F484831
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 890 | 263 | 890 | 236 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0010982|Ga0495672_0010982_1957_2805 |
| Length | 282 |
| Sequence | LDQGKPFFICHFSFEIWNLEFVIARPRLADSANNEIGVRVLFFGAARDAVGKGEVDLVLQGTPTASSAFASVLARFPELGRFGRSLLFAVNQEYAQADREVHDGDELAVFPPVSGGSSGTAEVSPVATFPEDFFELTTNSIDVGSVARRVVLPACGATVTLDGYAREWTRGRRTLYLVYEAYAPMAVLELQRLGREVHERFEIAHIGIVHRTGKLEIGETSVVIAVSAPHRQAAFAACEWAIKELKRTVPIWKKEFFEDGEVWVDGEEQTGNRGTGEMGNGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 179 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 190 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 203 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 204 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 205 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 206 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 218 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 219 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 220 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 222 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 223 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 226 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 227 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 228 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 229 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 234 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 235 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 236 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 239 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 240 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 241 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 242 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 243 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 244 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 245 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 246 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 247 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 248 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 249 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 251 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 262 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 263 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.22 |
| Nodule | 0 |
| Rhizoplane | 1.46 |
| Rhizosphere | 98.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1681169 | 2162886007 | Unclassified | 917 |
| 2 | CNAas_1001118 | 3300000532 | Bacteria | 2444 |
| 3 | JGI24034J14986_100817 | 3300001432 | Bacteria | 1847 |
| 4 | JGI24748J21848_1000001 | 3300002074 | Bacteria | 444271 |
| 5 | JGI24034J26672_10000001 | 3300002239 | Bacteria | 1118280 |
| 6 | JGI24742J22300_10019119 | 3300002244 | Bacteria | 1162 |
| 7 | JGI24751J29686_10000011 | 3300002459 | Bacteria | 117978 |
| 8 | JGI25406J46586_10000950 | 3300003203 | Bacteria | 13632 |
| 9 | rootH2_10208663 | 3300003320 | Unclassified | 1291 |
| 10 | Ga0065714_10064818 | 3300005288 | Bacteria | 18008 |
| 11 | Ga0065704_10012374 | 3300005289 | Unclassified | 2472 |
| 12 | Ga0065704_10021194 | 3300005289 | Unclassified | 1551 |
| 13 | Ga0065704_10198323 | 3300005289 | Unclassified | 1158 |
| 14 | Ga0065712_10009824 | 3300005290 | Bacteria | 2841 |
| 15 | Ga0065712_10067985 | 3300005290 | Bacteria | 18008 |
| 16 | Ga0065712_10074944 | 3300005290 | Bacteria | 3974 |
| 17 | Ga0065712_10084272 | 3300005290 | Bacteria | 2778 |
| 18 | Ga0065712_10086831 | 3300005290 | Bacteria | 2613 |
| 19 | Ga0065715_10000408 | 3300005293 | Bacteria | 15621 |
| 20 | Ga0065715_10095739 | 3300005293 | Bacteria | 4017 |
| 21 | Ga0065715_10108004 | 3300005293 | Bacteria | 2741 |
| 22 | Ga0065715_10115352 | 3300005293 | Unclassified | 2418 |
| 23 | Ga0065715_10174771 | 3300005293 | Viruses | 1520 |
| 24 | Ga0065715_10175709 | 3300005293 | Bacteria | 1513 |
| 25 | Ga0065707_10000695 | 3300005295 | Bacteria | 15926 |
| 26 | Ga0065707_10004636 | 3300005295 | Unclassified | 4917 |
| 27 | Ga0065707_10032723 | 3300005295 | Unclassified | 890 |
| 28 | Ga0070676_10213757 | 3300005328 | Bacteria | 1270 |
| 29 | Ga0070690_100005613 | 3300005330 | Bacteria | 7061 |
| 30 | Ga0070690_100010815 | 3300005330 | Bacteria | 5322 |
| 31 | Ga0070690_100020494 | 3300005330 | Bacteria | 4028 |
| 32 | Ga0070690_100072419 | 3300005330 | Bacteria | 2241 |
| 33 | Ga0070670_100000295 | 3300005331 | Bacteria | 43851 |
| 34 | Ga0070670_100346236 | 3300005331 | Bacteria | 1305 |
| 35 | Ga0070670_100715437 | 3300005331 | Bacteria | 901 |
| 36 | Ga0068869_100002098 | 3300005334 | Bacteria | 11981 |
| 37 | Ga0068869_100007543 | 3300005334 | Bacteria | 6961 |
| 38 | Ga0068869_100034544 | 3300005334 | Bacteria | 3577 |
| 39 | Ga0068869_100095695 | 3300005334 | Unclassified | 2241 |
| 40 | Ga0068869_100377013 | 3300005334 | Unclassified | 1162 |
| 41 | Ga0068869_100410224 | 3300005334 | Bacteria | 1116 |
| 42 | Ga0070666_10017717 | 3300005335 | Bacteria | 4570 |
| 43 | Ga0070680_100002436 | 3300005336 | Bacteria | 13786 |
| 44 | Ga0070680_100711112 | 3300005336 | Bacteria | 864 |
| 45 | Ga0070682_100000284 | 3300005337 | Bacteria | 36241 |
| 46 | Ga0070682_100003919 | 3300005337 | Bacteria | 8258 |
| 47 | Ga0068868_100011754 | 3300005338 | Bacteria | 6380 |
| 48 | Ga0068868_100168430 | 3300005338 | Bacteria | 1813 |
| 49 | Ga0068868_100212279 | 3300005338 | Bacteria | 1618 |
| 50 | Ga0070660_100747861 | 3300005339 | Unclassified | 821 |
| 51 | Ga0070689_100015200 | 3300005340 | Bacteria | 5608 |
| 52 | Ga0070689_100181243 | 3300005340 | Bacteria | 1711 |
| 53 | Ga0070691_10013382 | 3300005341 | Bacteria | 3758 |
| 54 | Ga0070687_100053771 | 3300005343 | Unclassified | 2095 |
| 55 | Ga0070687_100231762 | 3300005343 | Unclassified | 1137 |
| 56 | Ga0070692_10010986 | 3300005345 | Unclassified | 4144 |
| 57 | Ga0070692_10014617 | 3300005345 | Unclassified | 3693 |
| 58 | Ga0070692_10045493 | 3300005345 | Unclassified | 2264 |
| 59 | Ga0070692_10079040 | 3300005345 | Bacteria | 1767 |
| 60 | Ga0070692_10095853 | 3300005345 | Bacteria | 1620 |
| 61 | Ga0070692_10302900 | 3300005345 | Unclassified | 976 |
| 62 | Ga0070668_100024570 | 3300005347 | Bacteria | 4566 |
| 63 | Ga0070668_100888584 | 3300005347 | Unclassified | 796 |
| 64 | Ga0070669_100001335 | 3300005353 | Bacteria | 17792 |
| 65 | Ga0070669_100005821 | 3300005353 | Bacteria | 8890 |
| 66 | Ga0070669_100025634 | 3300005353 | Bacteria | 4235 |
| 67 | Ga0070669_100185867 | 3300005353 | Bacteria | 1628 |
| 68 | Ga0070669_100263468 | 3300005353 | Bacteria | 1376 |
| 69 | Ga0070675_100032362 | 3300005354 | Bacteria | 4232 |
| 70 | Ga0070671_100006944 | 3300005355 | Bacteria | 9069 |
| 71 | Ga0070671_100040518 | 3300005355 | Bacteria | 3869 |
| 72 | Ga0070671_100077319 | 3300005355 | Bacteria | 2781 |
| 73 | Ga0070671_100467960 | 3300005355 | Bacteria | 1082 |
| 74 | Ga0070674_100070927 | 3300005356 | Unclassified | 2463 |
| 75 | Ga0070673_100080591 | 3300005364 | Bacteria | 2638 |
| 76 | Ga0070673_100180424 | 3300005364 | Bacteria | 1807 |
| 77 | Ga0070673_100282563 | 3300005364 | Bacteria | 1456 |
| 78 | Ga0070673_100463603 | 3300005364 | Bacteria | 1141 |
| 79 | Ga0070673_100551232 | 3300005364 | Unclassified | 1047 |
| 80 | Ga0070673_100601507 | 3300005364 | Bacteria | 1003 |
| 81 | Ga0070688_100054417 | 3300005365 | Bacteria | 2506 |
| 82 | Ga0070688_100498018 | 3300005365 | Bacteria | 918 |
| 83 | Ga0070703_10000014 | 3300005406 | Bacteria | 89131 |
| 84 | Ga0070709_10077904 | 3300005434 | Bacteria | 2156 |
| 85 | Ga0070701_10019919 | 3300005438 | Unclassified | 3175 |
| 86 | Ga0070701_10048333 | 3300005438 | Bacteria | 2195 |
| 87 | Ga0070701_10155558 | 3300005438 | Unclassified | 1320 |
| 88 | Ga0070705_100063752 | 3300005440 | Unclassified | 2199 |
| 89 | Ga0070705_100095064 | 3300005440 | Bacteria | 1868 |
| 90 | Ga0070705_100100463 | 3300005440 | Bacteria | 1825 |
| 91 | Ga0070705_100117014 | 3300005440 | Bacteria | 1714 |
| 92 | Ga0070700_100000103 | 3300005441 | Bacteria | 53591 |
| 93 | Ga0070700_100001274 | 3300005441 | Bacteria | 12502 |
| 94 | Ga0070700_100007401 | 3300005441 | Bacteria | 5926 |
| 95 | Ga0070700_100009846 | 3300005441 | Bacteria | 5257 |
| 96 | Ga0070700_100037286 | 3300005441 | Unclassified | 2956 |
| 97 | Ga0070700_100039267 | 3300005441 | Bacteria | 2891 |
| 98 | Ga0070700_100047033 | 3300005441 | Bacteria | 2668 |
| 99 | Ga0070700_100050677 | 3300005441 | Unclassified | 2581 |
| 100 | Ga0070700_100084723 | 3300005441 | Unclassified | 2055 |
| 101 | Ga0070700_100168275 | 3300005441 | Unclassified | 1516 |
| 102 | Ga0070700_100353940 | 3300005441 | Bacteria | 1090 |
| 103 | Ga0070700_100505228 | 3300005441 | Bacteria | 931 |
| 104 | Ga0070694_100000381 | 3300005444 | Bacteria | 23963 |
| 105 | Ga0070694_100015550 | 3300005444 | Bacteria | 4781 |
| 106 | Ga0070694_100016088 | 3300005444 | Bacteria | 4708 |
| 107 | Ga0070694_100016758 | 3300005444 | Bacteria | 4617 |
| 108 | Ga0070694_100061927 | 3300005444 | Bacteria | 2555 |
| 109 | Ga0070694_100096731 | 3300005444 | Bacteria | 2081 |
| 110 | Ga0070694_100117169 | 3300005444 | Bacteria | 1906 |
| 111 | Ga0070694_100149359 | 3300005444 | Bacteria | 1705 |
| 112 | Ga0070694_100181115 | 3300005444 | Unclassified | 1559 |
| 113 | Ga0070694_100551895 | 3300005444 | Bacteria | 923 |
| 114 | Ga0070694_100578948 | 3300005444 | Unclassified | 902 |
| 115 | Ga0070708_100001824 | 3300005445 | Bacteria | 16336 |
| 116 | Ga0070708_100045574 | 3300005445 | Bacteria | 3864 |
| 117 | Ga0070663_100754065 | 3300005455 | Viruses | 831 |
| 118 | Ga0070662_100016422 | 3300005457 | Unclassified | 4972 |
| 119 | Ga0070662_100047380 | 3300005457 | Bacteria | 3092 |
| 120 | Ga0070662_100055917 | 3300005457 | Bacteria | 2864 |
| 121 | Ga0070681_10000359 | 3300005458 | Bacteria | 36799 |
| 122 | Ga0070681_10001543 | 3300005458 | Bacteria | 20396 |
| 123 | Ga0070681_10221183 | 3300005458 | Bacteria | 1808 |
| 124 | Ga0068867_100051711 | 3300005459 | Bacteria | 3031 |
| 125 | Ga0068867_100220419 | 3300005459 | Bacteria | 1528 |
| 126 | Ga0070685_10004591 | 3300005466 | Bacteria | 6988 |
| 127 | Ga0070706_100000001 | 3300005467 | Bacteria | 342302 |
| 128 | Ga0070706_100001194 | 3300005467 | Bacteria | 27840 |
| 129 | Ga0070706_100004663 | 3300005467 | Bacteria | 13148 |
| 130 | Ga0070706_100033745 | 3300005467 | Bacteria | 4725 |
| 131 | Ga0070706_100050601 | 3300005467 | Bacteria | 3834 |
| 132 | Ga0070706_100105036 | 3300005467 | Bacteria | 2628 |
| 133 | Ga0070706_100262549 | 3300005467 | Bacteria | 1612 |
| 134 | Ga0070707_100001152 | 3300005468 | Bacteria | 25962 |
| 135 | Ga0070707_100005091 | 3300005468 | Bacteria | 12322 |
| 136 | Ga0070707_100013363 | 3300005468 | Bacteria | 7679 |
| 137 | Ga0070707_100015254 | 3300005468 | Bacteria | 7211 |
| 138 | Ga0070707_100075469 | 3300005468 | Bacteria | 3252 |
| 139 | Ga0070707_100079397 | 3300005468 | Bacteria | 3167 |
| 140 | Ga0070707_100107578 | 3300005468 | Bacteria | 2705 |
| 141 | Ga0070707_100257053 | 3300005468 | Bacteria | 1700 |
| 142 | Ga0070707_100292866 | 3300005468 | Bacteria | 1582 |
| 143 | Ga0070707_100296334 | 3300005468 | Bacteria | 1572 |
| 144 | Ga0070707_100394973 | 3300005468 | Bacteria | 1343 |
| 145 | Ga0070698_100001546 | 3300005471 | Bacteria | 25524 |
| 146 | Ga0070698_100004183 | 3300005471 | Bacteria | 15855 |
| 147 | Ga0070698_100009712 | 3300005471 | Bacteria | 10290 |
| 148 | Ga0070698_100013859 | 3300005471 | Bacteria | 8525 |
| 149 | Ga0070698_100341324 | 3300005471 | Unclassified | 1429 |
| 150 | Ga0070698_100572419 | 3300005471 | Bacteria | 1069 |
| 151 | Ga0070698_100646494 | 3300005471 | Bacteria | 999 |
| 152 | Ga0070699_100000581 | 3300005518 | Bacteria | 34545 |
| 153 | Ga0070699_100002585 | 3300005518 | Bacteria | 16222 |
| 154 | Ga0070699_100012111 | 3300005518 | Bacteria | 7444 |
| 155 | Ga0070699_100207321 | 3300005518 | Bacteria | 1744 |
| 156 | Ga0070699_100227025 | 3300005518 | Bacteria | 1665 |
| 157 | Ga0070699_100303452 | 3300005518 | Bacteria | 1433 |
| 158 | Ga0070699_100630121 | 3300005518 | Bacteria | 978 |
| 159 | Ga0070679_100000081 | 3300005530 | Bacteria | 71191 |
| 160 | Ga0070697_100000449 | 3300005536 | Bacteria | 31648 |
| 161 | Ga0070697_100000459 | 3300005536 | Bacteria | 31292 |
| 162 | Ga0070697_100041216 | 3300005536 | Unclassified | 3736 |
| 163 | Ga0070697_100113805 | 3300005536 | Unclassified | 2257 |
| 164 | Ga0070697_100145467 | 3300005536 | Bacteria | 1995 |
| 165 | Ga0070697_100444376 | 3300005536 | Bacteria | 1129 |
| 166 | Ga0068853_100122909 | 3300005539 | Bacteria | 2317 |
| 167 | Ga0070672_100068745 | 3300005543 | Bacteria | 2810 |
| 168 | Ga0070672_100466389 | 3300005543 | Bacteria | 1089 |
| 169 | Ga0070686_100025351 | 3300005544 | Bacteria | 3568 |
| 170 | Ga0070686_100031105 | 3300005544 | Unclassified | 3261 |
| 171 | Ga0070686_100034421 | 3300005544 | Unclassified | 3122 |
| 172 | Ga0070686_100049338 | 3300005544 | Unclassified | 2670 |
| 173 | Ga0070686_100128410 | 3300005544 | Bacteria | 1750 |
| 174 | Ga0070695_100003269 | 3300005545 | Bacteria | 9467 |
| 175 | Ga0070695_100013440 | 3300005545 | Unclassified | 4920 |
| 176 | Ga0070695_100052191 | 3300005545 | Bacteria | 2627 |
| 177 | Ga0070695_100085925 | 3300005545 | Unclassified | 2090 |
| 178 | Ga0070695_100123105 | 3300005545 | Bacteria | 1777 |
| 179 | Ga0070695_100136923 | 3300005545 | Bacteria | 1693 |
| 180 | Ga0070695_100161560 | 3300005545 | Unclassified | 1573 |
| 181 | Ga0070695_100165618 | 3300005545 | Bacteria | 1556 |
| 182 | Ga0070695_100249761 | 3300005545 | Bacteria | 1290 |
| 183 | Ga0070695_100341849 | 3300005545 | Bacteria | 1118 |
| 184 | Ga0070695_100612699 | 3300005545 | Unclassified | 856 |
| 185 | Ga0070696_100012857 | 3300005546 | Bacteria | 5618 |
| 186 | Ga0070696_100077461 | 3300005546 | Bacteria | 2349 |
| 187 | Ga0070696_100164388 | 3300005546 | Unclassified | 1637 |
| 188 | Ga0070696_100230504 | 3300005546 | Bacteria | 1393 |
| 189 | Ga0070696_100401312 | 3300005546 | Bacteria | 1073 |
| 190 | Ga0070693_100009029 | 3300005547 | Bacteria | 4948 |
| 191 | Ga0070693_100083444 | 3300005547 | Bacteria | 1910 |
| 192 | Ga0070693_100097942 | 3300005547 | Bacteria | 1781 |
| 193 | Ga0070693_100120423 | 3300005547 | Bacteria | 1627 |
| 194 | Ga0070693_100256533 | 3300005547 | Unclassified | 1161 |
| 195 | Ga0070693_100434970 | 3300005547 | Unclassified | 917 |
| 196 | Ga0070693_100462596 | 3300005547 | Unclassified | 893 |
| 197 | Ga0070665_100031357 | 3300005548 | Bacteria | 5350 |
| 198 | Ga0070704_100001798 | 3300005549 | Bacteria | 11788 |
| 199 | Ga0070704_100025781 | 3300005549 | Bacteria | 3874 |
| 200 | Ga0070704_100032633 | 3300005549 | Bacteria | 3514 |
| 201 | Ga0070704_100068744 | 3300005549 | Bacteria | 2564 |
| 202 | Ga0070704_100103329 | 3300005549 | Bacteria | 2152 |
| 203 | Ga0070704_100210137 | 3300005549 | Unclassified | 1576 |
| 204 | Ga0070704_100307522 | 3300005549 | Bacteria | 1323 |
| 205 | Ga0070704_100374626 | 3300005549 | Unclassified | 1208 |
| 206 | Ga0070704_100417910 | 3300005549 | Bacteria | 1148 |
| 207 | Ga0070704_100570460 | 3300005549 | Unclassified | 991 |
| 208 | Ga0070704_101003467 | 3300005549 | Unclassified | 755 |
| 209 | Ga0068855_101199584 | 3300005563 | Unclassified | 789 |
| 210 | Ga0070664_100040159 | 3300005564 | Bacteria | 3944 |
| 211 | Ga0070664_100061803 | 3300005564 | Bacteria | 3193 |
| 212 | Ga0068857_100009027 | 3300005577 | Bacteria | 8646 |
| 213 | Ga0068857_100237115 | 3300005577 | Bacteria | 1669 |
| 214 | Ga0068857_100312629 | 3300005577 | Bacteria | 1450 |
| 215 | Ga0068857_100390208 | 3300005577 | Bacteria | 1294 |
| 216 | Ga0068857_100440075 | 3300005577 | Unclassified | 1218 |
| 217 | Ga0068854_100077229 | 3300005578 | Unclassified | 2450 |
| 218 | Ga0068854_100089363 | 3300005578 | Bacteria | 2289 |
| 219 | Ga0068854_100233886 | 3300005578 | Unclassified | 1460 |
| 220 | Ga0068854_100423488 | 3300005578 | Unclassified | 1106 |
| 221 | Ga0068854_100718289 | 3300005578 | Bacteria | 864 |
| 222 | Ga0070702_100002352 | 3300005615 | Bacteria | 8130 |
| 223 | Ga0070702_100008924 | 3300005615 | Bacteria | 4880 |
| 224 | Ga0070702_100012362 | 3300005615 | Bacteria | 4274 |
| 225 | Ga0070702_100043521 | 3300005615 | Bacteria | 2531 |
| 226 | Ga0070702_100328650 | 3300005615 | Bacteria | 1068 |
| 227 | Ga0070702_100387679 | 3300005615 | Unclassified | 995 |
| 228 | Ga0070702_100412428 | 3300005615 | Bacteria | 969 |
| 229 | Ga0068852_100256217 | 3300005616 | Unclassified | 1678 |
| 230 | Ga0068859_100003377 | 3300005617 | Bacteria | 16230 |
| 231 | Ga0068859_100020829 | 3300005617 | Bacteria | 6581 |
| 232 | Ga0068859_100023193 | 3300005617 | Bacteria | 6226 |
| 233 | Ga0068859_100030707 | 3300005617 | Bacteria | 5392 |
| 234 | Ga0068859_100036510 | 3300005617 | Bacteria | 4933 |
| 235 | Ga0068859_100047511 | 3300005617 | Bacteria | 4313 |
| 236 | Ga0068859_100055944 | 3300005617 | Bacteria | 3970 |
| 237 | Ga0068859_100056640 | 3300005617 | Bacteria | 3946 |
| 238 | Ga0068859_100056809 | 3300005617 | Bacteria | 3941 |
| 239 | Ga0068859_100074674 | 3300005617 | Bacteria | 3429 |
| 240 | Ga0068859_100105706 | 3300005617 | Bacteria | 2874 |
| 241 | Ga0068859_100107305 | 3300005617 | Unclassified | 2852 |
| 242 | Ga0068859_100131919 | 3300005617 | Unclassified | 2570 |
| 243 | Ga0068859_100180400 | 3300005617 | Unclassified | 2194 |
| 244 | Ga0068859_100205411 | 3300005617 | Unclassified | 2055 |
| 245 | Ga0068859_100352572 | 3300005617 | Bacteria | 1566 |
| 246 | Ga0068859_100388015 | 3300005617 | Bacteria | 1492 |
| 247 | Ga0068859_100595394 | 3300005617 | Bacteria | 1199 |
| 248 | Ga0068859_100685666 | 3300005617 | Unclassified | 1116 |
| 249 | Ga0068864_100028456 | 3300005618 | Unclassified | 4724 |
| 250 | Ga0068864_100041807 | 3300005618 | Bacteria | 3920 |
| 251 | Ga0068864_100068784 | 3300005618 | Bacteria | 3077 |
| 252 | Ga0068864_100188615 | 3300005618 | Bacteria | 1889 |
| 253 | Ga0068864_100197716 | 3300005618 | Bacteria | 1846 |
| 254 | Ga0068864_100275927 | 3300005618 | Bacteria | 1568 |
| 255 | Ga0068864_100292644 | 3300005618 | Bacteria | 1522 |
| 256 | Ga0068864_100440909 | 3300005618 | Bacteria | 1244 |
| 257 | Ga0068864_100561400 | 3300005618 | Bacteria | 1104 |
| 258 | Ga0068864_101112043 | 3300005618 | Bacteria | 787 |
| 259 | Ga0068866_10003551 | 3300005718 | Bacteria | 6385 |
| 260 | Ga0068866_10013561 | 3300005718 | Bacteria | 3580 |
| 261 | Ga0068866_10033318 | 3300005718 | Bacteria | 2498 |
| 262 | Ga0068866_10134631 | 3300005718 | Bacteria | 1410 |
| 263 | Ga0068861_100012344 | 3300005719 | Bacteria | 5956 |
| 264 | Ga0068861_100040685 | 3300005719 | Bacteria | 3478 |
| 265 | Ga0068861_100159633 | 3300005719 | Bacteria | 1858 |
| 266 | Ga0068861_100214797 | 3300005719 | Bacteria | 1622 |
| 267 | Ga0068851_10014077 | 3300005834 | Bacteria | 3793 |
| 268 | Ga0068870_10017714 | 3300005840 | Bacteria | 3426 |
| 269 | Ga0068870_10024979 | 3300005840 | Unclassified | 2962 |
| 270 | Ga0068870_10036163 | 3300005840 | Bacteria | 2540 |
| 271 | Ga0068870_10040907 | 3300005840 | Bacteria | 2406 |
| 272 | Ga0068870_10107713 | 3300005840 | Bacteria | 1586 |
| 273 | Ga0068870_10380900 | 3300005840 | Bacteria | 913 |
| 274 | Ga0068863_100035473 | 3300005841 | Bacteria | 4751 |
| 275 | Ga0068863_100069915 | 3300005841 | Unclassified | 3319 |
| 276 | Ga0068863_100133858 | 3300005841 | Unclassified | 2368 |
| 277 | Ga0068863_100166099 | 3300005841 | Unclassified | 2116 |
| 278 | Ga0068863_100235255 | 3300005841 | Bacteria | 1768 |
| 279 | Ga0068863_100240461 | 3300005841 | Bacteria | 1747 |
| 280 | Ga0068858_100000051 | 3300005842 | Bacteria | 120692 |
| 281 | Ga0068858_100036187 | 3300005842 | Bacteria | 4577 |
| 282 | Ga0068858_100060742 | 3300005842 | Unclassified | 3493 |
| 283 | Ga0068858_100197665 | 3300005842 | Bacteria | 1901 |
| 284 | Ga0068858_100212180 | 3300005842 | Bacteria | 1832 |
| 285 | Ga0068858_100334643 | 3300005842 | Bacteria | 1448 |
| 286 | Ga0068858_100638313 | 3300005842 | Unclassified | 1034 |
| 287 | Ga0068860_100005783 | 3300005843 | Bacteria | 12460 |
| 288 | Ga0068860_100040266 | 3300005843 | Bacteria | 4466 |
| 289 | Ga0068860_100086324 | 3300005843 | Bacteria | 2986 |
| 290 | Ga0068860_100096569 | 3300005843 | Bacteria | 2817 |
| 291 | Ga0068860_100154892 | 3300005843 | Unclassified | 2208 |
| 292 | Ga0068860_100163022 | 3300005843 | Bacteria | 2150 |
| 293 | Ga0068860_100186580 | 3300005843 | Bacteria | 2006 |
| 294 | Ga0068860_100243631 | 3300005843 | Unclassified | 1749 |
| 295 | Ga0068860_100385440 | 3300005843 | Bacteria | 1384 |
| 296 | Ga0068862_100012345 | 3300005844 | Bacteria | 7062 |
| 297 | Ga0068862_100018701 | 3300005844 | Bacteria | 5771 |
| 298 | Ga0068862_100028889 | 3300005844 | Bacteria | 4671 |
| 299 | Ga0068862_100229241 | 3300005844 | Bacteria | 1684 |
| 300 | Ga0068862_100302220 | 3300005844 | Bacteria | 1472 |
| 301 | Ga0068862_100436533 | 3300005844 | Unclassified | 1232 |
| 302 | Ga0081540_1048266 | 3300005983 | Unclassified | 2133 |
| 303 | Ga0081539_10000053 | 3300005985 | Bacteria | 264549 |
| 304 | Ga0081539_10000413 | 3300005985 | Bacteria | 91117 |
| 305 | Ga0070715_10000025 | 3300006163 | Bacteria | 107539 |
| 306 | Ga0070716_100000003 | 3300006173 | Bacteria | 312721 |
| 307 | Ga0070716_100135081 | 3300006173 | Unclassified | 1565 |
| 308 | Ga0097621_100001671 | 3300006237 | Bacteria | 15177 |
| 309 | Ga0097621_100009417 | 3300006237 | Bacteria | 7088 |
| 310 | Ga0097621_100010818 | 3300006237 | Bacteria | 6694 |
| 311 | Ga0097621_100090837 | 3300006237 | Bacteria | 2556 |
| 312 | Ga0068871_100004716 | 3300006358 | Bacteria | 9537 |
| 313 | Ga0068871_100014711 | 3300006358 | Bacteria | 5839 |
| 314 | Ga0068871_100015543 | 3300006358 | Bacteria | 5701 |
| 315 | Ga0068871_100136015 | 3300006358 | Bacteria | 2087 |
| 316 | Ga0075428_100110226 | 3300006844 | Bacteria | 2998 |
| 317 | Ga0075428_100168088 | 3300006844 | Bacteria | 2379 |
| 318 | Ga0075428_100633942 | 3300006844 | Bacteria | 1140 |
| 319 | Ga0075430_100032469 | 3300006846 | Unclassified | 4432 |
| 320 | Ga0075430_100330055 | 3300006846 | Bacteria | 1260 |
| 321 | Ga0075431_100071249 | 3300006847 | Unclassified | 3586 |
| 322 | Ga0075431_100133912 | 3300006847 | Bacteria | 2555 |
| 323 | Ga0075433_10005311 | 3300006852 | Bacteria | 10103 |
| 324 | Ga0075433_10020387 | 3300006852 | Bacteria | 5541 |
| 325 | Ga0075433_10023489 | 3300006852 | Bacteria | 5191 |
| 326 | Ga0075433_10037018 | 3300006852 | Bacteria | 4206 |
| 327 | Ga0075433_10059541 | 3300006852 | Bacteria | 3341 |
| 328 | Ga0075433_10081353 | 3300006852 | Bacteria | 2855 |
| 329 | Ga0075433_10209896 | 3300006852 | Bacteria | 1730 |
| 330 | Ga0075433_10213281 | 3300006852 | Bacteria | 1715 |
| 331 | Ga0075433_10244068 | 3300006852 | Bacteria | 1594 |
| 332 | Ga0075433_10325927 | 3300006852 | Unclassified | 1358 |
| 333 | Ga0075434_100015815 | 3300006871 | Bacteria | 7244 |
| 334 | Ga0075434_100016204 | 3300006871 | Bacteria | 7164 |
| 335 | Ga0075434_100035293 | 3300006871 | Bacteria | 4943 |
| 336 | Ga0075434_100055054 | 3300006871 | Bacteria | 3953 |
| 337 | Ga0075434_100060851 | 3300006871 | Unclassified | 3757 |
| 338 | Ga0075434_100080287 | 3300006871 | Bacteria | 3258 |
| 339 | Ga0075434_100121144 | 3300006871 | Bacteria | 2632 |
| 340 | Ga0075434_100127953 | 3300006871 | Bacteria | 2557 |
| 341 | Ga0075434_100437686 | 3300006871 | Bacteria | 1329 |
| 342 | Ga0075434_100460145 | 3300006871 | Unclassified | 1293 |
| 343 | Ga0075434_100586593 | 3300006871 | Bacteria | 1134 |
| 344 | Ga0075429_100035844 | 3300006880 | Bacteria | 4314 |
| 345 | Ga0075429_100272927 | 3300006880 | Unclassified | 1481 |
| 346 | Ga0075429_100453777 | 3300006880 | Bacteria | 1123 |
| 347 | Ga0075429_100552794 | 3300006880 | Unclassified | 1009 |
| 348 | Ga0068865_100092515 | 3300006881 | Bacteria | 2197 |
| 349 | Ga0068865_100185629 | 3300006881 | Bacteria | 1604 |
| 350 | Ga0068865_100257818 | 3300006881 | Bacteria | 1379 |
| 351 | Ga0075436_100000002 | 3300006914 | Bacteria | 475522 |
| 352 | Ga0075436_100163663 | 3300006914 | Unclassified | 1569 |
| 353 | Ga0075436_100212302 | 3300006914 | Bacteria | 1372 |
| 354 | Ga0075436_100281821 | 3300006914 | Bacteria | 1188 |
| 355 | Ga0097620_100003377 | 3300006931 | Bacteria | 16230 |
| 356 | Ga0097620_100020828 | 3300006931 | Bacteria | 6581 |
| 357 | Ga0097620_100023193 | 3300006931 | Bacteria | 6226 |
| 358 | Ga0097620_100030704 | 3300006931 | Bacteria | 5392 |
| 359 | Ga0097620_100036512 | 3300006931 | Bacteria | 4933 |
| 360 | Ga0097620_100047511 | 3300006931 | Bacteria | 4313 |
| 361 | Ga0097620_100055938 | 3300006931 | Bacteria | 3970 |
| 362 | Ga0097620_100056636 | 3300006931 | Bacteria | 3946 |
| 363 | Ga0097620_100056809 | 3300006931 | Bacteria | 3941 |
| 364 | Ga0097620_100074674 | 3300006931 | Bacteria | 3429 |
| 365 | Ga0097620_100105712 | 3300006931 | Bacteria | 2874 |
| 366 | Ga0097620_100107307 | 3300006931 | Unclassified | 2852 |
| 367 | Ga0097620_100131912 | 3300006931 | Unclassified | 2570 |
| 368 | Ga0097620_100180407 | 3300006931 | Unclassified | 2194 |
| 369 | Ga0097620_100205401 | 3300006931 | Unclassified | 2055 |
| 370 | Ga0097620_100352569 | 3300006931 | Bacteria | 1566 |
| 371 | Ga0097620_100388073 | 3300006931 | Bacteria | 1492 |
| 372 | Ga0097620_100595467 | 3300006931 | Bacteria | 1199 |
| 373 | Ga0097620_100685740 | 3300006931 | Unclassified | 1116 |
| 374 | Ga0075435_100018467 | 3300007076 | Bacteria | 5305 |
| 375 | Ga0075435_100030687 | 3300007076 | Bacteria | 4229 |
| 376 | Ga0075435_100054387 | 3300007076 | Bacteria | 3230 |
| 377 | Ga0075435_100056407 | 3300007076 | Bacteria | 3175 |
| 378 | Ga0075435_100204549 | 3300007076 | Bacteria | 1673 |
| 379 | Ga0099794_10039008 | 3300007265 | Bacteria | 2252 |
| 380 | Ga0105251_10049007 | 3300009011 | Unclassified | 2024 |
| 381 | Ga0111539_10001063 | 3300009094 | Bacteria | 36189 |
| 382 | Ga0111539_10001170 | 3300009094 | Bacteria | 34759 |
| 383 | Ga0111539_10002690 | 3300009094 | Bacteria | 23536 |
| 384 | Ga0111539_10008376 | 3300009094 | Bacteria | 13156 |
| 385 | Ga0111539_10013034 | 3300009094 | Bacteria | 10404 |
| 386 | Ga0111539_10088509 | 3300009094 | Bacteria | 3638 |
| 387 | Ga0111539_10115063 | 3300009094 | Bacteria | 3155 |
| 388 | Ga0111539_10435197 | 3300009094 | Bacteria | 1527 |
| 389 | Ga0111539_10846181 | 3300009094 | Unclassified | 1064 |
| 390 | Ga0111539_11373995 | 3300009094 | Unclassified | 819 |
| 391 | Ga0105245_10042109 | 3300009098 | Bacteria | 4073 |
| 392 | Ga0105245_10090957 | 3300009098 | Bacteria | 2808 |
| 393 | Ga0105247_10000004 | 3300009101 | Bacteria | 455497 |
| 394 | Ga0105247_10002714 | 3300009101 | Bacteria | 11872 |
| 395 | Ga0105247_10022652 | 3300009101 | Bacteria | 3784 |
| 396 | Ga0114129_10003680 | 3300009147 | Bacteria | 21574 |
| 397 | Ga0114129_10006111 | 3300009147 | Bacteria | 17076 |
| 398 | Ga0114129_10014321 | 3300009147 | Bacteria | 11303 |
| 399 | Ga0114129_10035789 | 3300009147 | Bacteria | 7013 |
| 400 | Ga0114129_10043769 | 3300009147 | Bacteria | 6299 |
| 401 | Ga0114129_10086966 | 3300009147 | Bacteria | 4334 |
| 402 | Ga0114129_10136453 | 3300009147 | Bacteria | 3366 |
| 403 | Ga0114129_10413717 | 3300009147 | Bacteria | 1775 |
| 404 | Ga0114129_10678167 | 3300009147 | Bacteria | 1327 |
| 405 | Ga0114129_11011524 | 3300009147 | Unclassified | 1046 |
| 406 | Ga0114129_11204774 | 3300009147 | Bacteria | 943 |
| 407 | Ga0114129_11596250 | 3300009147 | Unclassified | 799 |
| 408 | Ga0105243_10000037 | 3300009148 | Bacteria | 175237 |
| 409 | Ga0105243_10000204 | 3300009148 | Bacteria | 69282 |
| 410 | Ga0105243_10001165 | 3300009148 | Bacteria | 23834 |
| 411 | Ga0105243_10004015 | 3300009148 | Bacteria | 11726 |
| 412 | Ga0105243_10090209 | 3300009148 | Bacteria | 2522 |
| 413 | Ga0105243_10182963 | 3300009148 | Bacteria | 1824 |
| 414 | Ga0105243_10221297 | 3300009148 | Unclassified | 1673 |
| 415 | Ga0105243_10311503 | 3300009148 | Bacteria | 1430 |
| 416 | Ga0105243_10386898 | 3300009148 | Bacteria | 1295 |
| 417 | Ga0105241_10045379 | 3300009174 | Bacteria | 3334 |
| 418 | Ga0105241_10056953 | 3300009174 | Unclassified | 2997 |
| 419 | Ga0105241_10066392 | 3300009174 | Bacteria | 2790 |
| 420 | Ga0105241_10625838 | 3300009174 | Bacteria | 975 |
| 421 | Ga0105242_10000039 | 3300009176 | Bacteria | 88325 |
| 422 | Ga0105242_10031279 | 3300009176 | Bacteria | 4249 |
| 423 | Ga0105242_10049263 | 3300009176 | Bacteria | 3427 |
| 424 | Ga0105242_10113764 | 3300009176 | Bacteria | 2311 |
| 425 | Ga0105242_10121508 | 3300009176 | Bacteria | 2242 |
| 426 | Ga0105242_10146614 | 3300009176 | Unclassified | 2054 |
| 427 | Ga0105242_10393315 | 3300009176 | Bacteria | 1292 |
| 428 | Ga0105248_10018179 | 3300009177 | Bacteria | 7763 |
| 429 | Ga0105248_10025844 | 3300009177 | Bacteria | 6531 |
| 430 | Ga0105248_10028736 | 3300009177 | Bacteria | 6198 |
| 431 | Ga0105248_10043109 | 3300009177 | Bacteria | 5060 |
| 432 | Ga0105248_10092776 | 3300009177 | Bacteria | 3400 |
| 433 | Ga0105248_10418981 | 3300009177 | Bacteria | 1508 |
| 434 | Ga0105248_10819494 | 3300009177 | Unclassified | 1050 |
| 435 | Ga0105237_10003442 | 3300009545 | Bacteria | 18791 |
| 436 | Ga0105237_10132920 | 3300009545 | Bacteria | 2483 |
| 437 | Ga0105237_10626472 | 3300009545 | Bacteria | 1083 |
| 438 | Ga0105238_10004865 | 3300009551 | Bacteria | 13288 |
| 439 | Ga0105238_10063641 | 3300009551 | Unclassified | 3689 |
| 440 | Ga0105238_11213504 | 3300009551 | Unclassified | 779 |
| 441 | Ga0105249_10000052 | 3300009553 | Bacteria | 168047 |
| 442 | Ga0105249_10033549 | 3300009553 | Unclassified | 4648 |
| 443 | Ga0105249_10058162 | 3300009553 | Unclassified | 3543 |
| 444 | Ga0105249_10100153 | 3300009553 | Bacteria | 2724 |
| 445 | Ga0105249_10440825 | 3300009553 | Unclassified | 1340 |
| 446 | Ga0105249_10564018 | 3300009553 | Unclassified | 1191 |
| 447 | Ga0105249_10785694 | 3300009553 | Bacteria | 1015 |
| 448 | Ga0105249_11277089 | 3300009553 | Unclassified | 806 |
| 449 | Ga0105239_10008035 | 3300010375 | Bacteria | 12039 |
| 450 | Ga0105239_11215656 | 3300010375 | Bacteria | 869 |
| 451 | Ga0105239_11650984 | 3300010375 | Unclassified | 741 |
| 452 | Ga0105246_10034007 | 3300011119 | Bacteria | 3392 |
| 453 | Ga0105246_10111651 | 3300011119 | Bacteria | 2009 |
| 454 | Ga0157373_10070126 | 3300013100 | Bacteria | 2477 |
| 455 | Ga0157373_10086494 | 3300013100 | Bacteria | 2209 |
| 456 | Ga0157373_10323146 | 3300013100 | Unclassified | 1098 |
| 457 | Ga0157371_10059753 | 3300013102 | Bacteria | 2702 |
| 458 | Ga0157374_10032741 | 3300013296 | Bacteria | 4736 |
| 459 | Ga0157378_10000004 | 3300013297 | Bacteria | 201051 |
| 460 | Ga0157378_10005014 | 3300013297 | Bacteria | 11619 |
| 461 | Ga0157378_10034561 | 3300013297 | Bacteria | 4470 |
| 462 | Ga0157378_10036917 | 3300013297 | Unclassified | 4326 |
| 463 | Ga0157378_10040940 | 3300013297 | Unclassified | 4110 |
| 464 | Ga0157378_10050341 | 3300013297 | Bacteria | 3707 |
| 465 | Ga0157378_10059323 | 3300013297 | Bacteria | 3414 |
| 466 | Ga0157378_10081387 | 3300013297 | Bacteria | 2927 |
| 467 | Ga0157378_10123891 | 3300013297 | Bacteria | 2386 |
| 468 | Ga0157378_10223775 | 3300013297 | Unclassified | 1790 |
| 469 | Ga0157378_10274491 | 3300013297 | Bacteria | 1623 |
| 470 | Ga0157378_10504124 | 3300013297 | Unclassified | 1209 |
| 471 | Ga0157378_10582276 | 3300013297 | Viruses | 1128 |
| 472 | Ga0157378_10866531 | 3300013297 | Unclassified | 932 |
| 473 | Ga0163162_10000001 | 3300013306 | Bacteria | 751833 |
| 474 | Ga0163162_10004637 | 3300013306 | Bacteria | 13251 |
| 475 | Ga0163162_10004905 | 3300013306 | Bacteria | 12891 |
| 476 | Ga0163162_10008699 | 3300013306 | Bacteria | 9881 |
| 477 | Ga0163162_10026493 | 3300013306 | Bacteria | 5729 |
| 478 | Ga0163162_10026725 | 3300013306 | Bacteria | 5707 |
| 479 | Ga0163162_10099145 | 3300013306 | Bacteria | 3004 |
| 480 | Ga0163162_10138843 | 3300013306 | Unclassified | 2542 |
| 481 | Ga0163162_10195976 | 3300013306 | Bacteria | 2149 |
| 482 | Ga0163162_11204146 | 3300013306 | Bacteria | 859 |
| 483 | Ga0157372_10007348 | 3300013307 | Bacteria | 11722 |
| 484 | Ga0157372_10323663 | 3300013307 | Bacteria | 1795 |
| 485 | Ga0157372_10361410 | 3300013307 | Unclassified | 1692 |
| 486 | Ga0157372_10807000 | 3300013307 | Bacteria | 1090 |
| 487 | Ga0157375_10003507 | 3300013308 | Bacteria | 13605 |
| 488 | Ga0157375_10015347 | 3300013308 | Bacteria | 6854 |
| 489 | Ga0157375_10026598 | 3300013308 | Bacteria | 5395 |
| 490 | Ga0157375_10086991 | 3300013308 | Bacteria | 3177 |
| 491 | Ga0157375_10108436 | 3300013308 | Bacteria | 2871 |
| 492 | Ga0157375_10142684 | 3300013308 | Bacteria | 2523 |
| 493 | Ga0157375_10458945 | 3300013308 | Bacteria | 1439 |
| 494 | Ga0157375_10826928 | 3300013308 | Bacteria | 1074 |
| 495 | Ga0157375_11081810 | 3300013308 | Unclassified | 938 |
| 496 | Ga0163163_10001903 | 3300014325 | Bacteria | 17662 |
| 497 | Ga0163163_10017139 | 3300014325 | Bacteria | 6748 |
| 498 | Ga0163163_10029220 | 3300014325 | Bacteria | 5302 |
| 499 | Ga0163163_10047380 | 3300014325 | Bacteria | 4225 |
| 500 | Ga0163163_10078964 | 3300014325 | Bacteria | 3288 |
| 501 | Ga0163163_10079626 | 3300014325 | Bacteria | 3275 |
| 502 | Ga0163163_10184355 | 3300014325 | Bacteria | 2135 |
| 503 | Ga0163163_10664329 | 3300014325 | Bacteria | 1106 |
| 504 | Ga0163163_10866048 | 3300014325 | Unclassified | 967 |
| 505 | Ga0157380_10001690 | 3300014326 | Bacteria | 14575 |
| 506 | Ga0157380_10003274 | 3300014326 | Bacteria | 11099 |
| 507 | Ga0157380_10011248 | 3300014326 | Bacteria | 6461 |
| 508 | Ga0157380_10019779 | 3300014326 | Bacteria | 5023 |
| 509 | Ga0157380_10042355 | 3300014326 | Bacteria | 3559 |
| 510 | Ga0157380_10081338 | 3300014326 | Bacteria | 2649 |
| 511 | Ga0157380_10104053 | 3300014326 | Bacteria | 2370 |
| 512 | Ga0157380_10197191 | 3300014326 | Bacteria | 1783 |
| 513 | Ga0157380_11479548 | 3300014326 | Unclassified | 732 |
| 514 | Ga0157377_10117189 | 3300014745 | Bacteria | 1609 |
| 515 | Ga0157379_10067376 | 3300014968 | Bacteria | 3200 |
| 516 | Ga0157379_10165278 | 3300014968 | Bacteria | 1997 |
| 517 | Ga0157376_10013217 | 3300014969 | Bacteria | 6153 |
| 518 | Ga0157376_10377773 | 3300014969 | Bacteria | 1364 |
| 519 | Ga0163161_10008512 | 3300017792 | Bacteria | 7105 |
| 520 | Ga0163161_10048631 | 3300017792 | Unclassified | 3063 |
| 521 | Ga0163161_10228678 | 3300017792 | Bacteria | 1443 |
| 522 | Ga0163161_10410428 | 3300017792 | Bacteria | 1088 |
| 523 | Ga0163161_10750511 | 3300017792 | Unclassified | 816 |
| 524 | Ga0207672_1000019 | 3300025223 | Bacteria | 20169 |
| 525 | Ga0207697_10009201 | 3300025315 | Bacteria | 4274 |
| 526 | Ga0207653_10000054 | 3300025885 | Bacteria | 87543 |
| 527 | Ga0207653_10002794 | 3300025885 | Bacteria | 5551 |
| 528 | Ga0207653_10093085 | 3300025885 | Bacteria | 1058 |
| 529 | Ga0207642_10038250 | 3300025899 | Bacteria | 2075 |
| 530 | Ga0207642_10076640 | 3300025899 | Bacteria | 1610 |
| 531 | Ga0207710_10000002 | 3300025900 | Bacteria | 1251998 |
| 532 | Ga0207710_10009909 | 3300025900 | Bacteria | 4006 |
| 533 | Ga0207710_10037702 | 3300025900 | Bacteria | 2136 |
| 534 | Ga0207647_10005841 | 3300025904 | Bacteria | 8974 |
| 535 | Ga0207647_10035143 | 3300025904 | Bacteria | 3195 |
| 536 | Ga0207647_10265988 | 3300025904 | Bacteria | 981 |
| 537 | Ga0207685_10000008 | 3300025905 | Bacteria | 273136 |
| 538 | Ga0207699_10067689 | 3300025906 | Bacteria | 2172 |
| 539 | Ga0207645_10088308 | 3300025907 | Bacteria | 1993 |
| 540 | Ga0207643_10018891 | 3300025908 | Unclassified | 3775 |
| 541 | Ga0207643_10022022 | 3300025908 | Bacteria | 3507 |
| 542 | Ga0207643_10052870 | 3300025908 | Bacteria | 2307 |
| 543 | Ga0207684_10000030 | 3300025910 | Bacteria | 300037 |
| 544 | Ga0207684_10004486 | 3300025910 | Bacteria | 13132 |
| 545 | Ga0207684_10005647 | 3300025910 | Bacteria | 11491 |
| 546 | Ga0207684_10054107 | 3300025910 | Bacteria | 3405 |
| 547 | Ga0207684_10162911 | 3300025910 | Bacteria | 1921 |
| 548 | Ga0207684_10199122 | 3300025910 | Unclassified | 1728 |
| 549 | Ga0207684_10224388 | 3300025910 | Unclassified | 1621 |
| 550 | Ga0207684_10298258 | 3300025910 | Bacteria | 1390 |
| 551 | Ga0207654_10075676 | 3300025911 | Unclassified | 2012 |
| 552 | Ga0207654_10174739 | 3300025911 | Unclassified | 1397 |
| 553 | Ga0207654_10219987 | 3300025911 | Bacteria | 1259 |
| 554 | Ga0207707_10000007 | 3300025912 | Bacteria | 368555 |
| 555 | Ga0207695_10255331 | 3300025913 | Bacteria | 1652 |
| 556 | Ga0207695_10727935 | 3300025913 | Unclassified | 872 |
| 557 | Ga0207671_10004811 | 3300025914 | Bacteria | 12721 |
| 558 | Ga0207671_10559773 | 3300025914 | Unclassified | 911 |
| 559 | Ga0207660_10002775 | 3300025917 | Bacteria | 11480 |
| 560 | Ga0207662_10011825 | 3300025918 | Bacteria | 4851 |
| 561 | Ga0207662_10042573 | 3300025918 | Unclassified | 2677 |
| 562 | Ga0207662_10084831 | 3300025918 | Bacteria | 1938 |
| 563 | Ga0207662_10253584 | 3300025918 | Unclassified | 1156 |
| 564 | Ga0207652_10000062 | 3300025921 | Bacteria | 113255 |
| 565 | Ga0207646_10000399 | 3300025922 | Bacteria | 58192 |
| 566 | Ga0207646_10006739 | 3300025922 | Bacteria | 11826 |
| 567 | Ga0207646_10007966 | 3300025922 | Bacteria | 10685 |
| 568 | Ga0207646_10050922 | 3300025922 | Bacteria | 3706 |
| 569 | Ga0207646_10051069 | 3300025922 | Bacteria | 3700 |
| 570 | Ga0207646_10079019 | 3300025922 | Bacteria | 2941 |
| 571 | Ga0207646_10093594 | 3300025922 | Bacteria | 2691 |
| 572 | Ga0207646_10099557 | 3300025922 | Unclassified | 2605 |
| 573 | Ga0207646_10108018 | 3300025922 | Bacteria | 2496 |
| 574 | Ga0207646_10133474 | 3300025922 | Unclassified | 2235 |
| 575 | Ga0207646_10486492 | 3300025922 | Unclassified | 1112 |
| 576 | Ga0207646_10861913 | 3300025922 | Unclassified | 805 |
| 577 | Ga0207681_10004226 | 3300025923 | Bacteria | 8869 |
| 578 | Ga0207681_10025484 | 3300025923 | Unclassified | 3805 |
| 579 | Ga0207681_10045245 | 3300025923 | Bacteria | 2954 |
| 580 | Ga0207681_10087685 | 3300025923 | Bacteria | 2215 |
| 581 | Ga0207681_10590551 | 3300025923 | Bacteria | 917 |
| 582 | Ga0207694_10019502 | 3300025924 | Bacteria | 5127 |
| 583 | Ga0207694_10041211 | 3300025924 | Bacteria | 3557 |
| 584 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 585 | Ga0207650_10337824 | 3300025925 | Bacteria | 1236 |
| 586 | Ga0207650_10466396 | 3300025925 | Bacteria | 1052 |
| 587 | Ga0207659_10480080 | 3300025926 | Bacteria | 1050 |
| 588 | Ga0207687_10137965 | 3300025927 | Bacteria | 1847 |
| 589 | Ga0207644_10000648 | 3300025931 | Bacteria | 21996 |
| 590 | Ga0207644_10047254 | 3300025931 | Bacteria | 3070 |
| 591 | Ga0207644_10593667 | 3300025931 | Bacteria | 919 |
| 592 | Ga0207706_10311827 | 3300025933 | Bacteria | 1370 |
| 593 | Ga0207706_10425431 | 3300025933 | Unclassified | 1150 |
| 594 | Ga0207686_10000003 | 3300025934 | Bacteria | 376934 |
| 595 | Ga0207686_10000335 | 3300025934 | Bacteria | 33878 |
| 596 | Ga0207686_10002486 | 3300025934 | Bacteria | 10008 |
| 597 | Ga0207686_10083288 | 3300025934 | Bacteria | 2093 |
| 598 | Ga0207686_10366631 | 3300025934 | Bacteria | 1089 |
| 599 | Ga0207709_10000017 | 3300025935 | Bacteria | 470753 |
| 600 | Ga0207709_10000469 | 3300025935 | Bacteria | 37165 |
| 601 | Ga0207709_10000786 | 3300025935 | Bacteria | 24857 |
| 602 | Ga0207709_10018468 | 3300025935 | Bacteria | 3907 |
| 603 | Ga0207709_10128820 | 3300025935 | Bacteria | 1721 |
| 604 | Ga0207709_10251314 | 3300025935 | Bacteria | 1291 |
| 605 | Ga0207709_10357114 | 3300025935 | Bacteria | 1105 |
| 606 | Ga0207670_10001298 | 3300025936 | Bacteria | 13179 |
| 607 | Ga0207670_10050579 | 3300025936 | Unclassified | 2786 |
| 608 | Ga0207670_10237944 | 3300025936 | Bacteria | 1401 |
| 609 | Ga0207704_10135348 | 3300025938 | Bacteria | 1714 |
| 610 | Ga0207704_10259487 | 3300025938 | Bacteria | 1309 |
| 611 | Ga0207665_10000003 | 3300025939 | Bacteria | 220666 |
| 612 | Ga0207665_10233246 | 3300025939 | Unclassified | 1353 |
| 613 | Ga0207691_10331462 | 3300025940 | Unclassified | 1304 |
| 614 | Ga0207691_10679668 | 3300025940 | Unclassified | 869 |
| 615 | Ga0207711_10028572 | 3300025941 | Bacteria | 4695 |
| 616 | Ga0207711_10039645 | 3300025941 | Bacteria | 4008 |
| 617 | Ga0207711_10046688 | 3300025941 | Bacteria | 3701 |
| 618 | Ga0207711_10600289 | 3300025941 | Bacteria | 1027 |
| 619 | Ga0207711_10645593 | 3300025941 | Bacteria | 987 |
| 620 | Ga0207711_10648343 | 3300025941 | Unclassified | 985 |
| 621 | Ga0207711_10681183 | 3300025941 | Unclassified | 959 |
| 622 | Ga0207689_10001296 | 3300025942 | Bacteria | 24095 |
| 623 | Ga0207689_10009146 | 3300025942 | Bacteria | 8575 |
| 624 | Ga0207689_10020196 | 3300025942 | Bacteria | 5610 |
| 625 | Ga0207689_10023893 | 3300025942 | Bacteria | 5127 |
| 626 | Ga0207689_10033676 | 3300025942 | Bacteria | 4256 |
| 627 | Ga0207689_10113322 | 3300025942 | Bacteria | 2229 |
| 628 | Ga0207689_10166034 | 3300025942 | Bacteria | 1819 |
| 629 | Ga0207689_10290511 | 3300025942 | Bacteria | 1354 |
| 630 | Ga0207689_10295649 | 3300025942 | Bacteria | 1342 |
| 631 | Ga0207689_10730108 | 3300025942 | Bacteria | 836 |
| 632 | Ga0207679_10228042 | 3300025945 | Bacteria | 1571 |
| 633 | Ga0207651_10042437 | 3300025960 | Bacteria | 3027 |
| 634 | Ga0207651_10049810 | 3300025960 | Bacteria | 2840 |
| 635 | Ga0207651_10083331 | 3300025960 | Bacteria | 2312 |
| 636 | Ga0207651_10157410 | 3300025960 | Bacteria | 1777 |
| 637 | Ga0207651_10217008 | 3300025960 | Bacteria | 1544 |
| 638 | Ga0207712_10000022 | 3300025961 | Bacteria | 284365 |
| 639 | Ga0207712_10134188 | 3300025961 | Bacteria | 1891 |
| 640 | Ga0207712_10375589 | 3300025961 | Unclassified | 1188 |
| 641 | Ga0207668_10345369 | 3300025972 | Bacteria | 1243 |
| 642 | Ga0207640_10021271 | 3300025981 | Bacteria | 3865 |
| 643 | Ga0207640_10238836 | 3300025981 | Viruses | 1403 |
| 644 | Ga0207640_10500297 | 3300025981 | Bacteria | 1012 |
| 645 | Ga0207640_10617634 | 3300025981 | Bacteria | 920 |
| 646 | Ga0207658_10254404 | 3300025986 | Bacteria | 1494 |
| 647 | Ga0207677_10026157 | 3300026023 | Bacteria | 3655 |
| 648 | Ga0207677_10193660 | 3300026023 | Bacteria | 1610 |
| 649 | Ga0207677_10319567 | 3300026023 | Bacteria | 1289 |
| 650 | Ga0207703_10000114 | 3300026035 | Bacteria | 96051 |
| 651 | Ga0207703_10017836 | 3300026035 | Bacteria | 5543 |
| 652 | Ga0207703_10191443 | 3300026035 | Bacteria | 1812 |
| 653 | Ga0207703_10345077 | 3300026035 | Unclassified | 1369 |
| 654 | Ga0207703_10369186 | 3300026035 | Bacteria | 1325 |
| 655 | Ga0207703_10403198 | 3300026035 | Bacteria | 1269 |
| 656 | Ga0207703_10937829 | 3300026035 | Bacteria | 829 |
| 657 | Ga0207678_10312068 | 3300026067 | Unclassified | 1352 |
| 658 | Ga0207708_10000224 | 3300026075 | Bacteria | 44906 |
| 659 | Ga0207708_10014089 | 3300026075 | Bacteria | 5975 |
| 660 | Ga0207708_10022759 | 3300026075 | Bacteria | 4732 |
| 661 | Ga0207708_10026462 | 3300026075 | Unclassified | 4390 |
| 662 | Ga0207708_10029922 | 3300026075 | Unclassified | 4129 |
| 663 | Ga0207708_10031580 | 3300026075 | Bacteria | 4020 |
| 664 | Ga0207708_10054631 | 3300026075 | Bacteria | 3045 |
| 665 | Ga0207708_10064634 | 3300026075 | Unclassified | 2796 |
| 666 | Ga0207708_10208419 | 3300026075 | Bacteria | 1562 |
| 667 | Ga0207708_10231585 | 3300026075 | Bacteria | 1483 |
| 668 | Ga0207702_10087038 | 3300026078 | Bacteria | 2726 |
| 669 | Ga0207641_10031507 | 3300026088 | Bacteria | 4398 |
| 670 | Ga0207641_10048725 | 3300026088 | Bacteria | 3577 |
| 671 | Ga0207641_10448519 | 3300026088 | Unclassified | 1246 |
| 672 | Ga0207641_10475767 | 3300026088 | Bacteria | 1210 |
| 673 | Ga0207641_10528980 | 3300026088 | Unclassified | 1148 |
| 674 | Ga0207648_10020391 | 3300026089 | Bacteria | 5970 |
| 675 | Ga0207648_10049773 | 3300026089 | Bacteria | 3665 |
| 676 | Ga0207648_10147356 | 3300026089 | Bacteria | 2076 |
| 677 | Ga0207648_10263478 | 3300026089 | Bacteria | 1538 |
| 678 | Ga0207676_10004993 | 3300026095 | Bacteria | 9397 |
| 679 | Ga0207676_10011946 | 3300026095 | Bacteria | 6213 |
| 680 | Ga0207676_10058107 | 3300026095 | Bacteria | 3049 |
| 681 | Ga0207676_10137232 | 3300026095 | Bacteria | 2089 |
| 682 | Ga0207676_10497776 | 3300026095 | Bacteria | 1157 |
| 683 | Ga0207676_10608062 | 3300026095 | Bacteria | 1051 |
| 684 | Ga0207676_10669992 | 3300026095 | Bacteria | 1003 |
| 685 | Ga0207674_10027008 | 3300026116 | Bacteria | 6085 |
| 686 | Ga0207674_10064717 | 3300026116 | Bacteria | 3688 |
| 687 | Ga0207674_10109655 | 3300026116 | Unclassified | 2736 |
| 688 | Ga0207674_10255634 | 3300026116 | Unclassified | 1699 |
| 689 | Ga0207674_10574289 | 3300026116 | Bacteria | 1089 |
| 690 | Ga0207675_100000644 | 3300026118 | Bacteria | 34301 |
| 691 | Ga0207675_100009769 | 3300026118 | Bacteria | 8981 |
| 692 | Ga0207675_100077905 | 3300026118 | Bacteria | 3105 |
| 693 | Ga0207675_100143674 | 3300026118 | Unclassified | 2268 |
| 694 | Ga0207675_100254983 | 3300026118 | Bacteria | 1699 |
| 695 | Ga0207683_10154313 | 3300026121 | Bacteria | 2073 |
| 696 | Ga0207698_10119314 | 3300026142 | Bacteria | 2229 |
| 697 | Ga0207698_10554158 | 3300026142 | Bacteria | 1127 |
| 698 | Ga0209998_10046287 | 3300027717 | Bacteria | 998 |
| 699 | Ga0207428_10000116 | 3300027907 | Bacteria | 109048 |
| 700 | Ga0207428_10000138 | 3300027907 | Bacteria | 98359 |
| 701 | Ga0207428_10004277 | 3300027907 | Bacteria | 13660 |
| 702 | Ga0207428_10008185 | 3300027907 | Bacteria | 9463 |
| 703 | Ga0207428_10064592 | 3300027907 | Unclassified | 2889 |
| 704 | Ga0268266_10042839 | 3300028379 | Bacteria | 3868 |
| 705 | Ga0268265_10036834 | 3300028380 | Bacteria | 3586 |
| 706 | Ga0268265_10039886 | 3300028380 | Bacteria | 3464 |
| 707 | Ga0268265_10084352 | 3300028380 | Bacteria | 2518 |
| 708 | Ga0268265_10087114 | 3300028380 | Bacteria | 2484 |
| 709 | Ga0268265_10097804 | 3300028380 | Unclassified | 2362 |
| 710 | Ga0268264_10006252 | 3300028381 | Bacteria | 10046 |
| 711 | Ga0268264_10045196 | 3300028381 | Bacteria | 3656 |
| 712 | Ga0268264_10081747 | 3300028381 | Bacteria | 2762 |
| 713 | Ga0268264_10118211 | 3300028381 | Bacteria | 2333 |
| 714 | Ga0268264_10195884 | 3300028381 | Bacteria | 1845 |
| 715 | Ga0268264_10213120 | 3300028381 | Unclassified | 1774 |
| 716 | Ga0268264_10352692 | 3300028381 | Bacteria | 1401 |
| 717 | Ga0268264_10485458 | 3300028381 | Bacteria | 1202 |
| 718 | Ga0268264_10546130 | 3300028381 | Bacteria | 1136 |
| 719 | Ga0268264_10649115 | 3300028381 | Unclassified | 1044 |
| 720 | Ga0316176_1117742 | 3300030732 | Bacteria | 1084 |
| 721 | Ga0307513_10002024 | 3300031456 | Bacteria | 28560 |
| 722 | Ga0307408_100009272 | 3300031548 | Bacteria | 6487 |
| 723 | Ga0307408_100142675 | 3300031548 | Unclassified | 1882 |
| 724 | Ga0307413_10034184 | 3300031824 | Unclassified | 2903 |
| 725 | Ga0307410_10115719 | 3300031852 | Unclassified | 1947 |
| 726 | Ga0307410_10297791 | 3300031852 | Bacteria | 1272 |
| 727 | Ga0307406_10077701 | 3300031901 | Unclassified | 2197 |
| 728 | Ga0307412_10007074 | 3300031911 | Bacteria | 6368 |
| 729 | Ga0307412_10010567 | 3300031911 | Bacteria | 5319 |
| 730 | Ga0307416_100486312 | 3300032002 | Unclassified | 1295 |
| 731 | Ga0307414_10005688 | 3300032004 | Bacteria | 6881 |
| 732 | Ga0307411_10004154 | 3300032005 | Bacteria | 6882 |
| 733 | Ga0307411_10058444 | 3300032005 | Bacteria | 2552 |
| 734 | Ga0307411_10115649 | 3300032005 | Bacteria | 1930 |
| 735 | Ga0307415_100010852 | 3300032126 | Bacteria | 5178 |
| 736 | Ga0307415_100315064 | 3300032126 | Bacteria | 1302 |
| 737 | Ga0373930_0035453 | 3300034816 | Bacteria | 1044 |
| 738 | Ga0373958_0014006 | 3300034819 | Bacteria | 1397 |
| 739 | Ga0373928_0038233 | 3300035084 | Bacteria | 1092 |
| 740 | Ga0373940_0000629 | 3300035088 | Bacteria | 5640 |
| 741 | Ga0373940_0039403 | 3300035088 | Bacteria | 1293 |
| 742 | Ga0373940_0082006 | 3300035088 | Bacteria | 955 |
| 743 | Ga0373951_0004689 | 3300035091 | Bacteria | 3232 |
| 744 | Ga0373932_0071834 | 3300035112 | Bacteria | 1075 |
| 745 | Ga0373941_0002139 | 3300035115 | Bacteria | 4303 |
| 746 | Ga0373931_0019919 | 3300035691 | Bacteria | 3353 |
| 747 | Ga0373931_0023227 | 3300035691 | Bacteria | 3130 |
| 748 | Ga0373931_0333289 | 3300035691 | Bacteria | 945 |
| 749 | Ga0373937_0096287 | 3300036401 | Bacteria | 2745 |
| 750 | Ga0395900_0169841 | 3300037418 | Unclassified | 2221 |
| 751 | Ga0395900_0278910 | 3300037418 | Bacteria | 1664 |
| 752 | Ga0395900_0679022 | 3300037418 | Bacteria | 965 |
| 753 | Ga0395898_0312877 | 3300037466 | Unclassified | 1498 |
| 754 | Ga0395905_0042665 | 3300037471 | Unclassified | 4256 |
| 755 | Ga0395905_0198777 | 3300037471 | Bacteria | 1880 |
| 756 | Ga0395905_0885576 | 3300037471 | Unclassified | 796 |
| 757 | Ga0395901_0102131 | 3300038443 | Bacteria | 3009 |
| 758 | Ga0395901_0158788 | 3300038443 | Bacteria | 2375 |
| 759 | Ga0242419_003448 | 3300038698 | Bacteria | 1071 |
| 760 | Ga0242420_009381 | 3300038996 | Unclassified | 1604 |
| 761 | Ga0439439_0030222 | 3300041406 | Bacteria | 1377 |
| 762 | Ga0439458_0012407 | 3300042157 | Unclassified | 1912 |
| 763 | Ga0451577_0004588 | 3300042876 | Bacteria | 14515 |
| 764 | Ga0451577_0023549 | 3300042876 | Bacteria | 5614 |
| 765 | Ga0451576_0022577 | 3300045051 | Bacteria | 6821 |
| 766 | Ga0451576_0050316 | 3300045051 | Bacteria | 4370 |
| 767 | Ga0451576_0084930 | 3300045051 | Bacteria | 3292 |
| 768 | Ga0451576_0246340 | 3300045051 | Bacteria | 1867 |
| 769 | Ga0495580_0009246 | 3300046472 | Bacteria | 7763 |
| 770 | Ga0495632_0032708 | 3300046519 | Unclassified | 2677 |
| 771 | Ga0495663_0000234 | 3300046525 | Bacteria | 22071 |
| 772 | Ga0495642_0052408 | 3300046528 | Bacteria | 1680 |
| 773 | Ga0495586_0315539 | 3300046535 | Unclassified | 896 |
| 774 | Ga0495598_0000507 | 3300046537 | Bacteria | 7208 |
| 775 | Ga0495621_0003359 | 3300046539 | Bacteria | 4413 |
| 776 | Ga0495621_0008981 | 3300046539 | Bacteria | 3017 |
| 777 | Ga0495669_0040389 | 3300046684 | Bacteria | 2069 |
| 778 | Ga0495672_0010982 | 3300047320 | Bacteria | 6418 |
| 779 | Ga0496102_0020336 | 3300048905 | Bacteria | 5867 |
| 780 | Ga0496104_0128963 | 3300048907 | Bacteria | 2429 |
| 781 | Ga0496104_0257003 | 3300048907 | Bacteria | 1660 |
| 782 | Ga0496106_0012526 | 3300048909 | Bacteria | 6262 |
| 783 | Ga0496108_0069455 | 3300048911 | Bacteria | 2973 |
| 784 | Ga0496108_0187305 | 3300048911 | Bacteria | 1793 |
| 785 | Ga0496110_0287134 | 3300048913 | Unclassified | 1498 |
| 786 | Ga0496110_0321485 | 3300048913 | Bacteria | 1410 |
| 787 | Ga0496111_0236173 | 3300048914 | Bacteria | 1358 |
| 788 | Ga0496111_0309796 | 3300048914 | Bacteria | 1170 |
| 789 | Ga0496111_0423867 | 3300048914 | Unclassified | 983 |
| 790 | Ga0496112_0548513 | 3300048915 | Unclassified | 1090 |
| 791 | Ga0496114_0503001 | 3300048917 | Bacteria | 1072 |
| 792 | Ga0501292_014897 | 3300049515 | Bacteria | 1210 |
| 793 | Ga0501296_006886 | 3300049519 | Bacteria | 1296 |
| 794 | Ga0501298_020225 | 3300049521 | Bacteria | 1239 |
| 795 | Ga0501299_000422 | 3300049522 | Bacteria | 5017 |
| 796 | Ga0501300_004087 | 3300049523 | Bacteria | 2170 |
| 797 | Ga0501038_0002831 | 3300049574 | Bacteria | 16141 |
| 798 | Ga0501075_0103465 | 3300049591 | Bacteria | 2164 |
| 799 | Ga0501076_0344069 | 3300049592 | Bacteria | 1224 |
| 800 | Ga0501076_0608733 | 3300049592 | Unclassified | 901 |
| 801 | Ga0501202_000648 | 3300049652 | Bacteria | 5128 |
| 802 | Ga0501202_003361 | 3300049652 | Unclassified | 2736 |
| 803 | Ga0501202_053329 | 3300049652 | Bacteria | 900 |
| 804 | Ga0501216_007612 | 3300049660 | Unclassified | 1689 |
| 805 | Ga0501216_019361 | 3300049660 | Bacteria | 1180 |
| 806 | Ga0501217_083351 | 3300049661 | Bacteria | 888 |
| 807 | Ga0501217_138285 | 3300049661 | Bacteria | 719 |
| 808 | Ga0501223_011019 | 3300049663 | Bacteria | 1815 |
| 809 | Ga0501223_023595 | 3300049663 | Unclassified | 1199 |
| 810 | Ga0501227_004070 | 3300049665 | Bacteria | 3149 |
| 811 | Ga0501230_004268 | 3300049667 | Bacteria | 1956 |
| 812 | Ga0501233_023444 | 3300049668 | Bacteria | 1342 |
| 813 | Ga0501233_033480 | 3300049668 | Bacteria | 1174 |
| 814 | Ga0501235_006210 | 3300049669 | Bacteria | 2603 |
| 815 | Ga0501235_032528 | 3300049669 | Bacteria | 1180 |
| 816 | Ga0501235_046801 | 3300049669 | Bacteria | 997 |
| 817 | Ga0501242_013030 | 3300049674 | Bacteria | 1018 |
| 818 | Ga0501249_039853 | 3300049679 | Unclassified | 1063 |
| 819 | Ga0501253_017706 | 3300049683 | Bacteria | 1206 |
| 820 | Ga0501256_008113 | 3300049685 | Bacteria | 974 |
| 821 | Ga0501259_015285 | 3300049688 | Bacteria | 1309 |
| 822 | Ga0501221_007980 | 3300049704 | Bacteria | 1830 |
| 823 | Ga0501234_007896 | 3300049707 | Bacteria | 1663 |
| 824 | Ga0501245_010397 | 3300049708 | Bacteria | 1344 |
| 825 | Ga0501080_0599246 | 3300049742 | Bacteria | 978 |
| 826 | Ga0501271_011505 | 3300049768 | Bacteria | 947 |
| 827 | Ga0501045_0148477 | 3300049824 | Bacteria | 1744 |
| 828 | nmdc:mga05p37_103735_c1 | 3300050507 | Bacteria | 3499 |
| 829 | nmdc:mga05p37_1084577_c1 | 3300050507 | Bacteria | 840 |
| 830 | nmdc:mga05p37_25847_c1 | 3300050507 | Bacteria | 7138 |
| 831 | nmdc:mga05p37_293625_c1 | 3300050507 | Bacteria | 1934 |
| 832 | nmdc:mga05p37_29784_c1 | 3300050507 | Bacteria | 6661 |
| 833 | nmdc:mga05p37_360808_c1 | 3300050507 | Unclassified | 1708 |
| 834 | nmdc:mga05p37_54456_c2 | 3300050507 | Bacteria | 4334 |
| 835 | nmdc:mga05p37_598000_c1 | 3300050507 | Bacteria | 1246 |
| 836 | nmdc:mga05p37_71287_c1 | 3300050507 | Unclassified | 3731 |
| 837 | nmdc:mga05p37_75655_c1 | 3300050507 | Bacteria | 4145 |
| 838 | nmdc:mga05p37_84254_c1 | 3300050507 | Bacteria | 3917 |
| 839 | nmdc:mga09592_10833_c1 | 3300050508 | Bacteria | 7418 |
| 840 | nmdc:mga09592_20874_c1 | 3300050508 | Bacteria | 5393 |
| 841 | nmdc:mga09592_262479_c1 | 3300050508 | Unclassified | 1498 |
| 842 | nmdc:mga09592_567322_c1 | 3300050508 | Bacteria | 974 |
| 843 | nmdc:mga09592_74063_c1 | 3300050508 | Bacteria | 2894 |
| 844 | nmdc:mga09592_836577_c1 | 3300050508 | Unclassified | 777 |
| 845 | nmdc:mga0qj67_128935_c1 | 3300050509 | Bacteria | 2048 |
| 846 | nmdc:mga0qj67_141255_c1 | 3300050509 | Unclassified | 1953 |
| 847 | nmdc:mga06r32_312194_c1 | 3300050510 | Bacteria | 1558 |
| 848 | nmdc:mga08y16_104436_c1 | 3300050511 | Bacteria | 2949 |
| 849 | nmdc:mga08y16_118088_c1 | 3300050511 | Bacteria | 2760 |
| 850 | nmdc:mga08y16_1441_c1 | 3300050511 | Bacteria | 23825 |
| 851 | nmdc:mga08y16_18335_c1 | 3300050511 | Bacteria | 7376 |
| 852 | nmdc:mga08y16_2206_c1 | 3300050511 | Bacteria | 19973 |
| 853 | nmdc:mga08y16_26147_c1 | 3300050511 | Bacteria | 6156 |
| 854 | nmdc:mga08y16_32947_c1 | 3300050511 | Bacteria | 5445 |
| 855 | nmdc:mga0n895_109654_c1 | 3300050512 | Bacteria | 2775 |
| 856 | nmdc:mga0n895_157746_c1 | 3300050512 | Bacteria | 2300 |
| 857 | nmdc:mga0n895_159447_c1 | 3300050512 | Bacteria | 2287 |
| 858 | nmdc:mga0n895_16349_c1 | 3300050512 | Bacteria | 6803 |
| 859 | nmdc:mga0n895_189076_c1 | 3300050512 | Bacteria | 2090 |
| 860 | nmdc:mga0n895_237792_c1 | 3300050512 | Bacteria | 1848 |
| 861 | nmdc:mga0n895_421483_c1 | 3300050512 | Bacteria | 1349 |
| 862 | nmdc:mga0n895_48781_c1 | 3300050512 | Bacteria | 4146 |
| 863 | nmdc:mga0n895_57523_c1 | 3300050512 | Bacteria | 3833 |
| 864 | nmdc:mga0n895_82577_c1 | 3300050512 | Bacteria | 3204 |
| 865 | nmdc:mga0n895_864071_c1 | 3300050512 | Bacteria | 892 |
| 866 | nmdc:mga0n895_96337_c1 | 3300050512 | Bacteria | 2964 |
| 867 | nmdc:mga0rr50_114418_c1 | 3300050513 | Bacteria | 2139 |
| 868 | nmdc:mga0rr50_11540_c1 | 3300050513 | Bacteria | 5662 |
| 869 | nmdc:mga0rr50_156417_c1 | 3300050513 | Bacteria | 1847 |
| 870 | nmdc:mga0rr50_20831_c1 | 3300050513 | Bacteria | 4463 |
| 871 | nmdc:mga0rr50_413113_c1 | 3300050513 | Bacteria | 1141 |
| 872 | nmdc:mga0rr50_449156_c1 | 3300050513 | Bacteria | 1093 |
| 873 | nmdc:mga0rr50_54359_c1 | 3300050513 | Unclassified | 2983 |
| 874 | nmdc:mga08x19_9_c1 | 3300050514 | Bacteria | 418852 |
| 875 | nmdc:mga0a205_147677_c1 | 3300050515 | Bacteria | 2251 |
| 876 | nmdc:mga0a205_1778_c1 | 3300050515 | Bacteria | 18627 |
| 877 | nmdc:mga0a205_18518_c1 | 3300050515 | Bacteria | 4424 |
| 878 | nmdc:mga0a205_200908_c1 | 3300050515 | Bacteria | 1884 |
| 879 | nmdc:mga0a205_23263_c1 | 3300050515 | Bacteria | 5876 |
| 880 | nmdc:mga0a205_29986_c1 | 3300050515 | Bacteria | 5206 |
| 881 | nmdc:mga0a205_3671_c1 | 3300050515 | Bacteria | 10002 |
| 882 | nmdc:mga0a205_38407_c1 | 3300050515 | Bacteria | 4606 |
| 883 | nmdc:mga0a205_3979_c1 | 3300050515 | Bacteria | 13214 |
| 884 | nmdc:mga0a205_476761_c1 | 3300050515 | Bacteria | 1106 |
| 885 | nmdc:mga0a205_61291_c1 | 3300050515 | Bacteria | 3633 |
| 886 | nmdc:mga0a205_65122_c1 | 3300050515 | Bacteria | 3520 |
| 887 | nmdc:mga0a205_690_c1 | 3300050515 | Bacteria | 20516 |
| 888 | Ga0500616_0001750 | 3300053153 | Bacteria | 19909 |
| 889 | Ga0500619_062704 | 3300053154 | Unclassified | 1226 |
| 890 | Ga0501082_0546651 | 3300060353 | Bacteria | 1013 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049661 | Ga0501217_138285 | Ga0501217_138285_27_605 | 181 |
| 2 | 3300049679 | Ga0501249_039853 | Ga0501249_039853_450_1028 | 181 |
| 3 | 3300049768 | Ga0501271_011505 | Ga0501271_011505_342_920 | 181 |
| 4 | 3300027717 | Ga0209998_10046287 | Ga0209998_100462871 | 197 |
| 5 | 3300026067 | Ga0207678_10312068 | Ga0207678_103120682 | 204 |
| 6 | 3300049523 | Ga0501300_004087 | Ga0501300_004087_26_691 | 213 |
| 7 | 3300049685 | Ga0501256_008113 | Ga0501256_008113_18_692 | 213 |
| 8 | 3300005353 | Ga0070669_100185867 | Ga0070669_1001858672 | 215 |
| 9 | 3300005457 | Ga0070662_100055917 | Ga0070662_1000559173 | 215 |
| 10 | 3300005546 | Ga0070696_100164388 | Ga0070696_1001643882 | 215 |
| 11 | 3300006844 | Ga0075428_100168088 | Ga0075428_1001680882 | 215 |
| 12 | 3300006852 | Ga0075433_10020387 | Ga0075433_100203872 | 215 |
| 13 | 3300006852 | Ga0075433_10037018 | Ga0075433_100370182 | 215 |
| 14 | 3300006852 | Ga0075433_10244068 | Ga0075433_102440682 | 215 |
| 15 | 3300006871 | Ga0075434_100437686 | Ga0075434_1004376862 | 215 |
| 16 | 3300006871 | Ga0075434_100460145 | Ga0075434_1004601452 | 215 |
| 17 | 3300009094 | Ga0111539_10001063 | Ga0111539_1000106336 | 215 |
| 18 | 3300009147 | Ga0114129_10413717 | Ga0114129_104137173 | 215 |
| 19 | 3300013307 | Ga0157372_10807000 | Ga0157372_108070002 | 215 |
| 20 | 3300027907 | Ga0207428_10000116 | Ga0207428_1000011669 | 215 |
| 21 | 3300042876 | Ga0451577_0004588 | Ga0451577_0004588_7907_8602 | 215 |
| 22 | 3300045051 | Ga0451576_0084930 | Ga0451576_0084930_2426_3121 | 215 |
| 23 | 3300050507 | nmdc:mga05p37_360808_c1 | nmdc:mga05p37_360808_c1_128_823 | 215 |
| 24 | 3300050511 | nmdc:mga08y16_18335_c1 | nmdc:mga08y16_18335_c1_4585_5280 | 215 |
| 25 | 3300050512 | nmdc:mga0n895_109654_c1 | nmdc:mga0n895_109654_c1_1963_2655 | 215 |
| 26 | 3300050512 | nmdc:mga0n895_421483_c1 | nmdc:mga0n895_421483_c1_518_1213 | 215 |
| 27 | 3300050512 | nmdc:mga0n895_48781_c1 | nmdc:mga0n895_48781_c1_3143_3838 | 215 |
| 28 | 3300050515 | nmdc:mga0a205_1778_c1 | nmdc:mga0a205_1778_c1_1168_1863 | 215 |
| 29 | 3300050515 | nmdc:mga0a205_3671_c1 | nmdc:mga0a205_3671_c1_765_1460 | 215 |
| 30 | 3300009553 | Ga0105249_10000052 | Ga0105249_10000052113 | 216 |
| 31 | 3300013306 | Ga0163162_10000001 | Ga0163162_10000001625 | 216 |
| 32 | 3300025922 | Ga0207646_10079019 | Ga0207646_100790192 | 216 |
| 33 | 3300005341 | Ga0070691_10013382 | Ga0070691_100133822 | 217 |
| 34 | 3300005345 | Ga0070692_10079040 | Ga0070692_100790402 | 217 |
| 35 | 3300005459 | Ga0068867_100051711 | Ga0068867_1000517113 | 217 |
| 36 | 3300005545 | Ga0070695_100003269 | Ga0070695_1000032692 | 217 |
| 37 | 3300005549 | Ga0070704_100103329 | Ga0070704_1001033292 | 217 |
| 38 | 3300005577 | Ga0068857_100009027 | Ga0068857_1000090278 | 217 |
| 39 | 3300005718 | Ga0068866_10033318 | Ga0068866_100333182 | 217 |
| 40 | 3300005840 | Ga0068870_10036163 | Ga0068870_100361633 | 217 |
| 41 | 3300005843 | Ga0068860_100096569 | Ga0068860_1000965692 | 217 |
| 42 | 3300006852 | Ga0075433_10005311 | Ga0075433_100053114 | 217 |
| 43 | 3300006871 | Ga0075434_100015815 | Ga0075434_10001581510 | 217 |
| 44 | 3300009147 | Ga0114129_10006111 | Ga0114129_100061118 | 217 |
| 45 | 3300009147 | Ga0114129_10086966 | Ga0114129_100869661 | 217 |
| 46 | 3300009176 | Ga0105242_10121508 | Ga0105242_101215082 | 217 |
| 47 | 3300009553 | Ga0105249_10564018 | Ga0105249_105640182 | 217 |
| 48 | 3300013306 | Ga0163162_11204146 | Ga0163162_112041461 | 217 |
| 49 | 3300025885 | Ga0207653_10093085 | Ga0207653_100930852 | 217 |
| 50 | 3300025899 | Ga0207642_10076640 | Ga0207642_100766402 | 217 |
| 51 | 3300025910 | Ga0207684_10054107 | Ga0207684_100541071 | 217 |
| 52 | 3300025934 | Ga0207686_10083288 | Ga0207686_100832883 | 217 |
| 53 | 3300025935 | Ga0207709_10018468 | Ga0207709_100184686 | 217 |
| 54 | 3300025942 | Ga0207689_10023893 | Ga0207689_100238937 | 217 |
| 55 | 3300025961 | Ga0207712_10375589 | Ga0207712_103755892 | 217 |
| 56 | 3300026089 | Ga0207648_10147356 | Ga0207648_101473562 | 217 |
| 57 | 3300028381 | Ga0268264_10081747 | Ga0268264_100817472 | 217 |
| 58 | 3300048911 | Ga0496108_0187305 | Ga0496108_0187305_83_745 | 217 |
| 59 | 3300050507 | nmdc:mga05p37_25847_c1 | nmdc:mga05p37_25847_c1_5915_6628 | 217 |
| 60 | 3300050507 | nmdc:mga05p37_54456_c2 | nmdc:mga05p37_54456_c2_3391_4104 | 217 |
| 61 | 3300050515 | nmdc:mga0a205_3979_c1 | nmdc:mga0a205_3979_c1_5349_6062 | 217 |
| 62 | 3300005467 | Ga0070706_100004663 | Ga0070706_1000046631 | 218 |
| 63 | 3300005468 | Ga0070707_100005091 | Ga0070707_1000050913 | 218 |
| 64 | 3300005468 | Ga0070707_100107578 | Ga0070707_1001075781 | 218 |
| 65 | 3300005468 | Ga0070707_100257053 | Ga0070707_1002570533 | 218 |
| 66 | 3300005468 | Ga0070707_100292866 | Ga0070707_1002928661 | 218 |
| 67 | 3300005468 | Ga0070707_100296334 | Ga0070707_1002963343 | 218 |
| 68 | 3300005518 | Ga0070699_100303452 | Ga0070699_1003034522 | 218 |
| 69 | 3300005549 | Ga0070704_100025781 | Ga0070704_1000257816 | 218 |
| 70 | 3300005549 | Ga0070704_100417910 | Ga0070704_1004179101 | 218 |
| 71 | 3300005617 | Ga0068859_100352572 | Ga0068859_1003525722 | 218 |
| 72 | 3300005841 | Ga0068863_100235255 | Ga0068863_1002352552 | 218 |
| 73 | 3300006358 | Ga0068871_100136015 | Ga0068871_1001360152 | 218 |
| 74 | 3300006847 | Ga0075431_100133912 | Ga0075431_1001339123 | 218 |
| 75 | 3300006852 | Ga0075433_10023489 | Ga0075433_100234894 | 218 |
| 76 | 3300006852 | Ga0075433_10081353 | Ga0075433_100813534 | 218 |
| 77 | 3300006852 | Ga0075433_10209896 | Ga0075433_102098962 | 218 |
| 78 | 3300006871 | Ga0075434_100016204 | Ga0075434_1000162047 | 218 |
| 79 | 3300006871 | Ga0075434_100035293 | Ga0075434_1000352933 | 218 |
| 80 | 3300006871 | Ga0075434_100055054 | Ga0075434_1000550543 | 218 |
| 81 | 3300006914 | Ga0075436_100281821 | Ga0075436_1002818212 | 218 |
| 82 | 3300006931 | Ga0097620_100352569 | Ga0097620_1003525692 | 218 |
| 83 | 3300007076 | Ga0075435_100054387 | Ga0075435_1000543871 | 218 |
| 84 | 3300007076 | Ga0075435_100056407 | Ga0075435_1000564072 | 218 |
| 85 | 3300007076 | Ga0075435_100204549 | Ga0075435_1002045493 | 218 |
| 86 | 3300009094 | Ga0111539_10001170 | Ga0111539_1000117021 | 218 |
| 87 | 3300009094 | Ga0111539_10846181 | Ga0111539_108461812 | 218 |
| 88 | 3300009177 | Ga0105248_10028736 | Ga0105248_100287364 | 218 |
| 89 | 3300025910 | Ga0207684_10199122 | Ga0207684_101991223 | 218 |
| 90 | 3300025922 | Ga0207646_10007966 | Ga0207646_1000796618 | 218 |
| 91 | 3300025922 | Ga0207646_10051069 | Ga0207646_100510693 | 218 |
| 92 | 3300025923 | Ga0207681_10590551 | Ga0207681_105905511 | 218 |
| 93 | 3300025941 | Ga0207711_10600289 | Ga0207711_106002892 | 218 |
| 94 | 3300026088 | Ga0207641_10475767 | Ga0207641_104757672 | 218 |
| 95 | 3300027907 | Ga0207428_10000138 | Ga0207428_1000013850 | 218 |
| 96 | 3300028380 | Ga0268265_10087114 | Ga0268265_100871142 | 218 |
| 97 | 3300034816 | Ga0373930_0035453 | Ga0373930_0035453_70_741 | 218 |
| 98 | 3300034819 | Ga0373958_0014006 | Ga0373958_0014006_576_1247 | 218 |
| 99 | 3300035084 | Ga0373928_0038233 | Ga0373928_0038233_380_1051 | 218 |
| 100 | 3300035088 | Ga0373940_0000629 | Ga0373940_0000629_2947_3618 | 218 |
| 101 | 3300035088 | Ga0373940_0039403 | Ga0373940_0039403_448_1119 | 218 |
| 102 | 3300035112 | Ga0373932_0071834 | Ga0373932_0071834_201_872 | 218 |
| 103 | 3300035691 | Ga0373931_0023227 | Ga0373931_0023227_353_1024 | 218 |
| 104 | 3300035691 | Ga0373931_0333289 | Ga0373931_0333289_129_800 | 218 |
| 105 | 3300042876 | Ga0451577_0023549 | Ga0451577_0023549_3845_4516 | 218 |
| 106 | 3300045051 | Ga0451576_0246340 | Ga0451576_0246340_943_1614 | 218 |
| 107 | 3300046472 | Ga0495580_0009246 | Ga0495580_0009246_2374_3045 | 218 |
| 108 | 3300046528 | Ga0495642_0052408 | Ga0495642_0052408_547_1218 | 218 |
| 109 | 3300046684 | Ga0495669_0040389 | Ga0495669_0040389_346_1017 | 218 |
| 110 | 3300050507 | nmdc:mga05p37_75655_c1 | nmdc:mga05p37_75655_c1_2441_3112 | 218 |
| 111 | 3300050507 | nmdc:mga05p37_84254_c1 | nmdc:mga05p37_84254_c1_389_1060 | 218 |
| 112 | 3300050508 | nmdc:mga09592_20874_c1 | nmdc:mga09592_20874_c1_204_875 | 218 |
| 113 | 3300050509 | nmdc:mga0qj67_128935_c1 | nmdc:mga0qj67_128935_c1_850_1521 | 218 |
| 114 | 3300050510 | nmdc:mga06r32_312194_c1 | nmdc:mga06r32_312194_c1_51_722 | 218 |
| 115 | 3300050511 | nmdc:mga08y16_1441_c1 | nmdc:mga08y16_1441_c1_8608_9279 | 218 |
| 116 | 3300050512 | nmdc:mga0n895_157746_c1 | nmdc:mga0n895_157746_c1_673_1362 | 218 |
| 117 | 3300050512 | nmdc:mga0n895_57523_c1 | nmdc:mga0n895_57523_c1_2920_3591 | 218 |
| 118 | 3300050512 | nmdc:mga0n895_82577_c1 | nmdc:mga0n895_82577_c1_1034_1705 | 218 |
| 119 | 3300050512 | nmdc:mga0n895_864071_c1 | nmdc:mga0n895_864071_c1_128_799 | 218 |
| 120 | 3300050513 | nmdc:mga0rr50_156417_c1 | nmdc:mga0rr50_156417_c1_588_1259 | 218 |
| 121 | 3300050513 | nmdc:mga0rr50_20831_c1 | nmdc:mga0rr50_20831_c1_2310_2981 | 218 |
| 122 | 3300050513 | nmdc:mga0rr50_413113_c1 | nmdc:mga0rr50_413113_c1_191_862 | 218 |
| 123 | 3300050513 | nmdc:mga0rr50_449156_c1 | nmdc:mga0rr50_449156_c1_52_723 | 218 |
| 124 | 3300050515 | nmdc:mga0a205_200908_c1 | nmdc:mga0a205_200908_c1_278_949 | 218 |
| 125 | 3300050515 | nmdc:mga0a205_38407_c1 | nmdc:mga0a205_38407_c1_1920_2591 | 218 |
| 126 | 3300050515 | nmdc:mga0a205_690_c1 | nmdc:mga0a205_690_c1_11038_11709 | 218 |
| 127 | 3300002459 | JGI24751J29686_10000011 | JGI24751J29686_1000001168 | 219 |
| 128 | 3300005290 | Ga0065712_10084272 | Ga0065712_100842722 | 219 |
| 129 | 3300005293 | Ga0065715_10095739 | Ga0065715_100957392 | 219 |
| 130 | 3300005331 | Ga0070670_100000295 | Ga0070670_1000002957 | 219 |
| 131 | 3300005364 | Ga0070673_100282563 | Ga0070673_1002825632 | 219 |
| 132 | 3300005364 | Ga0070673_100601507 | Ga0070673_1006015072 | 219 |
| 133 | 3300005438 | Ga0070701_10155558 | Ga0070701_101555582 | 219 |
| 134 | 3300005441 | Ga0070700_100084723 | Ga0070700_1000847232 | 219 |
| 135 | 3300005441 | Ga0070700_100353940 | Ga0070700_1003539402 | 219 |
| 136 | 3300005458 | Ga0070681_10001543 | Ga0070681_1000154319 | 219 |
| 137 | 3300005458 | Ga0070681_10221183 | Ga0070681_102211832 | 219 |
| 138 | 3300005468 | Ga0070707_100394973 | Ga0070707_1003949732 | 219 |
| 139 | 3300005547 | Ga0070693_100097942 | Ga0070693_1000979422 | 219 |
| 140 | 3300005547 | Ga0070693_100120423 | Ga0070693_1001204232 | 219 |
| 141 | 3300005617 | Ga0068859_100020829 | Ga0068859_1000208292 | 219 |
| 142 | 3300005617 | Ga0068859_100036510 | Ga0068859_1000365105 | 219 |
| 143 | 3300005617 | Ga0068859_100131919 | Ga0068859_1001319192 | 219 |
| 144 | 3300005618 | Ga0068864_100028456 | Ga0068864_1000284565 | 219 |
| 145 | 3300005840 | Ga0068870_10380900 | Ga0068870_103809001 | 219 |
| 146 | 3300005841 | Ga0068863_100166099 | Ga0068863_1001660992 | 219 |
| 147 | 3300005843 | Ga0068860_100154892 | Ga0068860_1001548924 | 219 |
| 148 | 3300006871 | Ga0075434_100060851 | Ga0075434_1000608512 | 219 |
| 149 | 3300006881 | Ga0068865_100257818 | Ga0068865_1002578182 | 219 |
| 150 | 3300006931 | Ga0097620_100020828 | Ga0097620_1000208282 | 219 |
| 151 | 3300006931 | Ga0097620_100036512 | Ga0097620_1000365125 | 219 |
| 152 | 3300006931 | Ga0097620_100131912 | Ga0097620_1001319122 | 219 |
| 153 | 3300009011 | Ga0105251_10049007 | Ga0105251_100490073 | 219 |
| 154 | 3300009098 | Ga0105245_10090957 | Ga0105245_100909572 | 219 |
| 155 | 3300009101 | Ga0105247_10002714 | Ga0105247_100027142 | 219 |
| 156 | 3300009148 | Ga0105243_10182963 | Ga0105243_101829632 | 219 |
| 157 | 3300009174 | Ga0105241_10056953 | Ga0105241_100569532 | 219 |
| 158 | 3300009174 | Ga0105241_10066392 | Ga0105241_100663924 | 219 |
| 159 | 3300009176 | Ga0105242_10146614 | Ga0105242_101466142 | 219 |
| 160 | 3300009545 | Ga0105237_10132920 | Ga0105237_101329202 | 219 |
| 161 | 3300009551 | Ga0105238_10063641 | Ga0105238_100636414 | 219 |
| 162 | 3300009553 | Ga0105249_10100153 | Ga0105249_101001533 | 219 |
| 163 | 3300009553 | Ga0105249_10440825 | Ga0105249_104408252 | 219 |
| 164 | 3300009553 | Ga0105249_10785694 | Ga0105249_107856942 | 219 |
| 165 | 3300010375 | Ga0105239_11215656 | Ga0105239_112156561 | 219 |
| 166 | 3300013306 | Ga0163162_10026725 | Ga0163162_100267253 | 219 |
| 167 | 3300013307 | Ga0157372_10361410 | Ga0157372_103614102 | 219 |
| 168 | 3300014325 | Ga0163163_10001903 | Ga0163163_1000190310 | 219 |
| 169 | 3300014326 | Ga0157380_10011248 | Ga0157380_100112485 | 219 |
| 170 | 3300014326 | Ga0157380_10197191 | Ga0157380_101971912 | 219 |
| 171 | 3300014326 | Ga0157380_11479548 | Ga0157380_114795481 | 219 |
| 172 | 3300017792 | Ga0163161_10410428 | Ga0163161_104104281 | 219 |
| 173 | 3300017792 | Ga0163161_10750511 | Ga0163161_107505112 | 219 |
| 174 | 3300025900 | Ga0207710_10009909 | Ga0207710_100099092 | 219 |
| 175 | 3300025904 | Ga0207647_10265988 | Ga0207647_102659882 | 219 |
| 176 | 3300025911 | Ga0207654_10075676 | Ga0207654_100756762 | 219 |
| 177 | 3300025911 | Ga0207654_10174739 | Ga0207654_101747392 | 219 |
| 178 | 3300025913 | Ga0207695_10255331 | Ga0207695_102553312 | 219 |
| 179 | 3300025923 | Ga0207681_10087685 | Ga0207681_100876853 | 219 |
| 180 | 3300025924 | Ga0207694_10019502 | Ga0207694_100195022 | 219 |
| 181 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001715 | 219 |
| 182 | 3300025931 | Ga0207644_10593667 | Ga0207644_105936671 | 219 |
| 183 | 3300025933 | Ga0207706_10311827 | Ga0207706_103118272 | 219 |
| 184 | 3300025934 | Ga0207686_10366631 | Ga0207686_103666312 | 219 |
| 185 | 3300025938 | Ga0207704_10259487 | Ga0207704_102594872 | 219 |
| 186 | 3300025960 | Ga0207651_10083331 | Ga0207651_100833312 | 219 |
| 187 | 3300026075 | Ga0207708_10026462 | Ga0207708_100264622 | 219 |
| 188 | 3300026075 | Ga0207708_10231585 | Ga0207708_102315852 | 219 |
| 189 | 3300026088 | Ga0207641_10528980 | Ga0207641_105289801 | 219 |
| 190 | 3300026089 | Ga0207648_10049773 | Ga0207648_100497732 | 219 |
| 191 | 3300026095 | Ga0207676_10011946 | Ga0207676_100119462 | 219 |
| 192 | 3300026116 | Ga0207674_10255634 | Ga0207674_102556342 | 219 |
| 193 | 3300026118 | Ga0207675_100254983 | Ga0207675_1002549831 | 219 |
| 194 | 3300026142 | Ga0207698_10119314 | Ga0207698_101193143 | 219 |
| 195 | 3300028381 | Ga0268264_10649115 | Ga0268264_106491151 | 219 |
| 196 | 3300031548 | Ga0307408_100142675 | Ga0307408_1001426752 | 219 |
| 197 | 3300031852 | Ga0307410_10297791 | Ga0307410_102977912 | 219 |
| 198 | 3300035091 | Ga0373951_0004689 | Ga0373951_0004689_458_1126 | 219 |
| 199 | 3300050512 | nmdc:mga0n895_96337_c1 | nmdc:mga0n895_96337_c1_396_1082 | 219 |
| 200 | 3300050515 | nmdc:mga0a205_23263_c1 | nmdc:mga0a205_23263_c1_1644_2330 | 219 |
| 201 | 3300003320 | rootH2_10208663 | rootH2_102086632 | 220 |
| 202 | 3300005288 | Ga0065714_10064818 | Ga0065714_100648185 | 220 |
| 203 | 3300005290 | Ga0065712_10067985 | Ga0065712_100679855 | 220 |
| 204 | 3300005293 | Ga0065715_10000408 | Ga0065715_1000040812 | 220 |
| 205 | 3300005337 | Ga0070682_100003919 | Ga0070682_1000039196 | 220 |
| 206 | 3300005339 | Ga0070660_100747861 | Ga0070660_1007478611 | 220 |
| 207 | 3300005345 | Ga0070692_10014617 | Ga0070692_100146172 | 220 |
| 208 | 3300005440 | Ga0070705_100095064 | Ga0070705_1000950641 | 220 |
| 209 | 3300005441 | Ga0070700_100000103 | Ga0070700_10000010329 | 220 |
| 210 | 3300005441 | Ga0070700_100039267 | Ga0070700_1000392674 | 220 |
| 211 | 3300005444 | Ga0070694_100016088 | Ga0070694_1000160882 | 220 |
| 212 | 3300005467 | Ga0070706_100000001 | Ga0070706_10000000129 | 220 |
| 213 | 3300005518 | Ga0070699_100000581 | Ga0070699_10000058132 | 220 |
| 214 | 3300005518 | Ga0070699_100227025 | Ga0070699_1002270251 | 220 |
| 215 | 3300005544 | Ga0070686_100128410 | Ga0070686_1001284102 | 220 |
| 216 | 3300005545 | Ga0070695_100341849 | Ga0070695_1003418492 | 220 |
| 217 | 3300005547 | Ga0070693_100009029 | Ga0070693_1000090295 | 220 |
| 218 | 3300005615 | Ga0070702_100012362 | Ga0070702_1000123622 | 220 |
| 219 | 3300005616 | Ga0068852_100256217 | Ga0068852_1002562172 | 220 |
| 220 | 3300005617 | Ga0068859_100055944 | Ga0068859_1000559445 | 220 |
| 221 | 3300005618 | Ga0068864_100197716 | Ga0068864_1001977162 | 220 |
| 222 | 3300005834 | Ga0068851_10014077 | Ga0068851_100140771 | 220 |
| 223 | 3300005985 | Ga0081539_10000413 | Ga0081539_1000041334 | 220 |
| 224 | 3300006852 | Ga0075433_10325927 | Ga0075433_103259272 | 220 |
| 225 | 3300006871 | Ga0075434_100080287 | Ga0075434_1000802871 | 220 |
| 226 | 3300006871 | Ga0075434_100127953 | Ga0075434_1001279532 | 220 |
| 227 | 3300006880 | Ga0075429_100453777 | Ga0075429_1004537772 | 220 |
| 228 | 3300006931 | Ga0097620_100055938 | Ga0097620_1000559385 | 220 |
| 229 | 3300007076 | Ga0075435_100018467 | Ga0075435_1000184672 | 220 |
| 230 | 3300009094 | Ga0111539_11373995 | Ga0111539_113739952 | 220 |
| 231 | 3300009147 | Ga0114129_10035789 | Ga0114129_100357895 | 220 |
| 232 | 3300009147 | Ga0114129_10136453 | Ga0114129_101364532 | 220 |
| 233 | 3300009545 | Ga0105237_10003442 | Ga0105237_1000344210 | 220 |
| 234 | 3300010375 | Ga0105239_11650984 | Ga0105239_116509841 | 220 |
| 235 | 3300013100 | Ga0157373_10323146 | Ga0157373_103231461 | 220 |
| 236 | 3300013308 | Ga0157375_10015347 | Ga0157375_100153474 | 220 |
| 237 | 3300013308 | Ga0157375_10826928 | Ga0157375_108269282 | 220 |
| 238 | 3300014968 | Ga0157379_10165278 | Ga0157379_101652783 | 220 |
| 239 | 3300025885 | Ga0207653_10002794 | Ga0207653_100027942 | 220 |
| 240 | 3300025904 | Ga0207647_10035143 | Ga0207647_100351433 | 220 |
| 241 | 3300025910 | Ga0207684_10000030 | Ga0207684_10000030212 | 220 |
| 242 | 3300025914 | Ga0207671_10004811 | Ga0207671_100048119 | 220 |
| 243 | 3300025925 | Ga0207650_10337824 | Ga0207650_103378242 | 220 |
| 244 | 3300026035 | Ga0207703_10369186 | Ga0207703_103691861 | 220 |
| 245 | 3300026035 | Ga0207703_10937829 | Ga0207703_109378291 | 220 |
| 246 | 3300026075 | Ga0207708_10000224 | Ga0207708_1000022427 | 220 |
| 247 | 3300026075 | Ga0207708_10054631 | Ga0207708_100546314 | 220 |
| 248 | 3300031548 | Ga0307408_100009272 | Ga0307408_1000092722 | 220 |
| 249 | 3300031824 | Ga0307413_10034184 | Ga0307413_100341842 | 220 |
| 250 | 3300031852 | Ga0307410_10115719 | Ga0307410_101157192 | 220 |
| 251 | 3300031911 | Ga0307412_10007074 | Ga0307412_100070747 | 220 |
| 252 | 3300032002 | Ga0307416_100486312 | Ga0307416_1004863122 | 220 |
| 253 | 3300032004 | Ga0307414_10005688 | Ga0307414_100056886 | 220 |
| 254 | 3300032005 | Ga0307411_10004154 | Ga0307411_100041545 | 220 |
| 255 | 3300032005 | Ga0307411_10115649 | Ga0307411_101156492 | 220 |
| 256 | 3300032126 | Ga0307415_100010852 | Ga0307415_1000108522 | 220 |
| 257 | 3300032126 | Ga0307415_100315064 | Ga0307415_1003150642 | 220 |
| 258 | 3300035088 | Ga0373940_0082006 | Ga0373940_0082006_214_888 | 220 |
| 259 | 3300035115 | Ga0373941_0002139 | Ga0373941_0002139_271_945 | 220 |
| 260 | 3300035691 | Ga0373931_0019919 | Ga0373931_0019919_199_873 | 220 |
| 261 | 3300037418 | Ga0395900_0278910 | Ga0395900_0278910_799_1479 | 220 |
| 262 | 3300038443 | Ga0395901_0102131 | Ga0395901_0102131_1510_2190 | 220 |
| 263 | 3300038698 | Ga0242419_003448 | Ga0242419_003448_39_713 | 220 |
| 264 | 3300042157 | Ga0439458_0012407 | Ga0439458_0012407_241_921 | 220 |
| 265 | 3300045051 | Ga0451576_0050316 | Ga0451576_0050316_2919_3593 | 220 |
| 266 | 3300048907 | Ga0496104_0128963 | Ga0496104_0128963_1444_2121 | 220 |
| 267 | 3300048913 | Ga0496110_0321485 | Ga0496110_0321485_635_1312 | 220 |
| 268 | 3300048914 | Ga0496111_0236173 | Ga0496111_0236173_330_1007 | 220 |
| 269 | 3300049574 | Ga0501038_0002831 | Ga0501038_0002831_14061_14744 | 220 |
| 270 | 3300049591 | Ga0501075_0103465 | Ga0501075_0103465_155_856 | 220 |
| 271 | 3300049592 | Ga0501076_0608733 | Ga0501076_0608733_13_714 | 220 |
| 272 | 3300049652 | Ga0501202_003361 | Ga0501202_003361_745_1419 | 220 |
| 273 | 3300049660 | Ga0501216_007612 | Ga0501216_007612_900_1574 | 220 |
| 274 | 3300049660 | Ga0501216_019361 | Ga0501216_019361_432_1115 | 220 |
| 275 | 3300049663 | Ga0501223_011019 | Ga0501223_011019_1088_1771 | 220 |
| 276 | 3300049667 | Ga0501230_004268 | Ga0501230_004268_529_1212 | 220 |
| 277 | 3300049668 | Ga0501233_023444 | Ga0501233_023444_561_1244 | 220 |
| 278 | 3300049669 | Ga0501235_006210 | Ga0501235_006210_203_877 | 220 |
| 279 | 3300049683 | Ga0501253_017706 | Ga0501253_017706_26_709 | 220 |
| 280 | 3300050507 | nmdc:mga05p37_293625_c1 | nmdc:mga05p37_293625_c1_1115_1795 | 220 |
| 281 | 3300050508 | nmdc:mga09592_567322_c1 | nmdc:mga09592_567322_c1_55_759 | 220 |
| 282 | 3300050512 | nmdc:mga0n895_159447_c1 | nmdc:mga0n895_159447_c1_275_955 | 220 |
| 283 | 3300050513 | nmdc:mga0rr50_54359_c1 | nmdc:mga0rr50_54359_c1_246_929 | 220 |
| 284 | 3300050515 | nmdc:mga0a205_147677_c1 | nmdc:mga0a205_147677_c1_696_1376 | 220 |
| 285 | 3300050515 | nmdc:mga0a205_61291_c1 | nmdc:mga0a205_61291_c1_2310_2987 | 220 |
| 286 | 3300053154 | Ga0500619_062704 | Ga0500619_062704_105_881 | 220 |
| 287 | 3300005293 | Ga0065715_10175709 | Ga0065715_101757092 | 221 |
| 288 | 3300005330 | Ga0070690_100020494 | Ga0070690_1000204943 | 221 |
| 289 | 3300005336 | Ga0070680_100711112 | Ga0070680_1007111122 | 221 |
| 290 | 3300005340 | Ga0070689_100015200 | Ga0070689_1000152004 | 221 |
| 291 | 3300005444 | Ga0070694_100061927 | Ga0070694_1000619272 | 221 |
| 292 | 3300005444 | Ga0070694_100117169 | Ga0070694_1001171692 | 221 |
| 293 | 3300005444 | Ga0070694_100578948 | Ga0070694_1005789481 | 221 |
| 294 | 3300005545 | Ga0070695_100052191 | Ga0070695_1000521912 | 221 |
| 295 | 3300005545 | Ga0070695_100136923 | Ga0070695_1001369231 | 221 |
| 296 | 3300005545 | Ga0070695_100612699 | Ga0070695_1006126991 | 221 |
| 297 | 3300005577 | Ga0068857_100312629 | Ga0068857_1003126292 | 221 |
| 298 | 3300005617 | Ga0068859_100003377 | Ga0068859_10000337715 | 221 |
| 299 | 3300005617 | Ga0068859_100595394 | Ga0068859_1005953942 | 221 |
| 300 | 3300005618 | Ga0068864_100068784 | Ga0068864_1000687842 | 221 |
| 301 | 3300005840 | Ga0068870_10024979 | Ga0068870_100249794 | 221 |
| 302 | 3300005841 | Ga0068863_100069915 | Ga0068863_1000699154 | 221 |
| 303 | 3300005844 | Ga0068862_100302220 | Ga0068862_1003022202 | 221 |
| 304 | 3300006931 | Ga0097620_100003377 | Ga0097620_1000033772 | 221 |
| 305 | 3300006931 | Ga0097620_100595467 | Ga0097620_1005954672 | 221 |
| 306 | 3300007265 | Ga0099794_10039008 | Ga0099794_100390082 | 221 |
| 307 | 3300009101 | Ga0105247_10022652 | Ga0105247_100226524 | 221 |
| 308 | 3300009147 | Ga0114129_10014321 | Ga0114129_100143212 | 221 |
| 309 | 3300009177 | Ga0105248_10025844 | Ga0105248_100258442 | 221 |
| 310 | 3300013297 | Ga0157378_10504124 | Ga0157378_105041241 | 221 |
| 311 | 3300013307 | Ga0157372_10007348 | Ga0157372_100073484 | 221 |
| 312 | 3300014325 | Ga0163163_10184355 | Ga0163163_101843553 | 221 |
| 313 | 3300014326 | Ga0157380_10042355 | Ga0157380_100423553 | 221 |
| 314 | 3300025900 | Ga0207710_10037702 | Ga0207710_100377022 | 221 |
| 315 | 3300025908 | Ga0207643_10018891 | Ga0207643_100188914 | 221 |
| 316 | 3300025936 | Ga0207670_10001298 | Ga0207670_100012988 | 221 |
| 317 | 3300025941 | Ga0207711_10046688 | Ga0207711_100466884 | 221 |
| 318 | 3300026075 | Ga0207708_10208419 | Ga0207708_102084192 | 221 |
| 319 | 3300026095 | Ga0207676_10058107 | Ga0207676_100581072 | 221 |
| 320 | 3300026116 | Ga0207674_10109655 | Ga0207674_101096552 | 221 |
| 321 | 3300028380 | Ga0268265_10039886 | Ga0268265_100398862 | 221 |
| 322 | 3300028381 | Ga0268264_10546130 | Ga0268264_105461302 | 221 |
| 323 | 3300049515 | Ga0501292_014897 | Ga0501292_014897_18_719 | 221 |
| 324 | 3300049519 | Ga0501296_006886 | Ga0501296_006886_327_1028 | 221 |
| 325 | 3300049522 | Ga0501299_000422 | Ga0501299_000422_3231_3932 | 221 |
| 326 | 3300049652 | Ga0501202_000648 | Ga0501202_000648_184_885 | 221 |
| 327 | 3300049668 | Ga0501233_033480 | Ga0501233_033480_450_1142 | 221 |
| 328 | 3300049669 | Ga0501235_046801 | Ga0501235_046801_232_933 | 221 |
| 329 | 3300049674 | Ga0501242_013030 | Ga0501242_013030_51_743 | 221 |
| 330 | 3300049688 | Ga0501259_015285 | Ga0501259_015285_34_735 | 221 |
| 331 | 3300049707 | Ga0501234_007896 | Ga0501234_007896_911_1597 | 221 |
| 332 | 3300049708 | Ga0501245_010397 | Ga0501245_010397_437_1138 | 221 |
| 333 | 3300050507 | nmdc:mga05p37_29784_c1 | nmdc:mga05p37_29784_c1_2541_3266 | 221 |
| 334 | 3300050515 | nmdc:mga0a205_65122_c1 | nmdc:mga0a205_65122_c1_446_1186 | 221 |
| 335 | 3300003203 | JGI25406J46586_10000950 | JGI25406J46586_100009502 | 222 |
| 336 | 3300005290 | Ga0065712_10009824 | Ga0065712_100098243 | 222 |
| 337 | 3300005293 | Ga0065715_10115352 | Ga0065715_101153522 | 222 |
| 338 | 3300005330 | Ga0070690_100010815 | Ga0070690_1000108153 | 222 |
| 339 | 3300005334 | Ga0068869_100095695 | Ga0068869_1000956953 | 222 |
| 340 | 3300005334 | Ga0068869_100377013 | Ga0068869_1003770132 | 222 |
| 341 | 3300005338 | Ga0068868_100212279 | Ga0068868_1002122791 | 222 |
| 342 | 3300005343 | Ga0070687_100053771 | Ga0070687_1000537712 | 222 |
| 343 | 3300005345 | Ga0070692_10045493 | Ga0070692_100454932 | 222 |
| 344 | 3300005353 | Ga0070669_100263468 | Ga0070669_1002634682 | 222 |
| 345 | 3300005356 | Ga0070674_100070927 | Ga0070674_1000709273 | 222 |
| 346 | 3300005438 | Ga0070701_10019919 | Ga0070701_100199192 | 222 |
| 347 | 3300005440 | Ga0070705_100117014 | Ga0070705_1001170142 | 222 |
| 348 | 3300005441 | Ga0070700_100047033 | Ga0070700_1000470332 | 222 |
| 349 | 3300005441 | Ga0070700_100050677 | Ga0070700_1000506772 | 222 |
| 350 | 3300005441 | Ga0070700_100168275 | Ga0070700_1001682752 | 222 |
| 351 | 3300005444 | Ga0070694_100015550 | Ga0070694_1000155502 | 222 |
| 352 | 3300005444 | Ga0070694_100551895 | Ga0070694_1005518952 | 222 |
| 353 | 3300005457 | Ga0070662_100016422 | Ga0070662_1000164223 | 222 |
| 354 | 3300005544 | Ga0070686_100031105 | Ga0070686_1000311053 | 222 |
| 355 | 3300005547 | Ga0070693_100256533 | Ga0070693_1002565332 | 222 |
| 356 | 3300005549 | Ga0070704_100210137 | Ga0070704_1002101372 | 222 |
| 357 | 3300005578 | Ga0068854_100077229 | Ga0068854_1000772292 | 222 |
| 358 | 3300005615 | Ga0070702_100043521 | Ga0070702_1000435211 | 222 |
| 359 | 3300005617 | Ga0068859_100056809 | Ga0068859_1000568092 | 222 |
| 360 | 3300005617 | Ga0068859_100180400 | Ga0068859_1001804003 | 222 |
| 361 | 3300005618 | Ga0068864_100275927 | Ga0068864_1002759272 | 222 |
| 362 | 3300005718 | Ga0068866_10003551 | Ga0068866_100035514 | 222 |
| 363 | 3300005719 | Ga0068861_100214797 | Ga0068861_1002147972 | 222 |
| 364 | 3300005840 | Ga0068870_10040907 | Ga0068870_100409072 | 222 |
| 365 | 3300005842 | Ga0068858_100060742 | Ga0068858_1000607426 | 222 |
| 366 | 3300005843 | Ga0068860_100186580 | Ga0068860_1001865802 | 222 |
| 367 | 3300005843 | Ga0068860_100243631 | Ga0068860_1002436312 | 222 |
| 368 | 3300005844 | Ga0068862_100018701 | Ga0068862_1000187014 | 222 |
| 369 | 3300005844 | Ga0068862_100229241 | Ga0068862_1002292413 | 222 |
| 370 | 3300005985 | Ga0081539_10000053 | Ga0081539_10000053207 | 222 |
| 371 | 3300006173 | Ga0070716_100135081 | Ga0070716_1001350812 | 222 |
| 372 | 3300006846 | Ga0075430_100032469 | Ga0075430_1000324692 | 222 |
| 373 | 3300006880 | Ga0075429_100552794 | Ga0075429_1005527942 | 222 |
| 374 | 3300006881 | Ga0068865_100185629 | Ga0068865_1001856291 | 222 |
| 375 | 3300006931 | Ga0097620_100056809 | Ga0097620_1000568092 | 222 |
| 376 | 3300006931 | Ga0097620_100180407 | Ga0097620_1001804073 | 222 |
| 377 | 3300009094 | Ga0111539_10088509 | Ga0111539_100885092 | 222 |
| 378 | 3300009148 | Ga0105243_10221297 | Ga0105243_102212972 | 222 |
| 379 | 3300009174 | Ga0105241_10625838 | Ga0105241_106258382 | 222 |
| 380 | 3300009177 | Ga0105248_10043109 | Ga0105248_100431092 | 222 |
| 381 | 3300009177 | Ga0105248_10418981 | Ga0105248_104189811 | 222 |
| 382 | 3300013100 | Ga0157373_10070126 | Ga0157373_100701262 | 222 |
| 383 | 3300013102 | Ga0157371_10059753 | Ga0157371_100597534 | 222 |
| 384 | 3300013297 | Ga0157378_10005014 | Ga0157378_1000501410 | 222 |
| 385 | 3300013297 | Ga0157378_10036917 | Ga0157378_100369173 | 222 |
| 386 | 3300013297 | Ga0157378_10223775 | Ga0157378_102237752 | 222 |
| 387 | 3300013308 | Ga0157375_11081810 | Ga0157375_110818101 | 222 |
| 388 | 3300014326 | Ga0157380_10019779 | Ga0157380_100197793 | 222 |
| 389 | 3300014968 | Ga0157379_10067376 | Ga0157379_100673762 | 222 |
| 390 | 3300017792 | Ga0163161_10048631 | Ga0163161_100486312 | 222 |
| 391 | 3300025908 | Ga0207643_10022022 | Ga0207643_100220222 | 222 |
| 392 | 3300025918 | Ga0207662_10011825 | Ga0207662_100118252 | 222 |
| 393 | 3300025918 | Ga0207662_10042573 | Ga0207662_100425733 | 222 |
| 394 | 3300025923 | Ga0207681_10025484 | Ga0207681_100254842 | 222 |
| 395 | 3300025935 | Ga0207709_10251314 | Ga0207709_102513142 | 222 |
| 396 | 3300025940 | Ga0207691_10331462 | Ga0207691_103314621 | 222 |
| 397 | 3300025940 | Ga0207691_10679668 | Ga0207691_106796681 | 222 |
| 398 | 3300025941 | Ga0207711_10028572 | Ga0207711_100285722 | 222 |
| 399 | 3300025941 | Ga0207711_10645593 | Ga0207711_106455931 | 222 |
| 400 | 3300025942 | Ga0207689_10020196 | Ga0207689_100201963 | 222 |
| 401 | 3300025942 | Ga0207689_10290511 | Ga0207689_102905112 | 222 |
| 402 | 3300025942 | Ga0207689_10295649 | Ga0207689_102956491 | 222 |
| 403 | 3300025960 | Ga0207651_10157410 | Ga0207651_101574102 | 222 |
| 404 | 3300025981 | Ga0207640_10021271 | Ga0207640_100212712 | 222 |
| 405 | 3300025981 | Ga0207640_10238836 | Ga0207640_102388362 | 222 |
| 406 | 3300026023 | Ga0207677_10193660 | Ga0207677_101936602 | 222 |
| 407 | 3300026075 | Ga0207708_10031580 | Ga0207708_100315802 | 222 |
| 408 | 3300026088 | Ga0207641_10448519 | Ga0207641_104485192 | 222 |
| 409 | 3300026118 | Ga0207675_100143674 | Ga0207675_1001436742 | 222 |
| 410 | 3300028380 | Ga0268265_10084352 | Ga0268265_100843522 | 222 |
| 411 | 3300028381 | Ga0268264_10213120 | Ga0268264_102131202 | 222 |
| 412 | 3300028381 | Ga0268264_10485458 | Ga0268264_104854582 | 222 |
| 413 | 3300030732 | Ga0316176_1117742 | Ga0316176_11177421 | 222 |
| 414 | 3300048914 | Ga0496111_0423867 | Ga0496111_0423867_123_812 | 222 |
| 415 | 3300049652 | Ga0501202_053329 | Ga0501202_053329_167_856 | 222 |
| 416 | 3300049665 | Ga0501227_004070 | Ga0501227_004070_2196_2885 | 222 |
| 417 | 3300049704 | Ga0501221_007980 | Ga0501221_007980_1103_1795 | 222 |
| 418 | 3300050508 | nmdc:mga09592_836577_c1 | nmdc:mga09592_836577_c1_48_743 | 222 |
| 419 | 3300050509 | nmdc:mga0qj67_141255_c1 | nmdc:mga0qj67_141255_c1_685_1374 | 222 |
| 420 | 3300050511 | nmdc:mga08y16_104436_c1 | nmdc:mga08y16_104436_c1_850_1539 | 222 |
| 421 | 3300001432 | JGI24034J14986_100817 | JGI24034J14986_1008172 | 223 |
| 422 | 3300002074 | JGI24748J21848_1000001 | JGI24748J21848_1000001361 | 223 |
| 423 | 3300002239 | JGI24034J26672_10000001 | JGI24034J26672_1000000157 | 223 |
| 424 | 3300002244 | JGI24742J22300_10019119 | JGI24742J22300_100191192 | 223 |
| 425 | 3300005347 | Ga0070668_100024570 | Ga0070668_1000245702 | 223 |
| 426 | 3300005355 | Ga0070671_100467960 | Ga0070671_1004679601 | 223 |
| 427 | 3300005364 | Ga0070673_100080591 | Ga0070673_1000805913 | 223 |
| 428 | 3300005364 | Ga0070673_100180424 | Ga0070673_1001804242 | 223 |
| 429 | 3300005365 | Ga0070688_100498018 | Ga0070688_1004980181 | 223 |
| 430 | 3300005434 | Ga0070709_10077904 | Ga0070709_100779042 | 223 |
| 431 | 3300005441 | Ga0070700_100505228 | Ga0070700_1005052281 | 223 |
| 432 | 3300005444 | Ga0070694_100096731 | Ga0070694_1000967312 | 223 |
| 433 | 3300005445 | Ga0070708_100045574 | Ga0070708_1000455742 | 223 |
| 434 | 3300005468 | Ga0070707_100001152 | Ga0070707_10000115224 | 223 |
| 435 | 3300005468 | Ga0070707_100015254 | Ga0070707_1000152542 | 223 |
| 436 | 3300005468 | Ga0070707_100079397 | Ga0070707_1000793972 | 223 |
| 437 | 3300005471 | Ga0070698_100341324 | Ga0070698_1003413242 | 223 |
| 438 | 3300005518 | Ga0070699_100630121 | Ga0070699_1006301211 | 223 |
| 439 | 3300005536 | Ga0070697_100000459 | Ga0070697_1000004594 | 223 |
| 440 | 3300005536 | Ga0070697_100041216 | Ga0070697_1000412164 | 223 |
| 441 | 3300005536 | Ga0070697_100113805 | Ga0070697_1001138051 | 223 |
| 442 | 3300005543 | Ga0070672_100466389 | Ga0070672_1004663891 | 223 |
| 443 | 3300005546 | Ga0070696_100012857 | Ga0070696_1000128574 | 223 |
| 444 | 3300005546 | Ga0070696_100077461 | Ga0070696_1000774612 | 223 |
| 445 | 3300005546 | Ga0070696_100230504 | Ga0070696_1002305042 | 223 |
| 446 | 3300005549 | Ga0070704_100001798 | Ga0070704_10000179811 | 223 |
| 447 | 3300005549 | Ga0070704_100032633 | Ga0070704_1000326332 | 223 |
| 448 | 3300005615 | Ga0070702_100412428 | Ga0070702_1004124281 | 223 |
| 449 | 3300005617 | Ga0068859_100105706 | Ga0068859_1001057062 | 223 |
| 450 | 3300005617 | Ga0068859_100205411 | Ga0068859_1002054112 | 223 |
| 451 | 3300005617 | Ga0068859_100388015 | Ga0068859_1003880152 | 223 |
| 452 | 3300005618 | Ga0068864_100561400 | Ga0068864_1005614002 | 223 |
| 453 | 3300005718 | Ga0068866_10134631 | Ga0068866_101346312 | 223 |
| 454 | 3300005719 | Ga0068861_100159633 | Ga0068861_1001596331 | 223 |
| 455 | 3300005841 | Ga0068863_100133858 | Ga0068863_1001338582 | 223 |
| 456 | 3300005842 | Ga0068858_100000051 | Ga0068858_10000005110 | 223 |
| 457 | 3300005842 | Ga0068858_100036187 | Ga0068858_1000361874 | 223 |
| 458 | 3300006871 | Ga0075434_100586593 | Ga0075434_1005865932 | 223 |
| 459 | 3300006914 | Ga0075436_100000002 | Ga0075436_100000002277 | 223 |
| 460 | 3300006931 | Ga0097620_100105712 | Ga0097620_1001057122 | 223 |
| 461 | 3300006931 | Ga0097620_100205401 | Ga0097620_1002054012 | 223 |
| 462 | 3300006931 | Ga0097620_100388073 | Ga0097620_1003880732 | 223 |
| 463 | 3300007076 | Ga0075435_100030687 | Ga0075435_1000306874 | 223 |
| 464 | 3300009101 | Ga0105247_10000004 | Ga0105247_10000004103 | 223 |
| 465 | 3300009148 | Ga0105243_10311503 | Ga0105243_103115031 | 223 |
| 466 | 3300009553 | Ga0105249_10058162 | Ga0105249_100581624 | 223 |
| 467 | 3300013297 | Ga0157378_10081387 | Ga0157378_100813874 | 223 |
| 468 | 3300013306 | Ga0163162_10099145 | Ga0163162_100991452 | 223 |
| 469 | 3300014325 | Ga0163163_10664329 | Ga0163163_106643292 | 223 |
| 470 | 3300025223 | Ga0207672_1000019 | Ga0207672_10000196 | 223 |
| 471 | 3300025899 | Ga0207642_10038250 | Ga0207642_100382502 | 223 |
| 472 | 3300025900 | Ga0207710_10000002 | Ga0207710_10000002911 | 223 |
| 473 | 3300025906 | Ga0207699_10067689 | Ga0207699_100676892 | 223 |
| 474 | 3300025910 | Ga0207684_10004486 | Ga0207684_1000448611 | 223 |
| 475 | 3300025922 | Ga0207646_10000399 | Ga0207646_1000039911 | 223 |
| 476 | 3300025922 | Ga0207646_10006739 | Ga0207646_100067392 | 223 |
| 477 | 3300025922 | Ga0207646_10050922 | Ga0207646_100509222 | 223 |
| 478 | 3300025922 | Ga0207646_10108018 | Ga0207646_101080182 | 223 |
| 479 | 3300025922 | Ga0207646_10861913 | Ga0207646_108619131 | 223 |
| 480 | 3300025931 | Ga0207644_10000648 | Ga0207644_100006485 | 223 |
| 481 | 3300025934 | Ga0207686_10002486 | Ga0207686_100024862 | 223 |
| 482 | 3300025935 | Ga0207709_10000469 | Ga0207709_1000046917 | 223 |
| 483 | 3300025935 | Ga0207709_10357114 | Ga0207709_103571142 | 223 |
| 484 | 3300025936 | Ga0207670_10050579 | Ga0207670_100505792 | 223 |
| 485 | 3300025939 | Ga0207665_10233246 | Ga0207665_102332462 | 223 |
| 486 | 3300025942 | Ga0207689_10730108 | Ga0207689_107301081 | 223 |
| 487 | 3300025960 | Ga0207651_10049810 | Ga0207651_100498102 | 223 |
| 488 | 3300025960 | Ga0207651_10217008 | Ga0207651_102170082 | 223 |
| 489 | 3300025961 | Ga0207712_10000022 | Ga0207712_10000022236 | 223 |
| 490 | 3300026035 | Ga0207703_10000114 | Ga0207703_1000011461 | 223 |
| 491 | 3300026035 | Ga0207703_10191443 | Ga0207703_101914432 | 223 |
| 492 | 3300037418 | Ga0395900_0679022 | Ga0395900_0679022_131_856 | 223 |
| 493 | 3300037471 | Ga0395905_0885576 | Ga0395905_0885576_40_762 | 223 |
| 494 | 3300038443 | Ga0395901_0158788 | Ga0395901_0158788_1113_1835 | 223 |
| 495 | 3300050512 | nmdc:mga0n895_237792_c1 | nmdc:mga0n895_237792_c1_879_1607 | 223 |
| 496 | 3300050513 | nmdc:mga0rr50_11540_c1 | nmdc:mga0rr50_11540_c1_3357_4085 | 223 |
| 497 | 3300050514 | nmdc:mga08x19_9_c1 | nmdc:mga08x19_9_c1_92475_93203 | 223 |
| 498 | 3300005289 | Ga0065704_10021194 | Ga0065704_100211941 | 224 |
| 499 | 3300005295 | Ga0065707_10000695 | Ga0065707_100006955 | 224 |
| 500 | 3300005334 | Ga0068869_100034544 | Ga0068869_1000345442 | 224 |
| 501 | 3300005338 | Ga0068868_100011754 | Ga0068868_1000117542 | 224 |
| 502 | 3300005406 | Ga0070703_10000014 | Ga0070703_1000001433 | 224 |
| 503 | 3300005441 | Ga0070700_100001274 | Ga0070700_1000012749 | 224 |
| 504 | 3300005444 | Ga0070694_100000381 | Ga0070694_1000003819 | 224 |
| 505 | 3300005444 | Ga0070694_100149359 | Ga0070694_1001493592 | 224 |
| 506 | 3300005445 | Ga0070708_100001824 | Ga0070708_1000018246 | 224 |
| 507 | 3300005467 | Ga0070706_100001194 | Ga0070706_1000011946 | 224 |
| 508 | 3300005467 | Ga0070706_100033745 | Ga0070706_1000337454 | 224 |
| 509 | 3300005467 | Ga0070706_100105036 | Ga0070706_1001050364 | 224 |
| 510 | 3300005468 | Ga0070707_100013363 | Ga0070707_1000133637 | 224 |
| 511 | 3300005468 | Ga0070707_100075469 | Ga0070707_1000754694 | 224 |
| 512 | 3300005471 | Ga0070698_100001546 | Ga0070698_10000154611 | 224 |
| 513 | 3300005471 | Ga0070698_100004183 | Ga0070698_1000041836 | 224 |
| 514 | 3300005471 | Ga0070698_100646494 | Ga0070698_1006464941 | 224 |
| 515 | 3300005518 | Ga0070699_100002585 | Ga0070699_1000025856 | 224 |
| 516 | 3300005518 | Ga0070699_100012111 | Ga0070699_1000121117 | 224 |
| 517 | 3300005518 | Ga0070699_100207321 | Ga0070699_1002073212 | 224 |
| 518 | 3300005544 | Ga0070686_100049338 | Ga0070686_1000493383 | 224 |
| 519 | 3300005545 | Ga0070695_100085925 | Ga0070695_1000859252 | 224 |
| 520 | 3300005547 | Ga0070693_100462596 | Ga0070693_1004625961 | 224 |
| 521 | 3300005549 | Ga0070704_100068744 | Ga0070704_1000687442 | 224 |
| 522 | 3300005549 | Ga0070704_100307522 | Ga0070704_1003075222 | 224 |
| 523 | 3300005564 | Ga0070664_100040159 | Ga0070664_1000401594 | 224 |
| 524 | 3300005719 | Ga0068861_100012344 | Ga0068861_1000123441 | 224 |
| 525 | 3300005843 | Ga0068860_100163022 | Ga0068860_1001630222 | 224 |
| 526 | 3300005843 | Ga0068860_100385440 | Ga0068860_1003854401 | 224 |
| 527 | 3300005844 | Ga0068862_100028889 | Ga0068862_1000288893 | 224 |
| 528 | 3300006163 | Ga0070715_10000025 | Ga0070715_1000002551 | 224 |
| 529 | 3300006173 | Ga0070716_100000003 | Ga0070716_1000000032 | 224 |
| 530 | 3300006844 | Ga0075428_100110226 | Ga0075428_1001102263 | 224 |
| 531 | 3300006914 | Ga0075436_100163663 | Ga0075436_1001636632 | 224 |
| 532 | 3300009094 | Ga0111539_10008376 | Ga0111539_100083763 | 224 |
| 533 | 3300009147 | Ga0114129_11596250 | Ga0114129_115962501 | 224 |
| 534 | 3300009148 | Ga0105243_10000037 | Ga0105243_10000037118 | 224 |
| 535 | 3300009148 | Ga0105243_10000204 | Ga0105243_1000020449 | 224 |
| 536 | 3300009148 | Ga0105243_10090209 | Ga0105243_100902094 | 224 |
| 537 | 3300009148 | Ga0105243_10386898 | Ga0105243_103868982 | 224 |
| 538 | 3300009176 | Ga0105242_10000039 | Ga0105242_1000003934 | 224 |
| 539 | 3300009176 | Ga0105242_10049263 | Ga0105242_100492633 | 224 |
| 540 | 3300009176 | Ga0105242_10113764 | Ga0105242_101137642 | 224 |
| 541 | 3300009176 | Ga0105242_10393315 | Ga0105242_103933151 | 224 |
| 542 | 3300010375 | Ga0105239_10008035 | Ga0105239_1000803510 | 224 |
| 543 | 3300013297 | Ga0157378_10000004 | Ga0157378_1000000485 | 224 |
| 544 | 3300013297 | Ga0157378_10040940 | Ga0157378_100409402 | 224 |
| 545 | 3300013297 | Ga0157378_10050341 | Ga0157378_100503412 | 224 |
| 546 | 3300013297 | Ga0157378_10059323 | Ga0157378_100593231 | 224 |
| 547 | 3300013306 | Ga0163162_10004637 | Ga0163162_1000463711 | 224 |
| 548 | 3300013306 | Ga0163162_10004905 | Ga0163162_1000490510 | 224 |
| 549 | 3300013308 | Ga0157375_10458945 | Ga0157375_104589452 | 224 |
| 550 | 3300017792 | Ga0163161_10008512 | Ga0163161_100085123 | 224 |
| 551 | 3300017792 | Ga0163161_10228678 | Ga0163161_102286781 | 224 |
| 552 | 3300025885 | Ga0207653_10000054 | Ga0207653_1000005459 | 224 |
| 553 | 3300025905 | Ga0207685_10000008 | Ga0207685_1000000896 | 224 |
| 554 | 3300025910 | Ga0207684_10005647 | Ga0207684_100056476 | 224 |
| 555 | 3300025910 | Ga0207684_10224388 | Ga0207684_102243882 | 224 |
| 556 | 3300025918 | Ga0207662_10084831 | Ga0207662_100848312 | 224 |
| 557 | 3300025922 | Ga0207646_10093594 | Ga0207646_100935944 | 224 |
| 558 | 3300025922 | Ga0207646_10099557 | Ga0207646_100995572 | 224 |
| 559 | 3300025922 | Ga0207646_10133474 | Ga0207646_101334743 | 224 |
| 560 | 3300025934 | Ga0207686_10000003 | Ga0207686_10000003304 | 224 |
| 561 | 3300025934 | Ga0207686_10000335 | Ga0207686_1000033522 | 224 |
| 562 | 3300025935 | Ga0207709_10000017 | Ga0207709_10000017363 | 224 |
| 563 | 3300025939 | Ga0207665_10000003 | Ga0207665_10000003114 | 224 |
| 564 | 3300025942 | Ga0207689_10001296 | Ga0207689_1000129619 | 224 |
| 565 | 3300025945 | Ga0207679_10228042 | Ga0207679_102280422 | 224 |
| 566 | 3300025981 | Ga0207640_10500297 | Ga0207640_105002971 | 224 |
| 567 | 3300026023 | Ga0207677_10026157 | Ga0207677_100261573 | 224 |
| 568 | 3300026075 | Ga0207708_10022759 | Ga0207708_100227593 | 224 |
| 569 | 3300026095 | Ga0207676_10137232 | Ga0207676_101372322 | 224 |
| 570 | 3300026118 | Ga0207675_100000644 | Ga0207675_10000064417 | 224 |
| 571 | 3300027907 | Ga0207428_10004277 | Ga0207428_100042774 | 224 |
| 572 | 3300028380 | Ga0268265_10036834 | Ga0268265_100368345 | 224 |
| 573 | 3300028381 | Ga0268264_10118211 | Ga0268264_101182112 | 224 |
| 574 | 3300028381 | Ga0268264_10195884 | Ga0268264_101958841 | 224 |
| 575 | 3300031456 | Ga0307513_10002024 | Ga0307513_1000202410 | 224 |
| 576 | 3300031911 | Ga0307412_10010567 | Ga0307412_100105673 | 224 |
| 577 | 3300032005 | Ga0307411_10058444 | Ga0307411_100584443 | 224 |
| 578 | 3300038996 | Ga0242420_009381 | Ga0242420_009381_25_750 | 224 |
| 579 | 3300041406 | Ga0439439_0030222 | Ga0439439_0030222_329_1060 | 224 |
| 580 | 3300045051 | Ga0451576_0022577 | Ga0451576_0022577_920_1726 | 224 |
| 581 | 3300046535 | Ga0495586_0315539 | Ga0495586_0315539_99_848 | 224 |
| 582 | 3300046539 | Ga0495621_0008981 | Ga0495621_0008981_1476_2201 | 224 |
| 583 | 3300047320 | Ga0495672_0010982 | Ga0495672_0010982_1957_2805 | 224 |
| 584 | 3300048907 | Ga0496104_0257003 | Ga0496104_0257003_619_1329 | 224 |
| 585 | 3300048909 | Ga0496106_0012526 | Ga0496106_0012526_1272_2015 | 224 |
| 586 | 3300049521 | Ga0501298_020225 | Ga0501298_020225_434_1165 | 224 |
| 587 | 3300049661 | Ga0501217_083351 | Ga0501217_083351_112_843 | 224 |
| 588 | 3300049824 | Ga0501045_0148477 | Ga0501045_0148477_254_961 | 224 |
| 589 | 3300050508 | nmdc:mga09592_10833_c1 | nmdc:mga09592_10833_c1_806_1534 | 224 |
| 590 | 3300050511 | nmdc:mga08y16_26147_c1 | nmdc:mga08y16_26147_c1_3668_4396 | 224 |
| 591 | 3300050515 | nmdc:mga0a205_476761_c1 | nmdc:mga0a205_476761_c1_351_1076 | 224 |
| 592 | 3300005289 | Ga0065704_10198323 | Ga0065704_101983231 | 225 |
| 593 | 3300005295 | Ga0065707_10004636 | Ga0065707_100046365 | 225 |
| 594 | 3300005337 | Ga0070682_100000284 | Ga0070682_10000028416 | 225 |
| 595 | 3300005353 | Ga0070669_100005821 | Ga0070669_1000058214 | 225 |
| 596 | 3300005364 | Ga0070673_100463603 | Ga0070673_1004636031 | 225 |
| 597 | 3300005441 | Ga0070700_100007401 | Ga0070700_1000074014 | 225 |
| 598 | 3300005444 | Ga0070694_100181115 | Ga0070694_1001811152 | 225 |
| 599 | 3300005545 | Ga0070695_100161560 | Ga0070695_1001615602 | 225 |
| 600 | 3300005578 | Ga0068854_100089363 | Ga0068854_1000893632 | 225 |
| 601 | 3300005615 | Ga0070702_100328650 | Ga0070702_1003286502 | 225 |
| 602 | 3300005719 | Ga0068861_100040685 | Ga0068861_1000406853 | 225 |
| 603 | 3300005844 | Ga0068862_100012345 | Ga0068862_1000123453 | 225 |
| 604 | 3300006844 | Ga0075428_100633942 | Ga0075428_1006339421 | 225 |
| 605 | 3300009094 | Ga0111539_10435197 | Ga0111539_104351972 | 225 |
| 606 | 3300009147 | Ga0114129_10003680 | Ga0114129_1000368019 | 225 |
| 607 | 3300009147 | Ga0114129_11011524 | Ga0114129_110115242 | 225 |
| 608 | 3300013297 | Ga0157378_10123891 | Ga0157378_101238913 | 225 |
| 609 | 3300013306 | Ga0163162_10138843 | Ga0163162_101388432 | 225 |
| 610 | 3300014326 | Ga0157380_10001690 | Ga0157380_100016907 | 225 |
| 611 | 3300025923 | Ga0207681_10045245 | Ga0207681_100452453 | 225 |
| 612 | 3300026075 | Ga0207708_10014089 | Ga0207708_100140893 | 225 |
| 613 | 3300026118 | Ga0207675_100077905 | Ga0207675_1000779053 | 225 |
| 614 | 3300028380 | Ga0268265_10097804 | Ga0268265_100978043 | 225 |
| 615 | 3300037418 | Ga0395900_0169841 | Ga0395900_0169841_903_1649 | 225 |
| 616 | 3300037466 | Ga0395898_0312877 | Ga0395898_0312877_422_1168 | 225 |
| 617 | 3300037471 | Ga0395905_0042665 | Ga0395905_0042665_739_1485 | 225 |
| 618 | 3300046519 | Ga0495632_0032708 | Ga0495632_0032708_1230_2009 | 225 |
| 619 | 3300046525 | Ga0495663_0000234 | Ga0495663_0000234_11816_12550 | 225 |
| 620 | 3300046537 | Ga0495598_0000507 | Ga0495598_0000507_5596_6336 | 225 |
| 621 | 3300046539 | Ga0495621_0003359 | Ga0495621_0003359_490_1230 | 225 |
| 622 | 3300050507 | nmdc:mga05p37_103735_c1 | nmdc:mga05p37_103735_c1_2071_2802 | 225 |
| 623 | 3300050507 | nmdc:mga05p37_1084577_c1 | nmdc:mga05p37_1084577_c1_61_786 | 225 |
| 624 | 3300053153 | Ga0500616_0001750 | Ga0500616_0001750_18085_18843 | 225 |
| 625 | 3300005290 | Ga0065712_10086831 | Ga0065712_100868313 | 226 |
| 626 | 3300005293 | Ga0065715_10108004 | Ga0065715_101080042 | 226 |
| 627 | 3300005328 | Ga0070676_10213757 | Ga0070676_102137572 | 226 |
| 628 | 3300005330 | Ga0070690_100072419 | Ga0070690_1000724192 | 226 |
| 629 | 3300005343 | Ga0070687_100231762 | Ga0070687_1002317622 | 226 |
| 630 | 3300005345 | Ga0070692_10302900 | Ga0070692_103029001 | 226 |
| 631 | 3300005353 | Ga0070669_100025634 | Ga0070669_1000256343 | 226 |
| 632 | 3300005440 | Ga0070705_100063752 | Ga0070705_1000637522 | 226 |
| 633 | 3300005455 | Ga0070663_100754065 | Ga0070663_1007540651 | 226 |
| 634 | 3300005457 | Ga0070662_100047380 | Ga0070662_1000473804 | 226 |
| 635 | 3300005467 | Ga0070706_100050601 | Ga0070706_1000506014 | 226 |
| 636 | 3300005543 | Ga0070672_100068745 | Ga0070672_1000687453 | 226 |
| 637 | 3300005544 | Ga0070686_100034421 | Ga0070686_1000344212 | 226 |
| 638 | 3300005545 | Ga0070695_100123105 | Ga0070695_1001231052 | 226 |
| 639 | 3300005545 | Ga0070695_100165618 | Ga0070695_1001656181 | 226 |
| 640 | 3300005547 | Ga0070693_100083444 | Ga0070693_1000834443 | 226 |
| 641 | 3300005549 | Ga0070704_100570460 | Ga0070704_1005704601 | 226 |
| 642 | 3300005549 | Ga0070704_101003467 | Ga0070704_1010034671 | 226 |
| 643 | 3300005577 | Ga0068857_100390208 | Ga0068857_1003902081 | 226 |
| 644 | 3300005577 | Ga0068857_100440075 | Ga0068857_1004400752 | 226 |
| 645 | 3300005578 | Ga0068854_100233886 | Ga0068854_1002338862 | 226 |
| 646 | 3300005578 | Ga0068854_100718289 | Ga0068854_1007182892 | 226 |
| 647 | 3300005617 | Ga0068859_100023193 | Ga0068859_1000231932 | 226 |
| 648 | 3300005617 | Ga0068859_100074674 | Ga0068859_1000746742 | 226 |
| 649 | 3300005617 | Ga0068859_100107305 | Ga0068859_1001073052 | 226 |
| 650 | 3300005618 | Ga0068864_101112043 | Ga0068864_1011120431 | 226 |
| 651 | 3300005840 | Ga0068870_10107713 | Ga0068870_101077132 | 226 |
| 652 | 3300005841 | Ga0068863_100035473 | Ga0068863_1000354734 | 226 |
| 653 | 3300005842 | Ga0068858_100334643 | Ga0068858_1003346432 | 226 |
| 654 | 3300006931 | Ga0097620_100023193 | Ga0097620_1000231932 | 226 |
| 655 | 3300006931 | Ga0097620_100074674 | Ga0097620_1000746742 | 226 |
| 656 | 3300006931 | Ga0097620_100107307 | Ga0097620_1001073072 | 226 |
| 657 | 3300009094 | Ga0111539_10013034 | Ga0111539_100130342 | 226 |
| 658 | 3300009147 | Ga0114129_10043769 | Ga0114129_100437692 | 226 |
| 659 | 3300009177 | Ga0105248_10819494 | Ga0105248_108194942 | 226 |
| 660 | 3300013100 | Ga0157373_10086494 | Ga0157373_100864942 | 226 |
| 661 | 3300013297 | Ga0157378_10274491 | Ga0157378_102744913 | 226 |
| 662 | 3300013308 | Ga0157375_10086991 | Ga0157375_100869912 | 226 |
| 663 | 3300013308 | Ga0157375_10108436 | Ga0157375_101084362 | 226 |
| 664 | 3300014325 | Ga0163163_10866048 | Ga0163163_108660482 | 226 |
| 665 | 3300014326 | Ga0157380_10003274 | Ga0157380_100032749 | 226 |
| 666 | 3300025907 | Ga0207645_10088308 | Ga0207645_100883082 | 226 |
| 667 | 3300025910 | Ga0207684_10162911 | Ga0207684_101629112 | 226 |
| 668 | 3300025918 | Ga0207662_10253584 | Ga0207662_102535842 | 226 |
| 669 | 3300025938 | Ga0207704_10135348 | Ga0207704_101353482 | 226 |
| 670 | 3300025941 | Ga0207711_10681183 | Ga0207711_106811831 | 226 |
| 671 | 3300025981 | Ga0207640_10617634 | Ga0207640_106176342 | 226 |
| 672 | 3300026088 | Ga0207641_10031507 | Ga0207641_100315074 | 226 |
| 673 | 3300026089 | Ga0207648_10263478 | Ga0207648_102634782 | 226 |
| 674 | 3300026095 | Ga0207676_10669992 | Ga0207676_106699922 | 226 |
| 675 | 3300027907 | Ga0207428_10064592 | Ga0207428_100645922 | 226 |
| 676 | 3300028381 | Ga0268264_10352692 | Ga0268264_103526922 | 226 |
| 677 | 3300031901 | Ga0307406_10077701 | Ga0307406_100777013 | 226 |
| 678 | 3300048915 | Ga0496112_0548513 | Ga0496112_0548513_72_761 | 226 |
| 679 | 3300049592 | Ga0501076_0344069 | Ga0501076_0344069_422_1135 | 226 |
| 680 | 3300049663 | Ga0501223_023595 | Ga0501223_023595_334_1035 | 226 |
| 681 | 3300049669 | Ga0501235_032528 | Ga0501235_032528_73_774 | 226 |
| 682 | 3300049742 | Ga0501080_0599246 | Ga0501080_0599246_188_901 | 226 |
| 683 | 3300050511 | nmdc:mga08y16_32947_c1 | nmdc:mga08y16_32947_c1_1852_2562 | 226 |
| 684 | 3300060353 | Ga0501082_0546651 | Ga0501082_0546651_270_983 | 226 |
| 685 | 3300005293 | Ga0065715_10174771 | Ga0065715_101747712 | 227 |
| 686 | 3300005345 | Ga0070692_10010986 | Ga0070692_100109862 | 227 |
| 687 | 3300005441 | Ga0070700_100009846 | Ga0070700_1000098462 | 227 |
| 688 | 3300005539 | Ga0068853_100122909 | Ga0068853_1001229092 | 227 |
| 689 | 3300005545 | Ga0070695_100013440 | Ga0070695_1000134405 | 227 |
| 690 | 3300005615 | Ga0070702_100002352 | Ga0070702_1000023525 | 227 |
| 691 | 3300005617 | Ga0068859_100685666 | Ga0068859_1006856661 | 227 |
| 692 | 3300005842 | Ga0068858_100197665 | Ga0068858_1001976652 | 227 |
| 693 | 3300005843 | Ga0068860_100040266 | Ga0068860_1000402662 | 227 |
| 694 | 3300005983 | Ga0081540_1048266 | Ga0081540_10482663 | 227 |
| 695 | 3300006237 | Ga0097621_100009417 | Ga0097621_1000094176 | 227 |
| 696 | 3300006358 | Ga0068871_100004716 | Ga0068871_1000047169 | 227 |
| 697 | 3300006931 | Ga0097620_100685740 | Ga0097620_1006857401 | 227 |
| 698 | 3300009545 | Ga0105237_10626472 | Ga0105237_106264722 | 227 |
| 699 | 3300009551 | Ga0105238_10004865 | Ga0105238_1000486510 | 227 |
| 700 | 3300014325 | Ga0163163_10079626 | Ga0163163_100796262 | 227 |
| 701 | 3300014326 | Ga0157380_10081338 | Ga0157380_100813382 | 227 |
| 702 | 3300025904 | Ga0207647_10005841 | Ga0207647_100058418 | 227 |
| 703 | 3300025914 | Ga0207671_10559773 | Ga0207671_105597731 | 227 |
| 704 | 3300025924 | Ga0207694_10041211 | Ga0207694_100412112 | 227 |
| 705 | 3300025933 | Ga0207706_10425431 | Ga0207706_104254311 | 227 |
| 706 | 3300026035 | Ga0207703_10345077 | Ga0207703_103450771 | 227 |
| 707 | 3300026075 | Ga0207708_10029922 | Ga0207708_100299225 | 227 |
| 708 | 3300026116 | Ga0207674_10574289 | Ga0207674_105742891 | 227 |
| 709 | 3300026142 | Ga0207698_10554158 | Ga0207698_105541582 | 227 |
| 710 | 3300028381 | Ga0268264_10045196 | Ga0268264_100451962 | 227 |
| 711 | 3300000532 | CNAas_1001118 | CNAas_10011182 | 228 |
| 712 | 3300005331 | Ga0070670_100346236 | Ga0070670_1003462361 | 228 |
| 713 | 3300005334 | Ga0068869_100002098 | Ga0068869_1000020983 | 228 |
| 714 | 3300005334 | Ga0068869_100410224 | Ga0068869_1004102241 | 228 |
| 715 | 3300005353 | Ga0070669_100001335 | Ga0070669_1000013357 | 228 |
| 716 | 3300005444 | Ga0070694_100016758 | Ga0070694_1000167582 | 228 |
| 717 | 3300005471 | Ga0070698_100009712 | Ga0070698_1000097127 | 228 |
| 718 | 3300005471 | Ga0070698_100013859 | Ga0070698_1000138596 | 228 |
| 719 | 3300005536 | Ga0070697_100000449 | Ga0070697_1000004493 | 228 |
| 720 | 3300005549 | Ga0070704_100374626 | Ga0070704_1003746261 | 228 |
| 721 | 3300005718 | Ga0068866_10013561 | Ga0068866_100135615 | 228 |
| 722 | 3300006880 | Ga0075429_100272927 | Ga0075429_1002729272 | 228 |
| 723 | 3300009094 | Ga0111539_10115063 | Ga0111539_101150632 | 228 |
| 724 | 3300009147 | Ga0114129_11204774 | Ga0114129_112047741 | 228 |
| 725 | 3300011119 | Ga0105246_10111651 | Ga0105246_101116512 | 228 |
| 726 | 3300025922 | Ga0207646_10486492 | Ga0207646_104864921 | 228 |
| 727 | 3300025923 | Ga0207681_10004226 | Ga0207681_100042267 | 228 |
| 728 | 3300025942 | Ga0207689_10033676 | Ga0207689_100336762 | 228 |
| 729 | 3300026095 | Ga0207676_10608062 | Ga0207676_106080621 | 228 |
| 730 | 3300026116 | Ga0207674_10064717 | Ga0207674_100647172 | 228 |
| 731 | 3300050508 | nmdc:mga09592_262479_c1 | nmdc:mga09592_262479_c1_331_1050 | 228 |
| 732 | 3300050511 | nmdc:mga08y16_118088_c1 | nmdc:mga08y16_118088_c1_786_1505 | 228 |
| 733 | 3300005290 | Ga0065712_10074944 | Ga0065712_100749445 | 229 |
| 734 | 3300005330 | Ga0070690_100005613 | Ga0070690_1000056132 | 229 |
| 735 | 3300005331 | Ga0070670_100715437 | Ga0070670_1007154371 | 229 |
| 736 | 3300005334 | Ga0068869_100007543 | Ga0068869_1000075433 | 229 |
| 737 | 3300005335 | Ga0070666_10017717 | Ga0070666_100177172 | 229 |
| 738 | 3300005336 | Ga0070680_100002436 | Ga0070680_1000024365 | 229 |
| 739 | 3300005338 | Ga0068868_100168430 | Ga0068868_1001684302 | 229 |
| 740 | 3300005340 | Ga0070689_100181243 | Ga0070689_1001812432 | 229 |
| 741 | 3300005345 | Ga0070692_10095853 | Ga0070692_100958531 | 229 |
| 742 | 3300005347 | Ga0070668_100888584 | Ga0070668_1008885841 | 229 |
| 743 | 3300005354 | Ga0070675_100032362 | Ga0070675_1000323625 | 229 |
| 744 | 3300005355 | Ga0070671_100006944 | Ga0070671_1000069442 | 229 |
| 745 | 3300005355 | Ga0070671_100040518 | Ga0070671_1000405183 | 229 |
| 746 | 3300005355 | Ga0070671_100077319 | Ga0070671_1000773194 | 229 |
| 747 | 3300005364 | Ga0070673_100551232 | Ga0070673_1005512321 | 229 |
| 748 | 3300005365 | Ga0070688_100054417 | Ga0070688_1000544171 | 229 |
| 749 | 3300005438 | Ga0070701_10048333 | Ga0070701_100483332 | 229 |
| 750 | 3300005440 | Ga0070705_100100463 | Ga0070705_1001004632 | 229 |
| 751 | 3300005441 | Ga0070700_100037286 | Ga0070700_1000372862 | 229 |
| 752 | 3300005458 | Ga0070681_10000359 | Ga0070681_1000035913 | 229 |
| 753 | 3300005459 | Ga0068867_100220419 | Ga0068867_1002204192 | 229 |
| 754 | 3300005466 | Ga0070685_10004591 | Ga0070685_100045915 | 229 |
| 755 | 3300005467 | Ga0070706_100262549 | Ga0070706_1002625492 | 229 |
| 756 | 3300005471 | Ga0070698_100572419 | Ga0070698_1005724191 | 229 |
| 757 | 3300005530 | Ga0070679_100000081 | Ga0070679_10000008111 | 229 |
| 758 | 3300005536 | Ga0070697_100145467 | Ga0070697_1001454673 | 229 |
| 759 | 3300005536 | Ga0070697_100444376 | Ga0070697_1004443761 | 229 |
| 760 | 3300005544 | Ga0070686_100025351 | Ga0070686_1000253512 | 229 |
| 761 | 3300005545 | Ga0070695_100249761 | Ga0070695_1002497612 | 229 |
| 762 | 3300005546 | Ga0070696_100401312 | Ga0070696_1004013121 | 229 |
| 763 | 3300005547 | Ga0070693_100434970 | Ga0070693_1004349701 | 229 |
| 764 | 3300005548 | Ga0070665_100031357 | Ga0070665_1000313572 | 229 |
| 765 | 3300005563 | Ga0068855_101199584 | Ga0068855_1011995841 | 229 |
| 766 | 3300005564 | Ga0070664_100061803 | Ga0070664_1000618032 | 229 |
| 767 | 3300005577 | Ga0068857_100237115 | Ga0068857_1002371151 | 229 |
| 768 | 3300005578 | Ga0068854_100423488 | Ga0068854_1004234881 | 229 |
| 769 | 3300005615 | Ga0070702_100008924 | Ga0070702_1000089246 | 229 |
| 770 | 3300005615 | Ga0070702_100387679 | Ga0070702_1003876791 | 229 |
| 771 | 3300005617 | Ga0068859_100030707 | Ga0068859_1000307074 | 229 |
| 772 | 3300005617 | Ga0068859_100047511 | Ga0068859_1000475112 | 229 |
| 773 | 3300005617 | Ga0068859_100056640 | Ga0068859_1000566401 | 229 |
| 774 | 3300005618 | Ga0068864_100188615 | Ga0068864_1001886152 | 229 |
| 775 | 3300005618 | Ga0068864_100292644 | Ga0068864_1002926442 | 229 |
| 776 | 3300005618 | Ga0068864_100440909 | Ga0068864_1004409092 | 229 |
| 777 | 3300005840 | Ga0068870_10017714 | Ga0068870_100177142 | 229 |
| 778 | 3300005841 | Ga0068863_100240461 | Ga0068863_1002404612 | 229 |
| 779 | 3300005842 | Ga0068858_100212180 | Ga0068858_1002121802 | 229 |
| 780 | 3300005842 | Ga0068858_100638313 | Ga0068858_1006383132 | 229 |
| 781 | 3300005843 | Ga0068860_100005783 | Ga0068860_1000057839 | 229 |
| 782 | 3300005843 | Ga0068860_100086324 | Ga0068860_1000863242 | 229 |
| 783 | 3300005844 | Ga0068862_100436533 | Ga0068862_1004365332 | 229 |
| 784 | 3300006237 | Ga0097621_100001671 | Ga0097621_10000167110 | 229 |
| 785 | 3300006237 | Ga0097621_100010818 | Ga0097621_1000108184 | 229 |
| 786 | 3300006237 | Ga0097621_100090837 | Ga0097621_1000908372 | 229 |
| 787 | 3300006358 | Ga0068871_100014711 | Ga0068871_1000147116 | 229 |
| 788 | 3300006358 | Ga0068871_100015543 | Ga0068871_1000155432 | 229 |
| 789 | 3300006852 | Ga0075433_10059541 | Ga0075433_100595412 | 229 |
| 790 | 3300006852 | Ga0075433_10213281 | Ga0075433_102132811 | 229 |
| 791 | 3300006871 | Ga0075434_100121144 | Ga0075434_1001211443 | 229 |
| 792 | 3300006881 | Ga0068865_100092515 | Ga0068865_1000925153 | 229 |
| 793 | 3300006914 | Ga0075436_100212302 | Ga0075436_1002123022 | 229 |
| 794 | 3300006931 | Ga0097620_100030704 | Ga0097620_1000307042 | 229 |
| 795 | 3300006931 | Ga0097620_100047511 | Ga0097620_1000475115 | 229 |
| 796 | 3300006931 | Ga0097620_100056636 | Ga0097620_1000566361 | 229 |
| 797 | 3300009098 | Ga0105245_10042109 | Ga0105245_100421095 | 229 |
| 798 | 3300009147 | Ga0114129_10678167 | Ga0114129_106781671 | 229 |
| 799 | 3300009148 | Ga0105243_10004015 | Ga0105243_100040152 | 229 |
| 800 | 3300009174 | Ga0105241_10045379 | Ga0105241_100453791 | 229 |
| 801 | 3300009176 | Ga0105242_10031279 | Ga0105242_100312792 | 229 |
| 802 | 3300009177 | Ga0105248_10018179 | Ga0105248_100181793 | 229 |
| 803 | 3300009177 | Ga0105248_10092776 | Ga0105248_100927762 | 229 |
| 804 | 3300009551 | Ga0105238_11213504 | Ga0105238_112135041 | 229 |
| 805 | 3300009553 | Ga0105249_10033549 | Ga0105249_100335495 | 229 |
| 806 | 3300009553 | Ga0105249_11277089 | Ga0105249_112770891 | 229 |
| 807 | 3300011119 | Ga0105246_10034007 | Ga0105246_100340071 | 229 |
| 808 | 3300013296 | Ga0157374_10032741 | Ga0157374_100327412 | 229 |
| 809 | 3300013297 | Ga0157378_10034561 | Ga0157378_100345612 | 229 |
| 810 | 3300013297 | Ga0157378_10866531 | Ga0157378_108665312 | 229 |
| 811 | 3300013306 | Ga0163162_10008699 | Ga0163162_100086997 | 229 |
| 812 | 3300013306 | Ga0163162_10026493 | Ga0163162_100264932 | 229 |
| 813 | 3300013306 | Ga0163162_10195976 | Ga0163162_101959762 | 229 |
| 814 | 3300013307 | Ga0157372_10323663 | Ga0157372_103236632 | 229 |
| 815 | 3300013308 | Ga0157375_10003507 | Ga0157375_100035072 | 229 |
| 816 | 3300013308 | Ga0157375_10026598 | Ga0157375_100265985 | 229 |
| 817 | 3300013308 | Ga0157375_10142684 | Ga0157375_101426842 | 229 |
| 818 | 3300014325 | Ga0163163_10017139 | Ga0163163_100171394 | 229 |
| 819 | 3300014325 | Ga0163163_10029220 | Ga0163163_100292204 | 229 |
| 820 | 3300014325 | Ga0163163_10047380 | Ga0163163_100473802 | 229 |
| 821 | 3300014325 | Ga0163163_10078964 | Ga0163163_100789642 | 229 |
| 822 | 3300014326 | Ga0157380_10104053 | Ga0157380_101040533 | 229 |
| 823 | 3300014745 | Ga0157377_10117189 | Ga0157377_101171892 | 229 |
| 824 | 3300014969 | Ga0157376_10013217 | Ga0157376_100132174 | 229 |
| 825 | 3300014969 | Ga0157376_10377773 | Ga0157376_103777732 | 229 |
| 826 | 3300025315 | Ga0207697_10009201 | Ga0207697_100092012 | 229 |
| 827 | 3300025908 | Ga0207643_10052870 | Ga0207643_100528703 | 229 |
| 828 | 3300025910 | Ga0207684_10298258 | Ga0207684_102982582 | 229 |
| 829 | 3300025911 | Ga0207654_10219987 | Ga0207654_102199872 | 229 |
| 830 | 3300025912 | Ga0207707_10000007 | Ga0207707_1000000754 | 229 |
| 831 | 3300025913 | Ga0207695_10727935 | Ga0207695_107279352 | 229 |
| 832 | 3300025917 | Ga0207660_10002775 | Ga0207660_100027756 | 229 |
| 833 | 3300025921 | Ga0207652_10000062 | Ga0207652_1000006244 | 229 |
| 834 | 3300025925 | Ga0207650_10466396 | Ga0207650_104663961 | 229 |
| 835 | 3300025926 | Ga0207659_10480080 | Ga0207659_104800802 | 229 |
| 836 | 3300025927 | Ga0207687_10137965 | Ga0207687_101379652 | 229 |
| 837 | 3300025931 | Ga0207644_10047254 | Ga0207644_100472542 | 229 |
| 838 | 3300025935 | Ga0207709_10128820 | Ga0207709_101288201 | 229 |
| 839 | 3300025936 | Ga0207670_10237944 | Ga0207670_102379442 | 229 |
| 840 | 3300025941 | Ga0207711_10039645 | Ga0207711_100396452 | 229 |
| 841 | 3300025941 | Ga0207711_10648343 | Ga0207711_106483431 | 229 |
| 842 | 3300025942 | Ga0207689_10009146 | Ga0207689_100091462 | 229 |
| 843 | 3300025942 | Ga0207689_10113322 | Ga0207689_101133222 | 229 |
| 844 | 3300025942 | Ga0207689_10166034 | Ga0207689_101660343 | 229 |
| 845 | 3300025960 | Ga0207651_10042437 | Ga0207651_100424371 | 229 |
| 846 | 3300025961 | Ga0207712_10134188 | Ga0207712_101341882 | 229 |
| 847 | 3300025972 | Ga0207668_10345369 | Ga0207668_103453691 | 229 |
| 848 | 3300025986 | Ga0207658_10254404 | Ga0207658_102544042 | 229 |
| 849 | 3300026023 | Ga0207677_10319567 | Ga0207677_103195672 | 229 |
| 850 | 3300026035 | Ga0207703_10017836 | Ga0207703_100178364 | 229 |
| 851 | 3300026035 | Ga0207703_10403198 | Ga0207703_104031981 | 229 |
| 852 | 3300026075 | Ga0207708_10064634 | Ga0207708_100646344 | 229 |
| 853 | 3300026078 | Ga0207702_10087038 | Ga0207702_100870382 | 229 |
| 854 | 3300026088 | Ga0207641_10048725 | Ga0207641_100487254 | 229 |
| 855 | 3300026089 | Ga0207648_10020391 | Ga0207648_100203915 | 229 |
| 856 | 3300026095 | Ga0207676_10004993 | Ga0207676_100049934 | 229 |
| 857 | 3300026095 | Ga0207676_10497776 | Ga0207676_104977762 | 229 |
| 858 | 3300026118 | Ga0207675_100009769 | Ga0207675_1000097699 | 229 |
| 859 | 3300026121 | Ga0207683_10154313 | Ga0207683_101543132 | 229 |
| 860 | 3300028379 | Ga0268266_10042839 | Ga0268266_100428392 | 229 |
| 861 | 3300028381 | Ga0268264_10006252 | Ga0268264_100062525 | 229 |
| 862 | 3300036401 | Ga0373937_0096287 | Ga0373937_0096287_134_862 | 229 |
| 863 | 3300037471 | Ga0395905_0198777 | Ga0395905_0198777_826_1542 | 229 |
| 864 | 3300048905 | Ga0496102_0020336 | Ga0496102_0020336_282_1004 | 229 |
| 865 | 3300048911 | Ga0496108_0069455 | Ga0496108_0069455_2178_2894 | 229 |
| 866 | 3300048917 | Ga0496114_0503001 | Ga0496114_0503001_58_786 | 229 |
| 867 | 3300050507 | nmdc:mga05p37_598000_c1 | nmdc:mga05p37_598000_c1_43_789 | 229 |
| 868 | 3300050512 | nmdc:mga0n895_16349_c1 | nmdc:mga0n895_16349_c1_946_1662 | 229 |
| 869 | 3300050512 | nmdc:mga0n895_189076_c1 | nmdc:mga0n895_189076_c1_447_1172 | 229 |
| 870 | 3300050513 | nmdc:mga0rr50_114418_c1 | nmdc:mga0rr50_114418_c1_478_1194 | 229 |
| 871 | 3300050515 | nmdc:mga0a205_18518_c1 | nmdc:mga0a205_18518_c1_31_747 | 229 |
| 872 | 3300050515 | nmdc:mga0a205_29986_c1 | nmdc:mga0a205_29986_c1_1024_1749 | 229 |
| 873 | 3300005618 | Ga0068864_100041807 | Ga0068864_1000418072 | 230 |
| 874 | 3300006846 | Ga0075430_100330055 | Ga0075430_1003300552 | 230 |
| 875 | 3300006847 | Ga0075431_100071249 | Ga0075431_1000712495 | 230 |
| 876 | 3300006880 | Ga0075429_100035844 | Ga0075429_1000358442 | 230 |
| 877 | 3300013297 | Ga0157378_10582276 | Ga0157378_105822761 | 230 |
| 878 | 3300026116 | Ga0207674_10027008 | Ga0207674_100270083 | 230 |
| 879 | 3300048913 | Ga0496110_0287134 | Ga0496110_0287134_122_835 | 230 |
| 880 | 3300048914 | Ga0496111_0309796 | Ga0496111_0309796_122_835 | 230 |
| 881 | 3300050507 | nmdc:mga05p37_71287_c1 | nmdc:mga05p37_71287_c1_1655_2389 | 230 |
| 882 | 3300050508 | nmdc:mga09592_74063_c1 | nmdc:mga09592_74063_c1_2042_2776 | 230 |
| 883 | 2162886007 | SwRhRL2b_contig_1681169 | SwRhRL2b_0674.00006650 | 231 |
| 884 | 3300005289 | Ga0065704_10012374 | Ga0065704_100123742 | 231 |
| 885 | 3300005295 | Ga0065707_10032723 | Ga0065707_100327231 | 231 |
| 886 | 3300009094 | Ga0111539_10002690 | Ga0111539_100026909 | 231 |
| 887 | 3300009148 | Ga0105243_10001165 | Ga0105243_1000116518 | 231 |
| 888 | 3300025935 | Ga0207709_10000786 | Ga0207709_1000078622 | 231 |
| 889 | 3300027907 | Ga0207428_10008185 | Ga0207428_100081852 | 231 |
| 890 | 3300050511 | nmdc:mga08y16_2206_c1 | nmdc:mga08y16_2206_c1_13638_14333 | 231 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ap8-assembly1.cif.gz_A | crystal structure of human molybdopterin synthase catalytic subunit (mocs2b) | 0.9816 | 95 | 221 |
| 2qie-assembly2.cif.gz_H | staphylococcus aureus molybdopterin synthase in complex with precursor z | 0.9579 | 97 | 229 |
| 2q5w-assembly1.cif.gz_E | the x-ray crystal structure of molybdopterin synthase from staphylococcus aureus | 0.9541 | 97 | 229 |
| 6jc0-assembly1.cif.gz_B | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.9535 | 96 | 230 |
| 2wp4-assembly1.cif.gz_A | crystal structure of rv3119 from mycobacterium tuberculosis | 0.9384 | 94 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5mpoC00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9863 | 95 | 221 | 3.90.1170.40 |
| af_P91500_195_340_3.90.1170.40 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9762 | 95 | 228 | 3.90.1170.40 |
| af_Q86HF4_1_145_3.90.1170.40 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9694 | 94 | 229 | 3.90.1170.40 |
| af_Q6MWY3_4_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9647 | 9 | 82 | 3.10.20.30 |
| 2qieK00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9544 | 97 | 229 | 3.90.1170.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9L0U3-F1-model_v4 | Molybdenum cofactor biosynthesis protein MoaD | 0.993 | 124 | 229 |
GO:0006777
|
| AF-A0A0P6GA46-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) | 0.9921 | 95 | 231 |
GO:0006777
GO:0030366 GO:1990140 |
| AF-A0A0K8WI54-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) | 0.9912 | 95 | 231 |
GO:0006777
GO:0030366 GO:1990140 |
| AF-A0A026X236-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) | 0.9905 | 95 | 231 |
GO:0006777
GO:0030366 GO:1990140 |
| AF-A0A7M7G3R1-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) | 0.9893 | 94 | 231 |
GO:0006777
GO:0030366 GO:1990140 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar