
125 3300031251 Ga0265327_10012078 Ga0265327_100120782 517
126 3300042007 Ga0439449_0013031 Ga0439449_0013031_1170_2885 517
127 3300049742 Ga0501080_0034263 Ga0501080_0034263_2902_4536 517
128 3300050507 nmdc:mga05p37_46504_c1 nmdc:mga05p37_46504_c1_399_2117 517
129 3300003323 rootH1_10097586 rootH1_100975862 518
130 3300005327 Ga0070658_10061489 Ga0070658_100614891 518
131 3300005459 Ga0068867_100005824 Ga0068867_10000582410 518
132 3300005617 Ga0068859_100039325 Ga0068859_1000393252 518
133 3300006931 Ga0097620_100039324 Ga0097620_1000393242 518
134 3300025909 Ga0207705_10097636 Ga0207705_100976361 518
135 3300028800 Ga0265338_10000053 Ga0265338_1000005355 518
136 3300028800 Ga0265338_10000442 Ga0265338_1000044242 518
137 3300031249 Ga0265339_10008119 Ga0265339_100081192 518
138 3300045976 Ga0466967_0002472 Ga0466967_0002472_5509_7203 518
139 3300049568 Ga0501031_0002615 Ga0501031_0002615_4071_5723 518
140 3300049569 Ga0501032_0001195 Ga0501032_0001195_9915_11567 518
141 3300049571 Ga0501034_0099040 Ga0501034_0099040_1043_2695 518
142 3300049572 Ga0501036_0005480 Ga0501036_0005480_2316_3968 518
143 3300049573 Ga0501037_0002354 Ga0501037_0002354_4319_5971 518
144 3300049574 Ga0501038_0007129 Ga0501038_0007129_148_1800 518
145 3300049578 Ga0501042_0001734 Ga0501042_0001734_3039_4691 518
146 3300049580 Ga0501046_0003832 Ga0501046_0003832_4792_6444 518
147 3300049582 Ga0501048_0001510 Ga0501048_0001510_6307_7959 518
148 3300049742 Ga0501080_0068159 Ga0501080_0068159_82_1734 518
149 3300049742 Ga0501080_0076898 Ga0501080_0076898_338_1987 518
150 3300049744 Ga0501083_0043366 Ga0501083_0043366_754_2406 518
151 3300049822 Ga0501035_0003562 Ga0501035_0003562_7498_9150 518
152 3300049822 Ga0501035_0058755 Ga0501035_0058755_122_1771 518
153 3300003320 rootH2_10034401 rootH2_100344014 519
154 3300003323 rootH1_10001200 rootH1_100012005 519
155 3300005436 Ga0070713_100044714 Ga0070713_1000447141 519
156 3300005577 Ga0068857_100058242 Ga0068857_1000582422 519
157 3300005614 Ga0068856_100001817 Ga0068856_1000018176 519
158 3300006880 Ga0075429_100035556 Ga0075429_1000355563 519
159 3300006914 Ga0075436_100037970 Ga0075436_1000379703 519
160 3300013308 Ga0157375_10005169 Ga0157375_100051698 519
161 3300025928 Ga0207700_10022968 Ga0207700_100229681 519
162 3300026078 Ga0207702_10008275 Ga0207702_100082754 519
163 3300031595 Ga0265313_10009844 Ga0265313_100098444 519
164 3300031711 Ga0265314_10007159 Ga0265314_100071595 519
165 3300038443 Ga0395901_0064480 Ga0395901_0064480_1285_2922 519
166 3300044712 Ga0453684_0069808 Ga0453684_0069808_2742_4403 519
167 3300047319 Ga0495674_0037712 Ga0495674_0037712_171_1934 519
168 3300049744 Ga0501083_0016781 Ga0501083_0016781_367_2019 519
169 3300050514 nmdc:mga08x19_64455_c1 nmdc:mga08x19_64455_c1_531_2306 519
170 3300006028 Ga0070717_10000648 Ga0070717_100006488 520
171 3300006237 Ga0097621_100001013 Ga0097621_10000101315 520
172 3300006358 Ga0068871_100003639 Ga0068871_1000036396 520
173 3300013297 Ga0157378_10019118 Ga0157378_100191186 520
174 3300013306 Ga0163162_10013139 Ga0163162_100131398 520
175 3300031711 Ga0265314_10005415 Ga0265314_100054153 520
176 3300042876 Ga0451577_0000066 Ga0451577_0000066_79190_80833 520
177 3300042876 Ga0451577_0000715 Ga0451577_0000715_18655_20298 520
178 3300042876 Ga0451577_0150905 Ga0451577_0150905_437_2080 520
179 3300044656 Ga0466969_0043480 Ga0466969_0043480_213_2099 520
180 3300044673 Ga0453683_0000010 Ga0453683_0000010_221309_222952 520
181 3300044673 Ga0453683_0000174 Ga0453683_0000174_8558_10201 520
182 3300044673 Ga0453683_0109688 Ga0453683_0109688_45_1688 520
183 3300044712 Ga0453684_0000167 Ga0453684_0000167_150257_151900 520
184 3300044712 Ga0453684_0000206 Ga0453684_0000206_176818_178461 520
185 3300044712 Ga0453684_0000527 Ga0453684_0000527_72832_74475 520
186 3300044712 Ga0453684_0068355 Ga0453684_0068355_2594_4237 520
187 3300044712 Ga0453684_0073927 Ga0453684_0073927_10_1653 520
188 3300045051 Ga0451576_0000072 Ga0451576_0000072_176818_178461 520
189 3300045051 Ga0451576_0000211 Ga0451576_0000211_72832_74475 520
190 3300045051 Ga0451576_0034805 Ga0451576_0034805_242_1885 520
191 3300002738 JGI25154J39366_1000002 JGI25154J39366_1000002327 521
192 3300003215 JGI25153J46596_10000187 JGI25153J46596_1000018735 521
193 3300003354 JGI25160J50197_1002523 JGI25160J50197_10025236 521
194 3300003771 Ga0055526_1025514 Ga0055526_10255141 521
195 3300003790 Ga0055528_1000338 Ga0055528_10003386 521
196 3300003790 Ga0055528_1000600 Ga0055528_10006003 521
197 3300003791 Ga0055530_10001956 Ga0055530_1000195611 521
198 3300005262 Ga0065165_1000100 Ga0065165_100010099 521
199 3300005355 Ga0070671_100007427 Ga0070671_10000742710 521
200 3300005456 Ga0070678_100019833 Ga0070678_1000198333 521
201 3300005841 Ga0068863_100023628 Ga0068863_1000236283 521
202 3300006237 Ga0097621_100001217 Ga0097621_1000012176 521
203 3300006358 Ga0068871_100025182 Ga0068871_1000251823 521
204 3300009177 Ga0105248_10016053 Ga0105248_100160539 521
205 3300013306 Ga0163162_10002221 Ga0163162_100022214 521
206 3300014968 Ga0157379_10021198 Ga0157379_100211984 521
207 3300014969 Ga0157376_10000842 Ga0157376_1000084210 521
208 3300025246 Ga0209646_1000005 Ga0209646_100000547 521
209 3300025250 Ga0209026_1000587 Ga0209026_100058712 521
210 3300025273 Ga0209673_1000049 Ga0209673_100004915 521
211 3300025295 Ga0209564_1013600 Ga0209564_10136002 521
212 3300025297 Ga0209758_1000346 Ga0209758_100034620 521
213 3300025297 Ga0209758_1025236 Ga0209758_10252361 521
214 3300025298 Ga0209050_1000272 Ga0209050_100027266 521
215 3300025302 Ga0207426_1000381 Ga0207426_100038157 521
216 3300025302 Ga0207426_1001075 Ga0207426_100107517 521
217 3300025931 Ga0207644_10008865 Ga0207644_100088652 521
218 3300026088 Ga0207641_10030841 Ga0207641_100308414 521
219 3300045051 Ga0451576_0000003 Ga0451576_0000003_1129321_1130955 521
220 3300045051 Ga0451576_0007445 Ga0451576_0007445_3528_5177 521
221 3300003203 JGI25406J46586_10005984 JGI25406J46586_100059841 522
222 3300005288 Ga0065714_10002439 Ga0065714_1000243910 522
223 3300005289 Ga0065704_10073387 Ga0065704_100733876 522
224 3300005985 Ga0081539_10000085 Ga0081539_10000085121 522
225 3300013100 Ga0157373_10021959 Ga0157373_100219592 522
226 3300013308 Ga0157375_10185909 Ga0157375_101859092 522
227 3300015262 Ga0182007_10008552 Ga0182007_100085522 522
228 3300017792 Ga0163161_10071142 Ga0163161_100711422 522
229 3300025208 Ga0209436_101437 Ga0209436_1014372 522
230 3300025302 Ga0207426_1000233 Ga0207426_10002338 522
231 3300025937 Ga0207669_10111164 Ga0207669_101111641 522
232 3300031240 Ga0265320_10000776 Ga0265320_100007765 522
233 3300031595 Ga0265313_10020490 Ga0265313_100204903 522
234 3300031616 Ga0307508_10003578 Ga0307508_1000357817 522
235 3300032004 Ga0307414_10018010 Ga0307414_100180103 522
236 3300039453 Ga0436362_0034638 Ga0436362_0034638_3713_5479 522
237 3300044712 Ga0453684_0005060 Ga0453684_0005060_19108_20766 522
238 3300045051 Ga0451576_0002546 Ga0451576_0002546_12128_13795 522
239 3300005539 Ga0068853_100117153 Ga0068853_1001171531 523
240 3300005578 Ga0068854_100023435 Ga0068854_1000234353 523
241 3300005614 Ga0068856_100056388 Ga0068856_1000563884 523
242 3300005616 Ga0068852_100001462 Ga0068852_1000014629 523
243 3300005834 Ga0068851_10000010 Ga0068851_1000001044 523
244 3300006881 Ga0068865_100123175 Ga0068865_1001231751 523
245 3300009551 Ga0105238_10010193 Ga0105238_100101937 523
246 3300013104 Ga0157370_10026250 Ga0157370_100262501 523
247 3300013307 Ga0157372_10014609 Ga0157372_100146091 523
248 3300013308 Ga0157375_10124458 Ga0157375_101244582 523
249 3300014326 Ga0157380_10001220 Ga0157380_100012203 523
250 3300025321 Ga0207656_10000157 Ga0207656_1000015717 523
251 3300025924 Ga0207694_10011093 Ga0207694_100110932 523
252 3300026078 Ga0207702_10128423 Ga0207702_101284231 523
253 3300026142 Ga0207698_10003249 Ga0207698_100032494 523
254 3300031728 Ga0316578_10028658 Ga0316578_100286583 523
255 3300032137 Ga0316585_10004580 Ga0316585_100045803 523
256 3300039093 Ga0400489_60531 Ga0400489_60531_5231_6886 523
257 3300049822 Ga0501035_0082404 Ga0501035_0082404_21_1688 523
258 3300005329 Ga0070683_100003049 Ga0070683_10000304915 524
259 3300005535 Ga0070684_100002976 Ga0070684_1000029766 524
260 3300005563 Ga0068855_100027195 Ga0068855_1000271955 524
261 3300009093 Ga0105240_10006862 Ga0105240_100068628 524
262 3300009545 Ga0105237_10003940 Ga0105237_100039402 524
263 3300009545 Ga0105237_10053020 Ga0105237_100530203 524
264 3300010375 Ga0105239_10000283 Ga0105239_1000028320 524
265 3300013105 Ga0157369_10042857 Ga0157369_100428576 524
266 3300013307 Ga0157372_10004707 Ga0157372_1000470710 524
267 3300013307 Ga0157372_10090212 Ga0157372_100902122 524
268 3300025913 Ga0207695_10000051 Ga0207695_10000051108 524
269 3300025913 Ga0207695_10000056 Ga0207695_10000056134 524
270 3300025913 Ga0207695_10000081 Ga0207695_10000081108 524
271 3300025914 Ga0207671_10027684 Ga0207671_100276843 524
272 3300025914 Ga0207671_10030857 Ga0207671_100308573 524
273 3300025944 Ga0207661_10033981 Ga0207661_100339812 524
274 3300025949 Ga0207667_10002366 Ga0207667_100023665 524
275 3300033180 Ga0307510_10029575 Ga0307510_100295752 524
276 3300044673 Ga0453683_0000658 Ga0453683_0000658_22770_24452 524
277 3300044693 Ga0466961_0021360 Ga0466961_0021360_845_2656 524
278 3300045051 Ga0451576_0008410 Ga0451576_0008410_8888_10570 524
279 3300046507 Ga0495606_0004080 Ga0495606_0004080_6334_8259 524
280 3300046648 Ga0495611_0000941 Ga0495611_0000941_642_2468 524
281 3300003320 rootH2_10012018 rootH2_1001201825 525
282 3300005336 Ga0070680_100008330 Ga0070680_1000083302 525
283 3300005339 Ga0070660_100029929 Ga0070660_1000299292 525
284 3300005343 Ga0070687_100015930 Ga0070687_1000159301 525
285 3300005365 Ga0070688_100012988 Ga0070688_1000129883 525
286 3300005577 Ga0068857_100014392 Ga0068857_1000143927 525
287 3300005614 Ga0068856_100087457 Ga0068856_1000874572 525
288 3300005719 Ga0068861_100002834 Ga0068861_1000028344 525
289 3300009545 Ga0105237_10209197 Ga0105237_102091971 525
290 3300013102 Ga0157371_10045155 Ga0157371_100451552 525
291 3300014326 Ga0157380_10004286 Ga0157380_100042864 525
292 3300025909 Ga0207705_10009499 Ga0207705_100094992 525
293 3300025917 Ga0207660_10026465 Ga0207660_100264652 525
294 3300025921 Ga0207652_10004623 Ga0207652_100046239 525
295 3300026041 Ga0207639_10098604 Ga0207639_100986042 525
296 3300026078 Ga0207702_10067987 Ga0207702_100679873 525
297 3300026118 Ga0207675_100000085 Ga0207675_10000008549 525
298 3300031616 Ga0307508_10000157 Ga0307508_1000015743 525
299 3300044712 Ga0453684_0002293 Ga0453684_0002293_41801_43471 525
300 3300047471 Ga0495684_0052003 Ga0495684_0052003_824_2476 525
301 3300049569 Ga0501032_0000217 Ga0501032_0000217_35806_37470 525
302 3300049822 Ga0501035_0011451 Ga0501035_0011451_3757_5421 525
303 3300049823 Ga0501044_0000299 Ga0501044_0000299_20334_21998 525
304 iso_pu_bacteria 2738541278 2738724672 525
305 3300005336 Ga0070680_100084125 Ga0070680_1000841252 526
306 3300005547 Ga0070693_100005061 Ga0070693_1000050612 526
307 3300005843 Ga0068860_100000003 Ga0068860_1000000035 526
308 3300009093 Ga0105240_10004986 Ga0105240_100049862 526
309 3300013306 Ga0163162_10000175 Ga0163162_1000017510 526
310 3300025949 Ga0207667_10138552 Ga0207667_101385522 526
311 3300028381 Ga0268264_10000082 Ga0268264_10000082162 526
312 3300028573 Ga0265334_10006112 Ga0265334_100061124 526
313 3300028577 Ga0265318_10001041 Ga0265318_100010416 526
314 3300031238 Ga0265332_10040388 Ga0265332_100403881 526
315 3300031240 Ga0265320_10028679 Ga0265320_100286792 526
316 3300031250 Ga0265331_10020100 Ga0265331_100201003 526
317 3300031507 Ga0307509_10042858 Ga0307509_100428583 526
318 3300031507 Ga0307509_10120494 Ga0307509_101204942 526
319 3300031595 Ga0265313_10003199 Ga0265313_100031996 526
320 3300031711 Ga0265314_10002697 Ga0265314_100026975 526
321 3300046460 Ga0495638_0016791 Ga0495638_0016791_1968_3803 526
322 3300046524 Ga0495648_0007376 Ga0495648_0007376_356_2191 526
323 3300046648 Ga0495611_0028384 Ga0495611_0028384_62_1897 526
324 3300047443 Ga0495687_000179 Ga0495687_000179_78171_80006 526
325 3300053130 Ga0500642_0002743 Ga0500642_0002743_1000_2835 526
326 3300053156 Ga0500622_0009287 Ga0500622_0009287_178_2013 526
327 3300005983 Ga0081540_1003918 Ga0081540_10039183 527
328 3300009094 Ga0111539_10194366 Ga0111539_101943662 527
329 3300014325 Ga0163163_10015385 Ga0163163_100153857 527
330 3300025302 Ga0207426_1010995 Ga0207426_10109952 527
331 3300031616 Ga0307508_10042451 Ga0307508_100424513 527
332 3300031730 Ga0307516_10033453 Ga0307516_100334535 527
333 3300049580 Ga0501046_0121450 Ga0501046_0121450_17_1705 527
334 3300005339 Ga0070660_100000647 Ga0070660_10000064714 528
335 3300005364 Ga0070673_100019747 Ga0070673_1000197474 528
336 3300005564 Ga0070664_100034619 Ga0070664_1000346193 528
337 3300005616 Ga0068852_100038683 Ga0068852_1000386834 528
338 3300013297 Ga0157378_10025790 Ga0157378_100257903 528
339 3300013308 Ga0157375_10064390 Ga0157375_100643901 528
340 3300014745 Ga0157377_10019477 Ga0157377_100194772 528
341 3300015265 Ga0182005_1000061 Ga0182005_100006116 528
342 3300025919 Ga0207657_10005023 Ga0207657_100050239 528
343 3300025937 Ga0207669_10026030 Ga0207669_100260303 528
344 3300028786 Ga0307517_10075895 Ga0307517_100758952 528
345 3300031250 Ga0265331_10018911 Ga0265331_100189113 528
346 3300031251 Ga0265327_10002348 Ga0265327_100023482 528
347 3300044712 Ga0453684_0155404 Ga0453684_0155404_234_1949 528
348 3300047320 Ga0495672_0044167 Ga0495672_0044167_112_1887 528
349 3300049703 Ga0501219_000112 Ga0501219_000112_2057_3781 528
350 3300049758 Ga0501241_003638 Ga0501241_003638_974_2698 528
351 3300050005 Ga0501284_00086 Ga0501284_00086_1091_2815 528
352 3300005331 Ga0070670_100034247 Ga0070670_1000342474 529
353 3300005335 Ga0070666_10000301 Ga0070666_1000030116 529
354 3300005338 Ga0068868_100010528 Ga0068868_1000105288 529
355 3300005617 Ga0068859_100000006 Ga0068859_100000006399 529
356 3300005617 Ga0068859_100006790 Ga0068859_1000067907 529
357 3300005618 Ga0068864_100030464 Ga0068864_1000304642 529
358 3300005842 Ga0068858_100011681 Ga0068858_1000116815 529
359 3300005843 Ga0068860_100001345 Ga0068860_10000134519 529
360 3300005843 Ga0068860_100002872 Ga0068860_1000028726 529
361 3300006358 Ga0068871_100007102 Ga0068871_1000071023 529
362 3300006931 Ga0097620_100000006 Ga0097620_100000006399 529
363 3300006931 Ga0097620_100006790 Ga0097620_1000067907 529
364 3300009094 Ga0111539_10052998 Ga0111539_100529982 529
365 3300009094 Ga0111539_10079509 Ga0111539_100795091 529
366 3300009174 Ga0105241_10003877 Ga0105241_100038777 529
367 3300009545 Ga0105237_10011351 Ga0105237_100113517 529
368 3300011119 Ga0105246_10056558 Ga0105246_100565582 529
369 3300013297 Ga0157378_10048499 Ga0157378_100484993 529
370 3300013306 Ga0163162_10001206 Ga0163162_100012067 529
371 3300013306 Ga0163162_10001299 Ga0163162_1000129919 529
372 3300014325 Ga0163163_10000202 Ga0163163_1000020219 529
373 3300014326 Ga0157380_10002444 Ga0157380_100024449 529
374 3300014969 Ga0157376_10080737 Ga0157376_100807372 529
375 3300025903 Ga0207680_10000855 Ga0207680_100008553 529
376 3300025911 Ga0207654_10001346 Ga0207654_1000134611 529
377 3300025925 Ga0207650_10014874 Ga0207650_100148744 529
378 3300025926 Ga0207659_10030533 Ga0207659_100305332 529
379 3300025938 Ga0207704_10072337 Ga0207704_100723372 529
380 3300025942 Ga0207689_10002845 Ga0207689_100028458 529
381 3300025960 Ga0207651_10014270 Ga0207651_100142701 529
382 3300025961 Ga0207712_10002253 Ga0207712_100022536 529
383 3300026035 Ga0207703_10004255 Ga0207703_100042556 529
384 3300026088 Ga0207641_10002871 Ga0207641_1000287115 529
385 3300026095 Ga0207676_10083396 Ga0207676_100833962 529
386 3300026095 Ga0207676_10084450 Ga0207676_100844502 529
387 3300028381 Ga0268264_10004566 Ga0268264_100045662 529
388 3300028381 Ga0268264_10005045 Ga0268264_100050456 529
389 3300028794 Ga0307515_10000021 Ga0307515_10000021247 529
390 3300044712 Ga0453684_0061508 Ga0453684_0061508_2943_4607 529
391 3300046616 Ga0495668_0002015 Ga0495668_0002015_15299_17029 529
392 3300047320 Ga0495672_0010771 Ga0495672_0010771_3173_4951 529
393 3300049569 Ga0501032_0003483 Ga0501032_0003483_969_2687 529
394 3300049570 Ga0501033_0041909 Ga0501033_0041909_1672_3390 529
395 3300049574 Ga0501038_0007354 Ga0501038_0007354_7215_8933 529
396 3300049575 Ga0501039_0043183 Ga0501039_0043183_491_2209 529
397 3300049579 Ga0501043_0019201 Ga0501043_0019201_2853_4571 529
398 3300049579 Ga0501043_0088472 Ga0501043_0088472_283_2001 529
399 3300049581 Ga0501047_0005502 Ga0501047_0005502_4313_6031 529
400 3300049823 Ga0501044_0000920 Ga0501044_0000920_7132_8850 529
401 3300050511 nmdc:mga08y16_47954_c1 nmdc:mga08y16_47954_c1_1531_3252 529
402 iso_pu_bacteria 2818991442 2819576638 530
403 iso_pu_bacteria 2818991460 2819677395 530
404 iso_pu_bacteria 2821136567 2821143133 530
405 iso_pu_bacteria 2840677318 2840679216 530
406 iso_pu_bacteria 2883068021 2883070007 530
407 iso_pu_bacteria 2884791551 2884797314 530
408 iso_pu_bacteria 2896085136 2896087027 530
409 iso_pu_bacteria 2896109856 2896114311 530
410 iso_pu_bacteria 2904467357 2904470853 530
411 iso_pu_bacteria 2929177148 2929177216 530
412 iso_pu_bacteria 2929239360 2929239640 530
413 iso_pu_bacteria 2929921140 2929921276 530
414 iso_pu_bacteria 2945977869 2945979583 530
415 iso_pu_bacteria 2946013367 2946014549 530
416 iso_pu_bacteria 8003151029 8003157677 530
417 3300005334 Ga0068869_100005945 Ga0068869_1000059452 531
418 3300013307 Ga0157372_10028658 Ga0157372_100286585 531
419 3300025942 Ga0207689_10024801 Ga0207689_100248015 531
420 3300031995 Ga0307409_100118982 Ga0307409_1001189822 531
421 3300032126 Ga0307415_100103944 Ga0307415_1001039442 531
422 3300048918 Ga0496115_0003173 Ga0496115_0003173_8991_10661 532
423 3300003320 rootH2_10133206 rootH2_101332065 533
424 3300005458 Ga0070681_10011071 Ga0070681_100110715 533
425 3300005539 Ga0068853_100009547 Ga0068853_1000095471 533
426 3300005539 Ga0068853_100078295 Ga0068853_1000782952 533
427 3300005539 Ga0068853_100132223 Ga0068853_1001322232 533
428 3300005548 Ga0070665_100000002 Ga0070665_100000002385 533
429 3300005614 Ga0068856_100054687 Ga0068856_1000546873 533
430 3300005616 Ga0068852_100077578 Ga0068852_1000775782 533
431 3300005843 Ga0068860_100011297 Ga0068860_1000112974 533
432 3300006871 Ga0075434_100034087 Ga0075434_1000340875 533
433 3300009093 Ga0105240_10000367 Ga0105240_100003675 533
434 3300009093 Ga0105240_10000457 Ga0105240_1000045725 533
435 3300009093 Ga0105240_10000487 Ga0105240_1000048744 533
436 3300009093 Ga0105240_10046442 Ga0105240_100464421 533
437 3300010375 Ga0105239_10002422 Ga0105239_100024225 533
438 3300010375 Ga0105239_10041719 Ga0105239_100417194 533
439 3300013296 Ga0157374_10000013 Ga0157374_10000013136 533
440 3300014969 Ga0157376_10003024 Ga0157376_100030248 533
441 3300025911 Ga0207654_10001813 Ga0207654_100018135 533
442 3300025913 Ga0207695_10000066 Ga0207695_1000006625 533
443 3300025913 Ga0207695_10000156 Ga0207695_1000015684 533
444 3300025913 Ga0207695_10000550 Ga0207695_100005503 533
445 3300025913 Ga0207695_10001892 Ga0207695_1000189221 533
446 3300025914 Ga0207671_10007052 Ga0207671_100070523 533
447 3300026095 Ga0207676_10173889 Ga0207676_101738891 533
448 3300026142 Ga0207698_10075369 Ga0207698_100753691 533
449 3300028379 Ga0268266_10000022 Ga0268266_1000002253 533
450 3300028381 Ga0268264_10004767 Ga0268264_1000476710 533
451 3300047472 Ga0495686_0000010 Ga0495686_0000010_253359_255179 533
452 3300001989 JGI24739J22299_10000257 JGI24739J22299_100002576 534
453 3300003316 rootH1_10041871 rootH1_100418712 534
454 3300003322 rootL2_10017890 rootL2_100178903 534
455 3300003762 Ga0055542_1003866 Ga0055542_10038662 534
456 3300003794 Ga0055531_10000014 Ga0055531_10000014101 534
457 3300005289 Ga0065704_10074690 Ga0065704_100746902 534
458 3300006195 Ga0075366_10012766 Ga0075366_100127663 534
459 3300025242 Ga0209258_100029 Ga0209258_100029135 534
460 3300025254 Ga0209148_1000089 Ga0209148_100008943 534
461 3300025295 Ga0209564_1014874 Ga0209564_10148742 534
462 3300025304 Ga0209257_1000004 Ga0209257_1000004557 534
463 3300026075 Ga0207708_10017202 Ga0207708_100172022 534
464 3300031251 Ga0265327_10006052 Ga0265327_100060523 534
465 3300041997 Ga0439431_0002168 Ga0439431_0002168_1245_2912 534
466 3300046558 Ga0495633_0000025 Ga0495633_0000025_89458_91125 534
467 3300048924 Ga0496121_0000008 Ga0496121_0000008_178530_180194 534
468 3300049571 Ga0501034_0057476 Ga0501034_0057476_907_2574 534
469 3300053088 Ga0500644_0000039 Ga0500644_0000039_24028_25692 534
470 3300053121 Ga0500607_036339 Ga0500607_036339_815_2479 534
471 3300053134 Ga0500658_0000972 Ga0500658_0000972_5260_6924 534
472 3300053142 Ga0500577_0001411 Ga0500577_0001411_4234_5898 534
473 3300053148 Ga0500590_012391 Ga0500590_012391_479_2143 534
474 3300053156 Ga0500622_0000151 Ga0500622_0000151_13016_14680 534
475 iso_pu_bacteria 2818991444 2819585479 534
476 iso_pu_bacteria 2914759650 2914763455 534
477 iso_pu_bacteria 2929154850 2929159869 534
478 3300005329 Ga0070683_100034025 Ga0070683_1000340255 535
479 3300005335 Ga0070666_10047511 Ga0070666_100475112 535
480 3300005337 Ga0070682_100003881 Ga0070682_1000038816 535
481 3300005339 Ga0070660_100062577 Ga0070660_1000625772 535
482 3300005366 Ga0070659_100011665 Ga0070659_1000116652 535
483 3300005535 Ga0070684_100009202 Ga0070684_1000092025 535
484 3300005564 Ga0070664_100073457 Ga0070664_1000734572 535
485 3300005616 Ga0068852_100011285 Ga0068852_1000112857 535
486 3300005985 Ga0081539_10001707 Ga0081539_100017072 535
487 3300013100 Ga0157373_10008404 Ga0157373_100084045 535
488 3300013102 Ga0157371_10013075 Ga0157371_100130752 535
489 3300013105 Ga0157369_10015080 Ga0157369_100150805 535
490 3300025919 Ga0207657_10011902 Ga0207657_100119025 535
491 3300025933 Ga0207706_10009268 Ga0207706_100092685 535
492 3300025940 Ga0207691_10143076 Ga0207691_101430762 535
493 3300031730 Ga0307516_10001138 Ga0307516_100011382 535
494 3300041413 Ga0439465_0026797 Ga0439465_0026797_86_1792 535
495 3300049571 Ga0501034_0043401 Ga0501034_0043401_1275_3008 535
496 3300049585 Ga0501069_0045631 Ga0501069_0045631_27_1760 535
497 3300049744 Ga0501083_0011750 Ga0501083_0011750_4033_5766 535
498 3300049823 Ga0501044_0083841 Ga0501044_0083841_1248_2981 535
499 3300053727 Ga0500611_000039 Ga0500611_000039_18647_20350 535
500 3300054114 Ga0501084_0044804 Ga0501084_0044804_1944_3677 535
501 3300005328 Ga0070676_10000064 Ga0070676_100000644 536
502 3300005338 Ga0068868_100002193 Ga0068868_1000021939 536
503 3300005347 Ga0070668_100015362 Ga0070668_1000153622 536
504 3300005364 Ga0070673_100000197 Ga0070673_10000019723 536
505 3300005367 Ga0070667_100000240 Ga0070667_10000024039 536
506 3300005457 Ga0070662_100057633 Ga0070662_1000576332 536
507 3300005459 Ga0068867_100007586 Ga0068867_1000075863 536
508 3300005543 Ga0070672_100013181 Ga0070672_1000131817 536
509 3300005548 Ga0070665_100036782 Ga0070665_1000367823 536
510 3300005618 Ga0068864_100030070 Ga0068864_1000300704 536
511 3300005834 Ga0068851_10001240 Ga0068851_100012409 536
512 3300005841 Ga0068863_100015478 Ga0068863_1000154782 536
513 3300005842 Ga0068858_100000889 Ga0068858_10000088926 536
514 3300005843 Ga0068860_100004206 Ga0068860_10000420612 536
515 3300006237 Ga0097621_100020381 Ga0097621_1000203812 536
516 3300006358 Ga0068871_100133533 Ga0068871_1001335332 536
517 3300006881 Ga0068865_100096012 Ga0068865_1000960121 536
518 3300009553 Ga0105249_10018872 Ga0105249_100188723 536
519 3300013296 Ga0157374_10045714 Ga0157374_100457141 536
520 3300013297 Ga0157378_10008769 Ga0157378_1000876910 536
521 3300013306 Ga0163162_10006923 Ga0163162_100069239 536
522 3300013306 Ga0163162_10018140 Ga0163162_100181401 536
523 3300013308 Ga0157375_10027672 Ga0157375_100276723 536
524 3300013308 Ga0157375_10035262 Ga0157375_100352623 536
525 3300014968 Ga0157379_10001465 Ga0157379_1000146514 536
526 3300014968 Ga0157379_10019036 Ga0157379_100190366 536
527 3300014969 Ga0157376_10003719 Ga0157376_100037193 536
528 3300025903 Ga0207680_10001858 Ga0207680_100018582 536
529 3300025926 Ga0207659_10027778 Ga0207659_100277783 536
530 3300025933 Ga0207706_10050715 Ga0207706_100507153 536
531 3300025940 Ga0207691_10000076 Ga0207691_1000007668 536
532 3300025960 Ga0207651_10014260 Ga0207651_100142602 536
533 3300025972 Ga0207668_10014583 Ga0207668_100145833 536
534 3300025986 Ga0207658_10008424 Ga0207658_100084248 536
535 3300026023 Ga0207677_10009204 Ga0207677_100092042 536
536 3300026035 Ga0207703_10030625 Ga0207703_100306253 536
537 3300026088 Ga0207641_10009891 Ga0207641_100098914 536
538 3300026089 Ga0207648_10002106 Ga0207648_100021068 536
539 3300026095 Ga0207676_10024425 Ga0207676_100244253 536
540 3300026121 Ga0207683_10101930 Ga0207683_101019302 536
541 3300028379 Ga0268266_10021289 Ga0268266_100212894 536
542 3300028381 Ga0268264_10005982 Ga0268264_100059825 536
543 iso_pu_bacteria 2881955468 2881956225 536
544 3300005539 Ga0068853_100177439 Ga0068853_1001774391 537
545 3300013102 Ga0157371_10007543 Ga0157371_100075434 537
546 3300013307 Ga0157372_10161543 Ga0157372_101615432 537
547 3300025919 Ga0207657_10029703 Ga0207657_100297032 537
548 3300025938 Ga0207704_10080648 Ga0207704_100806482 537
549 3300026116 Ga0207674_10049020 Ga0207674_100490202 537
550 3300030521 Ga0307511_10000027 Ga0307511_1000002710 537
551 3300032004 Ga0307414_10043941 Ga0307414_100439412 537
552 3300037471 Ga0395905_0064357 Ga0395905_0064357_243_1925 537
553 3300049822 Ga0501035_0026868 Ga0501035_0026868_3027_4709 537
554 3300001979 JGI24740J21852_10014062 JGI24740J21852_100140621 538
555 3300003322 rootL2_10096669 rootL2_100966692 538
556 3300003354 JGI25160J50197_1002636 JGI25160J50197_10026365 538
557 3300005290 Ga0065712_10001246 Ga0065712_100012463 538
558 3300005327 Ga0070658_10029501 Ga0070658_100295012 538
559 3300005327 Ga0070658_10063179 Ga0070658_100631791 538
560 3300005328 Ga0070676_10066737 Ga0070676_100667372 538
561 3300005329 Ga0070683_100095607 Ga0070683_1000956074 538
562 3300005334 Ga0068869_100006962 Ga0068869_1000069624 538
563 3300005336 Ga0070680_100120681 Ga0070680_1001206812 538
564 3300005337 Ga0070682_100000074 Ga0070682_10000007421 538
565 3300005337 Ga0070682_100046639 Ga0070682_1000466393 538
566 3300005343 Ga0070687_100022966 Ga0070687_1000229662 538
567 3300005353 Ga0070669_100013584 Ga0070669_1000135842 538
568 3300005353 Ga0070669_100016100 Ga0070669_1000161004 538
569 3300005354 Ga0070675_100010008 Ga0070675_1000100084 538
570 3300005356 Ga0070674_100050497 Ga0070674_1000504972 538
571 3300005364 Ga0070673_100021118 Ga0070673_1000211185 538
572 3300005364 Ga0070673_100080466 Ga0070673_1000804663 538
573 3300005366 Ga0070659_100160722 Ga0070659_1001607221 538
574 3300005367 Ga0070667_100128198 Ga0070667_1001281981 538
575 3300005458 Ga0070681_10205905 Ga0070681_102059051 538
576 3300005459 Ga0068867_100018353 Ga0068867_1000183534 538
577 3300005459 Ga0068867_100043071 Ga0068867_1000430713 538
578 3300005471 Ga0070698_100001074 Ga0070698_10000107421 538
579 3300005471 Ga0070698_100020355 Ga0070698_1000203553 538
580 3300005530 Ga0070679_100001516 Ga0070679_10000151611 538
581 3300005530 Ga0070679_100052432 Ga0070679_1000524322 538
582 3300005530 Ga0070679_100113173 Ga0070679_1001131733 538
583 3300005539 Ga0068853_100007589 Ga0068853_1000075893 538
584 3300005539 Ga0068853_100020882 Ga0068853_1000208826 538
585 3300005539 Ga0068853_100023897 Ga0068853_1000238974 538
586 3300005539 Ga0068853_100034559 Ga0068853_1000345594 538
587 3300005539 Ga0068853_100045683 Ga0068853_1000456833 538
588 3300005543 Ga0070672_100061639 Ga0070672_1000616393 538
589 3300005548 Ga0070665_100027148 Ga0070665_1000271483 538
590 3300005563 Ga0068855_100000145 Ga0068855_10000014567 538
591 3300005563 Ga0068855_100003314 Ga0068855_1000033144 538
592 3300005563 Ga0068855_100031140 Ga0068855_1000311402 538
593 3300005577 Ga0068857_100087478 Ga0068857_1000874782 538
594 3300005616 Ga0068852_100029755 Ga0068852_1000297555 538
595 3300005617 Ga0068859_100001697 Ga0068859_10000169712 538
596 3300005617 Ga0068859_100042435 Ga0068859_1000424354 538
597 3300005617 Ga0068859_100260678 Ga0068859_1002606781 538
598 3300005618 Ga0068864_100065161 Ga0068864_1000651613 538
599 3300005719 Ga0068861_100007430 Ga0068861_1000074309 538
600 3300005719 Ga0068861_100007576 Ga0068861_1000075766 538
601 3300005840 Ga0068870_10008140 Ga0068870_100081403 538
602 3300005841 Ga0068863_100014068 Ga0068863_1000140685 538
603 3300005843 Ga0068860_100007629 Ga0068860_1000076298 538
604 3300005844 Ga0068862_100007876 Ga0068862_1000078762 538
605 3300006237 Ga0097621_100049975 Ga0097621_1000499753 538
606 3300006237 Ga0097621_100057071 Ga0097621_1000570712 538
607 3300006237 Ga0097621_100083120 Ga0097621_1000831202 538
608 3300006358 Ga0068871_100016955 Ga0068871_1000169554 538
609 3300006844 Ga0075428_100012683 Ga0075428_10001268312 538
610 3300006846 Ga0075430_100006312 Ga0075430_1000063126 538
611 3300006847 Ga0075431_100085335 Ga0075431_1000853352 538
612 3300006880 Ga0075429_100000533 Ga0075429_1000005331 538
613 3300006881 Ga0068865_100050338 Ga0068865_1000503383 538
614 3300006931 Ga0097620_100001697 Ga0097620_10000169712 538
615 3300006931 Ga0097620_100042435 Ga0097620_1000424354 538
616 3300006931 Ga0097620_100260671 Ga0097620_1002606711 538
617 3300009093 Ga0105240_10060472 Ga0105240_100604724 538
618 3300009101 Ga0105247_10005318 Ga0105247_100053185 538
619 3300009147 Ga0114129_10047706 Ga0114129_100477063 538
620 3300009176 Ga0105242_10006871 Ga0105242_100068716 538
621 3300009176 Ga0105242_10010685 Ga0105242_100106857 538
622 3300009545 Ga0105237_10045165 Ga0105237_100451654 538
623 3300009553 Ga0105249_10001044 Ga0105249_1000104416 538
624 3300009553 Ga0105249_10002600 Ga0105249_100026004 538
625 3300009553 Ga0105249_10003251 Ga0105249_1000325112 538
626 3300009553 Ga0105249_10013188 Ga0105249_100131885 538
627 3300009553 Ga0105249_10085511 Ga0105249_100855112 538
628 3300009553 Ga0105249_10200827 Ga0105249_102008271 538
629 3300011119 Ga0105246_10009216 Ga0105246_100092164 538
630 3300013100 Ga0157373_10004089 Ga0157373_100040899 538
631 3300013100 Ga0157373_10027803 Ga0157373_100278032 538
632 3300013102 Ga0157371_10000868 Ga0157371_1000086819 538
633 3300013102 Ga0157371_10001718 Ga0157371_100017187 538
634 3300013102 Ga0157371_10009380 Ga0157371_100093802 538
635 3300013102 Ga0157371_10014951 Ga0157371_100149512 538
636 3300013102 Ga0157371_10027230 Ga0157371_100272302 538
637 3300013102 Ga0157371_10079944 Ga0157371_100799441 538
638 3300013104 Ga0157370_10000313 Ga0157370_1000031347 538
639 3300013104 Ga0157370_10000628 Ga0157370_1000062827 538
640 3300013104 Ga0157370_10001571 Ga0157370_100015712 538
641 3300013104 Ga0157370_10049874 Ga0157370_100498743 538
642 3300013297 Ga0157378_10045323 Ga0157378_100453233 538
643 3300013307 Ga0157372_10010278 Ga0157372_100102784 538
644 3300013307 Ga0157372_10245278 Ga0157372_102452782 538
645 3300013308 Ga0157375_10102667 Ga0157375_101026673 538
646 3300014969 Ga0157376_10080508 Ga0157376_100805082 538
647 3300021384 Ga0213876_10006792 Ga0213876_100067924 538
648 3300025302 Ga0207426_1000059 Ga0207426_1000059213 538
649 3300025904 Ga0207647_10007138 Ga0207647_100071388 538
650 3300025905 Ga0207685_10017549 Ga0207685_100175492 538
651 3300025907 Ga0207645_10000326 Ga0207645_1000032626 538
652 3300025908 Ga0207643_10015731 Ga0207643_100157312 538
653 3300025909 Ga0207705_10026743 Ga0207705_100267432 538
654 3300025909 Ga0207705_10044637 Ga0207705_100446372 538
655 3300025909 Ga0207705_10108977 Ga0207705_101089772 538
656 3300025913 Ga0207695_10049095 Ga0207695_100490952 538
657 3300025914 Ga0207671_10024135 Ga0207671_100241355 538
658 3300025914 Ga0207671_10104978 Ga0207671_101049782 538
659 3300025917 Ga0207660_10007760 Ga0207660_100077602 538
660 3300025918 Ga0207662_10003292 Ga0207662_100032923 538
661 3300025921 Ga0207652_10000187 Ga0207652_1000018737 538
662 3300025921 Ga0207652_10000198 Ga0207652_1000019825 538
663 3300025932 Ga0207690_10045051 Ga0207690_100450512 538
664 3300025934 Ga0207686_10001189 Ga0207686_1000118913 538
665 3300025936 Ga0207670_10032418 Ga0207670_100324182 538
666 3300025937 Ga0207669_10011591 Ga0207669_100115914 538
667 3300025938 Ga0207704_10014903 Ga0207704_100149033 538
668 3300025938 Ga0207704_10040783 Ga0207704_100407832 538
669 3300025940 Ga0207691_10029891 Ga0207691_100298913 538
670 3300025942 Ga0207689_10001060 Ga0207689_1000106014 538
671 3300025942 Ga0207689_10007781 Ga0207689_100077816 538
672 3300025942 Ga0207689_10023684 Ga0207689_100236846 538
673 3300025942 Ga0207689_10040931 Ga0207689_100409313 538
674 3300025949 Ga0207667_10000492 Ga0207667_100004926 538
675 3300025949 Ga0207667_10027086 Ga0207667_100270866 538
676 3300025949 Ga0207667_10048616 Ga0207667_100486162 538
677 3300025961 Ga0207712_10001457 Ga0207712_100014578 538
678 3300025961 Ga0207712_10003884 Ga0207712_100038848 538
679 3300025961 Ga0207712_10006568 Ga0207712_100065687 538
680 3300025961 Ga0207712_10013777 Ga0207712_100137772 538
681 3300025961 Ga0207712_10014032 Ga0207712_100140322 538
682 3300025986 Ga0207658_10079544 Ga0207658_100795441 538
683 3300026041 Ga0207639_10004353 Ga0207639_1000435310 538
684 3300026041 Ga0207639_10004753 Ga0207639_100047534 538
685 3300026088 Ga0207641_10002685 Ga0207641_1000268514 538
686 3300026089 Ga0207648_10005153 Ga0207648_100051536 538
687 3300026089 Ga0207648_10008642 Ga0207648_100086422 538
688 3300026089 Ga0207648_10014835 Ga0207648_100148356 538
689 3300026089 Ga0207648_10058255 Ga0207648_100582553 538
690 3300026089 Ga0207648_10161143 Ga0207648_101611432 538
691 3300026116 Ga0207674_10073409 Ga0207674_100734092 538
692 3300026116 Ga0207674_10132858 Ga0207674_101328581 538
693 3300026118 Ga0207675_100011340 Ga0207675_1000113402 538
694 3300026118 Ga0207675_100029953 Ga0207675_1000299532 538
695 3300026118 Ga0207675_100031240 Ga0207675_1000312402 538
696 3300026121 Ga0207683_10001248 Ga0207683_100012484 538
697 3300026121 Ga0207683_10074800 Ga0207683_100748002 538
698 3300028379 Ga0268266_10033089 Ga0268266_100330894 538
699 3300028380 Ga0268265_10005023 Ga0268265_1000502310 538
700 3300028381 Ga0268264_10008916 Ga0268264_100089162 538
701 3300028381 Ga0268264_10009473 Ga0268264_100094735 538
702 3300028794 Ga0307515_10000001 Ga0307515_100000012002 538
703 3300031251 Ga0265327_10000059 Ga0265327_10000059113 538
704 3300031251 Ga0265327_10000142 Ga0265327_10000142113 538
705 3300031251 Ga0265327_10031964 Ga0265327_100319642 538
706 3300036401 Ga0373937_0130081 Ga0373937_0130081_54_1760 538
707 3300037312 Ga0395899_0003604 Ga0395899_0003604_1920_3602 538
708 3300037312 Ga0395899_0007612 Ga0395899_0007612_5596_7278 538
709 3300037418 Ga0395900_0064447 Ga0395900_0064447_1389_3071 538
710 3300037418 Ga0395900_0095736 Ga0395900_0095736_1213_2895 538
711 3300037466 Ga0395898_0003818 Ga0395898_0003818_14261_15943 538
712 3300037471 Ga0395905_0003378 Ga0395905_0003378_119_1927 538
713 3300037471 Ga0395905_0043377 Ga0395905_0043377_1717_3399 538
714 3300038443 Ga0395901_0006287 Ga0395901_0006287_9212_10894 538
715 3300038443 Ga0395901_0015165 Ga0395901_0015165_3829_5511 538
716 3300039437 Ga0436365_0561939 Ga0436365_0561939_8044_9726 538
717 3300044658 Ga0466972_0000067 Ga0466972_0000067_2087_3772 538
718 3300044712 Ga0453684_0033409 Ga0453684_0033409_5386_7068 538
719 3300044735 Ga0466968_0026127 Ga0466968_0026127_587_2272 538
720 3300044765 Ga0466970_0001874 Ga0466970_0001874_6767_8452 538
721 3300046471 Ga0495650_0006702 Ga0495650_0006702_1972_3678 538
722 3300046616 Ga0495668_0000106 Ga0495668_0000106_36243_37925 538
723 3300049521 Ga0501298_001052 Ga0501298_001052_894_2696 538
724 3300049523 Ga0501300_004061 Ga0501300_004061_285_2087 538
725 3300049570 Ga0501033_0041960 Ga0501033_0041960_493_2220 538
726 3300049571 Ga0501034_0000002 Ga0501034_0000002_105033_106715 538
727 3300049571 Ga0501034_0012357 Ga0501034_0012357_295_1977 538
728 3300049573 Ga0501037_0021086 Ga0501037_0021086_1338_3020 538
729 3300049661 Ga0501217_002332 Ga0501217_002332_655_2466 538
730 3300049663 Ga0501223_002818 Ga0501223_002818_1285_3087 538
731 3300049664 Ga0501224_000940 Ga0501224_000940_235_2037 538
732 3300049669 Ga0501235_002213 Ga0501235_002213_1411_3213 538
733 3300049674 Ga0501242_000064 Ga0501242_000064_2223_4034 538
734 3300049686 Ga0501257_006948 Ga0501257_006948_603_2405 538
735 3300049688 Ga0501259_001123 Ga0501259_001123_1072_2874 538
736 3300049704 Ga0501221_001922 Ga0501221_001922_521_2323 538
737 3300049705 Ga0501225_0005485 Ga0501225_0005485_505_2307 538
738 3300049708 Ga0501245_000056 Ga0501245_000056_737_2539 538
739 3300049822 Ga0501035_0099067 Ga0501035_0099067_95_1777 538
740 3300049823 Ga0501044_0036018 Ga0501044_0036018_33_1760 538
741 3300050508 nmdc:mga09592_31590_c1 nmdc:mga09592_31590_c1_1213_2919 538
742 3300050509 nmdc:mga0qj67_11847_c1 nmdc:mga0qj67_11847_c1_2022_3728 538
743 3300050510 nmdc:mga06r32_33770_c1 nmdc:mga06r32_33770_c1_1296_3002 538
744 3300053108 Ga0500562_000005 Ga0500562_000005_13106_14836 538
745 3300053139 Ga0500568_0002456 Ga0500568_0002456_289_2058 538
746 3300053156 Ga0500622_0009662 Ga0500622_0009662_1513_3195 538
747 3300055283 Ga0500661_008248 Ga0500661_008248_97_1779 538
748 3300003323 rootH1_10117601 rootH1_101176013 539
749 3300005295 Ga0065707_10098632 Ga0065707_100986323 539
750 3300005329 Ga0070683_100000508 Ga0070683_10000050816 539
751 3300005329 Ga0070683_100002318 Ga0070683_1000023183 539
752 3300005329 Ga0070683_100023175 Ga0070683_1000231754 539
753 3300005330 Ga0070690_100031981 Ga0070690_1000319812 539
754 3300005331 Ga0070670_100055395 Ga0070670_1000553952 539
755 3300005334 Ga0068869_100000739 Ga0068869_10000073914 539
756 3300005334 Ga0068869_100015990 Ga0068869_1000159902 539
757 3300005335 Ga0070666_10002049 Ga0070666_1000204911 539
758 3300005338 Ga0068868_100000543 Ga0068868_10000054312 539
759 3300005338 Ga0068868_100032037 Ga0068868_1000320372 539
760 3300005340 Ga0070689_100004881 Ga0070689_1000048819 539
761 3300005344 Ga0070661_100000111 Ga0070661_10000011116 539
762 3300005344 Ga0070661_100012082 Ga0070661_1000120824 539
763 3300005353 Ga0070669_100012807 Ga0070669_1000128074 539
764 3300005354 Ga0070675_100001118 Ga0070675_10000111816 539
765 3300005355 Ga0070671_100016684 Ga0070671_1000166845 539
766 3300005364 Ga0070673_100005388 Ga0070673_1000053888 539
767 3300005366 Ga0070659_100004285 Ga0070659_1000042855 539
768 3300005366 Ga0070659_100018906 Ga0070659_1000189064 539
769 3300005367 Ga0070667_100005088 Ga0070667_1000050889 539
770 3300005457 Ga0070662_100007893 Ga0070662_1000078934 539
771 3300005457 Ga0070662_100054931 Ga0070662_1000549312 539
772 3300005466 Ga0070685_10021575 Ga0070685_100215753 539
773 3300005471 Ga0070698_100025699 Ga0070698_1000256993 539
774 3300005535 Ga0070684_100001291 Ga0070684_1000012918 539
775 3300005539 Ga0068853_100007168 Ga0068853_1000071687 539
776 3300005548 Ga0070665_100115026 Ga0070665_1001150262 539
777 3300005564 Ga0070664_100000243 Ga0070664_10000024312 539
778 3300005564 Ga0070664_100000575 Ga0070664_10000057514 539
779 3300005564 Ga0070664_100036167 Ga0070664_1000361672 539
780 3300005577 Ga0068857_100089760 Ga0068857_1000897602 539
781 3300005578 Ga0068854_100097467 Ga0068854_1000974672 539
782 3300005616 Ga0068852_100003210 Ga0068852_1000032102 539
783 3300005617 Ga0068859_100006362 Ga0068859_10000636210 539
784 3300005617 Ga0068859_100018396 Ga0068859_1000183962 539
785 3300005840 Ga0068870_10007549 Ga0068870_100075493 539
786 3300005844 Ga0068862_100006209 Ga0068862_10000620911 539
787 3300005985 Ga0081539_10014329 Ga0081539_100143292 539
788 3300006237 Ga0097621_100077093 Ga0097621_1000770932 539
789 3300006358 Ga0068871_100051945 Ga0068871_1000519452 539
790 3300006844 Ga0075428_100095861 Ga0075428_1000958613 539
791 3300006931 Ga0097620_100006362 Ga0097620_1000063624 539
792 3300006931 Ga0097620_100018396 Ga0097620_1000183966 539
793 3300009094 Ga0111539_10016272 Ga0111539_100162725 539
794 3300009176 Ga0105242_10036072 Ga0105242_100360723 539
795 3300009553 Ga0105249_10025989 Ga0105249_100259894 539
796 3300009553 Ga0105249_10138193 Ga0105249_101381931 539
797 3300013100 Ga0157373_10013073 Ga0157373_100130736 539
798 3300013296 Ga0157374_10006867 Ga0157374_100068678 539
799 3300013306 Ga0163162_10004298 Ga0163162_100042989 539
800 3300013306 Ga0163162_10059758 Ga0163162_100597583 539
801 3300013306 Ga0163162_10061209 Ga0163162_100612092 539
802 3300013307 Ga0157372_10116165 Ga0157372_101161653 539
803 3300013308 Ga0157375_10007261 Ga0157375_100072613 539
804 3300013308 Ga0157375_10056528 Ga0157375_100565283 539
805 3300014326 Ga0157380_10033908 Ga0157380_100339082 539
806 3300014745 Ga0157377_10004071 Ga0157377_100040714 539
807 3300014968 Ga0157379_10026553 Ga0157379_100265533 539
808 3300014969 Ga0157376_10028267 Ga0157376_100282673 539
809 3300014969 Ga0157376_10070217 Ga0157376_100702173 539
810 3300017792 Ga0163161_10018794 Ga0163161_100187942 539
811 3300017792 Ga0163161_10044659 Ga0163161_100446592 539
812 3300025904 Ga0207647_10000096 Ga0207647_1000009612 539
813 3300025904 Ga0207647_10056788 Ga0207647_100567882 539
814 3300025908 Ga0207643_10019405 Ga0207643_100194053 539
815 3300025918 Ga0207662_10030141 Ga0207662_100301411 539
816 3300025920 Ga0207649_10002398 Ga0207649_100023984 539
817 3300025923 Ga0207681_10002024 Ga0207681_100020247 539
818 3300025925 Ga0207650_10066726 Ga0207650_100667263 539
819 3300025932 Ga0207690_10001171 Ga0207690_1000117115 539
820 3300025932 Ga0207690_10002934 Ga0207690_100029346 539
821 3300025933 Ga0207706_10005261 Ga0207706_1000526110 539
822 3300025933 Ga0207706_10035062 Ga0207706_100350623 539
823 3300025933 Ga0207706_10051143 Ga0207706_100511431 539
824 3300025936 Ga0207670_10002141 Ga0207670_1000214110 539
825 3300025936 Ga0207670_10013100 Ga0207670_100131004 539
826 3300025936 Ga0207670_10076597 Ga0207670_100765972 539
827 3300025940 Ga0207691_10027218 Ga0207691_100272183 539
828 3300025942 Ga0207689_10002851 Ga0207689_100028517 539
829 3300025942 Ga0207689_10005578 Ga0207689_100055787 539
830 3300025944 Ga0207661_10000669 Ga0207661_1000066912 539
831 3300025944 Ga0207661_10011967 Ga0207661_100119672 539
832 3300025944 Ga0207661_10062118 Ga0207661_100621182 539
833 3300025945 Ga0207679_10000091 Ga0207679_1000009168 539
834 3300025945 Ga0207679_10004528 Ga0207679_100045284 539
835 3300025945 Ga0207679_10054054 Ga0207679_100540542 539
836 3300025960 Ga0207651_10058053 Ga0207651_100580532 539
837 3300025960 Ga0207651_10106870 Ga0207651_101068702 539
838 3300025961 Ga0207712_10066574 Ga0207712_100665742 539
839 3300026023 Ga0207677_10004007 Ga0207677_100040075 539
840 3300026023 Ga0207677_10007307 Ga0207677_100073074 539
841 3300026041 Ga0207639_10001896 Ga0207639_100018968 539
842 3300026041 Ga0207639_10016310 Ga0207639_100163104 539
843 3300026067 Ga0207678_10009466 Ga0207678_100094665 539
844 3300026088 Ga0207641_10118440 Ga0207641_101184402 539
845 3300026088 Ga0207641_10160467 Ga0207641_101604671 539
846 3300026089 Ga0207648_10018365 Ga0207648_100183656 539
847 3300026095 Ga0207676_10003274 Ga0207676_100032745 539
848 3300026116 Ga0207674_10005257 Ga0207674_100052572 539
849 3300027907 Ga0207428_10037266 Ga0207428_100372663 539
850 3300028380 Ga0268265_10004802 Ga0268265_100048029 539
851 3300028381 Ga0268264_10075400 Ga0268264_100754002 539
852 3300035119 Ga0373956_0017169 Ga0373956_0017169_795_2516 539
853 3300036401 Ga0373937_0003368 Ga0373937_0003368_5827_7548 539
854 3300042004 Ga0439445_0008793 Ga0439445_0008793_452_2284 539
855 3300046511 Ga0495608_0035325 Ga0495608_0035325_998_2719 539
856 3300046517 Ga0495630_0006610 Ga0495630_0006610_4512_6233 539
857 3300046533 Ga0495640_0067516 Ga0495640_0067516_584_2305 539
858 3300046535 Ga0495586_0024780 Ga0495586_0024780_533_2254 539
859 3300046642 Ga0495634_0013547 Ga0495634_0013547_3157_4878 539
860 3300047320 Ga0495672_0050373 Ga0495672_0050373_535_2250 539
861 3300047322 Ga0495680_0056007 Ga0495680_0056007_88_1809 539
862 3300048913 Ga0496110_0082616 Ga0496110_0082616_903_2624 539
863 3300049571 Ga0501034_0014290 Ga0501034_0014290_2067_3782 539
864 3300049573 Ga0501037_0012007 Ga0501037_0012007_1086_2804 539
865 3300049580 Ga0501046_0096338 Ga0501046_0096338_479_2197 539
866 3300049589 Ga0501073_0014754 Ga0501073_0014754_686_2401 539
867 3300050511 nmdc:mga08y16_5833_c1 nmdc:mga08y16_5833_c1_370_2148 539
868 2162886007 SwRhRL2b_contig_1663468 SwRhRL2b_0819.00004000 540
869 3300003323 rootH1_10004531 rootH1_100045313 540
870 3300005289 Ga0065704_10070133 Ga0065704_100701331132 540
871 3300005548 Ga0070665_100008108 Ga0070665_1000081083 540
872 3300009093 Ga0105240_10000020 Ga0105240_10000020353 540
873 3300009093 Ga0105240_10010712 Ga0105240_100107125 540
874 3300010375 Ga0105239_10000631 Ga0105239_1000063122 540
875 3300013104 Ga0157370_10106726 Ga0157370_101067262 540
876 3300013307 Ga0157372_10006438 Ga0157372_100064383 540
877 3300025904 Ga0207647_10011414 Ga0207647_100114143 540
878 3300025913 Ga0207695_10000020 Ga0207695_10000020171 540
879 3300025913 Ga0207695_10009054 Ga0207695_100090543 540
880 3300025914 Ga0207671_10000025 Ga0207671_10000025214 540
881 3300026023 Ga0207677_10017223 Ga0207677_100172233 540
882 3300028800 Ga0265338_10027407 Ga0265338_100274074 540
883 3300031251 Ga0265327_10000098 Ga0265327_1000009874 540
884 3300031251 Ga0265327_10000338 Ga0265327_1000033877 540
885 3300046616 Ga0495668_0000450 Ga0495668_0000450_12856_14538 540
886 3300046616 Ga0495668_0038502 Ga0495668_0038502_113_1864 540
887 3300047318 Ga0495636_0000053 Ga0495636_0000053_31009_32691 540
888 3300047472 Ga0495686_0000234 Ga0495686_0000234_97629_99311 540
889 3300048917 Ga0496114_0007992 Ga0496114_0007992_6567_8282 540
890 3300053153 Ga0500616_0000626 Ga0500616_0000626_13381_15096 540
891 3300053158 Ga0500627_0018755 Ga0500627_0018755_954_2636 540

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02540

NAD_synthase

NAD synthase

353

612

0.97

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

35

277

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fiu-assembly2.cif.gz_D structure of nmn synthetase from francisella tularensis 0.9254 260 512
2e18-assembly1.cif.gz_B crystal structure of project ph0182 from pyrococcus horikoshii ot3 0.918 261 512
1xnh-assembly1.cif.gz_A-2 crystal structure of nh3-dependent nad+ synthetase from helicobacter pylori 0.911 264 511
3p52-assembly1.cif.gz_B nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion 0.9075 261 511
3p52-assembly1.cif.gz_A nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion 0.901 261 511
ID Description Score Start End Superfamily
3n05B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9407 263 449 3.40.50.620
3n05B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9257 263 449 3.40.50.620
af_Q58747_4_258_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9254 263 512 3.40.50.620
2e18A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9184 261 512 3.40.50.620
1xnhA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.911 264 511 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A534NNB0-F1-model_v4 NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) 0.9945 264 399 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
AF-A0A3D2JLK1-F1-model_v4 NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) 0.9903 297 403 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
AF-A0A662U6F9-F1-model_v4 NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) 0.9869 261 342 GO:0003921
GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
AF-A0A660VFN2-F1-model_v4 NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) 0.981 264 347 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
AF-A0A7X6SCG4-F1-model_v4 NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) 0.9782 263 525 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435

Feature Viewer

pLDDT pTM Quality
88.75 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map