F484849
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 891 | 357 | 870 | 566 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100003049|Ga0070683_10000304915 |
| Length | 637 |
| Sequence | LRMEGNGGKGWADCGMRGRPVDTGVRFLAYFYSMKIALAQQNYHIGNFEENARKILEGIAQAKKAGAELVVFSEMSVCGYPPRDFLEFGDFIAQCYAAVDRIRQEADTIGVIIGAPVRNPNKEGKDLFNAALLLYEKEIKGVAHKTCLPNYDVFDDYRYFEPAYEWKVIPFKGKKIALTVCEDIWNLGDNPLYRVCPMDQLIRQHPDLMINISASRKEVVRANVLKYHLPMYYCNAVGAQTEIVFDGGSLIYDAAGRLVRELNYFEEDFAVVPVPHPVPPLYEELLPGLSVAINQPDPEDEIGSGVPGAGASRTEVRASKVPAVFDKDMRVSKQNSPERILQYLTDDRNIGQIRRALLLGIRDYFSKMGFSKAVIASSGGVDSAVTLALACEALGAANVRAVLLPSAYSSGHSVSDAEQLSRNLGNPYDIIPIREVYEALLHALKPAFTGKGSGSGGQEGQEIGLAEENLQSRARGNILMGLANKFGYVMLNTSNKSELATGYGTLYGDMAGGLSVLGDVYKGQVYALARDINRDGEIIPLNILSKAPSAELRPGQKDSDSLPEYDILDKVLYQYIERRQGPKEIIALGIDEELVRRILRLVNTSEYKRNQFCPIIRVSTKAFGVGRRVPIVGKYLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 4 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 5 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 6 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 7 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 8 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 9 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 10 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 11 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 12 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 13 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 14 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 15 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 16 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 17 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 18 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 19 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 20 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 21 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 22 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 23 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 24 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 25 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 28 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 29 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 30 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 31 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 32 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 38 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 41 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 94 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 95 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 139 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 207 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 211 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 220 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 226 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 227 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 228 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 229 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 230 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 241 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 242 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 243 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 244 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 247 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 248 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 249 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 250 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 251 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 252 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 253 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 254 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 255 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 256 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 281 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 282 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 283 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 284 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 285 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 310 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 314 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 315 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 316 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 317 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 318 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 319 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 321 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 326 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 331 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 341 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 343 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 344 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 345 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 346 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 348 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 349 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 350 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 352 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 354 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 356 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.64 |
| Metatranscriptomes | 0 |
| Isolates | 2.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.16 |
| Nodule | 0 |
| Rhizoplane | 0.34 |
| Rhizosphere | 89.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1663468 | 2162886007 | Bacteria | 272152 |
| 2 | JGI24740J21852_10014062 | 3300001979 | Unclassified | 2965 |
| 3 | JGI24739J22299_10000257 | 3300001989 | Bacteria | 17846 |
| 4 | JGI25154J39366_1000002 | 3300002738 | Bacteria | 466942 |
| 5 | JGI25406J46586_10005984 | 3300003203 | Bacteria | 5625 |
| 6 | JGI25153J46596_10000187 | 3300003215 | Bacteria | 60030 |
| 7 | rootH1_10041871 | 3300003316 | Bacteria | 3331 |
| 8 | rootH2_10012018 | 3300003320 | Bacteria | 28153 |
| 9 | rootH2_10034401 | 3300003320 | Bacteria | 6996 |
| 10 | rootH2_10133206 | 3300003320 | Bacteria | 8189 |
| 11 | rootL2_10017890 | 3300003322 | Bacteria | 11966 |
| 12 | rootL2_10096669 | 3300003322 | Bacteria | 2077 |
| 13 | rootL2_10189327 | 3300003322 | Bacteria | 5463 |
| 14 | rootH1_10001200 | 3300003323 | Bacteria | 6332 |
| 15 | rootH1_10004531 | 3300003323 | Bacteria | 21017 |
| 16 | rootH1_10021532 | 3300003323 | Bacteria | 20565 |
| 17 | rootH1_10097586 | 3300003323 | Bacteria | 2522 |
| 18 | rootH1_10117601 | 3300003323 | Bacteria | 6301 |
| 19 | JGI25160J50197_1002523 | 3300003354 | Bacteria | 8483 |
| 20 | JGI25160J50197_1002636 | 3300003354 | Bacteria | 8267 |
| 21 | Ga0055542_1003866 | 3300003762 | Bacteria | 3859 |
| 22 | Ga0055526_1025514 | 3300003771 | Bacteria | 1895 |
| 23 | Ga0055528_1000338 | 3300003790 | Bacteria | 39174 |
| 24 | Ga0055528_1000600 | 3300003790 | Bacteria | 27092 |
| 25 | Ga0055530_10001956 | 3300003791 | Bacteria | 14038 |
| 26 | Ga0055531_10000014 | 3300003794 | Bacteria | 184532 |
| 27 | Ga0065165_1000100 | 3300005262 | Bacteria | 141963 |
| 28 | Ga0065714_10002439 | 3300005288 | Bacteria | 22682 |
| 29 | Ga0065704_10070133 | 3300005289 | Bacteria | 1266035 |
| 30 | Ga0065704_10073387 | 3300005289 | Bacteria | 7218 |
| 31 | Ga0065704_10074690 | 3300005289 | Bacteria | 6066 |
| 32 | Ga0065712_10001246 | 3300005290 | Bacteria | 8768 |
| 33 | Ga0065707_10098632 | 3300005295 | Bacteria | 3070 |
| 34 | Ga0070658_10029501 | 3300005327 | Bacteria | 4407 |
| 35 | Ga0070658_10061489 | 3300005327 | Bacteria | 3060 |
| 36 | Ga0070658_10063179 | 3300005327 | Unclassified | 3018 |
| 37 | Ga0070676_10000064 | 3300005328 | Bacteria | 35148 |
| 38 | Ga0070676_10066737 | 3300005328 | Unclassified | 2150 |
| 39 | Ga0070683_100000508 | 3300005329 | Bacteria | 27277 |
| 40 | Ga0070683_100002318 | 3300005329 | Bacteria | 15100 |
| 41 | Ga0070683_100003049 | 3300005329 | Bacteria | 13472 |
| 42 | Ga0070683_100023175 | 3300005329 | Bacteria | 5552 |
| 43 | Ga0070683_100034025 | 3300005329 | Bacteria | 4652 |
| 44 | Ga0070683_100095607 | 3300005329 | Bacteria | 2794 |
| 45 | Ga0070690_100031981 | 3300005330 | Bacteria | 3282 |
| 46 | Ga0070670_100034247 | 3300005331 | Unclassified | 4371 |
| 47 | Ga0070670_100055395 | 3300005331 | Bacteria | 3404 |
| 48 | Ga0068869_100000739 | 3300005334 | Bacteria | 18576 |
| 49 | Ga0068869_100005945 | 3300005334 | Bacteria | 7712 |
| 50 | Ga0068869_100006962 | 3300005334 | Bacteria | 7196 |
| 51 | Ga0068869_100015990 | 3300005334 | Bacteria | 5050 |
| 52 | Ga0070666_10000301 | 3300005335 | Bacteria | 31985 |
| 53 | Ga0070666_10002049 | 3300005335 | Bacteria | 12241 |
| 54 | Ga0070666_10047511 | 3300005335 | Bacteria | 2882 |
| 55 | Ga0070680_100008330 | 3300005336 | Bacteria | 7934 |
| 56 | Ga0070680_100084125 | 3300005336 | Bacteria | 2627 |
| 57 | Ga0070680_100120681 | 3300005336 | Unclassified | 2188 |
| 58 | Ga0070682_100000074 | 3300005337 | Bacteria | 91549 |
| 59 | Ga0070682_100003881 | 3300005337 | Bacteria | 8291 |
| 60 | Ga0070682_100046639 | 3300005337 | Bacteria | 2690 |
| 61 | Ga0068868_100000543 | 3300005338 | Bacteria | 25349 |
| 62 | Ga0068868_100002193 | 3300005338 | Bacteria | 13467 |
| 63 | Ga0068868_100010528 | 3300005338 | Bacteria | 6701 |
| 64 | Ga0068868_100032037 | 3300005338 | Bacteria | 4042 |
| 65 | Ga0070660_100000647 | 3300005339 | Bacteria | 23049 |
| 66 | Ga0070660_100029929 | 3300005339 | Bacteria | 4082 |
| 67 | Ga0070660_100062577 | 3300005339 | Bacteria | 2891 |
| 68 | Ga0070689_100004881 | 3300005340 | Bacteria | 9104 |
| 69 | Ga0070687_100015930 | 3300005343 | Bacteria | 3412 |
| 70 | Ga0070687_100022966 | 3300005343 | Bacteria | 2958 |
| 71 | Ga0070661_100000111 | 3300005344 | Bacteria | 68066 |
| 72 | Ga0070661_100012082 | 3300005344 | Bacteria | 6035 |
| 73 | Ga0070668_100015362 | 3300005347 | Bacteria | 5722 |
| 74 | Ga0070669_100012807 | 3300005353 | Bacteria | 5955 |
| 75 | Ga0070669_100013584 | 3300005353 | Bacteria | 5789 |
| 76 | Ga0070669_100016100 | 3300005353 | Bacteria | 5333 |
| 77 | Ga0070675_100001118 | 3300005354 | Bacteria | 19352 |
| 78 | Ga0070675_100010008 | 3300005354 | Bacteria | 7395 |
| 79 | Ga0070671_100007427 | 3300005355 | Bacteria | 8760 |
| 80 | Ga0070671_100016684 | 3300005355 | Bacteria | 5938 |
| 81 | Ga0070674_100050497 | 3300005356 | Bacteria | 2863 |
| 82 | Ga0070673_100000197 | 3300005364 | Bacteria | 29830 |
| 83 | Ga0070673_100005388 | 3300005364 | Bacteria | 8179 |
| 84 | Ga0070673_100019747 | 3300005364 | Bacteria | 4845 |
| 85 | Ga0070673_100021118 | 3300005364 | Bacteria | 4711 |
| 86 | Ga0070673_100080466 | 3300005364 | Bacteria | 2640 |
| 87 | Ga0070688_100012988 | 3300005365 | Bacteria | 4686 |
| 88 | Ga0070659_100004285 | 3300005366 | Bacteria | 10184 |
| 89 | Ga0070659_100011665 | 3300005366 | Bacteria | 6503 |
| 90 | Ga0070659_100018906 | 3300005366 | Bacteria | 5205 |
| 91 | Ga0070659_100160722 | 3300005366 | Bacteria | 1836 |
| 92 | Ga0070667_100000240 | 3300005367 | Bacteria | 62100 |
| 93 | Ga0070667_100005088 | 3300005367 | Bacteria | 11005 |
| 94 | Ga0070667_100128198 | 3300005367 | Bacteria | 2213 |
| 95 | Ga0070713_100044714 | 3300005436 | Bacteria | 3626 |
| 96 | Ga0070678_100019833 | 3300005456 | Bacteria | 4396 |
| 97 | Ga0070662_100007893 | 3300005457 | Bacteria | 6918 |
| 98 | Ga0070662_100054931 | 3300005457 | Bacteria | 2887 |
| 99 | Ga0070662_100057633 | 3300005457 | Bacteria | 2823 |
| 100 | Ga0070681_10011071 | 3300005458 | Bacteria | 8921 |
| 101 | Ga0070681_10205905 | 3300005458 | Unclassified | 1884 |
| 102 | Ga0068867_100005824 | 3300005459 | Bacteria | 8741 |
| 103 | Ga0068867_100007586 | 3300005459 | Bacteria | 7677 |
| 104 | Ga0068867_100018353 | 3300005459 | Bacteria | 4971 |
| 105 | Ga0068867_100043071 | 3300005459 | Bacteria | 3304 |
| 106 | Ga0068867_100157477 | 3300005459 | Bacteria | 1789 |
| 107 | Ga0070685_10021575 | 3300005466 | Unclassified | 3502 |
| 108 | Ga0070698_100001074 | 3300005471 | Bacteria | 30038 |
| 109 | Ga0070698_100020355 | 3300005471 | Bacteria | 6954 |
| 110 | Ga0070698_100025699 | 3300005471 | Bacteria | 6135 |
| 111 | Ga0070679_100001516 | 3300005530 | Bacteria | 20680 |
| 112 | Ga0070679_100052432 | 3300005530 | Bacteria | 4063 |
| 113 | Ga0070679_100113173 | 3300005530 | Bacteria | 2699 |
| 114 | Ga0070684_100001291 | 3300005535 | Bacteria | 17946 |
| 115 | Ga0070684_100002976 | 3300005535 | Bacteria | 12607 |
| 116 | Ga0070684_100009202 | 3300005535 | Bacteria | 7772 |
| 117 | Ga0068853_100007168 | 3300005539 | Bacteria | 8923 |
| 118 | Ga0068853_100007589 | 3300005539 | Bacteria | 8685 |
| 119 | Ga0068853_100009547 | 3300005539 | Bacteria | 7816 |
| 120 | Ga0068853_100020882 | 3300005539 | Bacteria | 5448 |
| 121 | Ga0068853_100023897 | 3300005539 | Bacteria | 5122 |
| 122 | Ga0068853_100034559 | 3300005539 | Bacteria | 4292 |
| 123 | Ga0068853_100045683 | 3300005539 | Unclassified | 3752 |
| 124 | Ga0068853_100078295 | 3300005539 | Bacteria | 2889 |
| 125 | Ga0068853_100117153 | 3300005539 | Bacteria | 2372 |
| 126 | Ga0068853_100132223 | 3300005539 | Unclassified | 2235 |
| 127 | Ga0068853_100177439 | 3300005539 | Bacteria | 1931 |
| 128 | Ga0070672_100013181 | 3300005543 | Bacteria | 5831 |
| 129 | Ga0070672_100061639 | 3300005543 | Unclassified | 2957 |
| 130 | Ga0070693_100005061 | 3300005547 | Bacteria | 6300 |
| 131 | Ga0070665_100000002 | 3300005548 | Bacteria | 849037 |
| 132 | Ga0070665_100008108 | 3300005548 | Bacteria | 10633 |
| 133 | Ga0070665_100027148 | 3300005548 | Bacteria | 5766 |
| 134 | Ga0070665_100036782 | 3300005548 | Bacteria | 4923 |
| 135 | Ga0070665_100115026 | 3300005548 | Unclassified | 2693 |
| 136 | Ga0068855_100000145 | 3300005563 | Bacteria | 91452 |
| 137 | Ga0068855_100003314 | 3300005563 | Bacteria | 19707 |
| 138 | Ga0068855_100016778 | 3300005563 | Bacteria | 8806 |
| 139 | Ga0068855_100027195 | 3300005563 | Bacteria | 6844 |
| 140 | Ga0068855_100031140 | 3300005563 | Bacteria | 6372 |
| 141 | Ga0070664_100000243 | 3300005564 | Bacteria | 39166 |
| 142 | Ga0070664_100000575 | 3300005564 | Bacteria | 27949 |
| 143 | Ga0070664_100034619 | 3300005564 | Bacteria | 4237 |
| 144 | Ga0070664_100036167 | 3300005564 | Bacteria | 4148 |
| 145 | Ga0070664_100073457 | 3300005564 | Bacteria | 2934 |
| 146 | Ga0068857_100014392 | 3300005577 | Bacteria | 6897 |
| 147 | Ga0068857_100058242 | 3300005577 | Bacteria | 3430 |
| 148 | Ga0068857_100087478 | 3300005577 | Bacteria | 2787 |
| 149 | Ga0068857_100089760 | 3300005577 | Bacteria | 2750 |
| 150 | Ga0068854_100023435 | 3300005578 | Bacteria | 4217 |
| 151 | Ga0068854_100097467 | 3300005578 | Bacteria | 2198 |
| 152 | Ga0068856_100001817 | 3300005614 | Bacteria | 22288 |
| 153 | Ga0068856_100054687 | 3300005614 | Bacteria | 3938 |
| 154 | Ga0068856_100056388 | 3300005614 | Bacteria | 3877 |
| 155 | Ga0068856_100087457 | 3300005614 | Bacteria | 3098 |
| 156 | Ga0068852_100001462 | 3300005616 | Bacteria | 15970 |
| 157 | Ga0068852_100003210 | 3300005616 | Bacteria | 11418 |
| 158 | Ga0068852_100011285 | 3300005616 | Bacteria | 6719 |
| 159 | Ga0068852_100029755 | 3300005616 | Bacteria | 4489 |
| 160 | Ga0068852_100038683 | 3300005616 | Bacteria | 4011 |
| 161 | Ga0068852_100077578 | 3300005616 | Unclassified | 2937 |
| 162 | Ga0068859_100000006 | 3300005617 | Bacteria | 421509 |
| 163 | Ga0068859_100001697 | 3300005617 | Bacteria | 22427 |
| 164 | Ga0068859_100006362 | 3300005617 | Bacteria | 11981 |
| 165 | Ga0068859_100006790 | 3300005617 | Bacteria | 11629 |
| 166 | Ga0068859_100018396 | 3300005617 | Bacteria | 7024 |
| 167 | Ga0068859_100039325 | 3300005617 | Bacteria | 4744 |
| 168 | Ga0068859_100042435 | 3300005617 | Bacteria | 4568 |
| 169 | Ga0068859_100260678 | 3300005617 | Bacteria | 1825 |
| 170 | Ga0068864_100030070 | 3300005618 | Bacteria | 4603 |
| 171 | Ga0068864_100030464 | 3300005618 | Bacteria | 4573 |
| 172 | Ga0068864_100065161 | 3300005618 | Bacteria | 3161 |
| 173 | Ga0068861_100002834 | 3300005719 | Bacteria | 11403 |
| 174 | Ga0068861_100007430 | 3300005719 | Bacteria | 7511 |
| 175 | Ga0068861_100007576 | 3300005719 | Bacteria | 7445 |
| 176 | Ga0068851_10000010 | 3300005834 | Bacteria | 202121 |
| 177 | Ga0068851_10001240 | 3300005834 | Bacteria | 11085 |
| 178 | Ga0068870_10007549 | 3300005840 | Bacteria | 4853 |
| 179 | Ga0068870_10008140 | 3300005840 | Bacteria | 4700 |
| 180 | Ga0068863_100014068 | 3300005841 | Bacteria | 7710 |
| 181 | Ga0068863_100015478 | 3300005841 | Bacteria | 7331 |
| 182 | Ga0068863_100023628 | 3300005841 | Bacteria | 5869 |
| 183 | Ga0068858_100000889 | 3300005842 | Bacteria | 31013 |
| 184 | Ga0068858_100011681 | 3300005842 | Bacteria | 8281 |
| 185 | Ga0068860_100000003 | 3300005843 | Bacteria | 575741 |
| 186 | Ga0068860_100001345 | 3300005843 | Bacteria | 26726 |
| 187 | Ga0068860_100002872 | 3300005843 | Bacteria | 17875 |
| 188 | Ga0068860_100004206 | 3300005843 | Bacteria | 14751 |
| 189 | Ga0068860_100007629 | 3300005843 | Bacteria | 10824 |
| 190 | Ga0068860_100011297 | 3300005843 | Bacteria | 8798 |
| 191 | Ga0068862_100006209 | 3300005844 | Bacteria | 9952 |
| 192 | Ga0068862_100007876 | 3300005844 | Bacteria | 8815 |
| 193 | Ga0081540_1003918 | 3300005983 | Bacteria | 11589 |
| 194 | Ga0081539_10000085 | 3300005985 | Bacteria | 217816 |
| 195 | Ga0081539_10001707 | 3300005985 | Bacteria | 35373 |
| 196 | Ga0081539_10014329 | 3300005985 | Bacteria | 5873 |
| 197 | Ga0070717_10000648 | 3300006028 | Bacteria | 22345 |
| 198 | Ga0075366_10012766 | 3300006195 | Bacteria | 4772 |
| 199 | Ga0075366_10028353 | 3300006195 | Bacteria | 3286 |
| 200 | Ga0097621_100001013 | 3300006237 | Bacteria | 19778 |
| 201 | Ga0097621_100001217 | 3300006237 | Bacteria | 17815 |
| 202 | Ga0097621_100020381 | 3300006237 | Bacteria | 5108 |
| 203 | Ga0097621_100049975 | 3300006237 | Bacteria | 3399 |
| 204 | Ga0097621_100057071 | 3300006237 | Bacteria | 3191 |
| 205 | Ga0097621_100077093 | 3300006237 | Bacteria | 2766 |
| 206 | Ga0097621_100083120 | 3300006237 | Unclassified | 2668 |
| 207 | Ga0068871_100003639 | 3300006358 | Bacteria | 10589 |
| 208 | Ga0068871_100007102 | 3300006358 | Bacteria | 7984 |
| 209 | Ga0068871_100016955 | 3300006358 | Bacteria | 5500 |
| 210 | Ga0068871_100025182 | 3300006358 | Bacteria | 4625 |
| 211 | Ga0068871_100051945 | 3300006358 | Bacteria | 3318 |
| 212 | Ga0068871_100133533 | 3300006358 | Unclassified | 2106 |
| 213 | Ga0075428_100012683 | 3300006844 | Bacteria | 9372 |
| 214 | Ga0075428_100095861 | 3300006844 | Unclassified | 3234 |
| 215 | Ga0075430_100006312 | 3300006846 | Bacteria | 10000 |
| 216 | Ga0075431_100085335 | 3300006847 | Bacteria | 3259 |
| 217 | Ga0075433_10006563 | 3300006852 | Bacteria | 9209 |
| 218 | Ga0075434_100001986 | 3300006871 | Bacteria | 17749 |
| 219 | Ga0075434_100034087 | 3300006871 | Bacteria | 5026 |
| 220 | Ga0075429_100000533 | 3300006880 | Bacteria | 28947 |
| 221 | Ga0075429_100035556 | 3300006880 | Bacteria | 4333 |
| 222 | Ga0068865_100000491 | 3300006881 | Bacteria | 22178 |
| 223 | Ga0068865_100050338 | 3300006881 | Bacteria | 2877 |
| 224 | Ga0068865_100096012 | 3300006881 | Bacteria | 2161 |
| 225 | Ga0068865_100123175 | 3300006881 | Bacteria | 1931 |
| 226 | Ga0075436_100037970 | 3300006914 | Bacteria | 3324 |
| 227 | Ga0097620_100000006 | 3300006931 | Bacteria | 421509 |
| 228 | Ga0097620_100001697 | 3300006931 | Bacteria | 22427 |
| 229 | Ga0097620_100006362 | 3300006931 | Bacteria | 11981 |
| 230 | Ga0097620_100006790 | 3300006931 | Bacteria | 11629 |
| 231 | Ga0097620_100018396 | 3300006931 | Bacteria | 7024 |
| 232 | Ga0097620_100039324 | 3300006931 | Bacteria | 4744 |
| 233 | Ga0097620_100042435 | 3300006931 | Bacteria | 4568 |
| 234 | Ga0097620_100260671 | 3300006931 | Bacteria | 1825 |
| 235 | Ga0075435_100000289 | 3300007076 | Bacteria | 31160 |
| 236 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 237 | Ga0105240_10000020 | 3300009093 | Bacteria | 399699 |
| 238 | Ga0105240_10000367 | 3300009093 | Bacteria | 84666 |
| 239 | Ga0105240_10000457 | 3300009093 | Bacteria | 75275 |
| 240 | Ga0105240_10000487 | 3300009093 | Bacteria | 73453 |
| 241 | Ga0105240_10004986 | 3300009093 | Bacteria | 19945 |
| 242 | Ga0105240_10006862 | 3300009093 | Bacteria | 16644 |
| 243 | Ga0105240_10010712 | 3300009093 | Bacteria | 12865 |
| 244 | Ga0105240_10046442 | 3300009093 | Bacteria | 5503 |
| 245 | Ga0105240_10060472 | 3300009093 | Bacteria | 4723 |
| 246 | Ga0111539_10016272 | 3300009094 | Bacteria | 9223 |
| 247 | Ga0111539_10052998 | 3300009094 | Bacteria | 4829 |
| 248 | Ga0111539_10079509 | 3300009094 | Bacteria | 3857 |
| 249 | Ga0111539_10194366 | 3300009094 | Bacteria | 2367 |
| 250 | Ga0105247_10005318 | 3300009101 | Bacteria | 8116 |
| 251 | Ga0114129_10018174 | 3300009147 | Bacteria | 10010 |
| 252 | Ga0114129_10047706 | 3300009147 | Bacteria | 6017 |
| 253 | Ga0105241_10003231 | 3300009174 | Bacteria | 12123 |
| 254 | Ga0105241_10003877 | 3300009174 | Bacteria | 11089 |
| 255 | Ga0105241_10038676 | 3300009174 | Bacteria | 3597 |
| 256 | Ga0105242_10006871 | 3300009176 | Bacteria | 8776 |
| 257 | Ga0105242_10010685 | 3300009176 | Bacteria | 7048 |
| 258 | Ga0105242_10036072 | 3300009176 | Bacteria | 3965 |
| 259 | Ga0105248_10016053 | 3300009177 | Bacteria | 8243 |
| 260 | Ga0105237_10003940 | 3300009545 | Bacteria | 17384 |
| 261 | Ga0105237_10011351 | 3300009545 | Bacteria | 9426 |
| 262 | Ga0105237_10014983 | 3300009545 | Bacteria | 8081 |
| 263 | Ga0105237_10045165 | 3300009545 | Bacteria | 4434 |
| 264 | Ga0105237_10047857 | 3300009545 | Bacteria | 4299 |
| 265 | Ga0105237_10053020 | 3300009545 | Bacteria | 4069 |
| 266 | Ga0105237_10148535 | 3300009545 | Bacteria | 2339 |
| 267 | Ga0105237_10209197 | 3300009545 | Bacteria | 1951 |
| 268 | Ga0105238_10010193 | 3300009551 | Bacteria | 9423 |
| 269 | Ga0105249_10001044 | 3300009553 | Bacteria | 24495 |
| 270 | Ga0105249_10002600 | 3300009553 | Bacteria | 15643 |
| 271 | Ga0105249_10003251 | 3300009553 | Bacteria | 14076 |
| 272 | Ga0105249_10013188 | 3300009553 | Bacteria | 7293 |
| 273 | Ga0105249_10018872 | 3300009553 | Bacteria | 6145 |
| 274 | Ga0105249_10025989 | 3300009553 | Bacteria | 5273 |
| 275 | Ga0105249_10085511 | 3300009553 | Bacteria | 2939 |
| 276 | Ga0105249_10138193 | 3300009553 | Bacteria | 2334 |
| 277 | Ga0105249_10200827 | 3300009553 | Bacteria | 1951 |
| 278 | Ga0105239_10000283 | 3300010375 | Bacteria | 74612 |
| 279 | Ga0105239_10000631 | 3300010375 | Bacteria | 50176 |
| 280 | Ga0105239_10002212 | 3300010375 | Bacteria | 24980 |
| 281 | Ga0105239_10002422 | 3300010375 | Bacteria | 23765 |
| 282 | Ga0105239_10041719 | 3300010375 | Bacteria | 5028 |
| 283 | Ga0105246_10009216 | 3300011119 | Bacteria | 6078 |
| 284 | Ga0105246_10056558 | 3300011119 | Bacteria | 2712 |
| 285 | Ga0157373_10004089 | 3300013100 | Bacteria | 10989 |
| 286 | Ga0157373_10008404 | 3300013100 | Bacteria | 7664 |
| 287 | Ga0157373_10013073 | 3300013100 | Bacteria | 6091 |
| 288 | Ga0157373_10021959 | 3300013100 | Bacteria | 4631 |
| 289 | Ga0157373_10027803 | 3300013100 | Bacteria | 4080 |
| 290 | Ga0157371_10000868 | 3300013102 | Bacteria | 34292 |
| 291 | Ga0157371_10001718 | 3300013102 | Bacteria | 22261 |
| 292 | Ga0157371_10007543 | 3300013102 | Bacteria | 8796 |
| 293 | Ga0157371_10009380 | 3300013102 | Bacteria | 7707 |
| 294 | Ga0157371_10013075 | 3300013102 | Bacteria | 6319 |
| 295 | Ga0157371_10014951 | 3300013102 | Bacteria | 5840 |
| 296 | Ga0157371_10027230 | 3300013102 | Bacteria | 4148 |
| 297 | Ga0157371_10045155 | 3300013102 | Bacteria | 3136 |
| 298 | Ga0157371_10079944 | 3300013102 | Unclassified | 2315 |
| 299 | Ga0157370_10000313 | 3300013104 | Bacteria | 60838 |
| 300 | Ga0157370_10000628 | 3300013104 | Bacteria | 43950 |
| 301 | Ga0157370_10001571 | 3300013104 | Bacteria | 28252 |
| 302 | Ga0157370_10026250 | 3300013104 | Bacteria | 5755 |
| 303 | Ga0157370_10049874 | 3300013104 | Bacteria | 4003 |
| 304 | Ga0157370_10106726 | 3300013104 | Unclassified | 2620 |
| 305 | Ga0157369_10015080 | 3300013105 | Bacteria | 8723 |
| 306 | Ga0157369_10042857 | 3300013105 | Bacteria | 4936 |
| 307 | Ga0157374_10000013 | 3300013296 | Bacteria | 461240 |
| 308 | Ga0157374_10006867 | 3300013296 | Bacteria | 9682 |
| 309 | Ga0157374_10008233 | 3300013296 | Bacteria | 8909 |
| 310 | Ga0157374_10045714 | 3300013296 | Bacteria | 4052 |
| 311 | Ga0157378_10008769 | 3300013297 | Bacteria | 8804 |
| 312 | Ga0157378_10019118 | 3300013297 | Bacteria | 6019 |
| 313 | Ga0157378_10025790 | 3300013297 | Bacteria | 5178 |
| 314 | Ga0157378_10045323 | 3300013297 | Bacteria | 3907 |
| 315 | Ga0157378_10048499 | 3300013297 | Bacteria | 3777 |
| 316 | Ga0163162_10000175 | 3300013306 | Bacteria | 59209 |
| 317 | Ga0163162_10000244 | 3300013306 | Bacteria | 49260 |
| 318 | Ga0163162_10001206 | 3300013306 | Bacteria | 24134 |
| 319 | Ga0163162_10001299 | 3300013306 | Bacteria | 23358 |
| 320 | Ga0163162_10002221 | 3300013306 | Bacteria | 18233 |
| 321 | Ga0163162_10004298 | 3300013306 | Bacteria | 13710 |
| 322 | Ga0163162_10006923 | 3300013306 | Bacteria | 10993 |
| 323 | Ga0163162_10013139 | 3300013306 | Bacteria | 8084 |
| 324 | Ga0163162_10018140 | 3300013306 | Bacteria | 6890 |
| 325 | Ga0163162_10059758 | 3300013306 | Bacteria | 3845 |
| 326 | Ga0163162_10061209 | 3300013306 | Bacteria | 3802 |
| 327 | Ga0157372_10004707 | 3300013307 | Bacteria | 14494 |
| 328 | Ga0157372_10006438 | 3300013307 | Bacteria | 12502 |
| 329 | Ga0157372_10010278 | 3300013307 | Bacteria | 9942 |
| 330 | Ga0157372_10014609 | 3300013307 | Bacteria | 8400 |
| 331 | Ga0157372_10028658 | 3300013307 | Bacteria | 6079 |
| 332 | Ga0157372_10090212 | 3300013307 | Bacteria | 3484 |
| 333 | Ga0157372_10116165 | 3300013307 | Bacteria | 3068 |
| 334 | Ga0157372_10161543 | 3300013307 | Bacteria | 2589 |
| 335 | Ga0157372_10245278 | 3300013307 | Unclassified | 2079 |
| 336 | Ga0157375_10005169 | 3300013308 | Bacteria | 11323 |
| 337 | Ga0157375_10007261 | 3300013308 | Bacteria | 9694 |
| 338 | Ga0157375_10027672 | 3300013308 | Bacteria | 5303 |
| 339 | Ga0157375_10035262 | 3300013308 | Bacteria | 4773 |
| 340 | Ga0157375_10056528 | 3300013308 | Bacteria | 3875 |
| 341 | Ga0157375_10064390 | 3300013308 | Unclassified | 3650 |
| 342 | Ga0157375_10102667 | 3300013308 | Bacteria | 2945 |
| 343 | Ga0157375_10124458 | 3300013308 | Bacteria | 2692 |
| 344 | Ga0157375_10185909 | 3300013308 | Bacteria | 2231 |
| 345 | Ga0163163_10000202 | 3300014325 | Bacteria | 61701 |
| 346 | Ga0163163_10015385 | 3300014325 | Bacteria | 7072 |
| 347 | Ga0163163_10255936 | 3300014325 | Bacteria | 1802 |
| 348 | Ga0157380_10001220 | 3300014326 | Bacteria | 16666 |
| 349 | Ga0157380_10002444 | 3300014326 | Bacteria | 12518 |
| 350 | Ga0157380_10004286 | 3300014326 | Bacteria | 9876 |
| 351 | Ga0157380_10033908 | 3300014326 | Bacteria | 3934 |
| 352 | Ga0157377_10004071 | 3300014745 | Bacteria | 6673 |
| 353 | Ga0157377_10019477 | 3300014745 | Bacteria | 3546 |
| 354 | Ga0157379_10001465 | 3300014968 | Bacteria | 19448 |
| 355 | Ga0157379_10019036 | 3300014968 | Bacteria | 6061 |
| 356 | Ga0157379_10021198 | 3300014968 | Bacteria | 5751 |
| 357 | Ga0157379_10026553 | 3300014968 | Bacteria | 5154 |
| 358 | Ga0157376_10000842 | 3300014969 | Bacteria | 20112 |
| 359 | Ga0157376_10003024 | 3300014969 | Bacteria | 11531 |
| 360 | Ga0157376_10003719 | 3300014969 | Bacteria | 10545 |
| 361 | Ga0157376_10028267 | 3300014969 | Bacteria | 4456 |
| 362 | Ga0157376_10070217 | 3300014969 | Bacteria | 2972 |
| 363 | Ga0157376_10080508 | 3300014969 | Bacteria | 2794 |
| 364 | Ga0157376_10080737 | 3300014969 | Bacteria | 2791 |
| 365 | Ga0182007_10008552 | 3300015262 | Bacteria | 4194 |
| 366 | Ga0182005_1000061 | 3300015265 | Bacteria | 98415 |
| 367 | Ga0163161_10018794 | 3300017792 | Bacteria | 4844 |
| 368 | Ga0163161_10044659 | 3300017792 | Bacteria | 3192 |
| 369 | Ga0163161_10071142 | 3300017792 | Bacteria | 2545 |
| 370 | Ga0213876_10006792 | 3300021384 | Bacteria | 6249 |
| 371 | Ga0209436_101437 | 3300025208 | Bacteria | 8344 |
| 372 | Ga0209258_100029 | 3300025242 | Bacteria | 490648 |
| 373 | Ga0209646_1000005 | 3300025246 | Bacteria | 717627 |
| 374 | Ga0209646_1001757 | 3300025246 | Bacteria | 5460 |
| 375 | Ga0209026_1000587 | 3300025250 | Bacteria | 23729 |
| 376 | Ga0209148_1000089 | 3300025254 | Bacteria | 253548 |
| 377 | Ga0209673_1000049 | 3300025273 | Bacteria | 286207 |
| 378 | Ga0209564_1013600 | 3300025295 | Bacteria | 3438 |
| 379 | Ga0209564_1014874 | 3300025295 | Bacteria | 3205 |
| 380 | Ga0209758_1000346 | 3300025297 | Bacteria | 84821 |
| 381 | Ga0209758_1025236 | 3300025297 | Bacteria | 2614 |
| 382 | Ga0209050_1000272 | 3300025298 | Bacteria | 110636 |
| 383 | Ga0207426_1000059 | 3300025302 | Bacteria | 363842 |
| 384 | Ga0207426_1000233 | 3300025302 | Bacteria | 127848 |
| 385 | Ga0207426_1000381 | 3300025302 | Bacteria | 76038 |
| 386 | Ga0207426_1001075 | 3300025302 | Bacteria | 25593 |
| 387 | Ga0207426_1010995 | 3300025302 | Bacteria | 3476 |
| 388 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 389 | Ga0207656_10000157 | 3300025321 | Bacteria | 25236 |
| 390 | Ga0207680_10000855 | 3300025903 | Bacteria | 14362 |
| 391 | Ga0207680_10001858 | 3300025903 | Bacteria | 9924 |
| 392 | Ga0207647_10000096 | 3300025904 | Bacteria | 67468 |
| 393 | Ga0207647_10007138 | 3300025904 | Bacteria | 8101 |
| 394 | Ga0207647_10011414 | 3300025904 | Bacteria | 6232 |
| 395 | Ga0207647_10056788 | 3300025904 | Bacteria | 2401 |
| 396 | Ga0207685_10017549 | 3300025905 | Unclassified | 2317 |
| 397 | Ga0207645_10000326 | 3300025907 | Bacteria | 39738 |
| 398 | Ga0207643_10015731 | 3300025908 | Unclassified | 4120 |
| 399 | Ga0207643_10019405 | 3300025908 | Bacteria | 3725 |
| 400 | Ga0207705_10009499 | 3300025909 | Bacteria | 7076 |
| 401 | Ga0207705_10026743 | 3300025909 | Bacteria | 4112 |
| 402 | Ga0207705_10044637 | 3300025909 | Bacteria | 3185 |
| 403 | Ga0207705_10097636 | 3300025909 | Bacteria | 2158 |
| 404 | Ga0207705_10108977 | 3300025909 | Bacteria | 2044 |
| 405 | Ga0207654_10001346 | 3300025911 | Bacteria | 13038 |
| 406 | Ga0207654_10001813 | 3300025911 | Bacteria | 11092 |
| 407 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 408 | Ga0207695_10000020 | 3300025913 | Bacteria | 723025 |
| 409 | Ga0207695_10000051 | 3300025913 | Bacteria | 399641 |
| 410 | Ga0207695_10000056 | 3300025913 | Bacteria | 382433 |
| 411 | Ga0207695_10000066 | 3300025913 | Bacteria | 334103 |
| 412 | Ga0207695_10000081 | 3300025913 | Bacteria | 284797 |
| 413 | Ga0207695_10000156 | 3300025913 | Bacteria | 204576 |
| 414 | Ga0207695_10000550 | 3300025913 | Bacteria | 77346 |
| 415 | Ga0207695_10001892 | 3300025913 | Bacteria | 32670 |
| 416 | Ga0207695_10009054 | 3300025913 | Bacteria | 12373 |
| 417 | Ga0207695_10049095 | 3300025913 | Bacteria | 4451 |
| 418 | Ga0207671_10000025 | 3300025914 | Bacteria | 271617 |
| 419 | Ga0207671_10007052 | 3300025914 | Bacteria | 9839 |
| 420 | Ga0207671_10024135 | 3300025914 | Bacteria | 4576 |
| 421 | Ga0207671_10027684 | 3300025914 | Bacteria | 4237 |
| 422 | Ga0207671_10030857 | 3300025914 | Bacteria | 3995 |
| 423 | Ga0207671_10104978 | 3300025914 | Unclassified | 2143 |
| 424 | Ga0207660_10007760 | 3300025917 | Bacteria | 6948 |
| 425 | Ga0207660_10026465 | 3300025917 | Bacteria | 3951 |
| 426 | Ga0207662_10003292 | 3300025918 | Bacteria | 8290 |
| 427 | Ga0207662_10030141 | 3300025918 | Bacteria | 3147 |
| 428 | Ga0207657_10005023 | 3300025919 | Bacteria | 13884 |
| 429 | Ga0207657_10011902 | 3300025919 | Bacteria | 8609 |
| 430 | Ga0207657_10029703 | 3300025919 | Bacteria | 4971 |
| 431 | Ga0207649_10002398 | 3300025920 | Bacteria | 10509 |
| 432 | Ga0207652_10000187 | 3300025921 | Bacteria | 65282 |
| 433 | Ga0207652_10000198 | 3300025921 | Bacteria | 63388 |
| 434 | Ga0207652_10004623 | 3300025921 | Bacteria | 11155 |
| 435 | Ga0207681_10002024 | 3300025923 | Bacteria | 13028 |
| 436 | Ga0207694_10011093 | 3300025924 | Bacteria | 6806 |
| 437 | Ga0207650_10014874 | 3300025925 | Bacteria | 5414 |
| 438 | Ga0207650_10066726 | 3300025925 | Bacteria | 2699 |
| 439 | Ga0207659_10027778 | 3300025926 | Bacteria | 3836 |
| 440 | Ga0207659_10030533 | 3300025926 | Bacteria | 3684 |
| 441 | Ga0207700_10022968 | 3300025928 | Bacteria | 4289 |
| 442 | Ga0207644_10008865 | 3300025931 | Bacteria | 6589 |
| 443 | Ga0207690_10001171 | 3300025932 | Bacteria | 16575 |
| 444 | Ga0207690_10002934 | 3300025932 | Bacteria | 10277 |
| 445 | Ga0207690_10040708 | 3300025932 | Bacteria | 3040 |
| 446 | Ga0207690_10045051 | 3300025932 | Bacteria | 2912 |
| 447 | Ga0207706_10005261 | 3300025933 | Bacteria | 12070 |
| 448 | Ga0207706_10009268 | 3300025933 | Bacteria | 9042 |
| 449 | Ga0207706_10035062 | 3300025933 | Bacteria | 4463 |
| 450 | Ga0207706_10050715 | 3300025933 | Bacteria | 3667 |
| 451 | Ga0207706_10051143 | 3300025933 | Bacteria | 3650 |
| 452 | Ga0207686_10001189 | 3300025934 | Bacteria | 15075 |
| 453 | Ga0207670_10002141 | 3300025936 | Bacteria | 10336 |
| 454 | Ga0207670_10013100 | 3300025936 | Bacteria | 4879 |
| 455 | Ga0207670_10032418 | 3300025936 | Bacteria | 3360 |
| 456 | Ga0207670_10076597 | 3300025936 | Bacteria | 2328 |
| 457 | Ga0207669_10011591 | 3300025937 | Bacteria | 4298 |
| 458 | Ga0207669_10026030 | 3300025937 | Bacteria | 3174 |
| 459 | Ga0207669_10111164 | 3300025937 | Bacteria | 1837 |
| 460 | Ga0207704_10002375 | 3300025938 | Bacteria | 8459 |
| 461 | Ga0207704_10014903 | 3300025938 | Bacteria | 3944 |
| 462 | Ga0207704_10040783 | 3300025938 | Bacteria | 2717 |
| 463 | Ga0207704_10072337 | 3300025938 | Bacteria | 2191 |
| 464 | Ga0207704_10080648 | 3300025938 | Unclassified | 2101 |
| 465 | Ga0207691_10000076 | 3300025940 | Bacteria | 83005 |
| 466 | Ga0207691_10027218 | 3300025940 | Bacteria | 5364 |
| 467 | Ga0207691_10029891 | 3300025940 | Bacteria | 5096 |
| 468 | Ga0207691_10143076 | 3300025940 | Bacteria | 2106 |
| 469 | Ga0207689_10000210 | 3300025942 | Bacteria | 51572 |
| 470 | Ga0207689_10001060 | 3300025942 | Bacteria | 26468 |
| 471 | Ga0207689_10002845 | 3300025942 | Bacteria | 15974 |
| 472 | Ga0207689_10002851 | 3300025942 | Bacteria | 15954 |
| 473 | Ga0207689_10005578 | 3300025942 | Bacteria | 11228 |
| 474 | Ga0207689_10007781 | 3300025942 | Bacteria | 9379 |
| 475 | Ga0207689_10023684 | 3300025942 | Bacteria | 5149 |
| 476 | Ga0207689_10024801 | 3300025942 | Bacteria | 5028 |
| 477 | Ga0207689_10040931 | 3300025942 | Bacteria | 3834 |
| 478 | Ga0207661_10000669 | 3300025944 | Bacteria | 22178 |
| 479 | Ga0207661_10011967 | 3300025944 | Bacteria | 6302 |
| 480 | Ga0207661_10033981 | 3300025944 | Bacteria | 3961 |
| 481 | Ga0207661_10062118 | 3300025944 | Bacteria | 3021 |
| 482 | Ga0207679_10000091 | 3300025945 | Bacteria | 78725 |
| 483 | Ga0207679_10004528 | 3300025945 | Bacteria | 8660 |
| 484 | Ga0207679_10054054 | 3300025945 | Bacteria | 2954 |
| 485 | Ga0207667_10000492 | 3300025949 | Bacteria | 52207 |
| 486 | Ga0207667_10002366 | 3300025949 | Bacteria | 23615 |
| 487 | Ga0207667_10005458 | 3300025949 | Bacteria | 15498 |
| 488 | Ga0207667_10027086 | 3300025949 | Bacteria | 6249 |
| 489 | Ga0207667_10048616 | 3300025949 | Bacteria | 4484 |
| 490 | Ga0207667_10138552 | 3300025949 | Bacteria | 2505 |
| 491 | Ga0207651_10014260 | 3300025960 | Bacteria | 4581 |
| 492 | Ga0207651_10014270 | 3300025960 | Bacteria | 4580 |
| 493 | Ga0207651_10058053 | 3300025960 | Bacteria | 2673 |
| 494 | Ga0207651_10106870 | 3300025960 | Bacteria | 2090 |
| 495 | Ga0207712_10001457 | 3300025961 | Bacteria | 16141 |
| 496 | Ga0207712_10002253 | 3300025961 | Bacteria | 12531 |
| 497 | Ga0207712_10003884 | 3300025961 | Bacteria | 9442 |
| 498 | Ga0207712_10006568 | 3300025961 | Bacteria | 7340 |
| 499 | Ga0207712_10013777 | 3300025961 | Bacteria | 5186 |
| 500 | Ga0207712_10014032 | 3300025961 | Bacteria | 5143 |
| 501 | Ga0207712_10066574 | 3300025961 | Unclassified | 2575 |
| 502 | Ga0207668_10014583 | 3300025972 | Bacteria | 4864 |
| 503 | Ga0207658_10008424 | 3300025986 | Bacteria | 7019 |
| 504 | Ga0207658_10079544 | 3300025986 | Bacteria | 2508 |
| 505 | Ga0207677_10004007 | 3300026023 | Bacteria | 7860 |
| 506 | Ga0207677_10007307 | 3300026023 | Bacteria | 6101 |
| 507 | Ga0207677_10009204 | 3300026023 | Bacteria | 5546 |
| 508 | Ga0207677_10017223 | 3300026023 | Bacteria | 4302 |
| 509 | Ga0207703_10004255 | 3300026035 | Bacteria | 11782 |
| 510 | Ga0207703_10030625 | 3300026035 | Bacteria | 4254 |
| 511 | Ga0207639_10001896 | 3300026041 | Bacteria | 14035 |
| 512 | Ga0207639_10004353 | 3300026041 | Bacteria | 9553 |
| 513 | Ga0207639_10004753 | 3300026041 | Bacteria | 9148 |
| 514 | Ga0207639_10016310 | 3300026041 | Bacteria | 5253 |
| 515 | Ga0207639_10098604 | 3300026041 | Bacteria | 2356 |
| 516 | Ga0207639_10137223 | 3300026041 | Bacteria | 2033 |
| 517 | Ga0207678_10009466 | 3300026067 | Bacteria | 8570 |
| 518 | Ga0207708_10017202 | 3300026075 | Bacteria | 5442 |
| 519 | Ga0207702_10008275 | 3300026078 | Bacteria | 8788 |
| 520 | Ga0207702_10067987 | 3300026078 | Unclassified | 3060 |
| 521 | Ga0207702_10128423 | 3300026078 | Bacteria | 2278 |
| 522 | Ga0207641_10002685 | 3300026088 | Bacteria | 16230 |
| 523 | Ga0207641_10002871 | 3300026088 | Bacteria | 15625 |
| 524 | Ga0207641_10009891 | 3300026088 | Bacteria | 7852 |
| 525 | Ga0207641_10030841 | 3300026088 | Bacteria | 4443 |
| 526 | Ga0207641_10118440 | 3300026088 | Bacteria | 2359 |
| 527 | Ga0207641_10160467 | 3300026088 | Bacteria | 2044 |
| 528 | Ga0207648_10002106 | 3300026089 | Bacteria | 21685 |
| 529 | Ga0207648_10003360 | 3300026089 | Bacteria | 16813 |
| 530 | Ga0207648_10005153 | 3300026089 | Bacteria | 13235 |
| 531 | Ga0207648_10008642 | 3300026089 | Bacteria | 9835 |
| 532 | Ga0207648_10014835 | 3300026089 | Bacteria | 7186 |
| 533 | Ga0207648_10018365 | 3300026089 | Bacteria | 6334 |
| 534 | Ga0207648_10058255 | 3300026089 | Bacteria | 3369 |
| 535 | Ga0207648_10161143 | 3300026089 | Bacteria | 1981 |
| 536 | Ga0207648_10179063 | 3300026089 | Bacteria | 1876 |
| 537 | Ga0207676_10003274 | 3300026095 | Bacteria | 11514 |
| 538 | Ga0207676_10024425 | 3300026095 | Bacteria | 4472 |
| 539 | Ga0207676_10083396 | 3300026095 | Bacteria | 2603 |
| 540 | Ga0207676_10084450 | 3300026095 | Bacteria | 2588 |
| 541 | Ga0207676_10173889 | 3300026095 | Unclassified | 1879 |
| 542 | Ga0207674_10005257 | 3300026116 | Bacteria | 15410 |
| 543 | Ga0207674_10049020 | 3300026116 | Bacteria | 4321 |
| 544 | Ga0207674_10073409 | 3300026116 | Bacteria | 3435 |
| 545 | Ga0207674_10132858 | 3300026116 | Unclassified | 2451 |
| 546 | Ga0207675_100000085 | 3300026118 | Bacteria | 73716 |
| 547 | Ga0207675_100011340 | 3300026118 | Bacteria | 8340 |
| 548 | Ga0207675_100029953 | 3300026118 | Bacteria | 5066 |
| 549 | Ga0207675_100031240 | 3300026118 | Bacteria | 4960 |
| 550 | Ga0207683_10001248 | 3300026121 | Bacteria | 23074 |
| 551 | Ga0207683_10074800 | 3300026121 | Bacteria | 2998 |
| 552 | Ga0207683_10101930 | 3300026121 | Bacteria | 2563 |
| 553 | Ga0207698_10003249 | 3300026142 | Bacteria | 9765 |
| 554 | Ga0207698_10075369 | 3300026142 | Bacteria | 2696 |
| 555 | Ga0207428_10037266 | 3300027907 | Bacteria | 3957 |
| 556 | Ga0268266_10000022 | 3300028379 | Bacteria | 508060 |
| 557 | Ga0268266_10021289 | 3300028379 | Bacteria | 5524 |
| 558 | Ga0268266_10033089 | 3300028379 | Bacteria | 4396 |
| 559 | Ga0268265_10004802 | 3300028380 | Bacteria | 9318 |
| 560 | Ga0268265_10005023 | 3300028380 | Bacteria | 9078 |
| 561 | Ga0268264_10000082 | 3300028381 | Bacteria | 246913 |
| 562 | Ga0268264_10004566 | 3300028381 | Bacteria | 11791 |
| 563 | Ga0268264_10004767 | 3300028381 | Bacteria | 11512 |
| 564 | Ga0268264_10005045 | 3300028381 | Bacteria | 11175 |
| 565 | Ga0268264_10005982 | 3300028381 | Bacteria | 10303 |
| 566 | Ga0268264_10008916 | 3300028381 | Bacteria | 8321 |
| 567 | Ga0268264_10009473 | 3300028381 | Bacteria | 8065 |
| 568 | Ga0268264_10075400 | 3300028381 | Bacteria | 2868 |
| 569 | Ga0265326_10006563 | 3300028558 | Bacteria | 3604 |
| 570 | Ga0265334_10006112 | 3300028573 | Bacteria | 5218 |
| 571 | Ga0265318_10001041 | 3300028577 | Bacteria | 17593 |
| 572 | Ga0265318_10007156 | 3300028577 | Bacteria | 5072 |
| 573 | Ga0307517_10075895 | 3300028786 | Bacteria | 2942 |
| 574 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 575 | Ga0307515_10000021 | 3300028794 | Bacteria | 406008 |
| 576 | Ga0265338_10000053 | 3300028800 | Bacteria | 208184 |
| 577 | Ga0265338_10000442 | 3300028800 | Bacteria | 74078 |
| 578 | Ga0265338_10027407 | 3300028800 | Bacteria | 5717 |
| 579 | Ga0265324_10013370 | 3300029957 | Bacteria | 3065 |
| 580 | Ga0307511_10000027 | 3300030521 | Bacteria | 109500 |
| 581 | Ga0265332_10040388 | 3300031238 | Bacteria | 2020 |
| 582 | Ga0265320_10000776 | 3300031240 | Bacteria | 24440 |
| 583 | Ga0265320_10003809 | 3300031240 | Bacteria | 10011 |
| 584 | Ga0265320_10028679 | 3300031240 | Bacteria | 2887 |
| 585 | Ga0265339_10008119 | 3300031249 | Bacteria | 6704 |
| 586 | Ga0265331_10018911 | 3300031250 | Bacteria | 3562 |
| 587 | Ga0265331_10020100 | 3300031250 | Bacteria | 3434 |
| 588 | Ga0265327_10000059 | 3300031251 | Bacteria | 236935 |
| 589 | Ga0265327_10000098 | 3300031251 | Bacteria | 190693 |
| 590 | Ga0265327_10000142 | 3300031251 | Bacteria | 157436 |
| 591 | Ga0265327_10000338 | 3300031251 | Bacteria | 88898 |
| 592 | Ga0265327_10002348 | 3300031251 | Bacteria | 20176 |
| 593 | Ga0265327_10006052 | 3300031251 | Bacteria | 9815 |
| 594 | Ga0265327_10012078 | 3300031251 | Bacteria | 5865 |
| 595 | Ga0265327_10031964 | 3300031251 | Bacteria | 2952 |
| 596 | Ga0307509_10042858 | 3300031507 | Bacteria | 4900 |
| 597 | Ga0307509_10120494 | 3300031507 | Bacteria | 2602 |
| 598 | Ga0307408_100000017 | 3300031548 | Bacteria | 355890 |
| 599 | Ga0265313_10003199 | 3300031595 | Bacteria | 13483 |
| 600 | Ga0265313_10009844 | 3300031595 | Bacteria | 6151 |
| 601 | Ga0265313_10020490 | 3300031595 | Bacteria | 3646 |
| 602 | Ga0307508_10000157 | 3300031616 | Bacteria | 81275 |
| 603 | Ga0307508_10003578 | 3300031616 | Bacteria | 15652 |
| 604 | Ga0307508_10042451 | 3300031616 | Bacteria | 4080 |
| 605 | Ga0265314_10000517 | 3300031711 | Bacteria | 49904 |
| 606 | Ga0265314_10002697 | 3300031711 | Bacteria | 17782 |
| 607 | Ga0265314_10005415 | 3300031711 | Bacteria | 11533 |
| 608 | Ga0265314_10007159 | 3300031711 | Bacteria | 9715 |
| 609 | Ga0316578_10028658 | 3300031728 | Bacteria | 3155 |
| 610 | Ga0307516_10001138 | 3300031730 | Bacteria | 37091 |
| 611 | Ga0307516_10033453 | 3300031730 | Bacteria | 5172 |
| 612 | Ga0307410_10000060 | 3300031852 | Bacteria | 38643 |
| 613 | Ga0307412_10007777 | 3300031911 | Bacteria | 6098 |
| 614 | Ga0307409_100000021 | 3300031995 | Bacteria | 54572 |
| 615 | Ga0307409_100118982 | 3300031995 | Bacteria | 2233 |
| 616 | Ga0307414_10018010 | 3300032004 | Bacteria | 4336 |
| 617 | Ga0307414_10043941 | 3300032004 | Bacteria | 3047 |
| 618 | Ga0307415_100103944 | 3300032126 | Bacteria | 2091 |
| 619 | Ga0316585_10004580 | 3300032137 | Bacteria | 3859 |
| 620 | Ga0307510_10029575 | 3300033180 | Bacteria | 6232 |
| 621 | Ga0373956_0017169 | 3300035119 | Bacteria | 3049 |
| 622 | Ga0373937_0003368 | 3300036401 | Bacteria | 13412 |
| 623 | Ga0373937_0130081 | 3300036401 | Bacteria | 2351 |
| 624 | Ga0316584_0130916 | 3300036712 | Bacteria | 1874 |
| 625 | Ga0395899_0003604 | 3300037312 | Bacteria | 12245 |
| 626 | Ga0395899_0007612 | 3300037312 | Bacteria | 8353 |
| 627 | Ga0395900_0064447 | 3300037418 | Bacteria | 3765 |
| 628 | Ga0395900_0095736 | 3300037418 | Bacteria | 3050 |
| 629 | Ga0395898_0003818 | 3300037466 | Bacteria | 16686 |
| 630 | Ga0395905_0003378 | 3300037471 | Bacteria | 17099 |
| 631 | Ga0395905_0043377 | 3300037471 | Bacteria | 4220 |
| 632 | Ga0395905_0064357 | 3300037471 | Bacteria | 3431 |
| 633 | Ga0395901_0006287 | 3300038443 | Bacteria | 12032 |
| 634 | Ga0395901_0015165 | 3300038443 | Bacteria | 7837 |
| 635 | Ga0395901_0064480 | 3300038443 | Bacteria | 3814 |
| 636 | Ga0400489_60531 | 3300039093 | Bacteria | 11725 |
| 637 | Ga0436365_0561939 | 3300039437 | Bacteria | 12472 |
| 638 | Ga0436362_0034638 | 3300039453 | Bacteria | 6719 |
| 639 | Ga0439465_0026797 | 3300041413 | Bacteria | 1824 |
| 640 | Ga0439431_0002168 | 3300041997 | Bacteria | 4325 |
| 641 | Ga0439445_0008793 | 3300042004 | Bacteria | 2370 |
| 642 | Ga0439449_0013031 | 3300042007 | Bacteria | 3127 |
| 643 | Ga0451577_0000066 | 3300042876 | Bacteria | 257650 |
| 644 | Ga0451577_0000715 | 3300042876 | Bacteria | 51599 |
| 645 | Ga0451577_0001301 | 3300042876 | Bacteria | 34324 |
| 646 | Ga0451577_0008541 | 3300042876 | Bacteria | 9963 |
| 647 | Ga0451577_0150905 | 3300042876 | Bacteria | 2091 |
| 648 | Ga0466969_0004160 | 3300044656 | Bacteria | 7683 |
| 649 | Ga0466969_0043480 | 3300044656 | Bacteria | 2239 |
| 650 | Ga0466972_0000067 | 3300044658 | Bacteria | 102835 |
| 651 | Ga0466972_0000471 | 3300044658 | Bacteria | 20416 |
| 652 | Ga0453683_0000010 | 3300044673 | Bacteria | 470890 |
| 653 | Ga0453683_0000174 | 3300044673 | Bacteria | 89378 |
| 654 | Ga0453683_0000658 | 3300044673 | Bacteria | 36964 |
| 655 | Ga0453683_0109688 | 3300044673 | Unclassified | 1735 |
| 656 | Ga0466961_0021360 | 3300044693 | Bacteria | 4167 |
| 657 | Ga0453684_0000167 | 3300044712 | Bacteria | 290200 |
| 658 | Ga0453684_0000199 | 3300044712 | Bacteria | 264155 |
| 659 | Ga0453684_0000206 | 3300044712 | Bacteria | 257650 |
| 660 | Ga0453684_0000527 | 3300044712 | Bacteria | 146072 |
| 661 | Ga0453684_0002293 | 3300044712 | Bacteria | 47018 |
| 662 | Ga0453684_0005060 | 3300044712 | Bacteria | 26712 |
| 663 | Ga0453684_0008138 | 3300044712 | Bacteria | 18929 |
| 664 | Ga0453684_0033409 | 3300044712 | Bacteria | 7175 |
| 665 | Ga0453684_0061508 | 3300044712 | Bacteria | 4820 |
| 666 | Ga0453684_0065790 | 3300044712 | Bacteria | 4621 |
| 667 | Ga0453684_0068355 | 3300044712 | Bacteria | 4512 |
| 668 | Ga0453684_0069808 | 3300044712 | Bacteria | 4454 |
| 669 | Ga0453684_0073927 | 3300044712 | Bacteria | 4295 |
| 670 | Ga0453684_0155404 | 3300044712 | Bacteria | 2713 |
| 671 | Ga0466968_0026127 | 3300044735 | Bacteria | 2395 |
| 672 | Ga0466970_0001874 | 3300044765 | Bacteria | 10173 |
| 673 | Ga0466957_0005323 | 3300044842 | Bacteria | 7218 |
| 674 | Ga0466957_0064342 | 3300044842 | Bacteria | 2256 |
| 675 | Ga0466960_0034600 | 3300044901 | Bacteria | 2356 |
| 676 | Ga0466959_0000004 | 3300045049 | Bacteria | 216815 |
| 677 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 678 | Ga0451576_0000072 | 3300045051 | Bacteria | 257650 |
| 679 | Ga0451576_0000211 | 3300045051 | Bacteria | 146199 |
| 680 | Ga0451576_0002546 | 3300045051 | Bacteria | 26948 |
| 681 | Ga0451576_0007445 | 3300045051 | Bacteria | 13081 |
| 682 | Ga0451576_0008410 | 3300045051 | Bacteria | 12113 |
| 683 | Ga0451576_0034805 | 3300045051 | Bacteria | 5348 |
| 684 | Ga0451576_0227615 | 3300045051 | Bacteria | 1947 |
| 685 | Ga0466967_0002472 | 3300045976 | Bacteria | 11524 |
| 686 | Ga0495638_0016791 | 3300046460 | Bacteria | 4896 |
| 687 | Ga0495638_0054016 | 3300046460 | Bacteria | 2499 |
| 688 | Ga0495651_0013727 | 3300046462 | Bacteria | 6263 |
| 689 | Ga0495650_0006702 | 3300046471 | Bacteria | 7132 |
| 690 | Ga0495606_0004080 | 3300046507 | Bacteria | 14847 |
| 691 | Ga0495608_0035325 | 3300046511 | Bacteria | 3372 |
| 692 | Ga0495630_0006610 | 3300046517 | Bacteria | 8262 |
| 693 | Ga0495648_0007376 | 3300046524 | Bacteria | 8810 |
| 694 | Ga0495640_0067516 | 3300046533 | Bacteria | 2408 |
| 695 | Ga0495586_0024780 | 3300046535 | Bacteria | 3209 |
| 696 | Ga0495633_0000025 | 3300046558 | Bacteria | 218627 |
| 697 | Ga0495668_0000106 | 3300046616 | Bacteria | 133476 |
| 698 | Ga0495668_0000450 | 3300046616 | Bacteria | 52543 |
| 699 | Ga0495668_0002015 | 3300046616 | Bacteria | 17737 |
| 700 | Ga0495668_0038502 | 3300046616 | Unclassified | 2671 |
| 701 | Ga0495634_0013547 | 3300046642 | Bacteria | 5889 |
| 702 | Ga0495611_0000941 | 3300046648 | Bacteria | 15637 |
| 703 | Ga0495611_0028384 | 3300046648 | Bacteria | 2450 |
| 704 | Ga0495661_0000134 | 3300046665 | Bacteria | 87487 |
| 705 | Ga0495661_0062610 | 3300046665 | Bacteria | 2203 |
| 706 | Ga0495636_0000053 | 3300047318 | Bacteria | 50598 |
| 707 | Ga0495674_0037712 | 3300047319 | Bacteria | 4342 |
| 708 | Ga0495672_0010771 | 3300047320 | Bacteria | 6490 |
| 709 | Ga0495672_0044167 | 3300047320 | Bacteria | 2675 |
| 710 | Ga0495672_0050373 | 3300047320 | Bacteria | 2458 |
| 711 | Ga0495680_0056007 | 3300047322 | Bacteria | 3055 |
| 712 | Ga0495687_000179 | 3300047443 | Bacteria | 92387 |
| 713 | Ga0495684_0052003 | 3300047471 | Unclassified | 3126 |
| 714 | Ga0495686_0000010 | 3300047472 | Bacteria | 573229 |
| 715 | Ga0495686_0000234 | 3300047472 | Bacteria | 101539 |
| 716 | Ga0496110_0082616 | 3300048913 | Bacteria | 2865 |
| 717 | Ga0496114_0007992 | 3300048917 | Bacteria | 8368 |
| 718 | Ga0496115_0003173 | 3300048918 | Bacteria | 11811 |
| 719 | Ga0496121_0000008 | 3300048924 | Bacteria | 843593 |
| 720 | Ga0501298_001052 | 3300049521 | Bacteria | 3963 |
| 721 | Ga0501300_004061 | 3300049523 | Bacteria | 2176 |
| 722 | Ga0501031_0002615 | 3300049568 | Bacteria | 11464 |
| 723 | Ga0501031_0018278 | 3300049568 | Bacteria | 4562 |
| 724 | Ga0501031_0024214 | 3300049568 | Bacteria | 3957 |
| 725 | Ga0501032_0000217 | 3300049569 | Bacteria | 47829 |
| 726 | Ga0501032_0001195 | 3300049569 | Bacteria | 20751 |
| 727 | Ga0501032_0003483 | 3300049569 | Bacteria | 12039 |
| 728 | Ga0501033_0032084 | 3300049570 | Bacteria | 3943 |
| 729 | Ga0501033_0041909 | 3300049570 | Bacteria | 3414 |
| 730 | Ga0501033_0041960 | 3300049570 | Bacteria | 3412 |
| 731 | Ga0501034_0000002 | 3300049571 | Bacteria | 565510 |
| 732 | Ga0501034_0012357 | 3300049571 | Bacteria | 8821 |
| 733 | Ga0501034_0014290 | 3300049571 | Bacteria | 8182 |
| 734 | Ga0501034_0025757 | 3300049571 | Bacteria | 5990 |
| 735 | Ga0501034_0043401 | 3300049571 | Bacteria | 4551 |
| 736 | Ga0501034_0057476 | 3300049571 | Bacteria | 3911 |
| 737 | Ga0501034_0099040 | 3300049571 | Bacteria | 2910 |
| 738 | Ga0501036_0005480 | 3300049572 | Bacteria | 10289 |
| 739 | Ga0501036_0030967 | 3300049572 | Bacteria | 4520 |
| 740 | Ga0501037_0002354 | 3300049573 | Bacteria | 13658 |
| 741 | Ga0501037_0012007 | 3300049573 | Bacteria | 6381 |
| 742 | Ga0501037_0012433 | 3300049573 | Bacteria | 6270 |
| 743 | Ga0501037_0021086 | 3300049573 | Bacteria | 4814 |
| 744 | Ga0501037_0032373 | 3300049573 | Bacteria | 3861 |
| 745 | Ga0501038_0007129 | 3300049574 | Bacteria | 10328 |
| 746 | Ga0501038_0007354 | 3300049574 | Bacteria | 10160 |
| 747 | Ga0501038_0009728 | 3300049574 | Bacteria | 8814 |
| 748 | Ga0501038_0125845 | 3300049574 | Bacteria | 2109 |
| 749 | Ga0501039_0023211 | 3300049575 | Bacteria | 4760 |
| 750 | Ga0501039_0043183 | 3300049575 | Bacteria | 3483 |
| 751 | Ga0501040_0025376 | 3300049576 | Bacteria | 3984 |
| 752 | Ga0501041_0000594 | 3300049577 | Bacteria | 18940 |
| 753 | Ga0501041_0005816 | 3300049577 | Bacteria | 7211 |
| 754 | Ga0501041_0015782 | 3300049577 | Bacteria | 4487 |
| 755 | Ga0501042_0000558 | 3300049578 | Bacteria | 19687 |
| 756 | Ga0501042_0001734 | 3300049578 | Bacteria | 13044 |
| 757 | Ga0501043_0004768 | 3300049579 | Bacteria | 10991 |
| 758 | Ga0501043_0019201 | 3300049579 | Bacteria | 5366 |
| 759 | Ga0501043_0022871 | 3300049579 | Bacteria | 4901 |
| 760 | Ga0501043_0088472 | 3300049579 | Bacteria | 2434 |
| 761 | Ga0501046_0003832 | 3300049580 | Bacteria | 13761 |
| 762 | Ga0501046_0046776 | 3300049580 | Bacteria | 3432 |
| 763 | Ga0501046_0096338 | 3300049580 | Bacteria | 2273 |
| 764 | Ga0501046_0121450 | 3300049580 | Bacteria | 1987 |
| 765 | Ga0501047_0005502 | 3300049581 | Bacteria | 11919 |
| 766 | Ga0501047_0016087 | 3300049581 | Bacteria | 7135 |
| 767 | Ga0501047_0017253 | 3300049581 | Bacteria | 6912 |
| 768 | Ga0501047_0043705 | 3300049581 | Bacteria | 4328 |
| 769 | Ga0501047_0071769 | 3300049581 | Bacteria | 3333 |
| 770 | Ga0501047_0128522 | 3300049581 | Bacteria | 2414 |
| 771 | Ga0501047_0131699 | 3300049581 | Bacteria | 2381 |
| 772 | Ga0501048_0001510 | 3300049582 | Bacteria | 17615 |
| 773 | Ga0501048_0024656 | 3300049582 | Bacteria | 4389 |
| 774 | Ga0501068_0007261 | 3300049584 | Bacteria | 6137 |
| 775 | Ga0501068_0016073 | 3300049584 | Bacteria | 4311 |
| 776 | Ga0501068_0134101 | 3300049584 | Bacteria | 1550 |
| 777 | Ga0501069_0002839 | 3300049585 | Bacteria | 8866 |
| 778 | Ga0501069_0044659 | 3300049585 | Bacteria | 2453 |
| 779 | Ga0501069_0045631 | 3300049585 | Bacteria | 2428 |
| 780 | Ga0501071_0002824 | 3300049587 | Bacteria | 10696 |
| 781 | Ga0501072_0007190 | 3300049588 | Bacteria | 8446 |
| 782 | Ga0501073_0014754 | 3300049589 | Bacteria | 5674 |
| 783 | Ga0501073_0038951 | 3300049589 | Bacteria | 3370 |
| 784 | Ga0501073_0105094 | 3300049589 | Bacteria | 1959 |
| 785 | Ga0501074_0006351 | 3300049590 | Bacteria | 8536 |
| 786 | Ga0501074_0007078 | 3300049590 | Bacteria | 8105 |
| 787 | Ga0501075_0006319 | 3300049591 | Bacteria | 8139 |
| 788 | Ga0501075_0085837 | 3300049591 | Bacteria | 2384 |
| 789 | Ga0501076_0004849 | 3300049592 | Bacteria | 9606 |
| 790 | Ga0501077_0001830 | 3300049593 | Bacteria | 12862 |
| 791 | Ga0501077_0005539 | 3300049593 | Bacteria | 7684 |
| 792 | Ga0501217_002332 | 3300049661 | Bacteria | 3723 |
| 793 | Ga0501223_002818 | 3300049663 | Bacteria | 3812 |
| 794 | Ga0501224_000940 | 3300049664 | Bacteria | 3755 |
| 795 | Ga0501235_002213 | 3300049669 | Bacteria | 4182 |
| 796 | Ga0501242_000064 | 3300049674 | Bacteria | 6749 |
| 797 | Ga0501243_002883 | 3300049675 | Bacteria | 2532 |
| 798 | Ga0501257_006948 | 3300049686 | Bacteria | 2521 |
| 799 | Ga0501259_001123 | 3300049688 | Bacteria | 4465 |
| 800 | Ga0501219_000112 | 3300049703 | Bacteria | 14228 |
| 801 | Ga0501221_001922 | 3300049704 | Bacteria | 3467 |
| 802 | Ga0501225_0002455 | 3300049705 | Bacteria | 5733 |
| 803 | Ga0501225_0005485 | 3300049705 | Bacteria | 3721 |
| 804 | Ga0501245_000056 | 3300049708 | Bacteria | 10539 |
| 805 | Ga0501079_0004520 | 3300049741 | Bacteria | 10317 |
| 806 | Ga0501079_0027471 | 3300049741 | Bacteria | 4363 |
| 807 | Ga0501080_0006199 | 3300049742 | Bacteria | 10734 |
| 808 | Ga0501080_0017939 | 3300049742 | Bacteria | 6550 |
| 809 | Ga0501080_0034263 | 3300049742 | Bacteria | 4739 |
| 810 | Ga0501080_0068159 | 3300049742 | Bacteria | 3310 |
| 811 | Ga0501080_0076898 | 3300049742 | Bacteria | 3104 |
| 812 | Ga0501081_0001351 | 3300049743 | Bacteria | 14971 |
| 813 | Ga0501083_0011750 | 3300049744 | Bacteria | 6138 |
| 814 | Ga0501083_0016781 | 3300049744 | Bacteria | 5114 |
| 815 | Ga0501083_0030105 | 3300049744 | Bacteria | 3730 |
| 816 | Ga0501083_0043366 | 3300049744 | Bacteria | 3048 |
| 817 | Ga0501241_003638 | 3300049758 | Bacteria | 2908 |
| 818 | Ga0501282_002657 | 3300049778 | Bacteria | 1938 |
| 819 | Ga0501035_0003562 | 3300049822 | Bacteria | 14872 |
| 820 | Ga0501035_0011451 | 3300049822 | Bacteria | 8223 |
| 821 | Ga0501035_0026868 | 3300049822 | Bacteria | 5264 |
| 822 | Ga0501035_0058755 | 3300049822 | Bacteria | 3426 |
| 823 | Ga0501035_0073639 | 3300049822 | Bacteria | 3022 |
| 824 | Ga0501035_0082404 | 3300049822 | Bacteria | 2839 |
| 825 | Ga0501035_0099067 | 3300049822 | Bacteria | 2559 |
| 826 | Ga0501035_0102051 | 3300049822 | Bacteria | 2517 |
| 827 | Ga0501044_0000299 | 3300049823 | Bacteria | 62791 |
| 828 | Ga0501044_0000920 | 3300049823 | Bacteria | 35464 |
| 829 | Ga0501044_0002188 | 3300049823 | Bacteria | 22426 |
| 830 | Ga0501044_0012419 | 3300049823 | Bacteria | 9222 |
| 831 | Ga0501044_0028417 | 3300049823 | Bacteria | 5903 |
| 832 | Ga0501044_0036018 | 3300049823 | Bacteria | 5178 |
| 833 | Ga0501044_0083841 | 3300049823 | Bacteria | 3222 |
| 834 | Ga0501044_0087540 | 3300049823 | Bacteria | 3146 |
| 835 | Ga0501044_0108763 | 3300049823 | Bacteria | 2782 |
| 836 | Ga0501045_0010793 | 3300049824 | Bacteria | 6402 |
| 837 | Ga0501045_0016750 | 3300049824 | Bacteria | 5206 |
| 838 | Ga0501284_00086 | 3300050005 | Bacteria | 22701 |
| 839 | nmdc:mga05p37_46504_c1 | 3300050507 | Bacteria | 5336 |
| 840 | nmdc:mga09592_31590_c1 | 3300050508 | Bacteria | 4413 |
| 841 | nmdc:mga0qj67_11847_c1 | 3300050509 | Bacteria | 6546 |
| 842 | nmdc:mga06r32_33770_c1 | 3300050510 | Bacteria | 4820 |
| 843 | nmdc:mga08y16_47954_c1 | 3300050511 | Bacteria | 4471 |
| 844 | nmdc:mga08y16_5833_c1 | 3300050511 | Bacteria | 12904 |
| 845 | nmdc:mga0n895_20_c1 | 3300050512 | Bacteria | 94193 |
| 846 | nmdc:mga0rr50_304_c1 | 3300050513 | Bacteria | 26740 |
| 847 | nmdc:mga08x19_64455_c1 | 3300050514 | Bacteria | 2379 |
| 848 | nmdc:mga0a205_626_c1 | 3300050515 | Bacteria | 28071 |
| 849 | Ga0500578_0000010 | 3300053086 | Bacteria | 217642 |
| 850 | Ga0500578_0018344 | 3300053086 | Bacteria | 4497 |
| 851 | Ga0500644_0000039 | 3300053088 | Bacteria | 78834 |
| 852 | Ga0500583_0000064 | 3300053092 | Bacteria | 66001 |
| 853 | Ga0500583_0000683 | 3300053092 | Bacteria | 9939 |
| 854 | Ga0500562_000005 | 3300053108 | Bacteria | 266746 |
| 855 | Ga0500607_036339 | 3300053121 | Bacteria | 2690 |
| 856 | Ga0500642_0002743 | 3300053130 | Bacteria | 5215 |
| 857 | Ga0500658_0000972 | 3300053134 | Bacteria | 11681 |
| 858 | Ga0500568_0002456 | 3300053139 | Bacteria | 10896 |
| 859 | Ga0500577_0001411 | 3300053142 | Bacteria | 6157 |
| 860 | Ga0500590_012391 | 3300053148 | Bacteria | 4347 |
| 861 | Ga0500616_0000626 | 3300053153 | Bacteria | 42914 |
| 862 | Ga0500622_0000151 | 3300053156 | Bacteria | 73392 |
| 863 | Ga0500622_0009287 | 3300053156 | Bacteria | 5451 |
| 864 | Ga0500622_0009662 | 3300053156 | Bacteria | 5331 |
| 865 | Ga0500627_0018755 | 3300053158 | Bacteria | 2744 |
| 866 | Ga0500611_000039 | 3300053727 | Bacteria | 68825 |
| 867 | Ga0501084_0040020 | 3300054114 | Bacteria | 3920 |
| 868 | Ga0501084_0044804 | 3300054114 | Bacteria | 3703 |
| 869 | Ga0500661_008248 | 3300055283 | Bacteria | 1915 |
| 870 | Ga0501082_0004014 | 3300060353 | Bacteria | 12843 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026089 | Ga0207648_10179063 | Ga0207648_101790632 | 440 |
| 2 | 3300049584 | Ga0501068_0134101 | Ga0501068_0134101_32_1450 | 442 |
| 3 | 3300049589 | Ga0501073_0105094 | Ga0501073_0105094_561_1946 | 446 |
| 4 | 3300049778 | Ga0501282_002657 | Ga0501282_002657_424_1908 | 451 |
| 5 | 3300049572 | Ga0501036_0030967 | Ga0501036_0030967_3078_4481 | 453 |
| 6 | 3300009545 | Ga0105237_10148535 | Ga0105237_101485351 | 460 |
| 7 | 3300013306 | Ga0163162_10000244 | Ga0163162_1000024431 | 463 |
| 8 | 3300044901 | Ga0466960_0034600 | Ga0466960_0034600_839_2332 | 463 |
| 9 | 3300025932 | Ga0207690_10040708 | Ga0207690_100407083 | 467 |
| 10 | 3300014325 | Ga0163163_10255936 | Ga0163163_102559362 | 476 |
| 11 | 3300054114 | Ga0501084_0040020 | Ga0501084_0040020_12_1589 | 476 |
| 12 | 3300009174 | Ga0105241_10003231 | Ga0105241_100032318 | 479 |
| 13 | 3300009545 | Ga0105237_10014983 | Ga0105237_100149832 | 479 |
| 14 | 3300049822 | Ga0501035_0073639 | Ga0501035_0073639_1408_3003 | 488 |
| 15 | 3300025913 | Ga0207695_10000001 | Ga0207695_1000000128 | 494 |
| 16 | 3300005459 | Ga0068867_100157477 | Ga0068867_1001574771 | 495 |
| 17 | 3300046460 | Ga0495638_0054016 | Ga0495638_0054016_647_2359 | 495 |
| 18 | 3300046665 | Ga0495661_0062610 | Ga0495661_0062610_310_1959 | 499 |
| 19 | 3300046665 | Ga0495661_0000134 | Ga0495661_0000134_15603_17252 | 500 |
| 20 | 3300049568 | Ga0501031_0018278 | Ga0501031_0018278_999_2657 | 501 |
| 21 | 3300049574 | Ga0501038_0009728 | Ga0501038_0009728_2515_4173 | 501 |
| 22 | 3300049575 | Ga0501039_0023211 | Ga0501039_0023211_441_2099 | 501 |
| 23 | 3300049576 | Ga0501040_0025376 | Ga0501040_0025376_620_2278 | 501 |
| 24 | 3300049577 | Ga0501041_0015782 | Ga0501041_0015782_2153_3811 | 501 |
| 25 | 3300049578 | Ga0501042_0000558 | Ga0501042_0000558_620_2278 | 501 |
| 26 | 3300049582 | Ga0501048_0024656 | Ga0501048_0024656_2061_3719 | 501 |
| 27 | 3300049587 | Ga0501071_0002824 | Ga0501071_0002824_982_2640 | 501 |
| 28 | 3300049588 | Ga0501072_0007190 | Ga0501072_0007190_5726_7384 | 501 |
| 29 | 3300049590 | Ga0501074_0006351 | Ga0501074_0006351_3758_5416 | 501 |
| 30 | 3300049591 | Ga0501075_0006319 | Ga0501075_0006319_5723_7381 | 501 |
| 31 | 3300049592 | Ga0501076_0004849 | Ga0501076_0004849_746_2404 | 501 |
| 32 | 3300049675 | Ga0501243_002883 | Ga0501243_002883_789_2489 | 501 |
| 33 | 3300049741 | Ga0501079_0004520 | Ga0501079_0004520_8124_9782 | 501 |
| 34 | 3300049742 | Ga0501080_0006199 | Ga0501080_0006199_5740_7398 | 501 |
| 35 | 3300049743 | Ga0501081_0001351 | Ga0501081_0001351_5699_7357 | 501 |
| 36 | 3300049824 | Ga0501045_0010793 | Ga0501045_0010793_1130_2788 | 501 |
| 37 | 3300060353 | Ga0501082_0004014 | Ga0501082_0004014_8376_10034 | 501 |
| 38 | 3300006881 | Ga0068865_100000491 | Ga0068865_10000049110 | 502 |
| 39 | 3300025938 | Ga0207704_10002375 | Ga0207704_100023753 | 502 |
| 40 | 3300025942 | Ga0207689_10000210 | Ga0207689_100002104 | 502 |
| 41 | 3300026089 | Ga0207648_10003360 | Ga0207648_100033609 | 502 |
| 42 | 3300036712 | Ga0316584_0130916 | Ga0316584_0130916_30_1625 | 502 |
| 43 | 3300046462 | Ga0495651_0013727 | Ga0495651_0013727_3420_5060 | 503 |
| 44 | 3300049568 | Ga0501031_0024214 | Ga0501031_0024214_1448_3070 | 504 |
| 45 | 3300049570 | Ga0501033_0032084 | Ga0501033_0032084_968_2590 | 504 |
| 46 | 3300049571 | Ga0501034_0025757 | Ga0501034_0025757_1812_3434 | 504 |
| 47 | 3300049573 | Ga0501037_0012433 | Ga0501037_0012433_3912_5534 | 504 |
| 48 | 3300049574 | Ga0501038_0125845 | Ga0501038_0125845_322_1944 | 504 |
| 49 | 3300049577 | Ga0501041_0000594 | Ga0501041_0000594_12695_14317 | 504 |
| 50 | 3300049577 | Ga0501041_0005816 | Ga0501041_0005816_4834_6456 | 504 |
| 51 | 3300049579 | Ga0501043_0004768 | Ga0501043_0004768_4168_5790 | 504 |
| 52 | 3300049579 | Ga0501043_0022871 | Ga0501043_0022871_35_1657 | 504 |
| 53 | 3300049580 | Ga0501046_0046776 | Ga0501046_0046776_319_1941 | 504 |
| 54 | 3300049581 | Ga0501047_0071769 | Ga0501047_0071769_273_1895 | 504 |
| 55 | 3300049584 | Ga0501068_0007261 | Ga0501068_0007261_4291_5913 | 504 |
| 56 | 3300049584 | Ga0501068_0016073 | Ga0501068_0016073_1198_2820 | 504 |
| 57 | 3300049585 | Ga0501069_0002839 | Ga0501069_0002839_3896_5518 | 504 |
| 58 | 3300049585 | Ga0501069_0044659 | Ga0501069_0044659_782_2404 | 504 |
| 59 | 3300049589 | Ga0501073_0038951 | Ga0501073_0038951_1062_2684 | 504 |
| 60 | 3300049590 | Ga0501074_0007078 | Ga0501074_0007078_3007_4629 | 504 |
| 61 | 3300049591 | Ga0501075_0085837 | Ga0501075_0085837_301_1923 | 504 |
| 62 | 3300049593 | Ga0501077_0001830 | Ga0501077_0001830_5547_7169 | 504 |
| 63 | 3300049593 | Ga0501077_0005539 | Ga0501077_0005539_1872_3494 | 504 |
| 64 | 3300049741 | Ga0501079_0027471 | Ga0501079_0027471_2551_4173 | 504 |
| 65 | 3300049742 | Ga0501080_0017939 | Ga0501080_0017939_1262_2884 | 504 |
| 66 | 3300049744 | Ga0501083_0030105 | Ga0501083_0030105_937_2559 | 504 |
| 67 | 3300049823 | Ga0501044_0087540 | Ga0501044_0087540_1358_2980 | 504 |
| 68 | 3300049824 | Ga0501045_0016750 | Ga0501045_0016750_1827_3449 | 504 |
| 69 | 3300006852 | Ga0075433_10006563 | Ga0075433_100065639 | 512 |
| 70 | 3300006871 | Ga0075434_100001986 | Ga0075434_10000198616 | 512 |
| 71 | 3300007076 | Ga0075435_100000289 | Ga0075435_10000028931 | 512 |
| 72 | 3300050512 | nmdc:mga0n895_20_c1 | nmdc:mga0n895_20_c1_31653_33428 | 512 |
| 73 | 3300050513 | nmdc:mga0rr50_304_c1 | nmdc:mga0rr50_304_c1_12057_13832 | 512 |
| 74 | 3300050515 | nmdc:mga0a205_626_c1 | nmdc:mga0a205_626_c1_14976_16751 | 512 |
| 75 | 3300044712 | Ga0453684_0008138 | Ga0453684_0008138_5195_6850 | 513 |
| 76 | 3300044712 | Ga0453684_0065790 | Ga0453684_0065790_934_2589 | 513 |
| 77 | 3300049581 | Ga0501047_0128522 | Ga0501047_0128522_230_1960 | 513 |
| 78 | 3300049823 | Ga0501044_0108763 | Ga0501044_0108763_815_2545 | 513 |
| 79 | 3300013296 | Ga0157374_10008233 | Ga0157374_100082332 | 514 |
| 80 | 3300025246 | Ga0209646_1001757 | Ga0209646_10017575 | 514 |
| 81 | 3300042876 | Ga0451577_0008541 | Ga0451577_0008541_1823_3466 | 514 |
| 82 | 3300044658 | Ga0466972_0000471 | Ga0466972_0000471_8543_10258 | 514 |
| 83 | 3300044712 | Ga0453684_0000199 | Ga0453684_0000199_164596_166239 | 514 |
| 84 | 3300049823 | Ga0501044_0002188 | Ga0501044_0002188_4704_6371 | 514 |
| 85 | 3300053086 | Ga0500578_0018344 | Ga0500578_0018344_1302_3017 | 514 |
| 86 | 3300005563 | Ga0068855_100016778 | Ga0068855_1000167786 | 515 |
| 87 | 3300009093 | Ga0105240_10000001 | Ga0105240_1000000128 | 515 |
| 88 | 3300009174 | Ga0105241_10038676 | Ga0105241_100386764 | 515 |
| 89 | 3300009545 | Ga0105237_10047857 | Ga0105237_100478572 | 515 |
| 90 | 3300025949 | Ga0207667_10005458 | Ga0207667_1000545810 | 515 |
| 91 | 3300026041 | Ga0207639_10137223 | Ga0207639_101372232 | 515 |
| 92 | 3300028558 | Ga0265326_10006563 | Ga0265326_100065632 | 515 |
| 93 | 3300029957 | Ga0265324_10013370 | Ga0265324_100133702 | 515 |
| 94 | 3300031711 | Ga0265314_10000517 | Ga0265314_1000051718 | 515 |
| 95 | 3300044656 | Ga0466969_0004160 | Ga0466969_0004160_450_2168 | 515 |
| 96 | 3300044842 | Ga0466957_0005323 | Ga0466957_0005323_1485_3206 | 515 |
| 97 | 3300044842 | Ga0466957_0064342 | Ga0466957_0064342_30_1745 | 515 |
| 98 | 3300045049 | Ga0466959_0000004 | Ga0466959_0000004_23019_24737 | 515 |
| 99 | 3300049581 | Ga0501047_0016087 | Ga0501047_0016087_1520_3235 | 515 |
| 100 | 3300049581 | Ga0501047_0043705 | Ga0501047_0043705_1769_3484 | 515 |
| 101 | 3300049822 | Ga0501035_0102051 | Ga0501035_0102051_658_2373 | 515 |
| 102 | 3300049823 | Ga0501044_0012419 | Ga0501044_0012419_380_2095 | 515 |
| 103 | 3300053086 | Ga0500578_0000010 | Ga0500578_0000010_156111_157826 | 515 |
| 104 | 3300053092 | Ga0500583_0000064 | Ga0500583_0000064_19236_20951 | 515 |
| 105 | 3300053092 | Ga0500583_0000683 | Ga0500583_0000683_2131_3846 | 515 |
| 106 | iso_pu_bacteria | 2786546940 | 2788436694 | 515 |
| 107 | 3300003322 | rootL2_10189327 | rootL2_101893275 | 516 |
| 108 | 3300028577 | Ga0265318_10007156 | Ga0265318_100071563 | 516 |
| 109 | 3300031240 | Ga0265320_10003809 | Ga0265320_100038094 | 516 |
| 110 | 3300031548 | Ga0307408_100000017 | Ga0307408_100000017186 | 516 |
| 111 | 3300031852 | Ga0307410_10000060 | Ga0307410_1000006033 | 516 |
| 112 | 3300031911 | Ga0307412_10007777 | Ga0307412_100077775 | 516 |
| 113 | 3300031995 | Ga0307409_100000021 | Ga0307409_10000002131 | 516 |
| 114 | 3300042876 | Ga0451577_0001301 | Ga0451577_0001301_22808_24451 | 516 |
| 115 | 3300045051 | Ga0451576_0227615 | Ga0451576_0227615_143_1786 | 516 |
| 116 | 3300049573 | Ga0501037_0032373 | Ga0501037_0032373_493_2145 | 516 |
| 117 | 3300049581 | Ga0501047_0017253 | Ga0501047_0017253_2198_3850 | 516 |
| 118 | 3300049581 | Ga0501047_0131699 | Ga0501047_0131699_184_1818 | 516 |
| 119 | 3300049705 | Ga0501225_0002455 | Ga0501225_0002455_741_2456 | 516 |
| 120 | 3300049823 | Ga0501044_0028417 | Ga0501044_0028417_1299_2951 | 516 |
| 121 | 3300003323 | rootH1_10021532 | rootH1_1002153216 | 517 |
| 122 | 3300006195 | Ga0075366_10028353 | Ga0075366_100283531 | 517 |
| 123 | 3300009147 | Ga0114129_10018174 | Ga0114129_100181746 | 517 |
| 124 | 3300010375 | Ga0105239_10002212 | Ga0105239_1000221214 | 517 |
| 125 | 3300031251 | Ga0265327_10012078 | Ga0265327_100120782 | 517 |
| 126 | 3300042007 | Ga0439449_0013031 | Ga0439449_0013031_1170_2885 | 517 |
| 127 | 3300049742 | Ga0501080_0034263 | Ga0501080_0034263_2902_4536 | 517 |
| 128 | 3300050507 | nmdc:mga05p37_46504_c1 | nmdc:mga05p37_46504_c1_399_2117 | 517 |
| 129 | 3300003323 | rootH1_10097586 | rootH1_100975862 | 518 |
| 130 | 3300005327 | Ga0070658_10061489 | Ga0070658_100614891 | 518 |
| 131 | 3300005459 | Ga0068867_100005824 | Ga0068867_10000582410 | 518 |
| 132 | 3300005617 | Ga0068859_100039325 | Ga0068859_1000393252 | 518 |
| 133 | 3300006931 | Ga0097620_100039324 | Ga0097620_1000393242 | 518 |
| 134 | 3300025909 | Ga0207705_10097636 | Ga0207705_100976361 | 518 |
| 135 | 3300028800 | Ga0265338_10000053 | Ga0265338_1000005355 | 518 |
| 136 | 3300028800 | Ga0265338_10000442 | Ga0265338_1000044242 | 518 |
| 137 | 3300031249 | Ga0265339_10008119 | Ga0265339_100081192 | 518 |
| 138 | 3300045976 | Ga0466967_0002472 | Ga0466967_0002472_5509_7203 | 518 |
| 139 | 3300049568 | Ga0501031_0002615 | Ga0501031_0002615_4071_5723 | 518 |
| 140 | 3300049569 | Ga0501032_0001195 | Ga0501032_0001195_9915_11567 | 518 |
| 141 | 3300049571 | Ga0501034_0099040 | Ga0501034_0099040_1043_2695 | 518 |
| 142 | 3300049572 | Ga0501036_0005480 | Ga0501036_0005480_2316_3968 | 518 |
| 143 | 3300049573 | Ga0501037_0002354 | Ga0501037_0002354_4319_5971 | 518 |
| 144 | 3300049574 | Ga0501038_0007129 | Ga0501038_0007129_148_1800 | 518 |
| 145 | 3300049578 | Ga0501042_0001734 | Ga0501042_0001734_3039_4691 | 518 |
| 146 | 3300049580 | Ga0501046_0003832 | Ga0501046_0003832_4792_6444 | 518 |
| 147 | 3300049582 | Ga0501048_0001510 | Ga0501048_0001510_6307_7959 | 518 |
| 148 | 3300049742 | Ga0501080_0068159 | Ga0501080_0068159_82_1734 | 518 |
| 149 | 3300049742 | Ga0501080_0076898 | Ga0501080_0076898_338_1987 | 518 |
| 150 | 3300049744 | Ga0501083_0043366 | Ga0501083_0043366_754_2406 | 518 |
| 151 | 3300049822 | Ga0501035_0003562 | Ga0501035_0003562_7498_9150 | 518 |
| 152 | 3300049822 | Ga0501035_0058755 | Ga0501035_0058755_122_1771 | 518 |
| 153 | 3300003320 | rootH2_10034401 | rootH2_100344014 | 519 |
| 154 | 3300003323 | rootH1_10001200 | rootH1_100012005 | 519 |
| 155 | 3300005436 | Ga0070713_100044714 | Ga0070713_1000447141 | 519 |
| 156 | 3300005577 | Ga0068857_100058242 | Ga0068857_1000582422 | 519 |
| 157 | 3300005614 | Ga0068856_100001817 | Ga0068856_1000018176 | 519 |
| 158 | 3300006880 | Ga0075429_100035556 | Ga0075429_1000355563 | 519 |
| 159 | 3300006914 | Ga0075436_100037970 | Ga0075436_1000379703 | 519 |
| 160 | 3300013308 | Ga0157375_10005169 | Ga0157375_100051698 | 519 |
| 161 | 3300025928 | Ga0207700_10022968 | Ga0207700_100229681 | 519 |
| 162 | 3300026078 | Ga0207702_10008275 | Ga0207702_100082754 | 519 |
| 163 | 3300031595 | Ga0265313_10009844 | Ga0265313_100098444 | 519 |
| 164 | 3300031711 | Ga0265314_10007159 | Ga0265314_100071595 | 519 |
| 165 | 3300038443 | Ga0395901_0064480 | Ga0395901_0064480_1285_2922 | 519 |
| 166 | 3300044712 | Ga0453684_0069808 | Ga0453684_0069808_2742_4403 | 519 |
| 167 | 3300047319 | Ga0495674_0037712 | Ga0495674_0037712_171_1934 | 519 |
| 168 | 3300049744 | Ga0501083_0016781 | Ga0501083_0016781_367_2019 | 519 |
| 169 | 3300050514 | nmdc:mga08x19_64455_c1 | nmdc:mga08x19_64455_c1_531_2306 | 519 |
| 170 | 3300006028 | Ga0070717_10000648 | Ga0070717_100006488 | 520 |
| 171 | 3300006237 | Ga0097621_100001013 | Ga0097621_10000101315 | 520 |
| 172 | 3300006358 | Ga0068871_100003639 | Ga0068871_1000036396 | 520 |
| 173 | 3300013297 | Ga0157378_10019118 | Ga0157378_100191186 | 520 |
| 174 | 3300013306 | Ga0163162_10013139 | Ga0163162_100131398 | 520 |
| 175 | 3300031711 | Ga0265314_10005415 | Ga0265314_100054153 | 520 |
| 176 | 3300042876 | Ga0451577_0000066 | Ga0451577_0000066_79190_80833 | 520 |
| 177 | 3300042876 | Ga0451577_0000715 | Ga0451577_0000715_18655_20298 | 520 |
| 178 | 3300042876 | Ga0451577_0150905 | Ga0451577_0150905_437_2080 | 520 |
| 179 | 3300044656 | Ga0466969_0043480 | Ga0466969_0043480_213_2099 | 520 |
| 180 | 3300044673 | Ga0453683_0000010 | Ga0453683_0000010_221309_222952 | 520 |
| 181 | 3300044673 | Ga0453683_0000174 | Ga0453683_0000174_8558_10201 | 520 |
| 182 | 3300044673 | Ga0453683_0109688 | Ga0453683_0109688_45_1688 | 520 |
| 183 | 3300044712 | Ga0453684_0000167 | Ga0453684_0000167_150257_151900 | 520 |
| 184 | 3300044712 | Ga0453684_0000206 | Ga0453684_0000206_176818_178461 | 520 |
| 185 | 3300044712 | Ga0453684_0000527 | Ga0453684_0000527_72832_74475 | 520 |
| 186 | 3300044712 | Ga0453684_0068355 | Ga0453684_0068355_2594_4237 | 520 |
| 187 | 3300044712 | Ga0453684_0073927 | Ga0453684_0073927_10_1653 | 520 |
| 188 | 3300045051 | Ga0451576_0000072 | Ga0451576_0000072_176818_178461 | 520 |
| 189 | 3300045051 | Ga0451576_0000211 | Ga0451576_0000211_72832_74475 | 520 |
| 190 | 3300045051 | Ga0451576_0034805 | Ga0451576_0034805_242_1885 | 520 |
| 191 | 3300002738 | JGI25154J39366_1000002 | JGI25154J39366_1000002327 | 521 |
| 192 | 3300003215 | JGI25153J46596_10000187 | JGI25153J46596_1000018735 | 521 |
| 193 | 3300003354 | JGI25160J50197_1002523 | JGI25160J50197_10025236 | 521 |
| 194 | 3300003771 | Ga0055526_1025514 | Ga0055526_10255141 | 521 |
| 195 | 3300003790 | Ga0055528_1000338 | Ga0055528_10003386 | 521 |
| 196 | 3300003790 | Ga0055528_1000600 | Ga0055528_10006003 | 521 |
| 197 | 3300003791 | Ga0055530_10001956 | Ga0055530_1000195611 | 521 |
| 198 | 3300005262 | Ga0065165_1000100 | Ga0065165_100010099 | 521 |
| 199 | 3300005355 | Ga0070671_100007427 | Ga0070671_10000742710 | 521 |
| 200 | 3300005456 | Ga0070678_100019833 | Ga0070678_1000198333 | 521 |
| 201 | 3300005841 | Ga0068863_100023628 | Ga0068863_1000236283 | 521 |
| 202 | 3300006237 | Ga0097621_100001217 | Ga0097621_1000012176 | 521 |
| 203 | 3300006358 | Ga0068871_100025182 | Ga0068871_1000251823 | 521 |
| 204 | 3300009177 | Ga0105248_10016053 | Ga0105248_100160539 | 521 |
| 205 | 3300013306 | Ga0163162_10002221 | Ga0163162_100022214 | 521 |
| 206 | 3300014968 | Ga0157379_10021198 | Ga0157379_100211984 | 521 |
| 207 | 3300014969 | Ga0157376_10000842 | Ga0157376_1000084210 | 521 |
| 208 | 3300025246 | Ga0209646_1000005 | Ga0209646_100000547 | 521 |
| 209 | 3300025250 | Ga0209026_1000587 | Ga0209026_100058712 | 521 |
| 210 | 3300025273 | Ga0209673_1000049 | Ga0209673_100004915 | 521 |
| 211 | 3300025295 | Ga0209564_1013600 | Ga0209564_10136002 | 521 |
| 212 | 3300025297 | Ga0209758_1000346 | Ga0209758_100034620 | 521 |
| 213 | 3300025297 | Ga0209758_1025236 | Ga0209758_10252361 | 521 |
| 214 | 3300025298 | Ga0209050_1000272 | Ga0209050_100027266 | 521 |
| 215 | 3300025302 | Ga0207426_1000381 | Ga0207426_100038157 | 521 |
| 216 | 3300025302 | Ga0207426_1001075 | Ga0207426_100107517 | 521 |
| 217 | 3300025931 | Ga0207644_10008865 | Ga0207644_100088652 | 521 |
| 218 | 3300026088 | Ga0207641_10030841 | Ga0207641_100308414 | 521 |
| 219 | 3300045051 | Ga0451576_0000003 | Ga0451576_0000003_1129321_1130955 | 521 |
| 220 | 3300045051 | Ga0451576_0007445 | Ga0451576_0007445_3528_5177 | 521 |
| 221 | 3300003203 | JGI25406J46586_10005984 | JGI25406J46586_100059841 | 522 |
| 222 | 3300005288 | Ga0065714_10002439 | Ga0065714_1000243910 | 522 |
| 223 | 3300005289 | Ga0065704_10073387 | Ga0065704_100733876 | 522 |
| 224 | 3300005985 | Ga0081539_10000085 | Ga0081539_10000085121 | 522 |
| 225 | 3300013100 | Ga0157373_10021959 | Ga0157373_100219592 | 522 |
| 226 | 3300013308 | Ga0157375_10185909 | Ga0157375_101859092 | 522 |
| 227 | 3300015262 | Ga0182007_10008552 | Ga0182007_100085522 | 522 |
| 228 | 3300017792 | Ga0163161_10071142 | Ga0163161_100711422 | 522 |
| 229 | 3300025208 | Ga0209436_101437 | Ga0209436_1014372 | 522 |
| 230 | 3300025302 | Ga0207426_1000233 | Ga0207426_10002338 | 522 |
| 231 | 3300025937 | Ga0207669_10111164 | Ga0207669_101111641 | 522 |
| 232 | 3300031240 | Ga0265320_10000776 | Ga0265320_100007765 | 522 |
| 233 | 3300031595 | Ga0265313_10020490 | Ga0265313_100204903 | 522 |
| 234 | 3300031616 | Ga0307508_10003578 | Ga0307508_1000357817 | 522 |
| 235 | 3300032004 | Ga0307414_10018010 | Ga0307414_100180103 | 522 |
| 236 | 3300039453 | Ga0436362_0034638 | Ga0436362_0034638_3713_5479 | 522 |
| 237 | 3300044712 | Ga0453684_0005060 | Ga0453684_0005060_19108_20766 | 522 |
| 238 | 3300045051 | Ga0451576_0002546 | Ga0451576_0002546_12128_13795 | 522 |
| 239 | 3300005539 | Ga0068853_100117153 | Ga0068853_1001171531 | 523 |
| 240 | 3300005578 | Ga0068854_100023435 | Ga0068854_1000234353 | 523 |
| 241 | 3300005614 | Ga0068856_100056388 | Ga0068856_1000563884 | 523 |
| 242 | 3300005616 | Ga0068852_100001462 | Ga0068852_1000014629 | 523 |
| 243 | 3300005834 | Ga0068851_10000010 | Ga0068851_1000001044 | 523 |
| 244 | 3300006881 | Ga0068865_100123175 | Ga0068865_1001231751 | 523 |
| 245 | 3300009551 | Ga0105238_10010193 | Ga0105238_100101937 | 523 |
| 246 | 3300013104 | Ga0157370_10026250 | Ga0157370_100262501 | 523 |
| 247 | 3300013307 | Ga0157372_10014609 | Ga0157372_100146091 | 523 |
| 248 | 3300013308 | Ga0157375_10124458 | Ga0157375_101244582 | 523 |
| 249 | 3300014326 | Ga0157380_10001220 | Ga0157380_100012203 | 523 |
| 250 | 3300025321 | Ga0207656_10000157 | Ga0207656_1000015717 | 523 |
| 251 | 3300025924 | Ga0207694_10011093 | Ga0207694_100110932 | 523 |
| 252 | 3300026078 | Ga0207702_10128423 | Ga0207702_101284231 | 523 |
| 253 | 3300026142 | Ga0207698_10003249 | Ga0207698_100032494 | 523 |
| 254 | 3300031728 | Ga0316578_10028658 | Ga0316578_100286583 | 523 |
| 255 | 3300032137 | Ga0316585_10004580 | Ga0316585_100045803 | 523 |
| 256 | 3300039093 | Ga0400489_60531 | Ga0400489_60531_5231_6886 | 523 |
| 257 | 3300049822 | Ga0501035_0082404 | Ga0501035_0082404_21_1688 | 523 |
| 258 | 3300005329 | Ga0070683_100003049 | Ga0070683_10000304915 | 524 |
| 259 | 3300005535 | Ga0070684_100002976 | Ga0070684_1000029766 | 524 |
| 260 | 3300005563 | Ga0068855_100027195 | Ga0068855_1000271955 | 524 |
| 261 | 3300009093 | Ga0105240_10006862 | Ga0105240_100068628 | 524 |
| 262 | 3300009545 | Ga0105237_10003940 | Ga0105237_100039402 | 524 |
| 263 | 3300009545 | Ga0105237_10053020 | Ga0105237_100530203 | 524 |
| 264 | 3300010375 | Ga0105239_10000283 | Ga0105239_1000028320 | 524 |
| 265 | 3300013105 | Ga0157369_10042857 | Ga0157369_100428576 | 524 |
| 266 | 3300013307 | Ga0157372_10004707 | Ga0157372_1000470710 | 524 |
| 267 | 3300013307 | Ga0157372_10090212 | Ga0157372_100902122 | 524 |
| 268 | 3300025913 | Ga0207695_10000051 | Ga0207695_10000051108 | 524 |
| 269 | 3300025913 | Ga0207695_10000056 | Ga0207695_10000056134 | 524 |
| 270 | 3300025913 | Ga0207695_10000081 | Ga0207695_10000081108 | 524 |
| 271 | 3300025914 | Ga0207671_10027684 | Ga0207671_100276843 | 524 |
| 272 | 3300025914 | Ga0207671_10030857 | Ga0207671_100308573 | 524 |
| 273 | 3300025944 | Ga0207661_10033981 | Ga0207661_100339812 | 524 |
| 274 | 3300025949 | Ga0207667_10002366 | Ga0207667_100023665 | 524 |
| 275 | 3300033180 | Ga0307510_10029575 | Ga0307510_100295752 | 524 |
| 276 | 3300044673 | Ga0453683_0000658 | Ga0453683_0000658_22770_24452 | 524 |
| 277 | 3300044693 | Ga0466961_0021360 | Ga0466961_0021360_845_2656 | 524 |
| 278 | 3300045051 | Ga0451576_0008410 | Ga0451576_0008410_8888_10570 | 524 |
| 279 | 3300046507 | Ga0495606_0004080 | Ga0495606_0004080_6334_8259 | 524 |
| 280 | 3300046648 | Ga0495611_0000941 | Ga0495611_0000941_642_2468 | 524 |
| 281 | 3300003320 | rootH2_10012018 | rootH2_1001201825 | 525 |
| 282 | 3300005336 | Ga0070680_100008330 | Ga0070680_1000083302 | 525 |
| 283 | 3300005339 | Ga0070660_100029929 | Ga0070660_1000299292 | 525 |
| 284 | 3300005343 | Ga0070687_100015930 | Ga0070687_1000159301 | 525 |
| 285 | 3300005365 | Ga0070688_100012988 | Ga0070688_1000129883 | 525 |
| 286 | 3300005577 | Ga0068857_100014392 | Ga0068857_1000143927 | 525 |
| 287 | 3300005614 | Ga0068856_100087457 | Ga0068856_1000874572 | 525 |
| 288 | 3300005719 | Ga0068861_100002834 | Ga0068861_1000028344 | 525 |
| 289 | 3300009545 | Ga0105237_10209197 | Ga0105237_102091971 | 525 |
| 290 | 3300013102 | Ga0157371_10045155 | Ga0157371_100451552 | 525 |
| 291 | 3300014326 | Ga0157380_10004286 | Ga0157380_100042864 | 525 |
| 292 | 3300025909 | Ga0207705_10009499 | Ga0207705_100094992 | 525 |
| 293 | 3300025917 | Ga0207660_10026465 | Ga0207660_100264652 | 525 |
| 294 | 3300025921 | Ga0207652_10004623 | Ga0207652_100046239 | 525 |
| 295 | 3300026041 | Ga0207639_10098604 | Ga0207639_100986042 | 525 |
| 296 | 3300026078 | Ga0207702_10067987 | Ga0207702_100679873 | 525 |
| 297 | 3300026118 | Ga0207675_100000085 | Ga0207675_10000008549 | 525 |
| 298 | 3300031616 | Ga0307508_10000157 | Ga0307508_1000015743 | 525 |
| 299 | 3300044712 | Ga0453684_0002293 | Ga0453684_0002293_41801_43471 | 525 |
| 300 | 3300047471 | Ga0495684_0052003 | Ga0495684_0052003_824_2476 | 525 |
| 301 | 3300049569 | Ga0501032_0000217 | Ga0501032_0000217_35806_37470 | 525 |
| 302 | 3300049822 | Ga0501035_0011451 | Ga0501035_0011451_3757_5421 | 525 |
| 303 | 3300049823 | Ga0501044_0000299 | Ga0501044_0000299_20334_21998 | 525 |
| 304 | iso_pu_bacteria | 2738541278 | 2738724672 | 525 |
| 305 | 3300005336 | Ga0070680_100084125 | Ga0070680_1000841252 | 526 |
| 306 | 3300005547 | Ga0070693_100005061 | Ga0070693_1000050612 | 526 |
| 307 | 3300005843 | Ga0068860_100000003 | Ga0068860_1000000035 | 526 |
| 308 | 3300009093 | Ga0105240_10004986 | Ga0105240_100049862 | 526 |
| 309 | 3300013306 | Ga0163162_10000175 | Ga0163162_1000017510 | 526 |
| 310 | 3300025949 | Ga0207667_10138552 | Ga0207667_101385522 | 526 |
| 311 | 3300028381 | Ga0268264_10000082 | Ga0268264_10000082162 | 526 |
| 312 | 3300028573 | Ga0265334_10006112 | Ga0265334_100061124 | 526 |
| 313 | 3300028577 | Ga0265318_10001041 | Ga0265318_100010416 | 526 |
| 314 | 3300031238 | Ga0265332_10040388 | Ga0265332_100403881 | 526 |
| 315 | 3300031240 | Ga0265320_10028679 | Ga0265320_100286792 | 526 |
| 316 | 3300031250 | Ga0265331_10020100 | Ga0265331_100201003 | 526 |
| 317 | 3300031507 | Ga0307509_10042858 | Ga0307509_100428583 | 526 |
| 318 | 3300031507 | Ga0307509_10120494 | Ga0307509_101204942 | 526 |
| 319 | 3300031595 | Ga0265313_10003199 | Ga0265313_100031996 | 526 |
| 320 | 3300031711 | Ga0265314_10002697 | Ga0265314_100026975 | 526 |
| 321 | 3300046460 | Ga0495638_0016791 | Ga0495638_0016791_1968_3803 | 526 |
| 322 | 3300046524 | Ga0495648_0007376 | Ga0495648_0007376_356_2191 | 526 |
| 323 | 3300046648 | Ga0495611_0028384 | Ga0495611_0028384_62_1897 | 526 |
| 324 | 3300047443 | Ga0495687_000179 | Ga0495687_000179_78171_80006 | 526 |
| 325 | 3300053130 | Ga0500642_0002743 | Ga0500642_0002743_1000_2835 | 526 |
| 326 | 3300053156 | Ga0500622_0009287 | Ga0500622_0009287_178_2013 | 526 |
| 327 | 3300005983 | Ga0081540_1003918 | Ga0081540_10039183 | 527 |
| 328 | 3300009094 | Ga0111539_10194366 | Ga0111539_101943662 | 527 |
| 329 | 3300014325 | Ga0163163_10015385 | Ga0163163_100153857 | 527 |
| 330 | 3300025302 | Ga0207426_1010995 | Ga0207426_10109952 | 527 |
| 331 | 3300031616 | Ga0307508_10042451 | Ga0307508_100424513 | 527 |
| 332 | 3300031730 | Ga0307516_10033453 | Ga0307516_100334535 | 527 |
| 333 | 3300049580 | Ga0501046_0121450 | Ga0501046_0121450_17_1705 | 527 |
| 334 | 3300005339 | Ga0070660_100000647 | Ga0070660_10000064714 | 528 |
| 335 | 3300005364 | Ga0070673_100019747 | Ga0070673_1000197474 | 528 |
| 336 | 3300005564 | Ga0070664_100034619 | Ga0070664_1000346193 | 528 |
| 337 | 3300005616 | Ga0068852_100038683 | Ga0068852_1000386834 | 528 |
| 338 | 3300013297 | Ga0157378_10025790 | Ga0157378_100257903 | 528 |
| 339 | 3300013308 | Ga0157375_10064390 | Ga0157375_100643901 | 528 |
| 340 | 3300014745 | Ga0157377_10019477 | Ga0157377_100194772 | 528 |
| 341 | 3300015265 | Ga0182005_1000061 | Ga0182005_100006116 | 528 |
| 342 | 3300025919 | Ga0207657_10005023 | Ga0207657_100050239 | 528 |
| 343 | 3300025937 | Ga0207669_10026030 | Ga0207669_100260303 | 528 |
| 344 | 3300028786 | Ga0307517_10075895 | Ga0307517_100758952 | 528 |
| 345 | 3300031250 | Ga0265331_10018911 | Ga0265331_100189113 | 528 |
| 346 | 3300031251 | Ga0265327_10002348 | Ga0265327_100023482 | 528 |
| 347 | 3300044712 | Ga0453684_0155404 | Ga0453684_0155404_234_1949 | 528 |
| 348 | 3300047320 | Ga0495672_0044167 | Ga0495672_0044167_112_1887 | 528 |
| 349 | 3300049703 | Ga0501219_000112 | Ga0501219_000112_2057_3781 | 528 |
| 350 | 3300049758 | Ga0501241_003638 | Ga0501241_003638_974_2698 | 528 |
| 351 | 3300050005 | Ga0501284_00086 | Ga0501284_00086_1091_2815 | 528 |
| 352 | 3300005331 | Ga0070670_100034247 | Ga0070670_1000342474 | 529 |
| 353 | 3300005335 | Ga0070666_10000301 | Ga0070666_1000030116 | 529 |
| 354 | 3300005338 | Ga0068868_100010528 | Ga0068868_1000105288 | 529 |
| 355 | 3300005617 | Ga0068859_100000006 | Ga0068859_100000006399 | 529 |
| 356 | 3300005617 | Ga0068859_100006790 | Ga0068859_1000067907 | 529 |
| 357 | 3300005618 | Ga0068864_100030464 | Ga0068864_1000304642 | 529 |
| 358 | 3300005842 | Ga0068858_100011681 | Ga0068858_1000116815 | 529 |
| 359 | 3300005843 | Ga0068860_100001345 | Ga0068860_10000134519 | 529 |
| 360 | 3300005843 | Ga0068860_100002872 | Ga0068860_1000028726 | 529 |
| 361 | 3300006358 | Ga0068871_100007102 | Ga0068871_1000071023 | 529 |
| 362 | 3300006931 | Ga0097620_100000006 | Ga0097620_100000006399 | 529 |
| 363 | 3300006931 | Ga0097620_100006790 | Ga0097620_1000067907 | 529 |
| 364 | 3300009094 | Ga0111539_10052998 | Ga0111539_100529982 | 529 |
| 365 | 3300009094 | Ga0111539_10079509 | Ga0111539_100795091 | 529 |
| 366 | 3300009174 | Ga0105241_10003877 | Ga0105241_100038777 | 529 |
| 367 | 3300009545 | Ga0105237_10011351 | Ga0105237_100113517 | 529 |
| 368 | 3300011119 | Ga0105246_10056558 | Ga0105246_100565582 | 529 |
| 369 | 3300013297 | Ga0157378_10048499 | Ga0157378_100484993 | 529 |
| 370 | 3300013306 | Ga0163162_10001206 | Ga0163162_100012067 | 529 |
| 371 | 3300013306 | Ga0163162_10001299 | Ga0163162_1000129919 | 529 |
| 372 | 3300014325 | Ga0163163_10000202 | Ga0163163_1000020219 | 529 |
| 373 | 3300014326 | Ga0157380_10002444 | Ga0157380_100024449 | 529 |
| 374 | 3300014969 | Ga0157376_10080737 | Ga0157376_100807372 | 529 |
| 375 | 3300025903 | Ga0207680_10000855 | Ga0207680_100008553 | 529 |
| 376 | 3300025911 | Ga0207654_10001346 | Ga0207654_1000134611 | 529 |
| 377 | 3300025925 | Ga0207650_10014874 | Ga0207650_100148744 | 529 |
| 378 | 3300025926 | Ga0207659_10030533 | Ga0207659_100305332 | 529 |
| 379 | 3300025938 | Ga0207704_10072337 | Ga0207704_100723372 | 529 |
| 380 | 3300025942 | Ga0207689_10002845 | Ga0207689_100028458 | 529 |
| 381 | 3300025960 | Ga0207651_10014270 | Ga0207651_100142701 | 529 |
| 382 | 3300025961 | Ga0207712_10002253 | Ga0207712_100022536 | 529 |
| 383 | 3300026035 | Ga0207703_10004255 | Ga0207703_100042556 | 529 |
| 384 | 3300026088 | Ga0207641_10002871 | Ga0207641_1000287115 | 529 |
| 385 | 3300026095 | Ga0207676_10083396 | Ga0207676_100833962 | 529 |
| 386 | 3300026095 | Ga0207676_10084450 | Ga0207676_100844502 | 529 |
| 387 | 3300028381 | Ga0268264_10004566 | Ga0268264_100045662 | 529 |
| 388 | 3300028381 | Ga0268264_10005045 | Ga0268264_100050456 | 529 |
| 389 | 3300028794 | Ga0307515_10000021 | Ga0307515_10000021247 | 529 |
| 390 | 3300044712 | Ga0453684_0061508 | Ga0453684_0061508_2943_4607 | 529 |
| 391 | 3300046616 | Ga0495668_0002015 | Ga0495668_0002015_15299_17029 | 529 |
| 392 | 3300047320 | Ga0495672_0010771 | Ga0495672_0010771_3173_4951 | 529 |
| 393 | 3300049569 | Ga0501032_0003483 | Ga0501032_0003483_969_2687 | 529 |
| 394 | 3300049570 | Ga0501033_0041909 | Ga0501033_0041909_1672_3390 | 529 |
| 395 | 3300049574 | Ga0501038_0007354 | Ga0501038_0007354_7215_8933 | 529 |
| 396 | 3300049575 | Ga0501039_0043183 | Ga0501039_0043183_491_2209 | 529 |
| 397 | 3300049579 | Ga0501043_0019201 | Ga0501043_0019201_2853_4571 | 529 |
| 398 | 3300049579 | Ga0501043_0088472 | Ga0501043_0088472_283_2001 | 529 |
| 399 | 3300049581 | Ga0501047_0005502 | Ga0501047_0005502_4313_6031 | 529 |
| 400 | 3300049823 | Ga0501044_0000920 | Ga0501044_0000920_7132_8850 | 529 |
| 401 | 3300050511 | nmdc:mga08y16_47954_c1 | nmdc:mga08y16_47954_c1_1531_3252 | 529 |
| 402 | iso_pu_bacteria | 2818991442 | 2819576638 | 530 |
| 403 | iso_pu_bacteria | 2818991460 | 2819677395 | 530 |
| 404 | iso_pu_bacteria | 2821136567 | 2821143133 | 530 |
| 405 | iso_pu_bacteria | 2840677318 | 2840679216 | 530 |
| 406 | iso_pu_bacteria | 2883068021 | 2883070007 | 530 |
| 407 | iso_pu_bacteria | 2884791551 | 2884797314 | 530 |
| 408 | iso_pu_bacteria | 2896085136 | 2896087027 | 530 |
| 409 | iso_pu_bacteria | 2896109856 | 2896114311 | 530 |
| 410 | iso_pu_bacteria | 2904467357 | 2904470853 | 530 |
| 411 | iso_pu_bacteria | 2929177148 | 2929177216 | 530 |
| 412 | iso_pu_bacteria | 2929239360 | 2929239640 | 530 |
| 413 | iso_pu_bacteria | 2929921140 | 2929921276 | 530 |
| 414 | iso_pu_bacteria | 2945977869 | 2945979583 | 530 |
| 415 | iso_pu_bacteria | 2946013367 | 2946014549 | 530 |
| 416 | iso_pu_bacteria | 8003151029 | 8003157677 | 530 |
| 417 | 3300005334 | Ga0068869_100005945 | Ga0068869_1000059452 | 531 |
| 418 | 3300013307 | Ga0157372_10028658 | Ga0157372_100286585 | 531 |
| 419 | 3300025942 | Ga0207689_10024801 | Ga0207689_100248015 | 531 |
| 420 | 3300031995 | Ga0307409_100118982 | Ga0307409_1001189822 | 531 |
| 421 | 3300032126 | Ga0307415_100103944 | Ga0307415_1001039442 | 531 |
| 422 | 3300048918 | Ga0496115_0003173 | Ga0496115_0003173_8991_10661 | 532 |
| 423 | 3300003320 | rootH2_10133206 | rootH2_101332065 | 533 |
| 424 | 3300005458 | Ga0070681_10011071 | Ga0070681_100110715 | 533 |
| 425 | 3300005539 | Ga0068853_100009547 | Ga0068853_1000095471 | 533 |
| 426 | 3300005539 | Ga0068853_100078295 | Ga0068853_1000782952 | 533 |
| 427 | 3300005539 | Ga0068853_100132223 | Ga0068853_1001322232 | 533 |
| 428 | 3300005548 | Ga0070665_100000002 | Ga0070665_100000002385 | 533 |
| 429 | 3300005614 | Ga0068856_100054687 | Ga0068856_1000546873 | 533 |
| 430 | 3300005616 | Ga0068852_100077578 | Ga0068852_1000775782 | 533 |
| 431 | 3300005843 | Ga0068860_100011297 | Ga0068860_1000112974 | 533 |
| 432 | 3300006871 | Ga0075434_100034087 | Ga0075434_1000340875 | 533 |
| 433 | 3300009093 | Ga0105240_10000367 | Ga0105240_100003675 | 533 |
| 434 | 3300009093 | Ga0105240_10000457 | Ga0105240_1000045725 | 533 |
| 435 | 3300009093 | Ga0105240_10000487 | Ga0105240_1000048744 | 533 |
| 436 | 3300009093 | Ga0105240_10046442 | Ga0105240_100464421 | 533 |
| 437 | 3300010375 | Ga0105239_10002422 | Ga0105239_100024225 | 533 |
| 438 | 3300010375 | Ga0105239_10041719 | Ga0105239_100417194 | 533 |
| 439 | 3300013296 | Ga0157374_10000013 | Ga0157374_10000013136 | 533 |
| 440 | 3300014969 | Ga0157376_10003024 | Ga0157376_100030248 | 533 |
| 441 | 3300025911 | Ga0207654_10001813 | Ga0207654_100018135 | 533 |
| 442 | 3300025913 | Ga0207695_10000066 | Ga0207695_1000006625 | 533 |
| 443 | 3300025913 | Ga0207695_10000156 | Ga0207695_1000015684 | 533 |
| 444 | 3300025913 | Ga0207695_10000550 | Ga0207695_100005503 | 533 |
| 445 | 3300025913 | Ga0207695_10001892 | Ga0207695_1000189221 | 533 |
| 446 | 3300025914 | Ga0207671_10007052 | Ga0207671_100070523 | 533 |
| 447 | 3300026095 | Ga0207676_10173889 | Ga0207676_101738891 | 533 |
| 448 | 3300026142 | Ga0207698_10075369 | Ga0207698_100753691 | 533 |
| 449 | 3300028379 | Ga0268266_10000022 | Ga0268266_1000002253 | 533 |
| 450 | 3300028381 | Ga0268264_10004767 | Ga0268264_1000476710 | 533 |
| 451 | 3300047472 | Ga0495686_0000010 | Ga0495686_0000010_253359_255179 | 533 |
| 452 | 3300001989 | JGI24739J22299_10000257 | JGI24739J22299_100002576 | 534 |
| 453 | 3300003316 | rootH1_10041871 | rootH1_100418712 | 534 |
| 454 | 3300003322 | rootL2_10017890 | rootL2_100178903 | 534 |
| 455 | 3300003762 | Ga0055542_1003866 | Ga0055542_10038662 | 534 |
| 456 | 3300003794 | Ga0055531_10000014 | Ga0055531_10000014101 | 534 |
| 457 | 3300005289 | Ga0065704_10074690 | Ga0065704_100746902 | 534 |
| 458 | 3300006195 | Ga0075366_10012766 | Ga0075366_100127663 | 534 |
| 459 | 3300025242 | Ga0209258_100029 | Ga0209258_100029135 | 534 |
| 460 | 3300025254 | Ga0209148_1000089 | Ga0209148_100008943 | 534 |
| 461 | 3300025295 | Ga0209564_1014874 | Ga0209564_10148742 | 534 |
| 462 | 3300025304 | Ga0209257_1000004 | Ga0209257_1000004557 | 534 |
| 463 | 3300026075 | Ga0207708_10017202 | Ga0207708_100172022 | 534 |
| 464 | 3300031251 | Ga0265327_10006052 | Ga0265327_100060523 | 534 |
| 465 | 3300041997 | Ga0439431_0002168 | Ga0439431_0002168_1245_2912 | 534 |
| 466 | 3300046558 | Ga0495633_0000025 | Ga0495633_0000025_89458_91125 | 534 |
| 467 | 3300048924 | Ga0496121_0000008 | Ga0496121_0000008_178530_180194 | 534 |
| 468 | 3300049571 | Ga0501034_0057476 | Ga0501034_0057476_907_2574 | 534 |
| 469 | 3300053088 | Ga0500644_0000039 | Ga0500644_0000039_24028_25692 | 534 |
| 470 | 3300053121 | Ga0500607_036339 | Ga0500607_036339_815_2479 | 534 |
| 471 | 3300053134 | Ga0500658_0000972 | Ga0500658_0000972_5260_6924 | 534 |
| 472 | 3300053142 | Ga0500577_0001411 | Ga0500577_0001411_4234_5898 | 534 |
| 473 | 3300053148 | Ga0500590_012391 | Ga0500590_012391_479_2143 | 534 |
| 474 | 3300053156 | Ga0500622_0000151 | Ga0500622_0000151_13016_14680 | 534 |
| 475 | iso_pu_bacteria | 2818991444 | 2819585479 | 534 |
| 476 | iso_pu_bacteria | 2914759650 | 2914763455 | 534 |
| 477 | iso_pu_bacteria | 2929154850 | 2929159869 | 534 |
| 478 | 3300005329 | Ga0070683_100034025 | Ga0070683_1000340255 | 535 |
| 479 | 3300005335 | Ga0070666_10047511 | Ga0070666_100475112 | 535 |
| 480 | 3300005337 | Ga0070682_100003881 | Ga0070682_1000038816 | 535 |
| 481 | 3300005339 | Ga0070660_100062577 | Ga0070660_1000625772 | 535 |
| 482 | 3300005366 | Ga0070659_100011665 | Ga0070659_1000116652 | 535 |
| 483 | 3300005535 | Ga0070684_100009202 | Ga0070684_1000092025 | 535 |
| 484 | 3300005564 | Ga0070664_100073457 | Ga0070664_1000734572 | 535 |
| 485 | 3300005616 | Ga0068852_100011285 | Ga0068852_1000112857 | 535 |
| 486 | 3300005985 | Ga0081539_10001707 | Ga0081539_100017072 | 535 |
| 487 | 3300013100 | Ga0157373_10008404 | Ga0157373_100084045 | 535 |
| 488 | 3300013102 | Ga0157371_10013075 | Ga0157371_100130752 | 535 |
| 489 | 3300013105 | Ga0157369_10015080 | Ga0157369_100150805 | 535 |
| 490 | 3300025919 | Ga0207657_10011902 | Ga0207657_100119025 | 535 |
| 491 | 3300025933 | Ga0207706_10009268 | Ga0207706_100092685 | 535 |
| 492 | 3300025940 | Ga0207691_10143076 | Ga0207691_101430762 | 535 |
| 493 | 3300031730 | Ga0307516_10001138 | Ga0307516_100011382 | 535 |
| 494 | 3300041413 | Ga0439465_0026797 | Ga0439465_0026797_86_1792 | 535 |
| 495 | 3300049571 | Ga0501034_0043401 | Ga0501034_0043401_1275_3008 | 535 |
| 496 | 3300049585 | Ga0501069_0045631 | Ga0501069_0045631_27_1760 | 535 |
| 497 | 3300049744 | Ga0501083_0011750 | Ga0501083_0011750_4033_5766 | 535 |
| 498 | 3300049823 | Ga0501044_0083841 | Ga0501044_0083841_1248_2981 | 535 |
| 499 | 3300053727 | Ga0500611_000039 | Ga0500611_000039_18647_20350 | 535 |
| 500 | 3300054114 | Ga0501084_0044804 | Ga0501084_0044804_1944_3677 | 535 |
| 501 | 3300005328 | Ga0070676_10000064 | Ga0070676_100000644 | 536 |
| 502 | 3300005338 | Ga0068868_100002193 | Ga0068868_1000021939 | 536 |
| 503 | 3300005347 | Ga0070668_100015362 | Ga0070668_1000153622 | 536 |
| 504 | 3300005364 | Ga0070673_100000197 | Ga0070673_10000019723 | 536 |
| 505 | 3300005367 | Ga0070667_100000240 | Ga0070667_10000024039 | 536 |
| 506 | 3300005457 | Ga0070662_100057633 | Ga0070662_1000576332 | 536 |
| 507 | 3300005459 | Ga0068867_100007586 | Ga0068867_1000075863 | 536 |
| 508 | 3300005543 | Ga0070672_100013181 | Ga0070672_1000131817 | 536 |
| 509 | 3300005548 | Ga0070665_100036782 | Ga0070665_1000367823 | 536 |
| 510 | 3300005618 | Ga0068864_100030070 | Ga0068864_1000300704 | 536 |
| 511 | 3300005834 | Ga0068851_10001240 | Ga0068851_100012409 | 536 |
| 512 | 3300005841 | Ga0068863_100015478 | Ga0068863_1000154782 | 536 |
| 513 | 3300005842 | Ga0068858_100000889 | Ga0068858_10000088926 | 536 |
| 514 | 3300005843 | Ga0068860_100004206 | Ga0068860_10000420612 | 536 |
| 515 | 3300006237 | Ga0097621_100020381 | Ga0097621_1000203812 | 536 |
| 516 | 3300006358 | Ga0068871_100133533 | Ga0068871_1001335332 | 536 |
| 517 | 3300006881 | Ga0068865_100096012 | Ga0068865_1000960121 | 536 |
| 518 | 3300009553 | Ga0105249_10018872 | Ga0105249_100188723 | 536 |
| 519 | 3300013296 | Ga0157374_10045714 | Ga0157374_100457141 | 536 |
| 520 | 3300013297 | Ga0157378_10008769 | Ga0157378_1000876910 | 536 |
| 521 | 3300013306 | Ga0163162_10006923 | Ga0163162_100069239 | 536 |
| 522 | 3300013306 | Ga0163162_10018140 | Ga0163162_100181401 | 536 |
| 523 | 3300013308 | Ga0157375_10027672 | Ga0157375_100276723 | 536 |
| 524 | 3300013308 | Ga0157375_10035262 | Ga0157375_100352623 | 536 |
| 525 | 3300014968 | Ga0157379_10001465 | Ga0157379_1000146514 | 536 |
| 526 | 3300014968 | Ga0157379_10019036 | Ga0157379_100190366 | 536 |
| 527 | 3300014969 | Ga0157376_10003719 | Ga0157376_100037193 | 536 |
| 528 | 3300025903 | Ga0207680_10001858 | Ga0207680_100018582 | 536 |
| 529 | 3300025926 | Ga0207659_10027778 | Ga0207659_100277783 | 536 |
| 530 | 3300025933 | Ga0207706_10050715 | Ga0207706_100507153 | 536 |
| 531 | 3300025940 | Ga0207691_10000076 | Ga0207691_1000007668 | 536 |
| 532 | 3300025960 | Ga0207651_10014260 | Ga0207651_100142602 | 536 |
| 533 | 3300025972 | Ga0207668_10014583 | Ga0207668_100145833 | 536 |
| 534 | 3300025986 | Ga0207658_10008424 | Ga0207658_100084248 | 536 |
| 535 | 3300026023 | Ga0207677_10009204 | Ga0207677_100092042 | 536 |
| 536 | 3300026035 | Ga0207703_10030625 | Ga0207703_100306253 | 536 |
| 537 | 3300026088 | Ga0207641_10009891 | Ga0207641_100098914 | 536 |
| 538 | 3300026089 | Ga0207648_10002106 | Ga0207648_100021068 | 536 |
| 539 | 3300026095 | Ga0207676_10024425 | Ga0207676_100244253 | 536 |
| 540 | 3300026121 | Ga0207683_10101930 | Ga0207683_101019302 | 536 |
| 541 | 3300028379 | Ga0268266_10021289 | Ga0268266_100212894 | 536 |
| 542 | 3300028381 | Ga0268264_10005982 | Ga0268264_100059825 | 536 |
| 543 | iso_pu_bacteria | 2881955468 | 2881956225 | 536 |
| 544 | 3300005539 | Ga0068853_100177439 | Ga0068853_1001774391 | 537 |
| 545 | 3300013102 | Ga0157371_10007543 | Ga0157371_100075434 | 537 |
| 546 | 3300013307 | Ga0157372_10161543 | Ga0157372_101615432 | 537 |
| 547 | 3300025919 | Ga0207657_10029703 | Ga0207657_100297032 | 537 |
| 548 | 3300025938 | Ga0207704_10080648 | Ga0207704_100806482 | 537 |
| 549 | 3300026116 | Ga0207674_10049020 | Ga0207674_100490202 | 537 |
| 550 | 3300030521 | Ga0307511_10000027 | Ga0307511_1000002710 | 537 |
| 551 | 3300032004 | Ga0307414_10043941 | Ga0307414_100439412 | 537 |
| 552 | 3300037471 | Ga0395905_0064357 | Ga0395905_0064357_243_1925 | 537 |
| 553 | 3300049822 | Ga0501035_0026868 | Ga0501035_0026868_3027_4709 | 537 |
| 554 | 3300001979 | JGI24740J21852_10014062 | JGI24740J21852_100140621 | 538 |
| 555 | 3300003322 | rootL2_10096669 | rootL2_100966692 | 538 |
| 556 | 3300003354 | JGI25160J50197_1002636 | JGI25160J50197_10026365 | 538 |
| 557 | 3300005290 | Ga0065712_10001246 | Ga0065712_100012463 | 538 |
| 558 | 3300005327 | Ga0070658_10029501 | Ga0070658_100295012 | 538 |
| 559 | 3300005327 | Ga0070658_10063179 | Ga0070658_100631791 | 538 |
| 560 | 3300005328 | Ga0070676_10066737 | Ga0070676_100667372 | 538 |
| 561 | 3300005329 | Ga0070683_100095607 | Ga0070683_1000956074 | 538 |
| 562 | 3300005334 | Ga0068869_100006962 | Ga0068869_1000069624 | 538 |
| 563 | 3300005336 | Ga0070680_100120681 | Ga0070680_1001206812 | 538 |
| 564 | 3300005337 | Ga0070682_100000074 | Ga0070682_10000007421 | 538 |
| 565 | 3300005337 | Ga0070682_100046639 | Ga0070682_1000466393 | 538 |
| 566 | 3300005343 | Ga0070687_100022966 | Ga0070687_1000229662 | 538 |
| 567 | 3300005353 | Ga0070669_100013584 | Ga0070669_1000135842 | 538 |
| 568 | 3300005353 | Ga0070669_100016100 | Ga0070669_1000161004 | 538 |
| 569 | 3300005354 | Ga0070675_100010008 | Ga0070675_1000100084 | 538 |
| 570 | 3300005356 | Ga0070674_100050497 | Ga0070674_1000504972 | 538 |
| 571 | 3300005364 | Ga0070673_100021118 | Ga0070673_1000211185 | 538 |
| 572 | 3300005364 | Ga0070673_100080466 | Ga0070673_1000804663 | 538 |
| 573 | 3300005366 | Ga0070659_100160722 | Ga0070659_1001607221 | 538 |
| 574 | 3300005367 | Ga0070667_100128198 | Ga0070667_1001281981 | 538 |
| 575 | 3300005458 | Ga0070681_10205905 | Ga0070681_102059051 | 538 |
| 576 | 3300005459 | Ga0068867_100018353 | Ga0068867_1000183534 | 538 |
| 577 | 3300005459 | Ga0068867_100043071 | Ga0068867_1000430713 | 538 |
| 578 | 3300005471 | Ga0070698_100001074 | Ga0070698_10000107421 | 538 |
| 579 | 3300005471 | Ga0070698_100020355 | Ga0070698_1000203553 | 538 |
| 580 | 3300005530 | Ga0070679_100001516 | Ga0070679_10000151611 | 538 |
| 581 | 3300005530 | Ga0070679_100052432 | Ga0070679_1000524322 | 538 |
| 582 | 3300005530 | Ga0070679_100113173 | Ga0070679_1001131733 | 538 |
| 583 | 3300005539 | Ga0068853_100007589 | Ga0068853_1000075893 | 538 |
| 584 | 3300005539 | Ga0068853_100020882 | Ga0068853_1000208826 | 538 |
| 585 | 3300005539 | Ga0068853_100023897 | Ga0068853_1000238974 | 538 |
| 586 | 3300005539 | Ga0068853_100034559 | Ga0068853_1000345594 | 538 |
| 587 | 3300005539 | Ga0068853_100045683 | Ga0068853_1000456833 | 538 |
| 588 | 3300005543 | Ga0070672_100061639 | Ga0070672_1000616393 | 538 |
| 589 | 3300005548 | Ga0070665_100027148 | Ga0070665_1000271483 | 538 |
| 590 | 3300005563 | Ga0068855_100000145 | Ga0068855_10000014567 | 538 |
| 591 | 3300005563 | Ga0068855_100003314 | Ga0068855_1000033144 | 538 |
| 592 | 3300005563 | Ga0068855_100031140 | Ga0068855_1000311402 | 538 |
| 593 | 3300005577 | Ga0068857_100087478 | Ga0068857_1000874782 | 538 |
| 594 | 3300005616 | Ga0068852_100029755 | Ga0068852_1000297555 | 538 |
| 595 | 3300005617 | Ga0068859_100001697 | Ga0068859_10000169712 | 538 |
| 596 | 3300005617 | Ga0068859_100042435 | Ga0068859_1000424354 | 538 |
| 597 | 3300005617 | Ga0068859_100260678 | Ga0068859_1002606781 | 538 |
| 598 | 3300005618 | Ga0068864_100065161 | Ga0068864_1000651613 | 538 |
| 599 | 3300005719 | Ga0068861_100007430 | Ga0068861_1000074309 | 538 |
| 600 | 3300005719 | Ga0068861_100007576 | Ga0068861_1000075766 | 538 |
| 601 | 3300005840 | Ga0068870_10008140 | Ga0068870_100081403 | 538 |
| 602 | 3300005841 | Ga0068863_100014068 | Ga0068863_1000140685 | 538 |
| 603 | 3300005843 | Ga0068860_100007629 | Ga0068860_1000076298 | 538 |
| 604 | 3300005844 | Ga0068862_100007876 | Ga0068862_1000078762 | 538 |
| 605 | 3300006237 | Ga0097621_100049975 | Ga0097621_1000499753 | 538 |
| 606 | 3300006237 | Ga0097621_100057071 | Ga0097621_1000570712 | 538 |
| 607 | 3300006237 | Ga0097621_100083120 | Ga0097621_1000831202 | 538 |
| 608 | 3300006358 | Ga0068871_100016955 | Ga0068871_1000169554 | 538 |
| 609 | 3300006844 | Ga0075428_100012683 | Ga0075428_10001268312 | 538 |
| 610 | 3300006846 | Ga0075430_100006312 | Ga0075430_1000063126 | 538 |
| 611 | 3300006847 | Ga0075431_100085335 | Ga0075431_1000853352 | 538 |
| 612 | 3300006880 | Ga0075429_100000533 | Ga0075429_1000005331 | 538 |
| 613 | 3300006881 | Ga0068865_100050338 | Ga0068865_1000503383 | 538 |
| 614 | 3300006931 | Ga0097620_100001697 | Ga0097620_10000169712 | 538 |
| 615 | 3300006931 | Ga0097620_100042435 | Ga0097620_1000424354 | 538 |
| 616 | 3300006931 | Ga0097620_100260671 | Ga0097620_1002606711 | 538 |
| 617 | 3300009093 | Ga0105240_10060472 | Ga0105240_100604724 | 538 |
| 618 | 3300009101 | Ga0105247_10005318 | Ga0105247_100053185 | 538 |
| 619 | 3300009147 | Ga0114129_10047706 | Ga0114129_100477063 | 538 |
| 620 | 3300009176 | Ga0105242_10006871 | Ga0105242_100068716 | 538 |
| 621 | 3300009176 | Ga0105242_10010685 | Ga0105242_100106857 | 538 |
| 622 | 3300009545 | Ga0105237_10045165 | Ga0105237_100451654 | 538 |
| 623 | 3300009553 | Ga0105249_10001044 | Ga0105249_1000104416 | 538 |
| 624 | 3300009553 | Ga0105249_10002600 | Ga0105249_100026004 | 538 |
| 625 | 3300009553 | Ga0105249_10003251 | Ga0105249_1000325112 | 538 |
| 626 | 3300009553 | Ga0105249_10013188 | Ga0105249_100131885 | 538 |
| 627 | 3300009553 | Ga0105249_10085511 | Ga0105249_100855112 | 538 |
| 628 | 3300009553 | Ga0105249_10200827 | Ga0105249_102008271 | 538 |
| 629 | 3300011119 | Ga0105246_10009216 | Ga0105246_100092164 | 538 |
| 630 | 3300013100 | Ga0157373_10004089 | Ga0157373_100040899 | 538 |
| 631 | 3300013100 | Ga0157373_10027803 | Ga0157373_100278032 | 538 |
| 632 | 3300013102 | Ga0157371_10000868 | Ga0157371_1000086819 | 538 |
| 633 | 3300013102 | Ga0157371_10001718 | Ga0157371_100017187 | 538 |
| 634 | 3300013102 | Ga0157371_10009380 | Ga0157371_100093802 | 538 |
| 635 | 3300013102 | Ga0157371_10014951 | Ga0157371_100149512 | 538 |
| 636 | 3300013102 | Ga0157371_10027230 | Ga0157371_100272302 | 538 |
| 637 | 3300013102 | Ga0157371_10079944 | Ga0157371_100799441 | 538 |
| 638 | 3300013104 | Ga0157370_10000313 | Ga0157370_1000031347 | 538 |
| 639 | 3300013104 | Ga0157370_10000628 | Ga0157370_1000062827 | 538 |
| 640 | 3300013104 | Ga0157370_10001571 | Ga0157370_100015712 | 538 |
| 641 | 3300013104 | Ga0157370_10049874 | Ga0157370_100498743 | 538 |
| 642 | 3300013297 | Ga0157378_10045323 | Ga0157378_100453233 | 538 |
| 643 | 3300013307 | Ga0157372_10010278 | Ga0157372_100102784 | 538 |
| 644 | 3300013307 | Ga0157372_10245278 | Ga0157372_102452782 | 538 |
| 645 | 3300013308 | Ga0157375_10102667 | Ga0157375_101026673 | 538 |
| 646 | 3300014969 | Ga0157376_10080508 | Ga0157376_100805082 | 538 |
| 647 | 3300021384 | Ga0213876_10006792 | Ga0213876_100067924 | 538 |
| 648 | 3300025302 | Ga0207426_1000059 | Ga0207426_1000059213 | 538 |
| 649 | 3300025904 | Ga0207647_10007138 | Ga0207647_100071388 | 538 |
| 650 | 3300025905 | Ga0207685_10017549 | Ga0207685_100175492 | 538 |
| 651 | 3300025907 | Ga0207645_10000326 | Ga0207645_1000032626 | 538 |
| 652 | 3300025908 | Ga0207643_10015731 | Ga0207643_100157312 | 538 |
| 653 | 3300025909 | Ga0207705_10026743 | Ga0207705_100267432 | 538 |
| 654 | 3300025909 | Ga0207705_10044637 | Ga0207705_100446372 | 538 |
| 655 | 3300025909 | Ga0207705_10108977 | Ga0207705_101089772 | 538 |
| 656 | 3300025913 | Ga0207695_10049095 | Ga0207695_100490952 | 538 |
| 657 | 3300025914 | Ga0207671_10024135 | Ga0207671_100241355 | 538 |
| 658 | 3300025914 | Ga0207671_10104978 | Ga0207671_101049782 | 538 |
| 659 | 3300025917 | Ga0207660_10007760 | Ga0207660_100077602 | 538 |
| 660 | 3300025918 | Ga0207662_10003292 | Ga0207662_100032923 | 538 |
| 661 | 3300025921 | Ga0207652_10000187 | Ga0207652_1000018737 | 538 |
| 662 | 3300025921 | Ga0207652_10000198 | Ga0207652_1000019825 | 538 |
| 663 | 3300025932 | Ga0207690_10045051 | Ga0207690_100450512 | 538 |
| 664 | 3300025934 | Ga0207686_10001189 | Ga0207686_1000118913 | 538 |
| 665 | 3300025936 | Ga0207670_10032418 | Ga0207670_100324182 | 538 |
| 666 | 3300025937 | Ga0207669_10011591 | Ga0207669_100115914 | 538 |
| 667 | 3300025938 | Ga0207704_10014903 | Ga0207704_100149033 | 538 |
| 668 | 3300025938 | Ga0207704_10040783 | Ga0207704_100407832 | 538 |
| 669 | 3300025940 | Ga0207691_10029891 | Ga0207691_100298913 | 538 |
| 670 | 3300025942 | Ga0207689_10001060 | Ga0207689_1000106014 | 538 |
| 671 | 3300025942 | Ga0207689_10007781 | Ga0207689_100077816 | 538 |
| 672 | 3300025942 | Ga0207689_10023684 | Ga0207689_100236846 | 538 |
| 673 | 3300025942 | Ga0207689_10040931 | Ga0207689_100409313 | 538 |
| 674 | 3300025949 | Ga0207667_10000492 | Ga0207667_100004926 | 538 |
| 675 | 3300025949 | Ga0207667_10027086 | Ga0207667_100270866 | 538 |
| 676 | 3300025949 | Ga0207667_10048616 | Ga0207667_100486162 | 538 |
| 677 | 3300025961 | Ga0207712_10001457 | Ga0207712_100014578 | 538 |
| 678 | 3300025961 | Ga0207712_10003884 | Ga0207712_100038848 | 538 |
| 679 | 3300025961 | Ga0207712_10006568 | Ga0207712_100065687 | 538 |
| 680 | 3300025961 | Ga0207712_10013777 | Ga0207712_100137772 | 538 |
| 681 | 3300025961 | Ga0207712_10014032 | Ga0207712_100140322 | 538 |
| 682 | 3300025986 | Ga0207658_10079544 | Ga0207658_100795441 | 538 |
| 683 | 3300026041 | Ga0207639_10004353 | Ga0207639_1000435310 | 538 |
| 684 | 3300026041 | Ga0207639_10004753 | Ga0207639_100047534 | 538 |
| 685 | 3300026088 | Ga0207641_10002685 | Ga0207641_1000268514 | 538 |
| 686 | 3300026089 | Ga0207648_10005153 | Ga0207648_100051536 | 538 |
| 687 | 3300026089 | Ga0207648_10008642 | Ga0207648_100086422 | 538 |
| 688 | 3300026089 | Ga0207648_10014835 | Ga0207648_100148356 | 538 |
| 689 | 3300026089 | Ga0207648_10058255 | Ga0207648_100582553 | 538 |
| 690 | 3300026089 | Ga0207648_10161143 | Ga0207648_101611432 | 538 |
| 691 | 3300026116 | Ga0207674_10073409 | Ga0207674_100734092 | 538 |
| 692 | 3300026116 | Ga0207674_10132858 | Ga0207674_101328581 | 538 |
| 693 | 3300026118 | Ga0207675_100011340 | Ga0207675_1000113402 | 538 |
| 694 | 3300026118 | Ga0207675_100029953 | Ga0207675_1000299532 | 538 |
| 695 | 3300026118 | Ga0207675_100031240 | Ga0207675_1000312402 | 538 |
| 696 | 3300026121 | Ga0207683_10001248 | Ga0207683_100012484 | 538 |
| 697 | 3300026121 | Ga0207683_10074800 | Ga0207683_100748002 | 538 |
| 698 | 3300028379 | Ga0268266_10033089 | Ga0268266_100330894 | 538 |
| 699 | 3300028380 | Ga0268265_10005023 | Ga0268265_1000502310 | 538 |
| 700 | 3300028381 | Ga0268264_10008916 | Ga0268264_100089162 | 538 |
| 701 | 3300028381 | Ga0268264_10009473 | Ga0268264_100094735 | 538 |
| 702 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012002 | 538 |
| 703 | 3300031251 | Ga0265327_10000059 | Ga0265327_10000059113 | 538 |
| 704 | 3300031251 | Ga0265327_10000142 | Ga0265327_10000142113 | 538 |
| 705 | 3300031251 | Ga0265327_10031964 | Ga0265327_100319642 | 538 |
| 706 | 3300036401 | Ga0373937_0130081 | Ga0373937_0130081_54_1760 | 538 |
| 707 | 3300037312 | Ga0395899_0003604 | Ga0395899_0003604_1920_3602 | 538 |
| 708 | 3300037312 | Ga0395899_0007612 | Ga0395899_0007612_5596_7278 | 538 |
| 709 | 3300037418 | Ga0395900_0064447 | Ga0395900_0064447_1389_3071 | 538 |
| 710 | 3300037418 | Ga0395900_0095736 | Ga0395900_0095736_1213_2895 | 538 |
| 711 | 3300037466 | Ga0395898_0003818 | Ga0395898_0003818_14261_15943 | 538 |
| 712 | 3300037471 | Ga0395905_0003378 | Ga0395905_0003378_119_1927 | 538 |
| 713 | 3300037471 | Ga0395905_0043377 | Ga0395905_0043377_1717_3399 | 538 |
| 714 | 3300038443 | Ga0395901_0006287 | Ga0395901_0006287_9212_10894 | 538 |
| 715 | 3300038443 | Ga0395901_0015165 | Ga0395901_0015165_3829_5511 | 538 |
| 716 | 3300039437 | Ga0436365_0561939 | Ga0436365_0561939_8044_9726 | 538 |
| 717 | 3300044658 | Ga0466972_0000067 | Ga0466972_0000067_2087_3772 | 538 |
| 718 | 3300044712 | Ga0453684_0033409 | Ga0453684_0033409_5386_7068 | 538 |
| 719 | 3300044735 | Ga0466968_0026127 | Ga0466968_0026127_587_2272 | 538 |
| 720 | 3300044765 | Ga0466970_0001874 | Ga0466970_0001874_6767_8452 | 538 |
| 721 | 3300046471 | Ga0495650_0006702 | Ga0495650_0006702_1972_3678 | 538 |
| 722 | 3300046616 | Ga0495668_0000106 | Ga0495668_0000106_36243_37925 | 538 |
| 723 | 3300049521 | Ga0501298_001052 | Ga0501298_001052_894_2696 | 538 |
| 724 | 3300049523 | Ga0501300_004061 | Ga0501300_004061_285_2087 | 538 |
| 725 | 3300049570 | Ga0501033_0041960 | Ga0501033_0041960_493_2220 | 538 |
| 726 | 3300049571 | Ga0501034_0000002 | Ga0501034_0000002_105033_106715 | 538 |
| 727 | 3300049571 | Ga0501034_0012357 | Ga0501034_0012357_295_1977 | 538 |
| 728 | 3300049573 | Ga0501037_0021086 | Ga0501037_0021086_1338_3020 | 538 |
| 729 | 3300049661 | Ga0501217_002332 | Ga0501217_002332_655_2466 | 538 |
| 730 | 3300049663 | Ga0501223_002818 | Ga0501223_002818_1285_3087 | 538 |
| 731 | 3300049664 | Ga0501224_000940 | Ga0501224_000940_235_2037 | 538 |
| 732 | 3300049669 | Ga0501235_002213 | Ga0501235_002213_1411_3213 | 538 |
| 733 | 3300049674 | Ga0501242_000064 | Ga0501242_000064_2223_4034 | 538 |
| 734 | 3300049686 | Ga0501257_006948 | Ga0501257_006948_603_2405 | 538 |
| 735 | 3300049688 | Ga0501259_001123 | Ga0501259_001123_1072_2874 | 538 |
| 736 | 3300049704 | Ga0501221_001922 | Ga0501221_001922_521_2323 | 538 |
| 737 | 3300049705 | Ga0501225_0005485 | Ga0501225_0005485_505_2307 | 538 |
| 738 | 3300049708 | Ga0501245_000056 | Ga0501245_000056_737_2539 | 538 |
| 739 | 3300049822 | Ga0501035_0099067 | Ga0501035_0099067_95_1777 | 538 |
| 740 | 3300049823 | Ga0501044_0036018 | Ga0501044_0036018_33_1760 | 538 |
| 741 | 3300050508 | nmdc:mga09592_31590_c1 | nmdc:mga09592_31590_c1_1213_2919 | 538 |
| 742 | 3300050509 | nmdc:mga0qj67_11847_c1 | nmdc:mga0qj67_11847_c1_2022_3728 | 538 |
| 743 | 3300050510 | nmdc:mga06r32_33770_c1 | nmdc:mga06r32_33770_c1_1296_3002 | 538 |
| 744 | 3300053108 | Ga0500562_000005 | Ga0500562_000005_13106_14836 | 538 |
| 745 | 3300053139 | Ga0500568_0002456 | Ga0500568_0002456_289_2058 | 538 |
| 746 | 3300053156 | Ga0500622_0009662 | Ga0500622_0009662_1513_3195 | 538 |
| 747 | 3300055283 | Ga0500661_008248 | Ga0500661_008248_97_1779 | 538 |
| 748 | 3300003323 | rootH1_10117601 | rootH1_101176013 | 539 |
| 749 | 3300005295 | Ga0065707_10098632 | Ga0065707_100986323 | 539 |
| 750 | 3300005329 | Ga0070683_100000508 | Ga0070683_10000050816 | 539 |
| 751 | 3300005329 | Ga0070683_100002318 | Ga0070683_1000023183 | 539 |
| 752 | 3300005329 | Ga0070683_100023175 | Ga0070683_1000231754 | 539 |
| 753 | 3300005330 | Ga0070690_100031981 | Ga0070690_1000319812 | 539 |
| 754 | 3300005331 | Ga0070670_100055395 | Ga0070670_1000553952 | 539 |
| 755 | 3300005334 | Ga0068869_100000739 | Ga0068869_10000073914 | 539 |
| 756 | 3300005334 | Ga0068869_100015990 | Ga0068869_1000159902 | 539 |
| 757 | 3300005335 | Ga0070666_10002049 | Ga0070666_1000204911 | 539 |
| 758 | 3300005338 | Ga0068868_100000543 | Ga0068868_10000054312 | 539 |
| 759 | 3300005338 | Ga0068868_100032037 | Ga0068868_1000320372 | 539 |
| 760 | 3300005340 | Ga0070689_100004881 | Ga0070689_1000048819 | 539 |
| 761 | 3300005344 | Ga0070661_100000111 | Ga0070661_10000011116 | 539 |
| 762 | 3300005344 | Ga0070661_100012082 | Ga0070661_1000120824 | 539 |
| 763 | 3300005353 | Ga0070669_100012807 | Ga0070669_1000128074 | 539 |
| 764 | 3300005354 | Ga0070675_100001118 | Ga0070675_10000111816 | 539 |
| 765 | 3300005355 | Ga0070671_100016684 | Ga0070671_1000166845 | 539 |
| 766 | 3300005364 | Ga0070673_100005388 | Ga0070673_1000053888 | 539 |
| 767 | 3300005366 | Ga0070659_100004285 | Ga0070659_1000042855 | 539 |
| 768 | 3300005366 | Ga0070659_100018906 | Ga0070659_1000189064 | 539 |
| 769 | 3300005367 | Ga0070667_100005088 | Ga0070667_1000050889 | 539 |
| 770 | 3300005457 | Ga0070662_100007893 | Ga0070662_1000078934 | 539 |
| 771 | 3300005457 | Ga0070662_100054931 | Ga0070662_1000549312 | 539 |
| 772 | 3300005466 | Ga0070685_10021575 | Ga0070685_100215753 | 539 |
| 773 | 3300005471 | Ga0070698_100025699 | Ga0070698_1000256993 | 539 |
| 774 | 3300005535 | Ga0070684_100001291 | Ga0070684_1000012918 | 539 |
| 775 | 3300005539 | Ga0068853_100007168 | Ga0068853_1000071687 | 539 |
| 776 | 3300005548 | Ga0070665_100115026 | Ga0070665_1001150262 | 539 |
| 777 | 3300005564 | Ga0070664_100000243 | Ga0070664_10000024312 | 539 |
| 778 | 3300005564 | Ga0070664_100000575 | Ga0070664_10000057514 | 539 |
| 779 | 3300005564 | Ga0070664_100036167 | Ga0070664_1000361672 | 539 |
| 780 | 3300005577 | Ga0068857_100089760 | Ga0068857_1000897602 | 539 |
| 781 | 3300005578 | Ga0068854_100097467 | Ga0068854_1000974672 | 539 |
| 782 | 3300005616 | Ga0068852_100003210 | Ga0068852_1000032102 | 539 |
| 783 | 3300005617 | Ga0068859_100006362 | Ga0068859_10000636210 | 539 |
| 784 | 3300005617 | Ga0068859_100018396 | Ga0068859_1000183962 | 539 |
| 785 | 3300005840 | Ga0068870_10007549 | Ga0068870_100075493 | 539 |
| 786 | 3300005844 | Ga0068862_100006209 | Ga0068862_10000620911 | 539 |
| 787 | 3300005985 | Ga0081539_10014329 | Ga0081539_100143292 | 539 |
| 788 | 3300006237 | Ga0097621_100077093 | Ga0097621_1000770932 | 539 |
| 789 | 3300006358 | Ga0068871_100051945 | Ga0068871_1000519452 | 539 |
| 790 | 3300006844 | Ga0075428_100095861 | Ga0075428_1000958613 | 539 |
| 791 | 3300006931 | Ga0097620_100006362 | Ga0097620_1000063624 | 539 |
| 792 | 3300006931 | Ga0097620_100018396 | Ga0097620_1000183966 | 539 |
| 793 | 3300009094 | Ga0111539_10016272 | Ga0111539_100162725 | 539 |
| 794 | 3300009176 | Ga0105242_10036072 | Ga0105242_100360723 | 539 |
| 795 | 3300009553 | Ga0105249_10025989 | Ga0105249_100259894 | 539 |
| 796 | 3300009553 | Ga0105249_10138193 | Ga0105249_101381931 | 539 |
| 797 | 3300013100 | Ga0157373_10013073 | Ga0157373_100130736 | 539 |
| 798 | 3300013296 | Ga0157374_10006867 | Ga0157374_100068678 | 539 |
| 799 | 3300013306 | Ga0163162_10004298 | Ga0163162_100042989 | 539 |
| 800 | 3300013306 | Ga0163162_10059758 | Ga0163162_100597583 | 539 |
| 801 | 3300013306 | Ga0163162_10061209 | Ga0163162_100612092 | 539 |
| 802 | 3300013307 | Ga0157372_10116165 | Ga0157372_101161653 | 539 |
| 803 | 3300013308 | Ga0157375_10007261 | Ga0157375_100072613 | 539 |
| 804 | 3300013308 | Ga0157375_10056528 | Ga0157375_100565283 | 539 |
| 805 | 3300014326 | Ga0157380_10033908 | Ga0157380_100339082 | 539 |
| 806 | 3300014745 | Ga0157377_10004071 | Ga0157377_100040714 | 539 |
| 807 | 3300014968 | Ga0157379_10026553 | Ga0157379_100265533 | 539 |
| 808 | 3300014969 | Ga0157376_10028267 | Ga0157376_100282673 | 539 |
| 809 | 3300014969 | Ga0157376_10070217 | Ga0157376_100702173 | 539 |
| 810 | 3300017792 | Ga0163161_10018794 | Ga0163161_100187942 | 539 |
| 811 | 3300017792 | Ga0163161_10044659 | Ga0163161_100446592 | 539 |
| 812 | 3300025904 | Ga0207647_10000096 | Ga0207647_1000009612 | 539 |
| 813 | 3300025904 | Ga0207647_10056788 | Ga0207647_100567882 | 539 |
| 814 | 3300025908 | Ga0207643_10019405 | Ga0207643_100194053 | 539 |
| 815 | 3300025918 | Ga0207662_10030141 | Ga0207662_100301411 | 539 |
| 816 | 3300025920 | Ga0207649_10002398 | Ga0207649_100023984 | 539 |
| 817 | 3300025923 | Ga0207681_10002024 | Ga0207681_100020247 | 539 |
| 818 | 3300025925 | Ga0207650_10066726 | Ga0207650_100667263 | 539 |
| 819 | 3300025932 | Ga0207690_10001171 | Ga0207690_1000117115 | 539 |
| 820 | 3300025932 | Ga0207690_10002934 | Ga0207690_100029346 | 539 |
| 821 | 3300025933 | Ga0207706_10005261 | Ga0207706_1000526110 | 539 |
| 822 | 3300025933 | Ga0207706_10035062 | Ga0207706_100350623 | 539 |
| 823 | 3300025933 | Ga0207706_10051143 | Ga0207706_100511431 | 539 |
| 824 | 3300025936 | Ga0207670_10002141 | Ga0207670_1000214110 | 539 |
| 825 | 3300025936 | Ga0207670_10013100 | Ga0207670_100131004 | 539 |
| 826 | 3300025936 | Ga0207670_10076597 | Ga0207670_100765972 | 539 |
| 827 | 3300025940 | Ga0207691_10027218 | Ga0207691_100272183 | 539 |
| 828 | 3300025942 | Ga0207689_10002851 | Ga0207689_100028517 | 539 |
| 829 | 3300025942 | Ga0207689_10005578 | Ga0207689_100055787 | 539 |
| 830 | 3300025944 | Ga0207661_10000669 | Ga0207661_1000066912 | 539 |
| 831 | 3300025944 | Ga0207661_10011967 | Ga0207661_100119672 | 539 |
| 832 | 3300025944 | Ga0207661_10062118 | Ga0207661_100621182 | 539 |
| 833 | 3300025945 | Ga0207679_10000091 | Ga0207679_1000009168 | 539 |
| 834 | 3300025945 | Ga0207679_10004528 | Ga0207679_100045284 | 539 |
| 835 | 3300025945 | Ga0207679_10054054 | Ga0207679_100540542 | 539 |
| 836 | 3300025960 | Ga0207651_10058053 | Ga0207651_100580532 | 539 |
| 837 | 3300025960 | Ga0207651_10106870 | Ga0207651_101068702 | 539 |
| 838 | 3300025961 | Ga0207712_10066574 | Ga0207712_100665742 | 539 |
| 839 | 3300026023 | Ga0207677_10004007 | Ga0207677_100040075 | 539 |
| 840 | 3300026023 | Ga0207677_10007307 | Ga0207677_100073074 | 539 |
| 841 | 3300026041 | Ga0207639_10001896 | Ga0207639_100018968 | 539 |
| 842 | 3300026041 | Ga0207639_10016310 | Ga0207639_100163104 | 539 |
| 843 | 3300026067 | Ga0207678_10009466 | Ga0207678_100094665 | 539 |
| 844 | 3300026088 | Ga0207641_10118440 | Ga0207641_101184402 | 539 |
| 845 | 3300026088 | Ga0207641_10160467 | Ga0207641_101604671 | 539 |
| 846 | 3300026089 | Ga0207648_10018365 | Ga0207648_100183656 | 539 |
| 847 | 3300026095 | Ga0207676_10003274 | Ga0207676_100032745 | 539 |
| 848 | 3300026116 | Ga0207674_10005257 | Ga0207674_100052572 | 539 |
| 849 | 3300027907 | Ga0207428_10037266 | Ga0207428_100372663 | 539 |
| 850 | 3300028380 | Ga0268265_10004802 | Ga0268265_100048029 | 539 |
| 851 | 3300028381 | Ga0268264_10075400 | Ga0268264_100754002 | 539 |
| 852 | 3300035119 | Ga0373956_0017169 | Ga0373956_0017169_795_2516 | 539 |
| 853 | 3300036401 | Ga0373937_0003368 | Ga0373937_0003368_5827_7548 | 539 |
| 854 | 3300042004 | Ga0439445_0008793 | Ga0439445_0008793_452_2284 | 539 |
| 855 | 3300046511 | Ga0495608_0035325 | Ga0495608_0035325_998_2719 | 539 |
| 856 | 3300046517 | Ga0495630_0006610 | Ga0495630_0006610_4512_6233 | 539 |
| 857 | 3300046533 | Ga0495640_0067516 | Ga0495640_0067516_584_2305 | 539 |
| 858 | 3300046535 | Ga0495586_0024780 | Ga0495586_0024780_533_2254 | 539 |
| 859 | 3300046642 | Ga0495634_0013547 | Ga0495634_0013547_3157_4878 | 539 |
| 860 | 3300047320 | Ga0495672_0050373 | Ga0495672_0050373_535_2250 | 539 |
| 861 | 3300047322 | Ga0495680_0056007 | Ga0495680_0056007_88_1809 | 539 |
| 862 | 3300048913 | Ga0496110_0082616 | Ga0496110_0082616_903_2624 | 539 |
| 863 | 3300049571 | Ga0501034_0014290 | Ga0501034_0014290_2067_3782 | 539 |
| 864 | 3300049573 | Ga0501037_0012007 | Ga0501037_0012007_1086_2804 | 539 |
| 865 | 3300049580 | Ga0501046_0096338 | Ga0501046_0096338_479_2197 | 539 |
| 866 | 3300049589 | Ga0501073_0014754 | Ga0501073_0014754_686_2401 | 539 |
| 867 | 3300050511 | nmdc:mga08y16_5833_c1 | nmdc:mga08y16_5833_c1_370_2148 | 539 |
| 868 | 2162886007 | SwRhRL2b_contig_1663468 | SwRhRL2b_0819.00004000 | 540 |
| 869 | 3300003323 | rootH1_10004531 | rootH1_100045313 | 540 |
| 870 | 3300005289 | Ga0065704_10070133 | Ga0065704_100701331132 | 540 |
| 871 | 3300005548 | Ga0070665_100008108 | Ga0070665_1000081083 | 540 |
| 872 | 3300009093 | Ga0105240_10000020 | Ga0105240_10000020353 | 540 |
| 873 | 3300009093 | Ga0105240_10010712 | Ga0105240_100107125 | 540 |
| 874 | 3300010375 | Ga0105239_10000631 | Ga0105239_1000063122 | 540 |
| 875 | 3300013104 | Ga0157370_10106726 | Ga0157370_101067262 | 540 |
| 876 | 3300013307 | Ga0157372_10006438 | Ga0157372_100064383 | 540 |
| 877 | 3300025904 | Ga0207647_10011414 | Ga0207647_100114143 | 540 |
| 878 | 3300025913 | Ga0207695_10000020 | Ga0207695_10000020171 | 540 |
| 879 | 3300025913 | Ga0207695_10009054 | Ga0207695_100090543 | 540 |
| 880 | 3300025914 | Ga0207671_10000025 | Ga0207671_10000025214 | 540 |
| 881 | 3300026023 | Ga0207677_10017223 | Ga0207677_100172233 | 540 |
| 882 | 3300028800 | Ga0265338_10027407 | Ga0265338_100274074 | 540 |
| 883 | 3300031251 | Ga0265327_10000098 | Ga0265327_1000009874 | 540 |
| 884 | 3300031251 | Ga0265327_10000338 | Ga0265327_1000033877 | 540 |
| 885 | 3300046616 | Ga0495668_0000450 | Ga0495668_0000450_12856_14538 | 540 |
| 886 | 3300046616 | Ga0495668_0038502 | Ga0495668_0038502_113_1864 | 540 |
| 887 | 3300047318 | Ga0495636_0000053 | Ga0495636_0000053_31009_32691 | 540 |
| 888 | 3300047472 | Ga0495686_0000234 | Ga0495686_0000234_97629_99311 | 540 |
| 889 | 3300048917 | Ga0496114_0007992 | Ga0496114_0007992_6567_8282 | 540 |
| 890 | 3300053153 | Ga0500616_0000626 | Ga0500616_0000626_13381_15096 | 540 |
| 891 | 3300053158 | Ga0500627_0018755 | Ga0500627_0018755_954_2636 | 540 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fiu-assembly2.cif.gz_D | structure of nmn synthetase from francisella tularensis | 0.9254 | 260 | 512 |
| 2e18-assembly1.cif.gz_B | crystal structure of project ph0182 from pyrococcus horikoshii ot3 | 0.918 | 261 | 512 |
| 1xnh-assembly1.cif.gz_A-2 | crystal structure of nh3-dependent nad+ synthetase from helicobacter pylori | 0.911 | 264 | 511 |
| 3p52-assembly1.cif.gz_B | nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion | 0.9075 | 261 | 511 |
| 3p52-assembly1.cif.gz_A | nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion | 0.901 | 261 | 511 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3n05B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9407 | 263 | 449 | 3.40.50.620 |
| 3n05B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9257 | 263 | 449 | 3.40.50.620 |
| af_Q58747_4_258_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9254 | 263 | 512 | 3.40.50.620 |
| 2e18A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9184 | 261 | 512 | 3.40.50.620 |
| 1xnhA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.911 | 264 | 511 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534NNB0-F1-model_v4 | NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) | 0.9945 | 264 | 399 |
GO:0003952
GO:0004359 GO:0005524 GO:0005737 GO:0008795 GO:0009435 |
| AF-A0A3D2JLK1-F1-model_v4 | NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) | 0.9903 | 297 | 403 |
GO:0003952
GO:0004359 GO:0005524 GO:0005737 GO:0008795 GO:0009435 |
| AF-A0A662U6F9-F1-model_v4 | NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) | 0.9869 | 261 | 342 |
GO:0003921
GO:0003952 GO:0004359 GO:0005524 GO:0005737 GO:0008795 GO:0009435 |
| AF-A0A660VFN2-F1-model_v4 | NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) | 0.981 | 264 | 347 |
GO:0003952
GO:0004359 GO:0005524 GO:0005737 GO:0008795 GO:0009435 |
| AF-A0A7X6SCG4-F1-model_v4 | NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) | 0.9782 | 263 | 525 |
GO:0003952
GO:0004359 GO:0005524 GO:0005737 GO:0008795 GO:0009435 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar