F484831

General Info

Members Datasets Scaffolds Average Seq Length
890 263 890 236

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0010982|Ga0495672_0010982_1957_2805
Length 282
Sequence LDQGKPFFICHFSFEIWNLEFVIARPRLADSANNEIGVRVLFFGAARDAVGKGEVDLVLQGTPTASSAFASVLARFPELGRFGRSLLFAVNQEYAQADREVHDGDELAVFPPVSGGSSGTAEVSPVATFPEDFFELTTNSIDVGSVARRVVLPACGATVTLDGYAREWTRGRRTLYLVYEAYAPMAVLELQRLGREVHERFEIAHIGIVHRTGKLEIGETSVVIAVSAPHRQAAFAACEWAIKELKRTVPIWKKEFFEDGEVWVDGEEQTGNRGTGEMGNGD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
190 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
191 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
203 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
204 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
205 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
226 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
227 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
228 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
229 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
234 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
235 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
236 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
237 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
238 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
239 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
240 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
241 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
242 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
243 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
244 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
245 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
246 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
247 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
248 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 1.46
Rhizosphere 98.09
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1681169 2162886007 Unclassified 917
2 CNAas_1001118 3300000532 Bacteria 2444
3 JGI24034J14986_100817 3300001432 Bacteria 1847
4 JGI24748J21848_1000001 3300002074 Bacteria 444271
5 JGI24034J26672_10000001 3300002239 Bacteria 1118280
6 JGI24742J22300_10019119 3300002244 Bacteria 1162
7 JGI24751J29686_10000011 3300002459 Bacteria 117978
8 JGI25406J46586_10000950 3300003203 Bacteria 13632
9 rootH2_10208663 3300003320 Unclassified 1291
10 Ga0065714_10064818 3300005288 Bacteria 18008
11 Ga0065704_10012374 3300005289 Unclassified 2472
12 Ga0065704_10021194 3300005289 Unclassified 1551
13 Ga0065704_10198323 3300005289 Unclassified 1158
14 Ga0065712_10009824 3300005290 Bacteria 2841
15 Ga0065712_10067985 3300005290 Bacteria 18008
16 Ga0065712_10074944 3300005290 Bacteria 3974
17 Ga0065712_10084272 3300005290 Bacteria 2778
18 Ga0065712_10086831 3300005290 Bacteria 2613
19 Ga0065715_10000408 3300005293 Bacteria 15621
20 Ga0065715_10095739 3300005293 Bacteria 4017
21 Ga0065715_10108004 3300005293 Bacteria 2741
22 Ga0065715_10115352 3300005293 Unclassified 2418
23 Ga0065715_10174771 3300005293 Viruses 1520
24 Ga0065715_10175709 3300005293 Bacteria 1513
25 Ga0065707_10000695 3300005295 Bacteria 15926
26 Ga0065707_10004636 3300005295 Unclassified 4917
27 Ga0065707_10032723 3300005295 Unclassified 890
28 Ga0070676_10213757 3300005328 Bacteria 1270
29 Ga0070690_100005613 3300005330 Bacteria 7061
30 Ga0070690_100010815 3300005330 Bacteria 5322
31 Ga0070690_100020494 3300005330 Bacteria 4028
32 Ga0070690_100072419 3300005330 Bacteria 2241
33 Ga0070670_100000295 3300005331 Bacteria 43851
34 Ga0070670_100346236 3300005331 Bacteria 1305
35 Ga0070670_100715437 3300005331 Bacteria 901
36 Ga0068869_100002098 3300005334 Bacteria 11981
37 Ga0068869_100007543 3300005334 Bacteria 6961
38 Ga0068869_100034544 3300005334 Bacteria 3577
39 Ga0068869_100095695 3300005334 Unclassified 2241
40 Ga0068869_100377013 3300005334 Unclassified 1162
41 Ga0068869_100410224 3300005334 Bacteria 1116
42 Ga0070666_10017717 3300005335 Bacteria 4570
43 Ga0070680_100002436 3300005336 Bacteria 13786
44 Ga0070680_100711112 3300005336 Bacteria 864
45 Ga0070682_100000284 3300005337 Bacteria 36241
46 Ga0070682_100003919 3300005337 Bacteria 8258
47 Ga0068868_100011754 3300005338 Bacteria 6380
48 Ga0068868_100168430 3300005338 Bacteria 1813
49 Ga0068868_100212279 3300005338 Bacteria 1618
50 Ga0070660_100747861 3300005339 Unclassified 821
51 Ga0070689_100015200 3300005340 Bacteria 5608
52 Ga0070689_100181243 3300005340 Bacteria 1711
53 Ga0070691_10013382 3300005341 Bacteria 3758
54 Ga0070687_100053771 3300005343 Unclassified 2095
55 Ga0070687_100231762 3300005343 Unclassified 1137
56 Ga0070692_10010986 3300005345 Unclassified 4144
57 Ga0070692_10014617 3300005345 Unclassified 3693
58 Ga0070692_10045493 3300005345 Unclassified 2264
59 Ga0070692_10079040 3300005345 Bacteria 1767
60 Ga0070692_10095853 3300005345 Bacteria 1620
61 Ga0070692_10302900 3300005345 Unclassified 976
62 Ga0070668_100024570 3300005347 Bacteria 4566
63 Ga0070668_100888584 3300005347 Unclassified 796
64 Ga0070669_100001335 3300005353 Bacteria 17792
65 Ga0070669_100005821 3300005353 Bacteria 8890
66 Ga0070669_100025634 3300005353 Bacteria 4235
67 Ga0070669_100185867 3300005353 Bacteria 1628
68 Ga0070669_100263468 3300005353 Bacteria 1376
69 Ga0070675_100032362 3300005354 Bacteria 4232
70 Ga0070671_100006944 3300005355 Bacteria 9069
71 Ga0070671_100040518 3300005355 Bacteria 3869
72 Ga0070671_100077319 3300005355 Bacteria 2781
73 Ga0070671_100467960 3300005355 Bacteria 1082
74 Ga0070674_100070927 3300005356 Unclassified 2463
75 Ga0070673_100080591 3300005364 Bacteria 2638
76 Ga0070673_100180424 3300005364 Bacteria 1807
77 Ga0070673_100282563 3300005364 Bacteria 1456
78 Ga0070673_100463603 3300005364 Bacteria 1141
79 Ga0070673_100551232 3300005364 Unclassified 1047
80 Ga0070673_100601507 3300005364 Bacteria 1003
81 Ga0070688_100054417 3300005365 Bacteria 2506
82 Ga0070688_100498018 3300005365 Bacteria 918
83 Ga0070703_10000014 3300005406 Bacteria 89131
84 Ga0070709_10077904 3300005434 Bacteria 2156
85 Ga0070701_10019919 3300005438 Unclassified 3175
86 Ga0070701_10048333 3300005438 Bacteria 2195
87 Ga0070701_10155558 3300005438 Unclassified 1320
88 Ga0070705_100063752 3300005440 Unclassified 2199
89 Ga0070705_100095064 3300005440 Bacteria 1868
90 Ga0070705_100100463 3300005440 Bacteria 1825
91 Ga0070705_100117014 3300005440 Bacteria 1714
92 Ga0070700_100000103 3300005441 Bacteria 53591
93 Ga0070700_100001274 3300005441 Bacteria 12502
94 Ga0070700_100007401 3300005441 Bacteria 5926
95 Ga0070700_100009846 3300005441 Bacteria 5257
96 Ga0070700_100037286 3300005441 Unclassified 2956
97 Ga0070700_100039267 3300005441 Bacteria 2891
98 Ga0070700_100047033 3300005441 Bacteria 2668
99 Ga0070700_100050677 3300005441 Unclassified 2581
100 Ga0070700_100084723 3300005441 Unclassified 2055
101 Ga0070700_100168275 3300005441 Unclassified 1516
102 Ga0070700_100353940 3300005441 Bacteria 1090
103 Ga0070700_100505228 3300005441 Bacteria 931
104 Ga0070694_100000381 3300005444 Bacteria 23963
105 Ga0070694_100015550 3300005444 Bacteria 4781
106 Ga0070694_100016088 3300005444 Bacteria 4708
107 Ga0070694_100016758 3300005444 Bacteria 4617
108 Ga0070694_100061927 3300005444 Bacteria 2555
109 Ga0070694_100096731 3300005444 Bacteria 2081
110 Ga0070694_100117169 3300005444 Bacteria 1906
111 Ga0070694_100149359 3300005444 Bacteria 1705
112 Ga0070694_100181115 3300005444 Unclassified 1559
113 Ga0070694_100551895 3300005444 Bacteria 923
114 Ga0070694_100578948 3300005444 Unclassified 902
115 Ga0070708_100001824 3300005445 Bacteria 16336
116 Ga0070708_100045574 3300005445 Bacteria 3864
117 Ga0070663_100754065 3300005455 Viruses 831
118 Ga0070662_100016422 3300005457 Unclassified 4972
119 Ga0070662_100047380 3300005457 Bacteria 3092
120 Ga0070662_100055917 3300005457 Bacteria 2864
121 Ga0070681_10000359 3300005458 Bacteria 36799
122 Ga0070681_10001543 3300005458 Bacteria 20396
123 Ga0070681_10221183 3300005458 Bacteria 1808
124 Ga0068867_100051711 3300005459 Bacteria 3031
125 Ga0068867_100220419 3300005459 Bacteria 1528
126 Ga0070685_10004591 3300005466 Bacteria 6988
127 Ga0070706_100000001 3300005467 Bacteria 342302
128 Ga0070706_100001194 3300005467 Bacteria 27840
129 Ga0070706_100004663 3300005467 Bacteria 13148
130 Ga0070706_100033745 3300005467 Bacteria 4725
131 Ga0070706_100050601 3300005467 Bacteria 3834
132 Ga0070706_100105036 3300005467 Bacteria 2628
133 Ga0070706_100262549 3300005467 Bacteria 1612
134 Ga0070707_100001152 3300005468 Bacteria 25962
135 Ga0070707_100005091 3300005468 Bacteria 12322
136 Ga0070707_100013363 3300005468 Bacteria 7679
137 Ga0070707_100015254 3300005468 Bacteria 7211
138 Ga0070707_100075469 3300005468 Bacteria 3252
139 Ga0070707_100079397 3300005468 Bacteria 3167
140 Ga0070707_100107578 3300005468 Bacteria 2705
141 Ga0070707_100257053 3300005468 Bacteria 1700
142 Ga0070707_100292866 3300005468 Bacteria 1582
143 Ga0070707_100296334 3300005468 Bacteria 1572
144 Ga0070707_100394973 3300005468 Bacteria 1343
145 Ga0070698_100001546 3300005471 Bacteria 25524
146 Ga0070698_100004183 3300005471 Bacteria 15855
147 Ga0070698_100009712 3300005471 Bacteria 10290
148 Ga0070698_100013859 3300005471 Bacteria 8525
149 Ga0070698_100341324 3300005471 Unclassified 1429
150 Ga0070698_100572419 3300005471 Bacteria 1069
151 Ga0070698_100646494 3300005471 Bacteria 999
152 Ga0070699_100000581 3300005518 Bacteria 34545
153 Ga0070699_100002585 3300005518 Bacteria 16222
154 Ga0070699_100012111 3300005518 Bacteria 7444
155 Ga0070699_100207321 3300005518 Bacteria 1744
156 Ga0070699_100227025 3300005518 Bacteria 1665
157 Ga0070699_100303452 3300005518 Bacteria 1433
158 Ga0070699_100630121 3300005518 Bacteria 978
159 Ga0070679_100000081 3300005530 Bacteria 71191
160 Ga0070697_100000449 3300005536 Bacteria 31648
161 Ga0070697_100000459 3300005536 Bacteria 31292
162 Ga0070697_100041216 3300005536 Unclassified 3736
163 Ga0070697_100113805 3300005536 Unclassified 2257
164 Ga0070697_100145467 3300005536 Bacteria 1995
165 Ga0070697_100444376 3300005536 Bacteria 1129
166 Ga0068853_100122909 3300005539 Bacteria 2317
167 Ga0070672_100068745 3300005543 Bacteria 2810
168 Ga0070672_100466389 3300005543 Bacteria 1089
169 Ga0070686_100025351 3300005544 Bacteria 3568
170 Ga0070686_100031105 3300005544 Unclassified 3261
171 Ga0070686_100034421 3300005544 Unclassified 3122
172 Ga0070686_100049338 3300005544 Unclassified 2670
173 Ga0070686_100128410 3300005544 Bacteria 1750
174 Ga0070695_100003269 3300005545 Bacteria 9467
175 Ga0070695_100013440 3300005545 Unclassified 4920
176 Ga0070695_100052191 3300005545 Bacteria 2627
177 Ga0070695_100085925 3300005545 Unclassified 2090
178 Ga0070695_100123105 3300005545 Bacteria 1777
179 Ga0070695_100136923 3300005545 Bacteria 1693
180 Ga0070695_100161560 3300005545 Unclassified 1573
181 Ga0070695_100165618 3300005545 Bacteria 1556
182 Ga0070695_100249761 3300005545 Bacteria 1290
183 Ga0070695_100341849 3300005545 Bacteria 1118
184 Ga0070695_100612699 3300005545 Unclassified 856
185 Ga0070696_100012857 3300005546 Bacteria 5618
186 Ga0070696_100077461 3300005546 Bacteria 2349
187 Ga0070696_100164388 3300005546 Unclassified 1637
188 Ga0070696_100230504 3300005546 Bacteria 1393
189 Ga0070696_100401312 3300005546 Bacteria 1073
190 Ga0070693_100009029 3300005547 Bacteria 4948
191 Ga0070693_100083444 3300005547 Bacteria 1910
192 Ga0070693_100097942 3300005547 Bacteria 1781
193 Ga0070693_100120423 3300005547 Bacteria 1627
194 Ga0070693_100256533 3300005547 Unclassified 1161
195 Ga0070693_100434970 3300005547 Unclassified 917
196 Ga0070693_100462596 3300005547 Unclassified 893
197 Ga0070665_100031357 3300005548 Bacteria 5350
198 Ga0070704_100001798 3300005549 Bacteria 11788
199 Ga0070704_100025781 3300005549 Bacteria 3874
200 Ga0070704_100032633 3300005549 Bacteria 3514
201 Ga0070704_100068744 3300005549 Bacteria 2564
202 Ga0070704_100103329 3300005549 Bacteria 2152
203 Ga0070704_100210137 3300005549 Unclassified 1576
204 Ga0070704_100307522 3300005549 Bacteria 1323
205 Ga0070704_100374626 3300005549 Unclassified 1208
206 Ga0070704_100417910 3300005549 Bacteria 1148
207 Ga0070704_100570460 3300005549 Unclassified 991
208 Ga0070704_101003467 3300005549 Unclassified 755
209 Ga0068855_101199584 3300005563 Unclassified 789
210 Ga0070664_100040159 3300005564 Bacteria 3944
211 Ga0070664_100061803 3300005564 Bacteria 3193
212 Ga0068857_100009027 3300005577 Bacteria 8646
213 Ga0068857_100237115 3300005577 Bacteria 1669
214 Ga0068857_100312629 3300005577 Bacteria 1450
215 Ga0068857_100390208 3300005577 Bacteria 1294
216 Ga0068857_100440075 3300005577 Unclassified 1218
217 Ga0068854_100077229 3300005578 Unclassified 2450
218 Ga0068854_100089363 3300005578 Bacteria 2289
219 Ga0068854_100233886 3300005578 Unclassified 1460
220 Ga0068854_100423488 3300005578 Unclassified 1106
221 Ga0068854_100718289 3300005578 Bacteria 864
222 Ga0070702_100002352 3300005615 Bacteria 8130
223 Ga0070702_100008924 3300005615 Bacteria 4880
224 Ga0070702_100012362 3300005615 Bacteria 4274
225 Ga0070702_100043521 3300005615 Bacteria 2531
226 Ga0070702_100328650 3300005615 Bacteria 1068
227 Ga0070702_100387679 3300005615 Unclassified 995
228 Ga0070702_100412428 3300005615 Bacteria 969
229 Ga0068852_100256217 3300005616 Unclassified 1678
230 Ga0068859_100003377 3300005617 Bacteria 16230
231 Ga0068859_100020829 3300005617 Bacteria 6581
232 Ga0068859_100023193 3300005617 Bacteria 6226
233 Ga0068859_100030707 3300005617 Bacteria 5392
234 Ga0068859_100036510 3300005617 Bacteria 4933
235 Ga0068859_100047511 3300005617 Bacteria 4313
236 Ga0068859_100055944 3300005617 Bacteria 3970
237 Ga0068859_100056640 3300005617 Bacteria 3946
238 Ga0068859_100056809 3300005617 Bacteria 3941
239 Ga0068859_100074674 3300005617 Bacteria 3429
240 Ga0068859_100105706 3300005617 Bacteria 2874
241 Ga0068859_100107305 3300005617 Unclassified 2852
242 Ga0068859_100131919 3300005617 Unclassified 2570
243 Ga0068859_100180400 3300005617 Unclassified 2194
244 Ga0068859_100205411 3300005617 Unclassified 2055
245 Ga0068859_100352572 3300005617 Bacteria 1566
246 Ga0068859_100388015 3300005617 Bacteria 1492
247 Ga0068859_100595394 3300005617 Bacteria 1199
248 Ga0068859_100685666 3300005617 Unclassified 1116
249 Ga0068864_100028456 3300005618 Unclassified 4724
250 Ga0068864_100041807 3300005618 Bacteria 3920
251 Ga0068864_100068784 3300005618 Bacteria 3077
252 Ga0068864_100188615 3300005618 Bacteria 1889
253 Ga0068864_100197716 3300005618 Bacteria 1846
254 Ga0068864_100275927 3300005618 Bacteria 1568
255 Ga0068864_100292644 3300005618 Bacteria 1522
256 Ga0068864_100440909 3300005618 Bacteria 1244
257 Ga0068864_100561400 3300005618 Bacteria 1104
258 Ga0068864_101112043 3300005618 Bacteria 787
259 Ga0068866_10003551 3300005718 Bacteria 6385
260 Ga0068866_10013561 3300005718 Bacteria 3580
261 Ga0068866_10033318 3300005718 Bacteria 2498
262 Ga0068866_10134631 3300005718 Bacteria 1410
263 Ga0068861_100012344 3300005719 Bacteria 5956
264 Ga0068861_100040685 3300005719 Bacteria 3478
265 Ga0068861_100159633 3300005719 Bacteria 1858
266 Ga0068861_100214797 3300005719 Bacteria 1622
267 Ga0068851_10014077 3300005834 Bacteria 3793
268 Ga0068870_10017714 3300005840 Bacteria 3426
269 Ga0068870_10024979 3300005840 Unclassified 2962
270 Ga0068870_10036163 3300005840 Bacteria 2540
271 Ga0068870_10040907 3300005840 Bacteria 2406
272 Ga0068870_10107713 3300005840 Bacteria 1586
273 Ga0068870_10380900 3300005840 Bacteria 913
274 Ga0068863_100035473 3300005841 Bacteria 4751
275 Ga0068863_100069915 3300005841 Unclassified 3319
276 Ga0068863_100133858 3300005841 Unclassified 2368
277 Ga0068863_100166099 3300005841 Unclassified 2116
278 Ga0068863_100235255 3300005841 Bacteria 1768
279 Ga0068863_100240461 3300005841 Bacteria 1747
280 Ga0068858_100000051 3300005842 Bacteria 120692
281 Ga0068858_100036187 3300005842 Bacteria 4577
282 Ga0068858_100060742 3300005842 Unclassified 3493
283 Ga0068858_100197665 3300005842 Bacteria 1901
284 Ga0068858_100212180 3300005842 Bacteria 1832
285 Ga0068858_100334643 3300005842 Bacteria 1448
286 Ga0068858_100638313 3300005842 Unclassified 1034
287 Ga0068860_100005783 3300005843 Bacteria 12460
288 Ga0068860_100040266 3300005843 Bacteria 4466
289 Ga0068860_100086324 3300005843 Bacteria 2986
290 Ga0068860_100096569 3300005843 Bacteria 2817
291 Ga0068860_100154892 3300005843 Unclassified 2208
292 Ga0068860_100163022 3300005843 Bacteria 2150
293 Ga0068860_100186580 3300005843 Bacteria 2006
294 Ga0068860_100243631 3300005843 Unclassified 1749
295 Ga0068860_100385440 3300005843 Bacteria 1384
296 Ga0068862_100012345 3300005844 Bacteria 7062
297 Ga0068862_100018701 3300005844 Bacteria 5771
298 Ga0068862_100028889 3300005844 Bacteria 4671
299 Ga0068862_100229241 3300005844 Bacteria 1684
300 Ga0068862_100302220 3300005844 Bacteria 1472
301 Ga0068862_100436533 3300005844 Unclassified 1232
302 Ga0081540_1048266 3300005983 Unclassified 2133
303 Ga0081539_10000053 3300005985 Bacteria 264549
304 Ga0081539_10000413 3300005985 Bacteria 91117
305 Ga0070715_10000025 3300006163 Bacteria 107539
306 Ga0070716_100000003 3300006173 Bacteria 312721
307 Ga0070716_100135081 3300006173 Unclassified 1565
308 Ga0097621_100001671 3300006237 Bacteria 15177
309 Ga0097621_100009417 3300006237 Bacteria 7088
310 Ga0097621_100010818 3300006237 Bacteria 6694
311 Ga0097621_100090837 3300006237 Bacteria 2556
312 Ga0068871_100004716 3300006358 Bacteria 9537
313 Ga0068871_100014711 3300006358 Bacteria 5839
314 Ga0068871_100015543 3300006358 Bacteria 5701
315 Ga0068871_100136015 3300006358 Bacteria 2087
316 Ga0075428_100110226 3300006844 Bacteria 2998
317 Ga0075428_100168088 3300006844 Bacteria 2379
318 Ga0075428_100633942 3300006844 Bacteria 1140
319 Ga0075430_100032469 3300006846 Unclassified 4432
320 Ga0075430_100330055 3300006846 Bacteria 1260
321 Ga0075431_100071249 3300006847 Unclassified 3586
322 Ga0075431_100133912 3300006847 Bacteria 2555
323 Ga0075433_10005311 3300006852 Bacteria 10103
324 Ga0075433_10020387 3300006852 Bacteria 5541
325 Ga0075433_10023489 3300006852 Bacteria 5191
326 Ga0075433_10037018 3300006852 Bacteria 4206
327 Ga0075433_10059541 3300006852 Bacteria 3341
328 Ga0075433_10081353 3300006852 Bacteria 2855
329 Ga0075433_10209896 3300006852 Bacteria 1730
330 Ga0075433_10213281 3300006852 Bacteria 1715
331 Ga0075433_10244068 3300006852 Bacteria 1594
332 Ga0075433_10325927 3300006852 Unclassified 1358
333 Ga0075434_100015815 3300006871 Bacteria 7244
334 Ga0075434_100016204 3300006871 Bacteria 7164
335 Ga0075434_100035293 3300006871 Bacteria 4943
336 Ga0075434_100055054 3300006871 Bacteria 3953
337 Ga0075434_100060851 3300006871 Unclassified 3757
338 Ga0075434_100080287 3300006871 Bacteria 3258
339 Ga0075434_100121144 3300006871 Bacteria 2632
340 Ga0075434_100127953 3300006871 Bacteria 2557
341 Ga0075434_100437686 3300006871 Bacteria 1329
342 Ga0075434_100460145 3300006871 Unclassified 1293
343 Ga0075434_100586593 3300006871 Bacteria 1134
344 Ga0075429_100035844 3300006880 Bacteria 4314
345 Ga0075429_100272927 3300006880 Unclassified 1481
346 Ga0075429_100453777 3300006880 Bacteria 1123
347 Ga0075429_100552794 3300006880 Unclassified 1009
348 Ga0068865_100092515 3300006881 Bacteria 2197
349 Ga0068865_100185629 3300006881 Bacteria 1604
350 Ga0068865_100257818 3300006881 Bacteria 1379
351 Ga0075436_100000002 3300006914 Bacteria 475522
352 Ga0075436_100163663 3300006914 Unclassified 1569
353 Ga0075436_100212302 3300006914 Bacteria 1372
354 Ga0075436_100281821 3300006914 Bacteria 1188
355 Ga0097620_100003377 3300006931 Bacteria 16230
356 Ga0097620_100020828 3300006931 Bacteria 6581
357 Ga0097620_100023193 3300006931 Bacteria 6226
358 Ga0097620_100030704 3300006931 Bacteria 5392
359 Ga0097620_100036512 3300006931 Bacteria 4933
360 Ga0097620_100047511 3300006931 Bacteria 4313
361 Ga0097620_100055938 3300006931 Bacteria 3970
362 Ga0097620_100056636 3300006931 Bacteria 3946
363 Ga0097620_100056809 3300006931 Bacteria 3941
364 Ga0097620_100074674 3300006931 Bacteria 3429
365 Ga0097620_100105712 3300006931 Bacteria 2874
366 Ga0097620_100107307 3300006931 Unclassified 2852
367 Ga0097620_100131912 3300006931 Unclassified 2570
368 Ga0097620_100180407 3300006931 Unclassified 2194
369 Ga0097620_100205401 3300006931 Unclassified 2055
370 Ga0097620_100352569 3300006931 Bacteria 1566
371 Ga0097620_100388073 3300006931 Bacteria 1492
372 Ga0097620_100595467 3300006931 Bacteria 1199
373 Ga0097620_100685740 3300006931 Unclassified 1116
374 Ga0075435_100018467 3300007076 Bacteria 5305
375 Ga0075435_100030687 3300007076 Bacteria 4229
376 Ga0075435_100054387 3300007076 Bacteria 3230
377 Ga0075435_100056407 3300007076 Bacteria 3175
378 Ga0075435_100204549 3300007076 Bacteria 1673
379 Ga0099794_10039008 3300007265 Bacteria 2252
380 Ga0105251_10049007 3300009011 Unclassified 2024
381 Ga0111539_10001063 3300009094 Bacteria 36189
382 Ga0111539_10001170 3300009094 Bacteria 34759
383 Ga0111539_10002690 3300009094 Bacteria 23536
384 Ga0111539_10008376 3300009094 Bacteria 13156
385 Ga0111539_10013034 3300009094 Bacteria 10404
386 Ga0111539_10088509 3300009094 Bacteria 3638
387 Ga0111539_10115063 3300009094 Bacteria 3155
388 Ga0111539_10435197 3300009094 Bacteria 1527
389 Ga0111539_10846181 3300009094 Unclassified 1064
390 Ga0111539_11373995 3300009094 Unclassified 819
391 Ga0105245_10042109 3300009098 Bacteria 4073
392 Ga0105245_10090957 3300009098 Bacteria 2808
393 Ga0105247_10000004 3300009101 Bacteria 455497
394 Ga0105247_10002714 3300009101 Bacteria 11872
395 Ga0105247_10022652 3300009101 Bacteria 3784
396 Ga0114129_10003680 3300009147 Bacteria 21574
397 Ga0114129_10006111 3300009147 Bacteria 17076
398 Ga0114129_10014321 3300009147 Bacteria 11303
399 Ga0114129_10035789 3300009147 Bacteria 7013
400 Ga0114129_10043769 3300009147 Bacteria 6299
401 Ga0114129_10086966 3300009147 Bacteria 4334
402 Ga0114129_10136453 3300009147 Bacteria 3366
403 Ga0114129_10413717 3300009147 Bacteria 1775
404 Ga0114129_10678167 3300009147 Bacteria 1327
405 Ga0114129_11011524 3300009147 Unclassified 1046
406 Ga0114129_11204774 3300009147 Bacteria 943
407 Ga0114129_11596250 3300009147 Unclassified 799
408 Ga0105243_10000037 3300009148 Bacteria 175237
409 Ga0105243_10000204 3300009148 Bacteria 69282
410 Ga0105243_10001165 3300009148 Bacteria 23834
411 Ga0105243_10004015 3300009148 Bacteria 11726
412 Ga0105243_10090209 3300009148 Bacteria 2522
413 Ga0105243_10182963 3300009148 Bacteria 1824
414 Ga0105243_10221297 3300009148 Unclassified 1673
415 Ga0105243_10311503 3300009148 Bacteria 1430
416 Ga0105243_10386898 3300009148 Bacteria 1295
417 Ga0105241_10045379 3300009174 Bacteria 3334
418 Ga0105241_10056953 3300009174 Unclassified 2997
419 Ga0105241_10066392 3300009174 Bacteria 2790
420 Ga0105241_10625838 3300009174 Bacteria 975
421 Ga0105242_10000039 3300009176 Bacteria 88325
422 Ga0105242_10031279 3300009176 Bacteria 4249
423 Ga0105242_10049263 3300009176 Bacteria 3427
424 Ga0105242_10113764 3300009176 Bacteria 2311
425 Ga0105242_10121508 3300009176 Bacteria 2242
426 Ga0105242_10146614 3300009176 Unclassified 2054
427 Ga0105242_10393315 3300009176 Bacteria 1292
428 Ga0105248_10018179 3300009177 Bacteria 7763
429 Ga0105248_10025844 3300009177 Bacteria 6531
430 Ga0105248_10028736 3300009177 Bacteria 6198
431 Ga0105248_10043109 3300009177 Bacteria 5060
432 Ga0105248_10092776 3300009177 Bacteria 3400
433 Ga0105248_10418981 3300009177 Bacteria 1508
434 Ga0105248_10819494 3300009177 Unclassified 1050
435 Ga0105237_10003442 3300009545 Bacteria 18791
436 Ga0105237_10132920 3300009545 Bacteria 2483
437 Ga0105237_10626472 3300009545 Bacteria 1083
438 Ga0105238_10004865 3300009551 Bacteria 13288
439 Ga0105238_10063641 3300009551 Unclassified 3689
440 Ga0105238_11213504 3300009551 Unclassified 779
441 Ga0105249_10000052 3300009553 Bacteria 168047
442 Ga0105249_10033549 3300009553 Unclassified 4648
443 Ga0105249_10058162 3300009553 Unclassified 3543
444 Ga0105249_10100153 3300009553 Bacteria 2724
445 Ga0105249_10440825 3300009553 Unclassified 1340
446 Ga0105249_10564018 3300009553 Unclassified 1191
447 Ga0105249_10785694 3300009553 Bacteria 1015
448 Ga0105249_11277089 3300009553 Unclassified 806
449 Ga0105239_10008035 3300010375 Bacteria 12039
450 Ga0105239_11215656 3300010375 Bacteria 869
451 Ga0105239_11650984 3300010375 Unclassified 741
452 Ga0105246_10034007 3300011119 Bacteria 3392
453 Ga0105246_10111651 3300011119 Bacteria 2009
454 Ga0157373_10070126 3300013100 Bacteria 2477
455 Ga0157373_10086494 3300013100 Bacteria 2209
456 Ga0157373_10323146 3300013100 Unclassified 1098
457 Ga0157371_10059753 3300013102 Bacteria 2702
458 Ga0157374_10032741 3300013296 Bacteria 4736
459 Ga0157378_10000004 3300013297 Bacteria 201051
460 Ga0157378_10005014 3300013297 Bacteria 11619
461 Ga0157378_10034561 3300013297 Bacteria 4470
462 Ga0157378_10036917 3300013297 Unclassified 4326
463 Ga0157378_10040940 3300013297 Unclassified 4110
464 Ga0157378_10050341 3300013297 Bacteria 3707
465 Ga0157378_10059323 3300013297 Bacteria 3414
466 Ga0157378_10081387 3300013297 Bacteria 2927
467 Ga0157378_10123891 3300013297 Bacteria 2386
468 Ga0157378_10223775 3300013297 Unclassified 1790
469 Ga0157378_10274491 3300013297 Bacteria 1623
470 Ga0157378_10504124 3300013297 Unclassified 1209
471 Ga0157378_10582276 3300013297 Viruses 1128
472 Ga0157378_10866531 3300013297 Unclassified 932
473 Ga0163162_10000001 3300013306 Bacteria 751833
474 Ga0163162_10004637 3300013306 Bacteria 13251
475 Ga0163162_10004905 3300013306 Bacteria 12891
476 Ga0163162_10008699 3300013306 Bacteria 9881
477 Ga0163162_10026493 3300013306 Bacteria 5729
478 Ga0163162_10026725 3300013306 Bacteria 5707
479 Ga0163162_10099145 3300013306 Bacteria 3004
480 Ga0163162_10138843 3300013306 Unclassified 2542
481 Ga0163162_10195976 3300013306 Bacteria 2149
482 Ga0163162_11204146 3300013306 Bacteria 859
483 Ga0157372_10007348 3300013307 Bacteria 11722
484 Ga0157372_10323663 3300013307 Bacteria 1795
485 Ga0157372_10361410 3300013307 Unclassified 1692
486 Ga0157372_10807000 3300013307 Bacteria 1090
487 Ga0157375_10003507 3300013308 Bacteria 13605
488 Ga0157375_10015347 3300013308 Bacteria 6854
489 Ga0157375_10026598 3300013308 Bacteria 5395
490 Ga0157375_10086991 3300013308 Bacteria 3177
491 Ga0157375_10108436 3300013308 Bacteria 2871
492 Ga0157375_10142684 3300013308 Bacteria 2523
493 Ga0157375_10458945 3300013308 Bacteria 1439
494 Ga0157375_10826928 3300013308 Bacteria 1074
495 Ga0157375_11081810 3300013308 Unclassified 938
496 Ga0163163_10001903 3300014325 Bacteria 17662
497 Ga0163163_10017139 3300014325 Bacteria 6748
498 Ga0163163_10029220 3300014325 Bacteria 5302
499 Ga0163163_10047380 3300014325 Bacteria 4225
500 Ga0163163_10078964 3300014325 Bacteria 3288
501 Ga0163163_10079626 3300014325 Bacteria 3275
502 Ga0163163_10184355 3300014325 Bacteria 2135
503 Ga0163163_10664329 3300014325 Bacteria 1106
504 Ga0163163_10866048 3300014325 Unclassified 967
505 Ga0157380_10001690 3300014326 Bacteria 14575
506 Ga0157380_10003274 3300014326 Bacteria 11099
507 Ga0157380_10011248 3300014326 Bacteria 6461
508 Ga0157380_10019779 3300014326 Bacteria 5023
509 Ga0157380_10042355 3300014326 Bacteria 3559
510 Ga0157380_10081338 3300014326 Bacteria 2649
511 Ga0157380_10104053 3300014326 Bacteria 2370
512 Ga0157380_10197191 3300014326 Bacteria 1783
513 Ga0157380_11479548 3300014326 Unclassified 732
514 Ga0157377_10117189 3300014745 Bacteria 1609
515 Ga0157379_10067376 3300014968 Bacteria 3200
516 Ga0157379_10165278 3300014968 Bacteria 1997
517 Ga0157376_10013217 3300014969 Bacteria 6153
518 Ga0157376_10377773 3300014969 Bacteria 1364
519 Ga0163161_10008512 3300017792 Bacteria 7105
520 Ga0163161_10048631 3300017792 Unclassified 3063
521 Ga0163161_10228678 3300017792 Bacteria 1443
522 Ga0163161_10410428 3300017792 Bacteria 1088
523 Ga0163161_10750511 3300017792 Unclassified 816
524 Ga0207672_1000019 3300025223 Bacteria 20169
525 Ga0207697_10009201 3300025315 Bacteria 4274
526 Ga0207653_10000054 3300025885 Bacteria 87543
527 Ga0207653_10002794 3300025885 Bacteria 5551
528 Ga0207653_10093085 3300025885 Bacteria 1058
529 Ga0207642_10038250 3300025899 Bacteria 2075
530 Ga0207642_10076640 3300025899 Bacteria 1610
531 Ga0207710_10000002 3300025900 Bacteria 1251998
532 Ga0207710_10009909 3300025900 Bacteria 4006
533 Ga0207710_10037702 3300025900 Bacteria 2136
534 Ga0207647_10005841 3300025904 Bacteria 8974
535 Ga0207647_10035143 3300025904 Bacteria 3195
536 Ga0207647_10265988 3300025904 Bacteria 981
537 Ga0207685_10000008 3300025905 Bacteria 273136
538 Ga0207699_10067689 3300025906 Bacteria 2172
539 Ga0207645_10088308 3300025907 Bacteria 1993
540 Ga0207643_10018891 3300025908 Unclassified 3775
541 Ga0207643_10022022 3300025908 Bacteria 3507
542 Ga0207643_10052870 3300025908 Bacteria 2307
543 Ga0207684_10000030 3300025910 Bacteria 300037
544 Ga0207684_10004486 3300025910 Bacteria 13132
545 Ga0207684_10005647 3300025910 Bacteria 11491
546 Ga0207684_10054107 3300025910 Bacteria 3405
547 Ga0207684_10162911 3300025910 Bacteria 1921
548 Ga0207684_10199122 3300025910 Unclassified 1728
549 Ga0207684_10224388 3300025910 Unclassified 1621
550 Ga0207684_10298258 3300025910 Bacteria 1390
551 Ga0207654_10075676 3300025911 Unclassified 2012
552 Ga0207654_10174739 3300025911 Unclassified 1397
553 Ga0207654_10219987 3300025911 Bacteria 1259
554 Ga0207707_10000007 3300025912 Bacteria 368555
555 Ga0207695_10255331 3300025913 Bacteria 1652
556 Ga0207695_10727935 3300025913 Unclassified 872
557 Ga0207671_10004811 3300025914 Bacteria 12721
558 Ga0207671_10559773 3300025914 Unclassified 911
559 Ga0207660_10002775 3300025917 Bacteria 11480
560 Ga0207662_10011825 3300025918 Bacteria 4851
561 Ga0207662_10042573 3300025918 Unclassified 2677
562 Ga0207662_10084831 3300025918 Bacteria 1938
563 Ga0207662_10253584 3300025918 Unclassified 1156
564 Ga0207652_10000062 3300025921 Bacteria 113255
565 Ga0207646_10000399 3300025922 Bacteria 58192
566 Ga0207646_10006739 3300025922 Bacteria 11826
567 Ga0207646_10007966 3300025922 Bacteria 10685
568 Ga0207646_10050922 3300025922 Bacteria 3706
569 Ga0207646_10051069 3300025922 Bacteria 3700
570 Ga0207646_10079019 3300025922 Bacteria 2941
571 Ga0207646_10093594 3300025922 Bacteria 2691
572 Ga0207646_10099557 3300025922 Unclassified 2605
573 Ga0207646_10108018 3300025922 Bacteria 2496
574 Ga0207646_10133474 3300025922 Unclassified 2235
575 Ga0207646_10486492 3300025922 Unclassified 1112
576 Ga0207646_10861913 3300025922 Unclassified 805
577 Ga0207681_10004226 3300025923 Bacteria 8869
578 Ga0207681_10025484 3300025923 Unclassified 3805
579 Ga0207681_10045245 3300025923 Bacteria 2954
580 Ga0207681_10087685 3300025923 Bacteria 2215
581 Ga0207681_10590551 3300025923 Bacteria 917
582 Ga0207694_10019502 3300025924 Bacteria 5127
583 Ga0207694_10041211 3300025924 Bacteria 3557
584 Ga0207650_10000001 3300025925 Bacteria 1545726
585 Ga0207650_10337824 3300025925 Bacteria 1236
586 Ga0207650_10466396 3300025925 Bacteria 1052
587 Ga0207659_10480080 3300025926 Bacteria 1050
588 Ga0207687_10137965 3300025927 Bacteria 1847
589 Ga0207644_10000648 3300025931 Bacteria 21996
590 Ga0207644_10047254 3300025931 Bacteria 3070
591 Ga0207644_10593667 3300025931 Bacteria 919
592 Ga0207706_10311827 3300025933 Bacteria 1370
593 Ga0207706_10425431 3300025933 Unclassified 1150
594 Ga0207686_10000003 3300025934 Bacteria 376934
595 Ga0207686_10000335 3300025934 Bacteria 33878
596 Ga0207686_10002486 3300025934 Bacteria 10008
597 Ga0207686_10083288 3300025934 Bacteria 2093
598 Ga0207686_10366631 3300025934 Bacteria 1089
599 Ga0207709_10000017 3300025935 Bacteria 470753
600 Ga0207709_10000469 3300025935 Bacteria 37165
601 Ga0207709_10000786 3300025935 Bacteria 24857
602 Ga0207709_10018468 3300025935 Bacteria 3907
603 Ga0207709_10128820 3300025935 Bacteria 1721
604 Ga0207709_10251314 3300025935 Bacteria 1291
605 Ga0207709_10357114 3300025935 Bacteria 1105
606 Ga0207670_10001298 3300025936 Bacteria 13179
607 Ga0207670_10050579 3300025936 Unclassified 2786
608 Ga0207670_10237944 3300025936 Bacteria 1401
609 Ga0207704_10135348 3300025938 Bacteria 1714
610 Ga0207704_10259487 3300025938 Bacteria 1309
611 Ga0207665_10000003 3300025939 Bacteria 220666
612 Ga0207665_10233246 3300025939 Unclassified 1353
613 Ga0207691_10331462 3300025940 Unclassified 1304
614 Ga0207691_10679668 3300025940 Unclassified 869
615 Ga0207711_10028572 3300025941 Bacteria 4695
616 Ga0207711_10039645 3300025941 Bacteria 4008
617 Ga0207711_10046688 3300025941 Bacteria 3701
618 Ga0207711_10600289 3300025941 Bacteria 1027
619 Ga0207711_10645593 3300025941 Bacteria 987
620 Ga0207711_10648343 3300025941 Unclassified 985
621 Ga0207711_10681183 3300025941 Unclassified 959
622 Ga0207689_10001296 3300025942 Bacteria 24095
623 Ga0207689_10009146 3300025942 Bacteria 8575
624 Ga0207689_10020196 3300025942 Bacteria 5610
625 Ga0207689_10023893 3300025942 Bacteria 5127
626 Ga0207689_10033676 3300025942 Bacteria 4256
627 Ga0207689_10113322 3300025942 Bacteria 2229
628 Ga0207689_10166034 3300025942 Bacteria 1819
629 Ga0207689_10290511 3300025942 Bacteria 1354
630 Ga0207689_10295649 3300025942 Bacteria 1342
631 Ga0207689_10730108 3300025942 Bacteria 836
632 Ga0207679_10228042 3300025945 Bacteria 1571
633 Ga0207651_10042437 3300025960 Bacteria 3027
634 Ga0207651_10049810 3300025960 Bacteria 2840
635 Ga0207651_10083331 3300025960 Bacteria 2312
636 Ga0207651_10157410 3300025960 Bacteria 1777
637 Ga0207651_10217008 3300025960 Bacteria 1544
638 Ga0207712_10000022 3300025961 Bacteria 284365
639 Ga0207712_10134188 3300025961 Bacteria 1891
640 Ga0207712_10375589 3300025961 Unclassified 1188
641 Ga0207668_10345369 3300025972 Bacteria 1243
642 Ga0207640_10021271 3300025981 Bacteria 3865
643 Ga0207640_10238836 3300025981 Viruses 1403
644 Ga0207640_10500297 3300025981 Bacteria 1012
645 Ga0207640_10617634 3300025981 Bacteria 920
646 Ga0207658_10254404 3300025986 Bacteria 1494
647 Ga0207677_10026157 3300026023 Bacteria 3655
648 Ga0207677_10193660 3300026023 Bacteria 1610
649 Ga0207677_10319567 3300026023 Bacteria 1289
650 Ga0207703_10000114 3300026035 Bacteria 96051
651 Ga0207703_10017836 3300026035 Bacteria 5543
652 Ga0207703_10191443 3300026035 Bacteria 1812
653 Ga0207703_10345077 3300026035 Unclassified 1369
654 Ga0207703_10369186 3300026035 Bacteria 1325
655 Ga0207703_10403198 3300026035 Bacteria 1269
656 Ga0207703_10937829 3300026035 Bacteria 829
657 Ga0207678_10312068 3300026067 Unclassified 1352
658 Ga0207708_10000224 3300026075 Bacteria 44906
659 Ga0207708_10014089 3300026075 Bacteria 5975
660 Ga0207708_10022759 3300026075 Bacteria 4732
661 Ga0207708_10026462 3300026075 Unclassified 4390
662 Ga0207708_10029922 3300026075 Unclassified 4129
663 Ga0207708_10031580 3300026075 Bacteria 4020
664 Ga0207708_10054631 3300026075 Bacteria 3045
665 Ga0207708_10064634 3300026075 Unclassified 2796
666 Ga0207708_10208419 3300026075 Bacteria 1562
667 Ga0207708_10231585 3300026075 Bacteria 1483
668 Ga0207702_10087038 3300026078 Bacteria 2726
669 Ga0207641_10031507 3300026088 Bacteria 4398
670 Ga0207641_10048725 3300026088 Bacteria 3577
671 Ga0207641_10448519 3300026088 Unclassified 1246
672 Ga0207641_10475767 3300026088 Bacteria 1210
673 Ga0207641_10528980 3300026088 Unclassified 1148
674 Ga0207648_10020391 3300026089 Bacteria 5970
675 Ga0207648_10049773 3300026089 Bacteria 3665
676 Ga0207648_10147356 3300026089 Bacteria 2076
677 Ga0207648_10263478 3300026089 Bacteria 1538
678 Ga0207676_10004993 3300026095 Bacteria 9397
679 Ga0207676_10011946 3300026095 Bacteria 6213
680 Ga0207676_10058107 3300026095 Bacteria 3049
681 Ga0207676_10137232 3300026095 Bacteria 2089
682 Ga0207676_10497776 3300026095 Bacteria 1157
683 Ga0207676_10608062 3300026095 Bacteria 1051
684 Ga0207676_10669992 3300026095 Bacteria 1003
685 Ga0207674_10027008 3300026116 Bacteria 6085
686 Ga0207674_10064717 3300026116 Bacteria 3688
687 Ga0207674_10109655 3300026116 Unclassified 2736
688 Ga0207674_10255634 3300026116 Unclassified 1699
689 Ga0207674_10574289 3300026116 Bacteria 1089
690 Ga0207675_100000644 3300026118 Bacteria 34301
691 Ga0207675_100009769 3300026118 Bacteria 8981
692 Ga0207675_100077905 3300026118 Bacteria 3105
693 Ga0207675_100143674 3300026118 Unclassified 2268
694 Ga0207675_100254983 3300026118 Bacteria 1699
695 Ga0207683_10154313 3300026121 Bacteria 2073
696 Ga0207698_10119314 3300026142 Bacteria 2229
697 Ga0207698_10554158 3300026142 Bacteria 1127
698 Ga0209998_10046287 3300027717 Bacteria 998
699 Ga0207428_10000116 3300027907 Bacteria 109048
700 Ga0207428_10000138 3300027907 Bacteria 98359
701 Ga0207428_10004277 3300027907 Bacteria 13660
702 Ga0207428_10008185 3300027907 Bacteria 9463
703 Ga0207428_10064592 3300027907 Unclassified 2889
704 Ga0268266_10042839 3300028379 Bacteria 3868
705 Ga0268265_10036834 3300028380 Bacteria 3586
706 Ga0268265_10039886 3300028380 Bacteria 3464
707 Ga0268265_10084352 3300028380 Bacteria 2518
708 Ga0268265_10087114 3300028380 Bacteria 2484
709 Ga0268265_10097804 3300028380 Unclassified 2362
710 Ga0268264_10006252 3300028381 Bacteria 10046
711 Ga0268264_10045196 3300028381 Bacteria 3656
712 Ga0268264_10081747 3300028381 Bacteria 2762
713 Ga0268264_10118211 3300028381 Bacteria 2333
714 Ga0268264_10195884 3300028381 Bacteria 1845
715 Ga0268264_10213120 3300028381 Unclassified 1774
716 Ga0268264_10352692 3300028381 Bacteria 1401
717 Ga0268264_10485458 3300028381 Bacteria 1202
718 Ga0268264_10546130 3300028381 Bacteria 1136
719 Ga0268264_10649115 3300028381 Unclassified 1044
720 Ga0316176_1117742 3300030732 Bacteria 1084
721 Ga0307513_10002024 3300031456 Bacteria 28560
722 Ga0307408_100009272 3300031548 Bacteria 6487
723 Ga0307408_100142675 3300031548 Unclassified 1882
724 Ga0307413_10034184 3300031824 Unclassified 2903
725 Ga0307410_10115719 3300031852 Unclassified 1947
726 Ga0307410_10297791 3300031852 Bacteria 1272
727 Ga0307406_10077701 3300031901 Unclassified 2197
728 Ga0307412_10007074 3300031911 Bacteria 6368
729 Ga0307412_10010567 3300031911 Bacteria 5319
730 Ga0307416_100486312 3300032002 Unclassified 1295
731 Ga0307414_10005688 3300032004 Bacteria 6881
732 Ga0307411_10004154 3300032005 Bacteria 6882
733 Ga0307411_10058444 3300032005 Bacteria 2552
734 Ga0307411_10115649 3300032005 Bacteria 1930
735 Ga0307415_100010852 3300032126 Bacteria 5178
736 Ga0307415_100315064 3300032126 Bacteria 1302
737 Ga0373930_0035453 3300034816 Bacteria 1044
738 Ga0373958_0014006 3300034819 Bacteria 1397
739 Ga0373928_0038233 3300035084 Bacteria 1092
740 Ga0373940_0000629 3300035088 Bacteria 5640
741 Ga0373940_0039403 3300035088 Bacteria 1293
742 Ga0373940_0082006 3300035088 Bacteria 955
743 Ga0373951_0004689 3300035091 Bacteria 3232
744 Ga0373932_0071834 3300035112 Bacteria 1075
745 Ga0373941_0002139 3300035115 Bacteria 4303
746 Ga0373931_0019919 3300035691 Bacteria 3353
747 Ga0373931_0023227 3300035691 Bacteria 3130
748 Ga0373931_0333289 3300035691 Bacteria 945
749 Ga0373937_0096287 3300036401 Bacteria 2745
750 Ga0395900_0169841 3300037418 Unclassified 2221
751 Ga0395900_0278910 3300037418 Bacteria 1664
752 Ga0395900_0679022 3300037418 Bacteria 965
753 Ga0395898_0312877 3300037466 Unclassified 1498
754 Ga0395905_0042665 3300037471 Unclassified 4256
755 Ga0395905_0198777 3300037471 Bacteria 1880
756 Ga0395905_0885576 3300037471 Unclassified 796
757 Ga0395901_0102131 3300038443 Bacteria 3009
758 Ga0395901_0158788 3300038443 Bacteria 2375
759 Ga0242419_003448 3300038698 Bacteria 1071
760 Ga0242420_009381 3300038996 Unclassified 1604
761 Ga0439439_0030222 3300041406 Bacteria 1377
762 Ga0439458_0012407 3300042157 Unclassified 1912
763 Ga0451577_0004588 3300042876 Bacteria 14515
764 Ga0451577_0023549 3300042876 Bacteria 5614
765 Ga0451576_0022577 3300045051 Bacteria 6821
766 Ga0451576_0050316 3300045051 Bacteria 4370
767 Ga0451576_0084930 3300045051 Bacteria 3292
768 Ga0451576_0246340 3300045051 Bacteria 1867
769 Ga0495580_0009246 3300046472 Bacteria 7763
770 Ga0495632_0032708 3300046519 Unclassified 2677
771 Ga0495663_0000234 3300046525 Bacteria 22071
772 Ga0495642_0052408 3300046528 Bacteria 1680
773 Ga0495586_0315539 3300046535 Unclassified 896
774 Ga0495598_0000507 3300046537 Bacteria 7208
775 Ga0495621_0003359 3300046539 Bacteria 4413
776 Ga0495621_0008981 3300046539 Bacteria 3017
777 Ga0495669_0040389 3300046684 Bacteria 2069
778 Ga0495672_0010982 3300047320 Bacteria 6418
779 Ga0496102_0020336 3300048905 Bacteria 5867
780 Ga0496104_0128963 3300048907 Bacteria 2429
781 Ga0496104_0257003 3300048907 Bacteria 1660
782 Ga0496106_0012526 3300048909 Bacteria 6262
783 Ga0496108_0069455 3300048911 Bacteria 2973
784 Ga0496108_0187305 3300048911 Bacteria 1793
785 Ga0496110_0287134 3300048913 Unclassified 1498
786 Ga0496110_0321485 3300048913 Bacteria 1410
787 Ga0496111_0236173 3300048914 Bacteria 1358
788 Ga0496111_0309796 3300048914 Bacteria 1170
789 Ga0496111_0423867 3300048914 Unclassified 983
790 Ga0496112_0548513 3300048915 Unclassified 1090
791 Ga0496114_0503001 3300048917 Bacteria 1072
792 Ga0501292_014897 3300049515 Bacteria 1210
793 Ga0501296_006886 3300049519 Bacteria 1296
794 Ga0501298_020225 3300049521 Bacteria 1239
795 Ga0501299_000422 3300049522 Bacteria 5017
796 Ga0501300_004087 3300049523 Bacteria 2170
797 Ga0501038_0002831 3300049574 Bacteria 16141
798 Ga0501075_0103465 3300049591 Bacteria 2164
799 Ga0501076_0344069 3300049592 Bacteria 1224
800 Ga0501076_0608733 3300049592 Unclassified 901
801 Ga0501202_000648 3300049652 Bacteria 5128
802 Ga0501202_003361 3300049652 Unclassified 2736
803 Ga0501202_053329 3300049652 Bacteria 900
804 Ga0501216_007612 3300049660 Unclassified 1689
805 Ga0501216_019361 3300049660 Bacteria 1180
806 Ga0501217_083351 3300049661 Bacteria 888
807 Ga0501217_138285 3300049661 Bacteria 719
808 Ga0501223_011019 3300049663 Bacteria 1815
809 Ga0501223_023595 3300049663 Unclassified 1199
810 Ga0501227_004070 3300049665 Bacteria 3149
811 Ga0501230_004268 3300049667 Bacteria 1956
812 Ga0501233_023444 3300049668 Bacteria 1342
813 Ga0501233_033480 3300049668 Bacteria 1174
814 Ga0501235_006210 3300049669 Bacteria 2603
815 Ga0501235_032528 3300049669 Bacteria 1180
816 Ga0501235_046801 3300049669 Bacteria 997
817 Ga0501242_013030 3300049674 Bacteria 1018
818 Ga0501249_039853 3300049679 Unclassified 1063
819 Ga0501253_017706 3300049683 Bacteria 1206
820 Ga0501256_008113 3300049685 Bacteria 974
821 Ga0501259_015285 3300049688 Bacteria 1309
822 Ga0501221_007980 3300049704 Bacteria 1830
823 Ga0501234_007896 3300049707 Bacteria 1663
824 Ga0501245_010397 3300049708 Bacteria 1344
825 Ga0501080_0599246 3300049742 Bacteria 978
826 Ga0501271_011505 3300049768 Bacteria 947
827 Ga0501045_0148477 3300049824 Bacteria 1744
828 nmdc:mga05p37_103735_c1 3300050507 Bacteria 3499
829 nmdc:mga05p37_1084577_c1 3300050507 Bacteria 840
830 nmdc:mga05p37_25847_c1 3300050507 Bacteria 7138
831 nmdc:mga05p37_293625_c1 3300050507 Bacteria 1934
832 nmdc:mga05p37_29784_c1 3300050507 Bacteria 6661
833 nmdc:mga05p37_360808_c1 3300050507 Unclassified 1708
834 nmdc:mga05p37_54456_c2 3300050507 Bacteria 4334
835 nmdc:mga05p37_598000_c1 3300050507 Bacteria 1246
836 nmdc:mga05p37_71287_c1 3300050507 Unclassified 3731
837 nmdc:mga05p37_75655_c1 3300050507 Bacteria 4145
838 nmdc:mga05p37_84254_c1 3300050507 Bacteria 3917
839 nmdc:mga09592_10833_c1 3300050508 Bacteria 7418
840 nmdc:mga09592_20874_c1 3300050508 Bacteria 5393
841 nmdc:mga09592_262479_c1 3300050508 Unclassified 1498
842 nmdc:mga09592_567322_c1 3300050508 Bacteria 974
843 nmdc:mga09592_74063_c1 3300050508 Bacteria 2894
844 nmdc:mga09592_836577_c1 3300050508 Unclassified 777
845 nmdc:mga0qj67_128935_c1 3300050509 Bacteria 2048
846 nmdc:mga0qj67_141255_c1 3300050509 Unclassified 1953
847 nmdc:mga06r32_312194_c1 3300050510 Bacteria 1558
848 nmdc:mga08y16_104436_c1 3300050511 Bacteria 2949
849 nmdc:mga08y16_118088_c1 3300050511 Bacteria 2760
850 nmdc:mga08y16_1441_c1 3300050511 Bacteria 23825
851 nmdc:mga08y16_18335_c1 3300050511 Bacteria 7376
852 nmdc:mga08y16_2206_c1 3300050511 Bacteria 19973
853 nmdc:mga08y16_26147_c1 3300050511 Bacteria 6156
854 nmdc:mga08y16_32947_c1 3300050511 Bacteria 5445
855 nmdc:mga0n895_109654_c1 3300050512 Bacteria 2775
856 nmdc:mga0n895_157746_c1 3300050512 Bacteria 2300
857 nmdc:mga0n895_159447_c1 3300050512 Bacteria 2287
858 nmdc:mga0n895_16349_c1 3300050512 Bacteria 6803
859 nmdc:mga0n895_189076_c1 3300050512 Bacteria 2090
860 nmdc:mga0n895_237792_c1 3300050512 Bacteria 1848
861 nmdc:mga0n895_421483_c1 3300050512 Bacteria 1349
862 nmdc:mga0n895_48781_c1 3300050512 Bacteria 4146
863 nmdc:mga0n895_57523_c1 3300050512 Bacteria 3833
864 nmdc:mga0n895_82577_c1 3300050512 Bacteria 3204
865 nmdc:mga0n895_864071_c1 3300050512 Bacteria 892
866 nmdc:mga0n895_96337_c1 3300050512 Bacteria 2964
867 nmdc:mga0rr50_114418_c1 3300050513 Bacteria 2139
868 nmdc:mga0rr50_11540_c1 3300050513 Bacteria 5662
869 nmdc:mga0rr50_156417_c1 3300050513 Bacteria 1847
870 nmdc:mga0rr50_20831_c1 3300050513 Bacteria 4463
871 nmdc:mga0rr50_413113_c1 3300050513 Bacteria 1141
872 nmdc:mga0rr50_449156_c1 3300050513 Bacteria 1093
873 nmdc:mga0rr50_54359_c1 3300050513 Unclassified 2983
874 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
875 nmdc:mga0a205_147677_c1 3300050515 Bacteria 2251
876 nmdc:mga0a205_1778_c1 3300050515 Bacteria 18627
877 nmdc:mga0a205_18518_c1 3300050515 Bacteria 4424
878 nmdc:mga0a205_200908_c1 3300050515 Bacteria 1884
879 nmdc:mga0a205_23263_c1 3300050515 Bacteria 5876
880 nmdc:mga0a205_29986_c1 3300050515 Bacteria 5206
881 nmdc:mga0a205_3671_c1 3300050515 Bacteria 10002
882 nmdc:mga0a205_38407_c1 3300050515 Bacteria 4606
883 nmdc:mga0a205_3979_c1 3300050515 Bacteria 13214
884 nmdc:mga0a205_476761_c1 3300050515 Bacteria 1106
885 nmdc:mga0a205_61291_c1 3300050515 Bacteria 3633
886 nmdc:mga0a205_65122_c1 3300050515 Bacteria 3520
887 nmdc:mga0a205_690_c1 3300050515 Bacteria 20516
888 Ga0500616_0001750 3300053153 Bacteria 19909
889 Ga0500619_062704 3300053154 Unclassified 1226
890 Ga0501082_0546651 3300060353 Bacteria 1013

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049661 Ga0501217_138285 Ga0501217_138285_27_605 181
2 3300049679 Ga0501249_039853 Ga0501249_039853_450_1028 181
3 3300049768 Ga0501271_011505 Ga0501271_011505_342_920 181
4 3300027717 Ga0209998_10046287 Ga0209998_100462871 197
5 3300026067 Ga0207678_10312068 Ga0207678_103120682 204
6 3300049523 Ga0501300_004087 Ga0501300_004087_26_691 213
7 3300049685 Ga0501256_008113 Ga0501256_008113_18_692 213
8 3300005353 Ga0070669_100185867 Ga0070669_1001858672 215
9 3300005457 Ga0070662_100055917 Ga0070662_1000559173 215
10 3300005546 Ga0070696_100164388 Ga0070696_1001643882 215
11 3300006844 Ga0075428_100168088 Ga0075428_1001680882 215
12 3300006852 Ga0075433_10020387 Ga0075433_100203872 215
13 3300006852 Ga0075433_10037018 Ga0075433_100370182 215
14 3300006852 Ga0075433_10244068 Ga0075433_102440682 215
15 3300006871 Ga0075434_100437686 Ga0075434_1004376862 215
16 3300006871 Ga0075434_100460145 Ga0075434_1004601452 215
17 3300009094 Ga0111539_10001063 Ga0111539_1000106336 215
18 3300009147 Ga0114129_10413717 Ga0114129_104137173 215
19 3300013307 Ga0157372_10807000 Ga0157372_108070002 215
20 3300027907 Ga0207428_10000116 Ga0207428_1000011669 215
21 3300042876 Ga0451577_0004588 Ga0451577_0004588_7907_8602 215
22 3300045051 Ga0451576_0084930 Ga0451576_0084930_2426_3121 215
23 3300050507 nmdc:mga05p37_360808_c1 nmdc:mga05p37_360808_c1_128_823 215
24 3300050511 nmdc:mga08y16_18335_c1 nmdc:mga08y16_18335_c1_4585_5280 215
25 3300050512 nmdc:mga0n895_109654_c1 nmdc:mga0n895_109654_c1_1963_2655 215
26 3300050512 nmdc:mga0n895_421483_c1 nmdc:mga0n895_421483_c1_518_1213 215
27 3300050512 nmdc:mga0n895_48781_c1 nmdc:mga0n895_48781_c1_3143_3838 215
28 3300050515 nmdc:mga0a205_1778_c1 nmdc:mga0a205_1778_c1_1168_1863 215
29 3300050515 nmdc:mga0a205_3671_c1 nmdc:mga0a205_3671_c1_765_1460 215
30 3300009553 Ga0105249_10000052 Ga0105249_10000052113 216
31 3300013306 Ga0163162_10000001 Ga0163162_10000001625 216
32 3300025922 Ga0207646_10079019 Ga0207646_100790192 216
33 3300005341 Ga0070691_10013382 Ga0070691_100133822 217
34 3300005345 Ga0070692_10079040 Ga0070692_100790402 217
35 3300005459 Ga0068867_100051711 Ga0068867_1000517113 217
36 3300005545 Ga0070695_100003269 Ga0070695_1000032692 217
37 3300005549 Ga0070704_100103329 Ga0070704_1001033292 217
38 3300005577 Ga0068857_100009027 Ga0068857_1000090278 217
39 3300005718 Ga0068866_10033318 Ga0068866_100333182 217
40 3300005840 Ga0068870_10036163 Ga0068870_100361633 217
41 3300005843 Ga0068860_100096569 Ga0068860_1000965692 217
42 3300006852 Ga0075433_10005311 Ga0075433_100053114 217
43 3300006871 Ga0075434_100015815 Ga0075434_10001581510 217
44 3300009147 Ga0114129_10006111 Ga0114129_100061118 217
45 3300009147 Ga0114129_10086966 Ga0114129_100869661 217
46 3300009176 Ga0105242_10121508 Ga0105242_101215082 217
47 3300009553 Ga0105249_10564018 Ga0105249_105640182 217
48 3300013306 Ga0163162_11204146 Ga0163162_112041461 217
49 3300025885 Ga0207653_10093085 Ga0207653_100930852 217
50 3300025899 Ga0207642_10076640 Ga0207642_100766402 217
51 3300025910 Ga0207684_10054107 Ga0207684_100541071 217
52 3300025934 Ga0207686_10083288 Ga0207686_100832883 217
53 3300025935 Ga0207709_10018468 Ga0207709_100184686 217
54 3300025942 Ga0207689_10023893 Ga0207689_100238937 217
55 3300025961 Ga0207712_10375589 Ga0207712_103755892 217
56 3300026089 Ga0207648_10147356 Ga0207648_101473562 217
57 3300028381 Ga0268264_10081747 Ga0268264_100817472 217
58 3300048911 Ga0496108_0187305 Ga0496108_0187305_83_745 217
59 3300050507 nmdc:mga05p37_25847_c1 nmdc:mga05p37_25847_c1_5915_6628 217
60 3300050507 nmdc:mga05p37_54456_c2 nmdc:mga05p37_54456_c2_3391_4104 217
61 3300050515 nmdc:mga0a205_3979_c1 nmdc:mga0a205_3979_c1_5349_6062 217
62 3300005467 Ga0070706_100004663 Ga0070706_1000046631 218
63 3300005468 Ga0070707_100005091 Ga0070707_1000050913 218
64 3300005468 Ga0070707_100107578 Ga0070707_1001075781 218
65 3300005468 Ga0070707_100257053 Ga0070707_1002570533 218
66 3300005468 Ga0070707_100292866 Ga0070707_1002928661 218
67 3300005468 Ga0070707_100296334 Ga0070707_1002963343 218
68 3300005518 Ga0070699_100303452 Ga0070699_1003034522 218
69 3300005549 Ga0070704_100025781 Ga0070704_1000257816 218
70 3300005549 Ga0070704_100417910 Ga0070704_1004179101 218
71 3300005617 Ga0068859_100352572 Ga0068859_1003525722 218
72 3300005841 Ga0068863_100235255 Ga0068863_1002352552 218
73 3300006358 Ga0068871_100136015 Ga0068871_1001360152 218
74 3300006847 Ga0075431_100133912 Ga0075431_1001339123 218
75 3300006852 Ga0075433_10023489 Ga0075433_100234894 218
76 3300006852 Ga0075433_10081353 Ga0075433_100813534 218
77 3300006852 Ga0075433_10209896 Ga0075433_102098962 218
78 3300006871 Ga0075434_100016204 Ga0075434_1000162047 218
79 3300006871 Ga0075434_100035293 Ga0075434_1000352933 218
80 3300006871 Ga0075434_100055054 Ga0075434_1000550543 218
81 3300006914 Ga0075436_100281821 Ga0075436_1002818212 218
82 3300006931 Ga0097620_100352569 Ga0097620_1003525692 218
83 3300007076 Ga0075435_100054387 Ga0075435_1000543871 218
84 3300007076 Ga0075435_100056407 Ga0075435_1000564072 218
85 3300007076 Ga0075435_100204549 Ga0075435_1002045493 218
86 3300009094 Ga0111539_10001170 Ga0111539_1000117021 218
87 3300009094 Ga0111539_10846181 Ga0111539_108461812 218
88 3300009177 Ga0105248_10028736 Ga0105248_100287364 218
89 3300025910 Ga0207684_10199122 Ga0207684_101991223 218
90 3300025922 Ga0207646_10007966 Ga0207646_1000796618 218
91 3300025922 Ga0207646_10051069 Ga0207646_100510693 218
92 3300025923 Ga0207681_10590551 Ga0207681_105905511 218
93 3300025941 Ga0207711_10600289 Ga0207711_106002892 218
94 3300026088 Ga0207641_10475767 Ga0207641_104757672 218
95 3300027907 Ga0207428_10000138 Ga0207428_1000013850 218
96 3300028380 Ga0268265_10087114 Ga0268265_100871142 218
97 3300034816 Ga0373930_0035453 Ga0373930_0035453_70_741 218
98 3300034819 Ga0373958_0014006 Ga0373958_0014006_576_1247 218
99 3300035084 Ga0373928_0038233 Ga0373928_0038233_380_1051 218
100 3300035088 Ga0373940_0000629 Ga0373940_0000629_2947_3618 218
101 3300035088 Ga0373940_0039403 Ga0373940_0039403_448_1119 218
102 3300035112 Ga0373932_0071834 Ga0373932_0071834_201_872 218
103 3300035691 Ga0373931_0023227 Ga0373931_0023227_353_1024 218
104 3300035691 Ga0373931_0333289 Ga0373931_0333289_129_800 218
105 3300042876 Ga0451577_0023549 Ga0451577_0023549_3845_4516 218
106 3300045051 Ga0451576_0246340 Ga0451576_0246340_943_1614 218
107 3300046472 Ga0495580_0009246 Ga0495580_0009246_2374_3045 218
108 3300046528 Ga0495642_0052408 Ga0495642_0052408_547_1218 218
109 3300046684 Ga0495669_0040389 Ga0495669_0040389_346_1017 218
110 3300050507 nmdc:mga05p37_75655_c1 nmdc:mga05p37_75655_c1_2441_3112 218
111 3300050507 nmdc:mga05p37_84254_c1 nmdc:mga05p37_84254_c1_389_1060 218
112 3300050508 nmdc:mga09592_20874_c1 nmdc:mga09592_20874_c1_204_875 218
113 3300050509 nmdc:mga0qj67_128935_c1 nmdc:mga0qj67_128935_c1_850_1521 218
114 3300050510 nmdc:mga06r32_312194_c1 nmdc:mga06r32_312194_c1_51_722 218
115 3300050511 nmdc:mga08y16_1441_c1 nmdc:mga08y16_1441_c1_8608_9279 218
116 3300050512 nmdc:mga0n895_157746_c1 nmdc:mga0n895_157746_c1_673_1362 218
117 3300050512 nmdc:mga0n895_57523_c1 nmdc:mga0n895_57523_c1_2920_3591 218
118 3300050512 nmdc:mga0n895_82577_c1 nmdc:mga0n895_82577_c1_1034_1705 218
119 3300050512 nmdc:mga0n895_864071_c1 nmdc:mga0n895_864071_c1_128_799 218
120 3300050513 nmdc:mga0rr50_156417_c1 nmdc:mga0rr50_156417_c1_588_1259 218
121 3300050513 nmdc:mga0rr50_20831_c1 nmdc:mga0rr50_20831_c1_2310_2981 218
122 3300050513 nmdc:mga0rr50_413113_c1 nmdc:mga0rr50_413113_c1_191_862 218
123 3300050513 nmdc:mga0rr50_449156_c1 nmdc:mga0rr50_449156_c1_52_723 218
124 3300050515 nmdc:mga0a205_200908_c1 nmdc:mga0a205_200908_c1_278_949 218
125 3300050515 nmdc:mga0a205_38407_c1 nmdc:mga0a205_38407_c1_1920_2591 218
126 3300050515 nmdc:mga0a205_690_c1 nmdc:mga0a205_690_c1_11038_11709 218
127 3300002459 JGI24751J29686_10000011 JGI24751J29686_1000001168 219
128 3300005290 Ga0065712_10084272 Ga0065712_100842722 219
129 3300005293 Ga0065715_10095739 Ga0065715_100957392 219
130 3300005331 Ga0070670_100000295 Ga0070670_1000002957 219
131 3300005364 Ga0070673_100282563 Ga0070673_1002825632 219
132 3300005364 Ga0070673_100601507 Ga0070673_1006015072 219
133 3300005438 Ga0070701_10155558 Ga0070701_101555582 219
134 3300005441 Ga0070700_100084723 Ga0070700_1000847232 219
135 3300005441 Ga0070700_100353940 Ga0070700_1003539402 219
136 3300005458 Ga0070681_10001543 Ga0070681_1000154319 219
137 3300005458 Ga0070681_10221183 Ga0070681_102211832 219
138 3300005468 Ga0070707_100394973 Ga0070707_1003949732 219
139 3300005547 Ga0070693_100097942 Ga0070693_1000979422 219
140 3300005547 Ga0070693_100120423 Ga0070693_1001204232 219
141 3300005617 Ga0068859_100020829 Ga0068859_1000208292 219
142 3300005617 Ga0068859_100036510 Ga0068859_1000365105 219
143 3300005617 Ga0068859_100131919 Ga0068859_1001319192 219
144 3300005618 Ga0068864_100028456 Ga0068864_1000284565 219
145 3300005840 Ga0068870_10380900 Ga0068870_103809001 219
146 3300005841 Ga0068863_100166099 Ga0068863_1001660992 219
147 3300005843 Ga0068860_100154892 Ga0068860_1001548924 219
148 3300006871 Ga0075434_100060851 Ga0075434_1000608512 219
149 3300006881 Ga0068865_100257818 Ga0068865_1002578182 219
150 3300006931 Ga0097620_100020828 Ga0097620_1000208282 219
151 3300006931 Ga0097620_100036512 Ga0097620_1000365125 219
152 3300006931 Ga0097620_100131912 Ga0097620_1001319122 219
153 3300009011 Ga0105251_10049007 Ga0105251_100490073 219
154 3300009098 Ga0105245_10090957 Ga0105245_100909572 219
155 3300009101 Ga0105247_10002714 Ga0105247_100027142 219
156 3300009148 Ga0105243_10182963 Ga0105243_101829632 219
157 3300009174 Ga0105241_10056953 Ga0105241_100569532 219
158 3300009174 Ga0105241_10066392 Ga0105241_100663924 219
159 3300009176 Ga0105242_10146614 Ga0105242_101466142 219
160 3300009545 Ga0105237_10132920 Ga0105237_101329202 219
161 3300009551 Ga0105238_10063641 Ga0105238_100636414 219
162 3300009553 Ga0105249_10100153 Ga0105249_101001533 219
163 3300009553 Ga0105249_10440825 Ga0105249_104408252 219
164 3300009553 Ga0105249_10785694 Ga0105249_107856942 219
165 3300010375 Ga0105239_11215656 Ga0105239_112156561 219
166 3300013306 Ga0163162_10026725 Ga0163162_100267253 219
167 3300013307 Ga0157372_10361410 Ga0157372_103614102 219
168 3300014325 Ga0163163_10001903 Ga0163163_1000190310 219
169 3300014326 Ga0157380_10011248 Ga0157380_100112485 219
170 3300014326 Ga0157380_10197191 Ga0157380_101971912 219
171 3300014326 Ga0157380_11479548 Ga0157380_114795481 219
172 3300017792 Ga0163161_10410428 Ga0163161_104104281 219
173 3300017792 Ga0163161_10750511 Ga0163161_107505112 219
174 3300025900 Ga0207710_10009909 Ga0207710_100099092 219
175 3300025904 Ga0207647_10265988 Ga0207647_102659882 219
176 3300025911 Ga0207654_10075676 Ga0207654_100756762 219
177 3300025911 Ga0207654_10174739 Ga0207654_101747392 219
178 3300025913 Ga0207695_10255331 Ga0207695_102553312 219
179 3300025923 Ga0207681_10087685 Ga0207681_100876853 219
180 3300025924 Ga0207694_10019502 Ga0207694_100195022 219
181 3300025925 Ga0207650_10000001 Ga0207650_10000001715 219
182 3300025931 Ga0207644_10593667 Ga0207644_105936671 219
183 3300025933 Ga0207706_10311827 Ga0207706_103118272 219
184 3300025934 Ga0207686_10366631 Ga0207686_103666312 219
185 3300025938 Ga0207704_10259487 Ga0207704_102594872 219
186 3300025960 Ga0207651_10083331 Ga0207651_100833312 219
187 3300026075 Ga0207708_10026462 Ga0207708_100264622 219
188 3300026075 Ga0207708_10231585 Ga0207708_102315852 219
189 3300026088 Ga0207641_10528980 Ga0207641_105289801 219
190 3300026089 Ga0207648_10049773 Ga0207648_100497732 219
191 3300026095 Ga0207676_10011946 Ga0207676_100119462 219
192 3300026116 Ga0207674_10255634 Ga0207674_102556342 219
193 3300026118 Ga0207675_100254983 Ga0207675_1002549831 219
194 3300026142 Ga0207698_10119314 Ga0207698_101193143 219
195 3300028381 Ga0268264_10649115 Ga0268264_106491151 219
196 3300031548 Ga0307408_100142675 Ga0307408_1001426752 219
197 3300031852 Ga0307410_10297791 Ga0307410_102977912 219
198 3300035091 Ga0373951_0004689 Ga0373951_0004689_458_1126 219
199 3300050512 nmdc:mga0n895_96337_c1 nmdc:mga0n895_96337_c1_396_1082 219
200 3300050515 nmdc:mga0a205_23263_c1 nmdc:mga0a205_23263_c1_1644_2330 219
201 3300003320 rootH2_10208663 rootH2_102086632 220
202 3300005288 Ga0065714_10064818 Ga0065714_100648185 220
203 3300005290 Ga0065712_10067985 Ga0065712_100679855 220
204 3300005293 Ga0065715_10000408 Ga0065715_1000040812 220
205 3300005337 Ga0070682_100003919 Ga0070682_1000039196 220
206 3300005339 Ga0070660_100747861 Ga0070660_1007478611 220
207 3300005345 Ga0070692_10014617 Ga0070692_100146172 220
208 3300005440 Ga0070705_100095064 Ga0070705_1000950641 220
209 3300005441 Ga0070700_100000103 Ga0070700_10000010329 220
210 3300005441 Ga0070700_100039267 Ga0070700_1000392674 220
211 3300005444 Ga0070694_100016088 Ga0070694_1000160882 220
212 3300005467 Ga0070706_100000001 Ga0070706_10000000129 220
213 3300005518 Ga0070699_100000581 Ga0070699_10000058132 220
214 3300005518 Ga0070699_100227025 Ga0070699_1002270251 220
215 3300005544 Ga0070686_100128410 Ga0070686_1001284102 220
216 3300005545 Ga0070695_100341849 Ga0070695_1003418492 220
217 3300005547 Ga0070693_100009029 Ga0070693_1000090295 220
218 3300005615 Ga0070702_100012362 Ga0070702_1000123622 220
219 3300005616 Ga0068852_100256217 Ga0068852_1002562172 220
220 3300005617 Ga0068859_100055944 Ga0068859_1000559445 220
221 3300005618 Ga0068864_100197716 Ga0068864_1001977162 220
222 3300005834 Ga0068851_10014077 Ga0068851_100140771 220
223 3300005985 Ga0081539_10000413 Ga0081539_1000041334 220
224 3300006852 Ga0075433_10325927 Ga0075433_103259272 220
225 3300006871 Ga0075434_100080287 Ga0075434_1000802871 220
226 3300006871 Ga0075434_100127953 Ga0075434_1001279532 220
227 3300006880 Ga0075429_100453777 Ga0075429_1004537772 220
228 3300006931 Ga0097620_100055938 Ga0097620_1000559385 220
229 3300007076 Ga0075435_100018467 Ga0075435_1000184672 220
230 3300009094 Ga0111539_11373995 Ga0111539_113739952 220
231 3300009147 Ga0114129_10035789 Ga0114129_100357895 220
232 3300009147 Ga0114129_10136453 Ga0114129_101364532 220
233 3300009545 Ga0105237_10003442 Ga0105237_1000344210 220
234 3300010375 Ga0105239_11650984 Ga0105239_116509841 220
235 3300013100 Ga0157373_10323146 Ga0157373_103231461 220
236 3300013308 Ga0157375_10015347 Ga0157375_100153474 220
237 3300013308 Ga0157375_10826928 Ga0157375_108269282 220
238 3300014968 Ga0157379_10165278 Ga0157379_101652783 220
239 3300025885 Ga0207653_10002794 Ga0207653_100027942 220
240 3300025904 Ga0207647_10035143 Ga0207647_100351433 220
241 3300025910 Ga0207684_10000030 Ga0207684_10000030212 220
242 3300025914 Ga0207671_10004811 Ga0207671_100048119 220
243 3300025925 Ga0207650_10337824 Ga0207650_103378242 220
244 3300026035 Ga0207703_10369186 Ga0207703_103691861 220
245 3300026035 Ga0207703_10937829 Ga0207703_109378291 220
246 3300026075 Ga0207708_10000224 Ga0207708_1000022427 220
247 3300026075 Ga0207708_10054631 Ga0207708_100546314 220
248 3300031548 Ga0307408_100009272 Ga0307408_1000092722 220
249 3300031824 Ga0307413_10034184 Ga0307413_100341842 220
250 3300031852 Ga0307410_10115719 Ga0307410_101157192 220
251 3300031911 Ga0307412_10007074 Ga0307412_100070747 220
252 3300032002 Ga0307416_100486312 Ga0307416_1004863122 220
253 3300032004 Ga0307414_10005688 Ga0307414_100056886 220
254 3300032005 Ga0307411_10004154 Ga0307411_100041545 220
255 3300032005 Ga0307411_10115649 Ga0307411_101156492 220
256 3300032126 Ga0307415_100010852 Ga0307415_1000108522 220
257 3300032126 Ga0307415_100315064 Ga0307415_1003150642 220
258 3300035088 Ga0373940_0082006 Ga0373940_0082006_214_888 220
259 3300035115 Ga0373941_0002139 Ga0373941_0002139_271_945 220
260 3300035691 Ga0373931_0019919 Ga0373931_0019919_199_873 220
261 3300037418 Ga0395900_0278910 Ga0395900_0278910_799_1479 220
262 3300038443 Ga0395901_0102131 Ga0395901_0102131_1510_2190 220
263 3300038698 Ga0242419_003448 Ga0242419_003448_39_713 220
264 3300042157 Ga0439458_0012407 Ga0439458_0012407_241_921 220
265 3300045051 Ga0451576_0050316 Ga0451576_0050316_2919_3593 220
266 3300048907 Ga0496104_0128963 Ga0496104_0128963_1444_2121 220
267 3300048913 Ga0496110_0321485 Ga0496110_0321485_635_1312 220
268 3300048914 Ga0496111_0236173 Ga0496111_0236173_330_1007 220
269 3300049574 Ga0501038_0002831 Ga0501038_0002831_14061_14744 220
270 3300049591 Ga0501075_0103465 Ga0501075_0103465_155_856 220
271 3300049592 Ga0501076_0608733 Ga0501076_0608733_13_714 220
272 3300049652 Ga0501202_003361 Ga0501202_003361_745_1419 220
273 3300049660 Ga0501216_007612 Ga0501216_007612_900_1574 220
274 3300049660 Ga0501216_019361 Ga0501216_019361_432_1115 220
275 3300049663 Ga0501223_011019 Ga0501223_011019_1088_1771 220
276 3300049667 Ga0501230_004268 Ga0501230_004268_529_1212 220
277 3300049668 Ga0501233_023444 Ga0501233_023444_561_1244 220
278 3300049669 Ga0501235_006210 Ga0501235_006210_203_877 220
279 3300049683 Ga0501253_017706 Ga0501253_017706_26_709 220
280 3300050507 nmdc:mga05p37_293625_c1 nmdc:mga05p37_293625_c1_1115_1795 220
281 3300050508 nmdc:mga09592_567322_c1 nmdc:mga09592_567322_c1_55_759 220
282 3300050512 nmdc:mga0n895_159447_c1 nmdc:mga0n895_159447_c1_275_955 220
283 3300050513 nmdc:mga0rr50_54359_c1 nmdc:mga0rr50_54359_c1_246_929 220
284 3300050515 nmdc:mga0a205_147677_c1 nmdc:mga0a205_147677_c1_696_1376 220
285 3300050515 nmdc:mga0a205_61291_c1 nmdc:mga0a205_61291_c1_2310_2987 220
286 3300053154 Ga0500619_062704 Ga0500619_062704_105_881 220
287 3300005293 Ga0065715_10175709 Ga0065715_101757092 221
288 3300005330 Ga0070690_100020494 Ga0070690_1000204943 221
289 3300005336 Ga0070680_100711112 Ga0070680_1007111122 221
290 3300005340 Ga0070689_100015200 Ga0070689_1000152004 221
291 3300005444 Ga0070694_100061927 Ga0070694_1000619272 221
292 3300005444 Ga0070694_100117169 Ga0070694_1001171692 221
293 3300005444 Ga0070694_100578948 Ga0070694_1005789481 221
294 3300005545 Ga0070695_100052191 Ga0070695_1000521912 221
295 3300005545 Ga0070695_100136923 Ga0070695_1001369231 221
296 3300005545 Ga0070695_100612699 Ga0070695_1006126991 221
297 3300005577 Ga0068857_100312629 Ga0068857_1003126292 221
298 3300005617 Ga0068859_100003377 Ga0068859_10000337715 221
299 3300005617 Ga0068859_100595394 Ga0068859_1005953942 221
300 3300005618 Ga0068864_100068784 Ga0068864_1000687842 221
301 3300005840 Ga0068870_10024979 Ga0068870_100249794 221
302 3300005841 Ga0068863_100069915 Ga0068863_1000699154 221
303 3300005844 Ga0068862_100302220 Ga0068862_1003022202 221
304 3300006931 Ga0097620_100003377 Ga0097620_1000033772 221
305 3300006931 Ga0097620_100595467 Ga0097620_1005954672 221
306 3300007265 Ga0099794_10039008 Ga0099794_100390082 221
307 3300009101 Ga0105247_10022652 Ga0105247_100226524 221
308 3300009147 Ga0114129_10014321 Ga0114129_100143212 221
309 3300009177 Ga0105248_10025844 Ga0105248_100258442 221
310 3300013297 Ga0157378_10504124 Ga0157378_105041241 221
311 3300013307 Ga0157372_10007348 Ga0157372_100073484 221
312 3300014325 Ga0163163_10184355 Ga0163163_101843553 221
313 3300014326 Ga0157380_10042355 Ga0157380_100423553 221
314 3300025900 Ga0207710_10037702 Ga0207710_100377022 221
315 3300025908 Ga0207643_10018891 Ga0207643_100188914 221
316 3300025936 Ga0207670_10001298 Ga0207670_100012988 221
317 3300025941 Ga0207711_10046688 Ga0207711_100466884 221
318 3300026075 Ga0207708_10208419 Ga0207708_102084192 221
319 3300026095 Ga0207676_10058107 Ga0207676_100581072 221
320 3300026116 Ga0207674_10109655 Ga0207674_101096552 221
321 3300028380 Ga0268265_10039886 Ga0268265_100398862 221
322 3300028381 Ga0268264_10546130 Ga0268264_105461302 221
323 3300049515 Ga0501292_014897 Ga0501292_014897_18_719 221
324 3300049519 Ga0501296_006886 Ga0501296_006886_327_1028 221
325 3300049522 Ga0501299_000422 Ga0501299_000422_3231_3932 221
326 3300049652 Ga0501202_000648 Ga0501202_000648_184_885 221
327 3300049668 Ga0501233_033480 Ga0501233_033480_450_1142 221
328 3300049669 Ga0501235_046801 Ga0501235_046801_232_933 221
329 3300049674 Ga0501242_013030 Ga0501242_013030_51_743 221
330 3300049688 Ga0501259_015285 Ga0501259_015285_34_735 221
331 3300049707 Ga0501234_007896 Ga0501234_007896_911_1597 221
332 3300049708 Ga0501245_010397 Ga0501245_010397_437_1138 221
333 3300050507 nmdc:mga05p37_29784_c1 nmdc:mga05p37_29784_c1_2541_3266 221
334 3300050515 nmdc:mga0a205_65122_c1 nmdc:mga0a205_65122_c1_446_1186 221
335 3300003203 JGI25406J46586_10000950 JGI25406J46586_100009502 222
336 3300005290 Ga0065712_10009824 Ga0065712_100098243 222
337 3300005293 Ga0065715_10115352 Ga0065715_101153522 222
338 3300005330 Ga0070690_100010815 Ga0070690_1000108153 222
339 3300005334 Ga0068869_100095695 Ga0068869_1000956953 222
340 3300005334 Ga0068869_100377013 Ga0068869_1003770132 222
341 3300005338 Ga0068868_100212279 Ga0068868_1002122791 222
342 3300005343 Ga0070687_100053771 Ga0070687_1000537712 222
343 3300005345 Ga0070692_10045493 Ga0070692_100454932 222
344 3300005353 Ga0070669_100263468 Ga0070669_1002634682 222
345 3300005356 Ga0070674_100070927 Ga0070674_1000709273 222
346 3300005438 Ga0070701_10019919 Ga0070701_100199192 222
347 3300005440 Ga0070705_100117014 Ga0070705_1001170142 222
348 3300005441 Ga0070700_100047033 Ga0070700_1000470332 222
349 3300005441 Ga0070700_100050677 Ga0070700_1000506772 222
350 3300005441 Ga0070700_100168275 Ga0070700_1001682752 222
351 3300005444 Ga0070694_100015550 Ga0070694_1000155502 222
352 3300005444 Ga0070694_100551895 Ga0070694_1005518952 222
353 3300005457 Ga0070662_100016422 Ga0070662_1000164223 222
354 3300005544 Ga0070686_100031105 Ga0070686_1000311053 222
355 3300005547 Ga0070693_100256533 Ga0070693_1002565332 222
356 3300005549 Ga0070704_100210137 Ga0070704_1002101372 222
357 3300005578 Ga0068854_100077229 Ga0068854_1000772292 222
358 3300005615 Ga0070702_100043521 Ga0070702_1000435211 222
359 3300005617 Ga0068859_100056809 Ga0068859_1000568092 222
360 3300005617 Ga0068859_100180400 Ga0068859_1001804003 222
361 3300005618 Ga0068864_100275927 Ga0068864_1002759272 222
362 3300005718 Ga0068866_10003551 Ga0068866_100035514 222
363 3300005719 Ga0068861_100214797 Ga0068861_1002147972 222
364 3300005840 Ga0068870_10040907 Ga0068870_100409072 222
365 3300005842 Ga0068858_100060742 Ga0068858_1000607426 222
366 3300005843 Ga0068860_100186580 Ga0068860_1001865802 222
367 3300005843 Ga0068860_100243631 Ga0068860_1002436312 222
368 3300005844 Ga0068862_100018701 Ga0068862_1000187014 222
369 3300005844 Ga0068862_100229241 Ga0068862_1002292413 222
370 3300005985 Ga0081539_10000053 Ga0081539_10000053207 222
371 3300006173 Ga0070716_100135081 Ga0070716_1001350812 222
372 3300006846 Ga0075430_100032469 Ga0075430_1000324692 222
373 3300006880 Ga0075429_100552794 Ga0075429_1005527942 222
374 3300006881 Ga0068865_100185629 Ga0068865_1001856291 222
375 3300006931 Ga0097620_100056809 Ga0097620_1000568092 222
376 3300006931 Ga0097620_100180407 Ga0097620_1001804073 222
377 3300009094 Ga0111539_10088509 Ga0111539_100885092 222
378 3300009148 Ga0105243_10221297 Ga0105243_102212972 222
379 3300009174 Ga0105241_10625838 Ga0105241_106258382 222
380 3300009177 Ga0105248_10043109 Ga0105248_100431092 222
381 3300009177 Ga0105248_10418981 Ga0105248_104189811 222
382 3300013100 Ga0157373_10070126 Ga0157373_100701262 222
383 3300013102 Ga0157371_10059753 Ga0157371_100597534 222
384 3300013297 Ga0157378_10005014 Ga0157378_1000501410 222
385 3300013297 Ga0157378_10036917 Ga0157378_100369173 222
386 3300013297 Ga0157378_10223775 Ga0157378_102237752 222
387 3300013308 Ga0157375_11081810 Ga0157375_110818101 222
388 3300014326 Ga0157380_10019779 Ga0157380_100197793 222
389 3300014968 Ga0157379_10067376 Ga0157379_100673762 222
390 3300017792 Ga0163161_10048631 Ga0163161_100486312 222
391 3300025908 Ga0207643_10022022 Ga0207643_100220222 222
392 3300025918 Ga0207662_10011825 Ga0207662_100118252 222
393 3300025918 Ga0207662_10042573 Ga0207662_100425733 222
394 3300025923 Ga0207681_10025484 Ga0207681_100254842 222
395 3300025935 Ga0207709_10251314 Ga0207709_102513142 222
396 3300025940 Ga0207691_10331462 Ga0207691_103314621 222
397 3300025940 Ga0207691_10679668 Ga0207691_106796681 222
398 3300025941 Ga0207711_10028572 Ga0207711_100285722 222
399 3300025941 Ga0207711_10645593 Ga0207711_106455931 222
400 3300025942 Ga0207689_10020196 Ga0207689_100201963 222
401 3300025942 Ga0207689_10290511 Ga0207689_102905112 222
402 3300025942 Ga0207689_10295649 Ga0207689_102956491 222
403 3300025960 Ga0207651_10157410 Ga0207651_101574102 222
404 3300025981 Ga0207640_10021271 Ga0207640_100212712 222
405 3300025981 Ga0207640_10238836 Ga0207640_102388362 222
406 3300026023 Ga0207677_10193660 Ga0207677_101936602 222
407 3300026075 Ga0207708_10031580 Ga0207708_100315802 222
408 3300026088 Ga0207641_10448519 Ga0207641_104485192 222
409 3300026118 Ga0207675_100143674 Ga0207675_1001436742 222
410 3300028380 Ga0268265_10084352 Ga0268265_100843522 222
411 3300028381 Ga0268264_10213120 Ga0268264_102131202 222
412 3300028381 Ga0268264_10485458 Ga0268264_104854582 222
413 3300030732 Ga0316176_1117742 Ga0316176_11177421 222
414 3300048914 Ga0496111_0423867 Ga0496111_0423867_123_812 222
415 3300049652 Ga0501202_053329 Ga0501202_053329_167_856 222
416 3300049665 Ga0501227_004070 Ga0501227_004070_2196_2885 222
417 3300049704 Ga0501221_007980 Ga0501221_007980_1103_1795 222
418 3300050508 nmdc:mga09592_836577_c1 nmdc:mga09592_836577_c1_48_743 222
419 3300050509 nmdc:mga0qj67_141255_c1 nmdc:mga0qj67_141255_c1_685_1374 222
420 3300050511 nmdc:mga08y16_104436_c1 nmdc:mga08y16_104436_c1_850_1539 222
421 3300001432 JGI24034J14986_100817 JGI24034J14986_1008172 223
422 3300002074 JGI24748J21848_1000001 JGI24748J21848_1000001361 223
423 3300002239 JGI24034J26672_10000001 JGI24034J26672_1000000157 223
424 3300002244 JGI24742J22300_10019119 JGI24742J22300_100191192 223
425 3300005347 Ga0070668_100024570 Ga0070668_1000245702 223
426 3300005355 Ga0070671_100467960 Ga0070671_1004679601 223
427 3300005364 Ga0070673_100080591 Ga0070673_1000805913 223
428 3300005364 Ga0070673_100180424 Ga0070673_1001804242 223
429 3300005365 Ga0070688_100498018 Ga0070688_1004980181 223
430 3300005434 Ga0070709_10077904 Ga0070709_100779042 223
431 3300005441 Ga0070700_100505228 Ga0070700_1005052281 223
432 3300005444 Ga0070694_100096731 Ga0070694_1000967312 223
433 3300005445 Ga0070708_100045574 Ga0070708_1000455742 223
434 3300005468 Ga0070707_100001152 Ga0070707_10000115224 223
435 3300005468 Ga0070707_100015254 Ga0070707_1000152542 223
436 3300005468 Ga0070707_100079397 Ga0070707_1000793972 223
437 3300005471 Ga0070698_100341324 Ga0070698_1003413242 223
438 3300005518 Ga0070699_100630121 Ga0070699_1006301211 223
439 3300005536 Ga0070697_100000459 Ga0070697_1000004594 223
440 3300005536 Ga0070697_100041216 Ga0070697_1000412164 223
441 3300005536 Ga0070697_100113805 Ga0070697_1001138051 223
442 3300005543 Ga0070672_100466389 Ga0070672_1004663891 223
443 3300005546 Ga0070696_100012857 Ga0070696_1000128574 223
444 3300005546 Ga0070696_100077461 Ga0070696_1000774612 223
445 3300005546 Ga0070696_100230504 Ga0070696_1002305042 223
446 3300005549 Ga0070704_100001798 Ga0070704_10000179811 223
447 3300005549 Ga0070704_100032633 Ga0070704_1000326332 223
448 3300005615 Ga0070702_100412428 Ga0070702_1004124281 223
449 3300005617 Ga0068859_100105706 Ga0068859_1001057062 223
450 3300005617 Ga0068859_100205411 Ga0068859_1002054112 223
451 3300005617 Ga0068859_100388015 Ga0068859_1003880152 223
452 3300005618 Ga0068864_100561400 Ga0068864_1005614002 223
453 3300005718 Ga0068866_10134631 Ga0068866_101346312 223
454 3300005719 Ga0068861_100159633 Ga0068861_1001596331 223
455 3300005841 Ga0068863_100133858 Ga0068863_1001338582 223
456 3300005842 Ga0068858_100000051 Ga0068858_10000005110 223
457 3300005842 Ga0068858_100036187 Ga0068858_1000361874 223
458 3300006871 Ga0075434_100586593 Ga0075434_1005865932 223
459 3300006914 Ga0075436_100000002 Ga0075436_100000002277 223
460 3300006931 Ga0097620_100105712 Ga0097620_1001057122 223
461 3300006931 Ga0097620_100205401 Ga0097620_1002054012 223
462 3300006931 Ga0097620_100388073 Ga0097620_1003880732 223
463 3300007076 Ga0075435_100030687 Ga0075435_1000306874 223
464 3300009101 Ga0105247_10000004 Ga0105247_10000004103 223
465 3300009148 Ga0105243_10311503 Ga0105243_103115031 223
466 3300009553 Ga0105249_10058162 Ga0105249_100581624 223
467 3300013297 Ga0157378_10081387 Ga0157378_100813874 223
468 3300013306 Ga0163162_10099145 Ga0163162_100991452 223
469 3300014325 Ga0163163_10664329 Ga0163163_106643292 223
470 3300025223 Ga0207672_1000019 Ga0207672_10000196 223
471 3300025899 Ga0207642_10038250 Ga0207642_100382502 223
472 3300025900 Ga0207710_10000002 Ga0207710_10000002911 223
473 3300025906 Ga0207699_10067689 Ga0207699_100676892 223
474 3300025910 Ga0207684_10004486 Ga0207684_1000448611 223
475 3300025922 Ga0207646_10000399 Ga0207646_1000039911 223
476 3300025922 Ga0207646_10006739 Ga0207646_100067392 223
477 3300025922 Ga0207646_10050922 Ga0207646_100509222 223
478 3300025922 Ga0207646_10108018 Ga0207646_101080182 223
479 3300025922 Ga0207646_10861913 Ga0207646_108619131 223
480 3300025931 Ga0207644_10000648 Ga0207644_100006485 223
481 3300025934 Ga0207686_10002486 Ga0207686_100024862 223
482 3300025935 Ga0207709_10000469 Ga0207709_1000046917 223
483 3300025935 Ga0207709_10357114 Ga0207709_103571142 223
484 3300025936 Ga0207670_10050579 Ga0207670_100505792 223
485 3300025939 Ga0207665_10233246 Ga0207665_102332462 223
486 3300025942 Ga0207689_10730108 Ga0207689_107301081 223
487 3300025960 Ga0207651_10049810 Ga0207651_100498102 223
488 3300025960 Ga0207651_10217008 Ga0207651_102170082 223
489 3300025961 Ga0207712_10000022 Ga0207712_10000022236 223
490 3300026035 Ga0207703_10000114 Ga0207703_1000011461 223
491 3300026035 Ga0207703_10191443 Ga0207703_101914432 223
492 3300037418 Ga0395900_0679022 Ga0395900_0679022_131_856 223
493 3300037471 Ga0395905_0885576 Ga0395905_0885576_40_762 223
494 3300038443 Ga0395901_0158788 Ga0395901_0158788_1113_1835 223
495 3300050512 nmdc:mga0n895_237792_c1 nmdc:mga0n895_237792_c1_879_1607 223
496 3300050513 nmdc:mga0rr50_11540_c1 nmdc:mga0rr50_11540_c1_3357_4085 223
497 3300050514 nmdc:mga08x19_9_c1 nmdc:mga08x19_9_c1_92475_93203 223
498 3300005289 Ga0065704_10021194 Ga0065704_100211941 224
499 3300005295 Ga0065707_10000695 Ga0065707_100006955 224
500 3300005334 Ga0068869_100034544 Ga0068869_1000345442 224
501 3300005338 Ga0068868_100011754 Ga0068868_1000117542 224
502 3300005406 Ga0070703_10000014 Ga0070703_1000001433 224
503 3300005441 Ga0070700_100001274 Ga0070700_1000012749 224
504 3300005444 Ga0070694_100000381 Ga0070694_1000003819 224
505 3300005444 Ga0070694_100149359 Ga0070694_1001493592 224
506 3300005445 Ga0070708_100001824 Ga0070708_1000018246 224
507 3300005467 Ga0070706_100001194 Ga0070706_1000011946 224
508 3300005467 Ga0070706_100033745 Ga0070706_1000337454 224
509 3300005467 Ga0070706_100105036 Ga0070706_1001050364 224
510 3300005468 Ga0070707_100013363 Ga0070707_1000133637 224
511 3300005468 Ga0070707_100075469 Ga0070707_1000754694 224
512 3300005471 Ga0070698_100001546 Ga0070698_10000154611 224
513 3300005471 Ga0070698_100004183 Ga0070698_1000041836 224
514 3300005471 Ga0070698_100646494 Ga0070698_1006464941 224
515 3300005518 Ga0070699_100002585 Ga0070699_1000025856 224
516 3300005518 Ga0070699_100012111 Ga0070699_1000121117 224
517 3300005518 Ga0070699_100207321 Ga0070699_1002073212 224
518 3300005544 Ga0070686_100049338 Ga0070686_1000493383 224
519 3300005545 Ga0070695_100085925 Ga0070695_1000859252 224
520 3300005547 Ga0070693_100462596 Ga0070693_1004625961 224
521 3300005549 Ga0070704_100068744 Ga0070704_1000687442 224
522 3300005549 Ga0070704_100307522 Ga0070704_1003075222 224
523 3300005564 Ga0070664_100040159 Ga0070664_1000401594 224
524 3300005719 Ga0068861_100012344 Ga0068861_1000123441 224
525 3300005843 Ga0068860_100163022 Ga0068860_1001630222 224
526 3300005843 Ga0068860_100385440 Ga0068860_1003854401 224
527 3300005844 Ga0068862_100028889 Ga0068862_1000288893 224
528 3300006163 Ga0070715_10000025 Ga0070715_1000002551 224
529 3300006173 Ga0070716_100000003 Ga0070716_1000000032 224
530 3300006844 Ga0075428_100110226 Ga0075428_1001102263 224
531 3300006914 Ga0075436_100163663 Ga0075436_1001636632 224
532 3300009094 Ga0111539_10008376 Ga0111539_100083763 224
533 3300009147 Ga0114129_11596250 Ga0114129_115962501 224
534 3300009148 Ga0105243_10000037 Ga0105243_10000037118 224
535 3300009148 Ga0105243_10000204 Ga0105243_1000020449 224
536 3300009148 Ga0105243_10090209 Ga0105243_100902094 224
537 3300009148 Ga0105243_10386898 Ga0105243_103868982 224
538 3300009176 Ga0105242_10000039 Ga0105242_1000003934 224
539 3300009176 Ga0105242_10049263 Ga0105242_100492633 224
540 3300009176 Ga0105242_10113764 Ga0105242_101137642 224
541 3300009176 Ga0105242_10393315 Ga0105242_103933151 224
542 3300010375 Ga0105239_10008035 Ga0105239_1000803510 224
543 3300013297 Ga0157378_10000004 Ga0157378_1000000485 224
544 3300013297 Ga0157378_10040940 Ga0157378_100409402 224
545 3300013297 Ga0157378_10050341 Ga0157378_100503412 224
546 3300013297 Ga0157378_10059323 Ga0157378_100593231 224
547 3300013306 Ga0163162_10004637 Ga0163162_1000463711 224
548 3300013306 Ga0163162_10004905 Ga0163162_1000490510 224
549 3300013308 Ga0157375_10458945 Ga0157375_104589452 224
550 3300017792 Ga0163161_10008512 Ga0163161_100085123 224
551 3300017792 Ga0163161_10228678 Ga0163161_102286781 224
552 3300025885 Ga0207653_10000054 Ga0207653_1000005459 224
553 3300025905 Ga0207685_10000008 Ga0207685_1000000896 224
554 3300025910 Ga0207684_10005647 Ga0207684_100056476 224
555 3300025910 Ga0207684_10224388 Ga0207684_102243882 224
556 3300025918 Ga0207662_10084831 Ga0207662_100848312 224
557 3300025922 Ga0207646_10093594 Ga0207646_100935944 224
558 3300025922 Ga0207646_10099557 Ga0207646_100995572 224
559 3300025922 Ga0207646_10133474 Ga0207646_101334743 224
560 3300025934 Ga0207686_10000003 Ga0207686_10000003304 224
561 3300025934 Ga0207686_10000335 Ga0207686_1000033522 224
562 3300025935 Ga0207709_10000017 Ga0207709_10000017363 224
563 3300025939 Ga0207665_10000003 Ga0207665_10000003114 224
564 3300025942 Ga0207689_10001296 Ga0207689_1000129619 224
565 3300025945 Ga0207679_10228042 Ga0207679_102280422 224
566 3300025981 Ga0207640_10500297 Ga0207640_105002971 224
567 3300026023 Ga0207677_10026157 Ga0207677_100261573 224
568 3300026075 Ga0207708_10022759 Ga0207708_100227593 224
569 3300026095 Ga0207676_10137232 Ga0207676_101372322 224
570 3300026118 Ga0207675_100000644 Ga0207675_10000064417 224
571 3300027907 Ga0207428_10004277 Ga0207428_100042774 224
572 3300028380 Ga0268265_10036834 Ga0268265_100368345 224
573 3300028381 Ga0268264_10118211 Ga0268264_101182112 224
574 3300028381 Ga0268264_10195884 Ga0268264_101958841 224
575 3300031456 Ga0307513_10002024 Ga0307513_1000202410 224
576 3300031911 Ga0307412_10010567 Ga0307412_100105673 224
577 3300032005 Ga0307411_10058444 Ga0307411_100584443 224
578 3300038996 Ga0242420_009381 Ga0242420_009381_25_750 224
579 3300041406 Ga0439439_0030222 Ga0439439_0030222_329_1060 224
580 3300045051 Ga0451576_0022577 Ga0451576_0022577_920_1726 224
581 3300046535 Ga0495586_0315539 Ga0495586_0315539_99_848 224
582 3300046539 Ga0495621_0008981 Ga0495621_0008981_1476_2201 224
583 3300047320 Ga0495672_0010982 Ga0495672_0010982_1957_2805 224
584 3300048907 Ga0496104_0257003 Ga0496104_0257003_619_1329 224
585 3300048909 Ga0496106_0012526 Ga0496106_0012526_1272_2015 224
586 3300049521 Ga0501298_020225 Ga0501298_020225_434_1165 224
587 3300049661 Ga0501217_083351 Ga0501217_083351_112_843 224
588 3300049824 Ga0501045_0148477 Ga0501045_0148477_254_961 224
589 3300050508 nmdc:mga09592_10833_c1 nmdc:mga09592_10833_c1_806_1534 224
590 3300050511 nmdc:mga08y16_26147_c1 nmdc:mga08y16_26147_c1_3668_4396 224
591 3300050515 nmdc:mga0a205_476761_c1 nmdc:mga0a205_476761_c1_351_1076 224
592 3300005289 Ga0065704_10198323 Ga0065704_101983231 225
593 3300005295 Ga0065707_10004636 Ga0065707_100046365 225
594 3300005337 Ga0070682_100000284 Ga0070682_10000028416 225
595 3300005353 Ga0070669_100005821 Ga0070669_1000058214 225
596 3300005364 Ga0070673_100463603 Ga0070673_1004636031 225
597 3300005441 Ga0070700_100007401 Ga0070700_1000074014 225
598 3300005444 Ga0070694_100181115 Ga0070694_1001811152 225
599 3300005545 Ga0070695_100161560 Ga0070695_1001615602 225
600 3300005578 Ga0068854_100089363 Ga0068854_1000893632 225
601 3300005615 Ga0070702_100328650 Ga0070702_1003286502 225
602 3300005719 Ga0068861_100040685 Ga0068861_1000406853 225
603 3300005844 Ga0068862_100012345 Ga0068862_1000123453 225
604 3300006844 Ga0075428_100633942 Ga0075428_1006339421 225
605 3300009094 Ga0111539_10435197 Ga0111539_104351972 225
606 3300009147 Ga0114129_10003680 Ga0114129_1000368019 225
607 3300009147 Ga0114129_11011524 Ga0114129_110115242 225
608 3300013297 Ga0157378_10123891 Ga0157378_101238913 225
609 3300013306 Ga0163162_10138843 Ga0163162_101388432 225
610 3300014326 Ga0157380_10001690 Ga0157380_100016907 225
611 3300025923 Ga0207681_10045245 Ga0207681_100452453 225
612 3300026075 Ga0207708_10014089 Ga0207708_100140893 225
613 3300026118 Ga0207675_100077905 Ga0207675_1000779053 225
614 3300028380 Ga0268265_10097804 Ga0268265_100978043 225
615 3300037418 Ga0395900_0169841 Ga0395900_0169841_903_1649 225
616 3300037466 Ga0395898_0312877 Ga0395898_0312877_422_1168 225
617 3300037471 Ga0395905_0042665 Ga0395905_0042665_739_1485 225
618 3300046519 Ga0495632_0032708 Ga0495632_0032708_1230_2009 225
619 3300046525 Ga0495663_0000234 Ga0495663_0000234_11816_12550 225
620 3300046537 Ga0495598_0000507 Ga0495598_0000507_5596_6336 225
621 3300046539 Ga0495621_0003359 Ga0495621_0003359_490_1230 225
622 3300050507 nmdc:mga05p37_103735_c1 nmdc:mga05p37_103735_c1_2071_2802 225
623 3300050507 nmdc:mga05p37_1084577_c1 nmdc:mga05p37_1084577_c1_61_786 225
624 3300053153 Ga0500616_0001750 Ga0500616_0001750_18085_18843 225
625 3300005290 Ga0065712_10086831 Ga0065712_100868313 226
626 3300005293 Ga0065715_10108004 Ga0065715_101080042 226
627 3300005328 Ga0070676_10213757 Ga0070676_102137572 226
628 3300005330 Ga0070690_100072419 Ga0070690_1000724192 226
629 3300005343 Ga0070687_100231762 Ga0070687_1002317622 226
630 3300005345 Ga0070692_10302900 Ga0070692_103029001 226
631 3300005353 Ga0070669_100025634 Ga0070669_1000256343 226
632 3300005440 Ga0070705_100063752 Ga0070705_1000637522 226
633 3300005455 Ga0070663_100754065 Ga0070663_1007540651 226
634 3300005457 Ga0070662_100047380 Ga0070662_1000473804 226
635 3300005467 Ga0070706_100050601 Ga0070706_1000506014 226
636 3300005543 Ga0070672_100068745 Ga0070672_1000687453 226
637 3300005544 Ga0070686_100034421 Ga0070686_1000344212 226
638 3300005545 Ga0070695_100123105 Ga0070695_1001231052 226
639 3300005545 Ga0070695_100165618 Ga0070695_1001656181 226
640 3300005547 Ga0070693_100083444 Ga0070693_1000834443 226
641 3300005549 Ga0070704_100570460 Ga0070704_1005704601 226
642 3300005549 Ga0070704_101003467 Ga0070704_1010034671 226
643 3300005577 Ga0068857_100390208 Ga0068857_1003902081 226
644 3300005577 Ga0068857_100440075 Ga0068857_1004400752 226
645 3300005578 Ga0068854_100233886 Ga0068854_1002338862 226
646 3300005578 Ga0068854_100718289 Ga0068854_1007182892 226
647 3300005617 Ga0068859_100023193 Ga0068859_1000231932 226
648 3300005617 Ga0068859_100074674 Ga0068859_1000746742 226
649 3300005617 Ga0068859_100107305 Ga0068859_1001073052 226
650 3300005618 Ga0068864_101112043 Ga0068864_1011120431 226
651 3300005840 Ga0068870_10107713 Ga0068870_101077132 226
652 3300005841 Ga0068863_100035473 Ga0068863_1000354734 226
653 3300005842 Ga0068858_100334643 Ga0068858_1003346432 226
654 3300006931 Ga0097620_100023193 Ga0097620_1000231932 226
655 3300006931 Ga0097620_100074674 Ga0097620_1000746742 226
656 3300006931 Ga0097620_100107307 Ga0097620_1001073072 226
657 3300009094 Ga0111539_10013034 Ga0111539_100130342 226
658 3300009147 Ga0114129_10043769 Ga0114129_100437692 226
659 3300009177 Ga0105248_10819494 Ga0105248_108194942 226
660 3300013100 Ga0157373_10086494 Ga0157373_100864942 226
661 3300013297 Ga0157378_10274491 Ga0157378_102744913 226
662 3300013308 Ga0157375_10086991 Ga0157375_100869912 226
663 3300013308 Ga0157375_10108436 Ga0157375_101084362 226
664 3300014325 Ga0163163_10866048 Ga0163163_108660482 226
665 3300014326 Ga0157380_10003274 Ga0157380_100032749 226
666 3300025907 Ga0207645_10088308 Ga0207645_100883082 226
667 3300025910 Ga0207684_10162911 Ga0207684_101629112 226
668 3300025918 Ga0207662_10253584 Ga0207662_102535842 226
669 3300025938 Ga0207704_10135348 Ga0207704_101353482 226
670 3300025941 Ga0207711_10681183 Ga0207711_106811831 226
671 3300025981 Ga0207640_10617634 Ga0207640_106176342 226
672 3300026088 Ga0207641_10031507 Ga0207641_100315074 226
673 3300026089 Ga0207648_10263478 Ga0207648_102634782 226
674 3300026095 Ga0207676_10669992 Ga0207676_106699922 226
675 3300027907 Ga0207428_10064592 Ga0207428_100645922 226
676 3300028381 Ga0268264_10352692 Ga0268264_103526922 226
677 3300031901 Ga0307406_10077701 Ga0307406_100777013 226
678 3300048915 Ga0496112_0548513 Ga0496112_0548513_72_761 226
679 3300049592 Ga0501076_0344069 Ga0501076_0344069_422_1135 226
680 3300049663 Ga0501223_023595 Ga0501223_023595_334_1035 226
681 3300049669 Ga0501235_032528 Ga0501235_032528_73_774 226
682 3300049742 Ga0501080_0599246 Ga0501080_0599246_188_901 226
683 3300050511 nmdc:mga08y16_32947_c1 nmdc:mga08y16_32947_c1_1852_2562 226
684 3300060353 Ga0501082_0546651 Ga0501082_0546651_270_983 226
685 3300005293 Ga0065715_10174771 Ga0065715_101747712 227
686 3300005345 Ga0070692_10010986 Ga0070692_100109862 227
687 3300005441 Ga0070700_100009846 Ga0070700_1000098462 227
688 3300005539 Ga0068853_100122909 Ga0068853_1001229092 227
689 3300005545 Ga0070695_100013440 Ga0070695_1000134405 227
690 3300005615 Ga0070702_100002352 Ga0070702_1000023525 227
691 3300005617 Ga0068859_100685666 Ga0068859_1006856661 227
692 3300005842 Ga0068858_100197665 Ga0068858_1001976652 227
693 3300005843 Ga0068860_100040266 Ga0068860_1000402662 227
694 3300005983 Ga0081540_1048266 Ga0081540_10482663 227
695 3300006237 Ga0097621_100009417 Ga0097621_1000094176 227
696 3300006358 Ga0068871_100004716 Ga0068871_1000047169 227
697 3300006931 Ga0097620_100685740 Ga0097620_1006857401 227
698 3300009545 Ga0105237_10626472 Ga0105237_106264722 227
699 3300009551 Ga0105238_10004865 Ga0105238_1000486510 227
700 3300014325 Ga0163163_10079626 Ga0163163_100796262 227
701 3300014326 Ga0157380_10081338 Ga0157380_100813382 227
702 3300025904 Ga0207647_10005841 Ga0207647_100058418 227
703 3300025914 Ga0207671_10559773 Ga0207671_105597731 227
704 3300025924 Ga0207694_10041211 Ga0207694_100412112 227
705 3300025933 Ga0207706_10425431 Ga0207706_104254311 227
706 3300026035 Ga0207703_10345077 Ga0207703_103450771 227
707 3300026075 Ga0207708_10029922 Ga0207708_100299225 227
708 3300026116 Ga0207674_10574289 Ga0207674_105742891 227
709 3300026142 Ga0207698_10554158 Ga0207698_105541582 227
710 3300028381 Ga0268264_10045196 Ga0268264_100451962 227
711 3300000532 CNAas_1001118 CNAas_10011182 228
712 3300005331 Ga0070670_100346236 Ga0070670_1003462361 228
713 3300005334 Ga0068869_100002098 Ga0068869_1000020983 228
714 3300005334 Ga0068869_100410224 Ga0068869_1004102241 228
715 3300005353 Ga0070669_100001335 Ga0070669_1000013357 228
716 3300005444 Ga0070694_100016758 Ga0070694_1000167582 228
717 3300005471 Ga0070698_100009712 Ga0070698_1000097127 228
718 3300005471 Ga0070698_100013859 Ga0070698_1000138596 228
719 3300005536 Ga0070697_100000449 Ga0070697_1000004493 228
720 3300005549 Ga0070704_100374626 Ga0070704_1003746261 228
721 3300005718 Ga0068866_10013561 Ga0068866_100135615 228
722 3300006880 Ga0075429_100272927 Ga0075429_1002729272 228
723 3300009094 Ga0111539_10115063 Ga0111539_101150632 228
724 3300009147 Ga0114129_11204774 Ga0114129_112047741 228
725 3300011119 Ga0105246_10111651 Ga0105246_101116512 228
726 3300025922 Ga0207646_10486492 Ga0207646_104864921 228
727 3300025923 Ga0207681_10004226 Ga0207681_100042267 228
728 3300025942 Ga0207689_10033676 Ga0207689_100336762 228
729 3300026095 Ga0207676_10608062 Ga0207676_106080621 228
730 3300026116 Ga0207674_10064717 Ga0207674_100647172 228
731 3300050508 nmdc:mga09592_262479_c1 nmdc:mga09592_262479_c1_331_1050 228
732 3300050511 nmdc:mga08y16_118088_c1 nmdc:mga08y16_118088_c1_786_1505 228
733 3300005290 Ga0065712_10074944 Ga0065712_100749445 229
734 3300005330 Ga0070690_100005613 Ga0070690_1000056132 229
735 3300005331 Ga0070670_100715437 Ga0070670_1007154371 229
736 3300005334 Ga0068869_100007543 Ga0068869_1000075433 229
737 3300005335 Ga0070666_10017717 Ga0070666_100177172 229
738 3300005336 Ga0070680_100002436 Ga0070680_1000024365 229
739 3300005338 Ga0068868_100168430 Ga0068868_1001684302 229
740 3300005340 Ga0070689_100181243 Ga0070689_1001812432 229
741 3300005345 Ga0070692_10095853 Ga0070692_100958531 229
742 3300005347 Ga0070668_100888584 Ga0070668_1008885841 229
743 3300005354 Ga0070675_100032362 Ga0070675_1000323625 229
744 3300005355 Ga0070671_100006944 Ga0070671_1000069442 229
745 3300005355 Ga0070671_100040518 Ga0070671_1000405183 229
746 3300005355 Ga0070671_100077319 Ga0070671_1000773194 229
747 3300005364 Ga0070673_100551232 Ga0070673_1005512321 229
748 3300005365 Ga0070688_100054417 Ga0070688_1000544171 229
749 3300005438 Ga0070701_10048333 Ga0070701_100483332 229
750 3300005440 Ga0070705_100100463 Ga0070705_1001004632 229
751 3300005441 Ga0070700_100037286 Ga0070700_1000372862 229
752 3300005458 Ga0070681_10000359 Ga0070681_1000035913 229
753 3300005459 Ga0068867_100220419 Ga0068867_1002204192 229
754 3300005466 Ga0070685_10004591 Ga0070685_100045915 229
755 3300005467 Ga0070706_100262549 Ga0070706_1002625492 229
756 3300005471 Ga0070698_100572419 Ga0070698_1005724191 229
757 3300005530 Ga0070679_100000081 Ga0070679_10000008111 229
758 3300005536 Ga0070697_100145467 Ga0070697_1001454673 229
759 3300005536 Ga0070697_100444376 Ga0070697_1004443761 229
760 3300005544 Ga0070686_100025351 Ga0070686_1000253512 229
761 3300005545 Ga0070695_100249761 Ga0070695_1002497612 229
762 3300005546 Ga0070696_100401312 Ga0070696_1004013121 229
763 3300005547 Ga0070693_100434970 Ga0070693_1004349701 229
764 3300005548 Ga0070665_100031357 Ga0070665_1000313572 229
765 3300005563 Ga0068855_101199584 Ga0068855_1011995841 229
766 3300005564 Ga0070664_100061803 Ga0070664_1000618032 229
767 3300005577 Ga0068857_100237115 Ga0068857_1002371151 229
768 3300005578 Ga0068854_100423488 Ga0068854_1004234881 229
769 3300005615 Ga0070702_100008924 Ga0070702_1000089246 229
770 3300005615 Ga0070702_100387679 Ga0070702_1003876791 229
771 3300005617 Ga0068859_100030707 Ga0068859_1000307074 229
772 3300005617 Ga0068859_100047511 Ga0068859_1000475112 229
773 3300005617 Ga0068859_100056640 Ga0068859_1000566401 229
774 3300005618 Ga0068864_100188615 Ga0068864_1001886152 229
775 3300005618 Ga0068864_100292644 Ga0068864_1002926442 229
776 3300005618 Ga0068864_100440909 Ga0068864_1004409092 229
777 3300005840 Ga0068870_10017714 Ga0068870_100177142 229
778 3300005841 Ga0068863_100240461 Ga0068863_1002404612 229
779 3300005842 Ga0068858_100212180 Ga0068858_1002121802 229
780 3300005842 Ga0068858_100638313 Ga0068858_1006383132 229
781 3300005843 Ga0068860_100005783 Ga0068860_1000057839 229
782 3300005843 Ga0068860_100086324 Ga0068860_1000863242 229
783 3300005844 Ga0068862_100436533 Ga0068862_1004365332 229
784 3300006237 Ga0097621_100001671 Ga0097621_10000167110 229
785 3300006237 Ga0097621_100010818 Ga0097621_1000108184 229
786 3300006237 Ga0097621_100090837 Ga0097621_1000908372 229
787 3300006358 Ga0068871_100014711 Ga0068871_1000147116 229
788 3300006358 Ga0068871_100015543 Ga0068871_1000155432 229
789 3300006852 Ga0075433_10059541 Ga0075433_100595412 229
790 3300006852 Ga0075433_10213281 Ga0075433_102132811 229
791 3300006871 Ga0075434_100121144 Ga0075434_1001211443 229
792 3300006881 Ga0068865_100092515 Ga0068865_1000925153 229
793 3300006914 Ga0075436_100212302 Ga0075436_1002123022 229
794 3300006931 Ga0097620_100030704 Ga0097620_1000307042 229
795 3300006931 Ga0097620_100047511 Ga0097620_1000475115 229
796 3300006931 Ga0097620_100056636 Ga0097620_1000566361 229
797 3300009098 Ga0105245_10042109 Ga0105245_100421095 229
798 3300009147 Ga0114129_10678167 Ga0114129_106781671 229
799 3300009148 Ga0105243_10004015 Ga0105243_100040152 229
800 3300009174 Ga0105241_10045379 Ga0105241_100453791 229
801 3300009176 Ga0105242_10031279 Ga0105242_100312792 229
802 3300009177 Ga0105248_10018179 Ga0105248_100181793 229
803 3300009177 Ga0105248_10092776 Ga0105248_100927762 229
804 3300009551 Ga0105238_11213504 Ga0105238_112135041 229
805 3300009553 Ga0105249_10033549 Ga0105249_100335495 229
806 3300009553 Ga0105249_11277089 Ga0105249_112770891 229
807 3300011119 Ga0105246_10034007 Ga0105246_100340071 229
808 3300013296 Ga0157374_10032741 Ga0157374_100327412 229
809 3300013297 Ga0157378_10034561 Ga0157378_100345612 229
810 3300013297 Ga0157378_10866531 Ga0157378_108665312 229
811 3300013306 Ga0163162_10008699 Ga0163162_100086997 229
812 3300013306 Ga0163162_10026493 Ga0163162_100264932 229
813 3300013306 Ga0163162_10195976 Ga0163162_101959762 229
814 3300013307 Ga0157372_10323663 Ga0157372_103236632 229
815 3300013308 Ga0157375_10003507 Ga0157375_100035072 229
816 3300013308 Ga0157375_10026598 Ga0157375_100265985 229
817 3300013308 Ga0157375_10142684 Ga0157375_101426842 229
818 3300014325 Ga0163163_10017139 Ga0163163_100171394 229
819 3300014325 Ga0163163_10029220 Ga0163163_100292204 229
820 3300014325 Ga0163163_10047380 Ga0163163_100473802 229
821 3300014325 Ga0163163_10078964 Ga0163163_100789642 229
822 3300014326 Ga0157380_10104053 Ga0157380_101040533 229
823 3300014745 Ga0157377_10117189 Ga0157377_101171892 229
824 3300014969 Ga0157376_10013217 Ga0157376_100132174 229
825 3300014969 Ga0157376_10377773 Ga0157376_103777732 229
826 3300025315 Ga0207697_10009201 Ga0207697_100092012 229
827 3300025908 Ga0207643_10052870 Ga0207643_100528703 229
828 3300025910 Ga0207684_10298258 Ga0207684_102982582 229
829 3300025911 Ga0207654_10219987 Ga0207654_102199872 229
830 3300025912 Ga0207707_10000007 Ga0207707_1000000754 229
831 3300025913 Ga0207695_10727935 Ga0207695_107279352 229
832 3300025917 Ga0207660_10002775 Ga0207660_100027756 229
833 3300025921 Ga0207652_10000062 Ga0207652_1000006244 229
834 3300025925 Ga0207650_10466396 Ga0207650_104663961 229
835 3300025926 Ga0207659_10480080 Ga0207659_104800802 229
836 3300025927 Ga0207687_10137965 Ga0207687_101379652 229
837 3300025931 Ga0207644_10047254 Ga0207644_100472542 229
838 3300025935 Ga0207709_10128820 Ga0207709_101288201 229
839 3300025936 Ga0207670_10237944 Ga0207670_102379442 229
840 3300025941 Ga0207711_10039645 Ga0207711_100396452 229
841 3300025941 Ga0207711_10648343 Ga0207711_106483431 229
842 3300025942 Ga0207689_10009146 Ga0207689_100091462 229
843 3300025942 Ga0207689_10113322 Ga0207689_101133222 229
844 3300025942 Ga0207689_10166034 Ga0207689_101660343 229
845 3300025960 Ga0207651_10042437 Ga0207651_100424371 229
846 3300025961 Ga0207712_10134188 Ga0207712_101341882 229
847 3300025972 Ga0207668_10345369 Ga0207668_103453691 229
848 3300025986 Ga0207658_10254404 Ga0207658_102544042 229
849 3300026023 Ga0207677_10319567 Ga0207677_103195672 229
850 3300026035 Ga0207703_10017836 Ga0207703_100178364 229
851 3300026035 Ga0207703_10403198 Ga0207703_104031981 229
852 3300026075 Ga0207708_10064634 Ga0207708_100646344 229
853 3300026078 Ga0207702_10087038 Ga0207702_100870382 229
854 3300026088 Ga0207641_10048725 Ga0207641_100487254 229
855 3300026089 Ga0207648_10020391 Ga0207648_100203915 229
856 3300026095 Ga0207676_10004993 Ga0207676_100049934 229
857 3300026095 Ga0207676_10497776 Ga0207676_104977762 229
858 3300026118 Ga0207675_100009769 Ga0207675_1000097699 229
859 3300026121 Ga0207683_10154313 Ga0207683_101543132 229
860 3300028379 Ga0268266_10042839 Ga0268266_100428392 229
861 3300028381 Ga0268264_10006252 Ga0268264_100062525 229
862 3300036401 Ga0373937_0096287 Ga0373937_0096287_134_862 229
863 3300037471 Ga0395905_0198777 Ga0395905_0198777_826_1542 229
864 3300048905 Ga0496102_0020336 Ga0496102_0020336_282_1004 229
865 3300048911 Ga0496108_0069455 Ga0496108_0069455_2178_2894 229
866 3300048917 Ga0496114_0503001 Ga0496114_0503001_58_786 229
867 3300050507 nmdc:mga05p37_598000_c1 nmdc:mga05p37_598000_c1_43_789 229
868 3300050512 nmdc:mga0n895_16349_c1 nmdc:mga0n895_16349_c1_946_1662 229
869 3300050512 nmdc:mga0n895_189076_c1 nmdc:mga0n895_189076_c1_447_1172 229
870 3300050513 nmdc:mga0rr50_114418_c1 nmdc:mga0rr50_114418_c1_478_1194 229
871 3300050515 nmdc:mga0a205_18518_c1 nmdc:mga0a205_18518_c1_31_747 229
872 3300050515 nmdc:mga0a205_29986_c1 nmdc:mga0a205_29986_c1_1024_1749 229
873 3300005618 Ga0068864_100041807 Ga0068864_1000418072 230
874 3300006846 Ga0075430_100330055 Ga0075430_1003300552 230
875 3300006847 Ga0075431_100071249 Ga0075431_1000712495 230
876 3300006880 Ga0075429_100035844 Ga0075429_1000358442 230
877 3300013297 Ga0157378_10582276 Ga0157378_105822761 230
878 3300026116 Ga0207674_10027008 Ga0207674_100270083 230
879 3300048913 Ga0496110_0287134 Ga0496110_0287134_122_835 230
880 3300048914 Ga0496111_0309796 Ga0496111_0309796_122_835 230
881 3300050507 nmdc:mga05p37_71287_c1 nmdc:mga05p37_71287_c1_1655_2389 230
882 3300050508 nmdc:mga09592_74063_c1 nmdc:mga09592_74063_c1_2042_2776 230
883 2162886007 SwRhRL2b_contig_1681169 SwRhRL2b_0674.00006650 231
884 3300005289 Ga0065704_10012374 Ga0065704_100123742 231
885 3300005295 Ga0065707_10032723 Ga0065707_100327231 231
886 3300009094 Ga0111539_10002690 Ga0111539_100026909 231
887 3300009148 Ga0105243_10001165 Ga0105243_1000116518 231
888 3300025935 Ga0207709_10000786 Ga0207709_1000078622 231
889 3300027907 Ga0207428_10008185 Ga0207428_100081852 231
890 3300050511 nmdc:mga08y16_2206_c1 nmdc:mga08y16_2206_c1_13638_14333 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

40

116

0.99

PF02391

MoaE

MoaE protein

136

248

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ap8-assembly1.cif.gz_A crystal structure of human molybdopterin synthase catalytic subunit (mocs2b) 0.9816 95 221
2qie-assembly2.cif.gz_H staphylococcus aureus molybdopterin synthase in complex with precursor z 0.9579 97 229
2q5w-assembly1.cif.gz_E the x-ray crystal structure of molybdopterin synthase from staphylococcus aureus 0.9541 97 229
6jc0-assembly1.cif.gz_B structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.9535 96 230
2wp4-assembly1.cif.gz_A crystal structure of rv3119 from mycobacterium tuberculosis 0.9384 94 218
ID Description Score Start End Superfamily
5mpoC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9863 95 221 3.90.1170.40
af_P91500_195_340_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9762 95 228 3.90.1170.40
af_Q86HF4_1_145_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9694 94 229 3.90.1170.40
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9647 9 82 3.10.20.30
2qieK00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9544 97 229 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A2V9L0U3-F1-model_v4 Molybdenum cofactor biosynthesis protein MoaD 0.993 124 229 GO:0006777
AF-A0A0P6GA46-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) 0.9921 95 231 GO:0006777
GO:0030366
GO:1990140
AF-A0A0K8WI54-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) 0.9912 95 231 GO:0006777
GO:0030366
GO:1990140
AF-A0A026X236-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) 0.9905 95 231 GO:0006777
GO:0030366
GO:1990140
AF-A0A7M7G3R1-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (Molybdenum cofactor synthesis protein 2 large subunit) (Molybdenum cofactor synthesis protein 2B) (MOCS2B) 0.9893 94 231 GO:0006777
GO:0030366
GO:1990140

Feature Viewer

pLDDT pTM Quality
88.17 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map