F484799

General Info

Members Datasets Scaffolds Average Seq Length
889 462 856 153

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10338516|Ga0307515_103385162
Length 180
Sequence MNKKHPEPSATPTSPPKGVEQPGKASSAQEKTSFVYVTYIRSTPEKVFEAITRPEVARRYWGHENVSDWKPGSDWQHVRANEERTVNIVGKVVEAVPPTRLVITWASPSQAADPASYSRVAFDVEAYDDMVRLTVTHNELEAGSGMANGIQKGWPIVLSSLKSLLETGQGIDVFAKPKAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512875024 Mesorhizobium loti R88b Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
5 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
6 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
7 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
8 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
9 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
10 2738543013 Variovorax sp. BT01 Isolate Unclassified
11 2738543024 Aminobacter sp. AP02 Isolate Unclassified
12 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
13 2791355199
14 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
15 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
16 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
17 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
18 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
19 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
20 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
21 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
22 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
23 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
24 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
25 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
26 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
27 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
28 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
29 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
30 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
31 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
40 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
66 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
67 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
68 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
69 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
70 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
71 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
72 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
73 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
74 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
83 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
84 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
85 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
89 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
90 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
91 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
99 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
100 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
101 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
102 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
103 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
104 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
105 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
106 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
107 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
108 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
109 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
112 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
113 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
114 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
115 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
116 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
117 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
118 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
119 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
120 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
121 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
122 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
123 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
124 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
125 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
127 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
128 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
129 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
130 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
131 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
132 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
133 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
134 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
135 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
137 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
138 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
142 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
143 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
145 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
146 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
147 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
151 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
152 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
153 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
160 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
161 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
162 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
163 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
167 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
168 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
169 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
170 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
171 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
173 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
174 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
175 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
176 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
184 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
248 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
253 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
254 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
256 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
257 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
258 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
259 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
260 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
261 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
262 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
263 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
264 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
265 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
266 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
267 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
268 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
269 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
270 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
271 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
272 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
273 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
274 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
275 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
276 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
277 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
278 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
279 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
280 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
281 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
282 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
283 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
284 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
285 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
286 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
287 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
288 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
290 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
291 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
292 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
293 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
294 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
295 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
296 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
297 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
298 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
299 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
300 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
301 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
302 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
303 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
304 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
305 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
306 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
307 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
308 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
309 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
310 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
311 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
312 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
313 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
314 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
315 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
316 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
317 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
318 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
319 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
320 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
321 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
322 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
323 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
324 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
325 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
326 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
327 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
328 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
329 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
330 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
331 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
332 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
333 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
334 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
335 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
336 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
337 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
338 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
339 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
340 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
341 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
342 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
343 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
344 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
345 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
346 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
347 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
348 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
349 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
350 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
351 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
352 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
353 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
354 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
355 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
356 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
357 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
358 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
359 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
360 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
361 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
362 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
363 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
364 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
365 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
366 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
367 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
368 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
369 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
370 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
371 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
372 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
373 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
374 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
375 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
376 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
377 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
378 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
379 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
380 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
381 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
382 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
383 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
384 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
385 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
386 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
387 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
388 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
389 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
390 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
391 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
392 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
393 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
394 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
395 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
396 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
397 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
398 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
399 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
400 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
401 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
402 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
403 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
404 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
405 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
406 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
407 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
408 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
409 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
410 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
411 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
412 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
413 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
414 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
416 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
417 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
418 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
419 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
420 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
421 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
422 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
423 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
424 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
425 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
426 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
427 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
428 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
429 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
430 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
431 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
432 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
433 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
434 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
435 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
436 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
437 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
438 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
439 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
440 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
441 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
442 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
443 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
444 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
445 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
446 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
447 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
448 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
449 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
450 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
451 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
452 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
453 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
454 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
455 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
456 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
457 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
458 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
459 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
460 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
461 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
462 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.17
Metatranscriptomes 0.23
Isolates 3.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.81
Nodule 1.8
Rhizoplane 4.61
Rhizosphere 77.05
Stem 0
Stem Tuber 0
Unclassified 4.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1515736 2162886007 Bacteria 1477
2 JGI25159J45721_1021508 3300002987 Bacteria 1214
3 JGI25151J46595_10003752 3300003187 Bacteria 8249
4 JGI25153J46596_10001158 3300003215 Bacteria 15941
5 rootH1_10043371 3300003316 Bacteria 1440
6 rootH2_10121193 3300003320 Bacteria 6167
7 JGI25404J52841_10026573 3300003659 Bacteria 1245
8 Ga0055524_1000137 3300003775 Bacteria 87107
9 Ga0055534_1050564 3300003784 Bacteria 592
10 Ga0065165_1029138 3300005262 Bacteria 1773
11 Ga0065704_10140138 3300005289 Bacteria 1526
12 Ga0065707_10316564 3300005295 Bacteria 974
13 Ga0065707_10353841 3300005295 Bacteria 901
14 Ga0065707_10377784 3300005295 Bacteria 881
15 Ga0070658_10861092 3300005327 Bacteria 788
16 Ga0070676_10039829 3300005328 Bacteria 2719
17 Ga0070676_10536095 3300005328 Bacteria 836
18 Ga0070676_10879175 3300005328 Bacteria 666
19 Ga0070690_100035946 3300005330 Bacteria 3111
20 Ga0070690_100507090 3300005330 Bacteria 903
21 Ga0070670_100004124 3300005331 Bacteria 12144
22 Ga0070670_100087383 3300005331 Bacteria 2679
23 Ga0070670_100147753 3300005331 Bacteria 2034
24 Ga0070670_100557042 3300005331 Bacteria 1023
25 Ga0070670_100691180 3300005331 Bacteria 917
26 Ga0070670_101497051 3300005331 Bacteria 620
27 Ga0070677_10193196 3300005333 Bacteria 977
28 Ga0068869_100007638 3300005334 Bacteria 6923
29 Ga0068869_100011532 3300005334 Bacteria 5800
30 Ga0068869_100100004 3300005334 Bacteria 2192
31 Ga0068869_100108458 3300005334 Bacteria 2109
32 Ga0068869_101976401 3300005334 Bacteria 523
33 Ga0070666_10000334 3300005335 Bacteria 29652
34 Ga0070666_10169935 3300005335 Bacteria 1527
35 Ga0070666_10490529 3300005335 Bacteria 890
36 Ga0070680_100011020 3300005336 Bacteria 6989
37 Ga0070682_100006830 3300005337 Bacteria 6407
38 Ga0068868_100008484 3300005338 Bacteria 7356
39 Ga0068868_100049789 3300005338 Bacteria 3288
40 Ga0068868_100076000 3300005338 Bacteria 2685
41 Ga0070660_100052028 3300005339 Bacteria 3156
42 Ga0070689_100001229 3300005340 Bacteria 16275
43 Ga0070689_100028459 3300005340 Bacteria 4224
44 Ga0070691_10002807 3300005341 Bacteria 7775
45 Ga0070691_10014898 3300005341 Bacteria 3570
46 Ga0070691_10540913 3300005341 Unclassified 679
47 Ga0070687_100007347 3300005343 Bacteria 4587
48 Ga0070687_100071123 3300005343 Bacteria 1868
49 Ga0070661_100001029 3300005344 Bacteria 19751
50 Ga0070661_100381286 3300005344 Bacteria 1111
51 Ga0070661_100458095 3300005344 Bacteria 1015
52 Ga0070692_10021996 3300005345 Bacteria 3110
53 Ga0070692_10050097 3300005345 Bacteria 2168
54 Ga0070668_100101106 3300005347 Bacteria 2284
55 Ga0070668_100117982 3300005347 Bacteria 2118
56 Ga0070668_100637243 3300005347 Bacteria 935
57 Ga0070669_100101857 3300005353 Bacteria 2167
58 Ga0070669_101005627 3300005353 Bacteria 715
59 Ga0070675_100041361 3300005354 Bacteria 3765
60 Ga0070671_100017688 3300005355 Bacteria 5778
61 Ga0070673_100009931 3300005364 Bacteria 6415
62 Ga0070673_100015597 3300005364 Bacteria 5344
63 Ga0070688_100001653 3300005365 Bacteria 11155
64 Ga0070688_100256564 3300005365 Bacteria 1247
65 Ga0070659_100012395 3300005366 Bacteria 6323
66 Ga0070667_100652428 3300005367 Bacteria 972
67 Ga0070703_10001628 3300005406 Bacteria 6671
68 Ga0070703_10149018 3300005406 Bacteria 877
69 Ga0070709_10259021 3300005434 Bacteria 1256
70 Ga0070713_101398130 3300005436 Bacteria 679
71 Ga0070710_10225712 3300005437 Bacteria 1194
72 Ga0070701_10002577 3300005438 Bacteria 7025
73 Ga0070701_10011908 3300005438 Bacteria 3905
74 Ga0070711_100418326 3300005439 Bacteria 1091
75 Ga0070705_100001468 3300005440 Bacteria 12477
76 Ga0070705_100558158 3300005440 Bacteria 879
77 Ga0070700_100038106 3300005441 Bacteria 2928
78 Ga0070694_100009542 3300005444 Bacteria 5953
79 Ga0070694_100023909 3300005444 Bacteria 3937
80 Ga0070694_100095143 3300005444 Bacteria 2097
81 Ga0070708_100220898 3300005445 Bacteria 1777
82 Ga0070663_100011222 3300005455 Bacteria 5613
83 Ga0070663_100014671 3300005455 Bacteria 5035
84 Ga0070663_100202207 3300005455 Bacteria 1551
85 Ga0070663_100325044 3300005455 Bacteria 1238
86 Ga0070678_100005734 3300005456 Bacteria 7216
87 Ga0070678_101032419 3300005456 Bacteria 757
88 Ga0070662_100004392 3300005457 Bacteria 8912
89 Ga0070662_100042618 3300005457 Bacteria 3242
90 Ga0070681_10292809 3300005458 Bacteria 1538
91 Ga0068867_100009633 3300005459 Bacteria 6811
92 Ga0068867_100276687 3300005459 Bacteria 1375
93 Ga0068867_101121393 3300005459 Bacteria 719
94 Ga0070685_10002114 3300005466 Bacteria 10261
95 Ga0070685_10003699 3300005466 Bacteria 7743
96 Ga0070685_10612182 3300005466 Bacteria 785
97 Ga0070706_100765960 3300005467 Bacteria 894
98 Ga0070706_101677565 3300005467 Bacteria 579
99 Ga0070698_100000332 3300005471 Bacteria 48527
100 Ga0070699_100222618 3300005518 Bacteria 1682
101 Ga0070699_102156121 3300005518 Bacteria 509
102 Ga0070679_100017350 3300005530 Bacteria 6969
103 Ga0070697_100652663 3300005536 Bacteria 927
104 Ga0068853_100010770 3300005539 Bacteria 7407
105 Ga0068853_100070079 3300005539 Bacteria 3051
106 Ga0068853_100170174 3300005539 Bacteria 1971
107 Ga0068853_102034546 3300005539 Bacteria 557
108 Ga0070672_100000535 3300005543 Bacteria 22337
109 Ga0070686_100001557 3300005544 Bacteria 12882
110 Ga0070695_100002056 3300005545 Bacteria 11510
111 Ga0070696_100002711 3300005546 Bacteria 11749
112 Ga0070693_100000154 3300005547 Bacteria 31511
113 Ga0070665_100002080 3300005548 Bacteria 22457
114 Ga0070665_100031156 3300005548 Bacteria 5368
115 Ga0070665_100171687 3300005548 Bacteria 2169
116 Ga0070665_101732989 3300005548 Bacteria 632
117 Ga0070704_100004467 3300005549 Bacteria 8078
118 Ga0070704_100055291 3300005549 Bacteria 2813
119 Ga0070704_101465364 3300005549 Bacteria 627
120 Ga0068855_100025696 3300005563 Bacteria 7043
121 Ga0068855_100042076 3300005563 Bacteria 5413
122 Ga0068855_100643912 3300005563 Bacteria 1139
123 Ga0070664_100134904 3300005564 Bacteria 2170
124 Ga0070664_100711813 3300005564 Bacteria 936
125 Ga0070664_101727368 3300005564 Bacteria 593
126 Ga0068857_100165253 3300005577 Bacteria 2010
127 Ga0068854_100055986 3300005578 Bacteria 2841
128 Ga0068854_100289637 3300005578 Bacteria 1321
129 Ga0068854_100823551 3300005578 Bacteria 811
130 Ga0068856_100082746 3300005614 Bacteria 3186
131 Ga0068856_100168664 3300005614 Bacteria 2200
132 Ga0068856_100355589 3300005614 Bacteria 1483
133 Ga0068856_100375329 3300005614 Bacteria 1441
134 Ga0070702_100000735 3300005615 Bacteria 12415
135 Ga0070702_100628446 3300005615 Bacteria 809
136 Ga0068852_100006324 3300005616 Bacteria 8544
137 Ga0068852_100040808 3300005616 Bacteria 3918
138 Ga0068852_100230335 3300005616 Bacteria 1766
139 Ga0068852_100672713 3300005616 Bacteria 1044
140 Ga0068859_100007318 3300005617 Bacteria 11194
141 Ga0068859_100059562 3300005617 Bacteria 3847
142 Ga0068859_102794065 3300005617 Bacteria 536
143 Ga0068864_100033819 3300005618 Bacteria 4346
144 Ga0068864_100035855 3300005618 Bacteria 4224
145 Ga0068864_100240958 3300005618 Bacteria 1676
146 Ga0068866_10011784 3300005718 Bacteria 3793
147 Ga0068866_10832658 3300005718 Bacteria 644
148 Ga0068866_10982131 3300005718 Bacteria 599
149 Ga0068861_100007761 3300005719 Bacteria 7371
150 Ga0068861_100015603 3300005719 Bacteria 5358
151 Ga0068861_100060602 3300005719 Bacteria 2901
152 Ga0068861_100616611 3300005719 Bacteria 998
153 Ga0068861_100753878 3300005719 Bacteria 910
154 Ga0068851_10003102 3300005834 Bacteria 7359
155 Ga0068851_10086087 3300005834 Bacteria 1648
156 Ga0068870_10071101 3300005840 Bacteria 1898
157 Ga0068863_100073454 3300005841 Bacteria 3235
158 Ga0068863_100146383 3300005841 Bacteria 2259
159 Ga0068863_100228353 3300005841 Bacteria 1795
160 Ga0068858_100000756 3300005842 Bacteria 33914
161 Ga0068858_100003657 3300005842 Bacteria 15222
162 Ga0068858_100217629 3300005842 Bacteria 1808
163 Ga0068858_100291441 3300005842 Bacteria 1556
164 Ga0068860_100044984 3300005843 Bacteria 4208
165 Ga0068860_100059465 3300005843 Bacteria 3633
166 Ga0068860_100063051 3300005843 Bacteria 3521
167 Ga0068860_100134028 3300005843 Bacteria 2378
168 Ga0068862_100011814 3300005844 Bacteria 7212
169 Ga0068862_100305414 3300005844 Bacteria 1465
170 Ga0068862_100432315 3300005844 Bacteria 1237
171 Ga0068862_101199244 3300005844 Bacteria 757
172 Ga0081455_10003737 3300005937 Bacteria 17391
173 Ga0081455_10074169 3300005937 Bacteria 2811
174 Ga0081538_10037787 3300005981 Bacteria 3124
175 Ga0081540_1006094 3300005983 Bacteria 8860
176 Ga0081540_1017056 3300005983 Bacteria 4514
177 Ga0081540_1030764 3300005983 Bacteria 2967
178 Ga0070717_10522973 3300006028 Bacteria 1073
179 Ga0075365_10008443 3300006038 Bacteria 5849
180 Ga0075365_10202781 3300006038 Bacteria 1390
181 Ga0075368_10110641 3300006042 Bacteria 1132
182 Ga0075363_100000455 3300006048 Bacteria 12847
183 Ga0075363_100060704 3300006048 Bacteria 2036
184 Ga0075363_100079633 3300006048 Bacteria 1790
185 Ga0075363_100326450 3300006048 Bacteria 893
186 Ga0075364_10087364 3300006051 Bacteria 2066
187 Ga0075364_10398619 3300006051 Bacteria 939
188 Ga0075364_10494718 3300006051 Bacteria 836
189 Ga0070715_10067289 3300006163 Bacteria 1590
190 Ga0070715_10118611 3300006163 Unclassified 1258
191 Ga0070712_100241719 3300006175 Bacteria 1438
192 Ga0075362_10003653 3300006177 Bacteria 5423
193 Ga0075362_10045697 3300006177 Bacteria 1945
194 Ga0075362_10135936 3300006177 Bacteria 1172
195 Ga0075367_10010124 3300006178 Bacteria 4944
196 Ga0075367_10141495 3300006178 Bacteria 1490
197 Ga0075367_10224715 3300006178 Bacteria 1175
198 Ga0075367_10242518 3300006178 Bacteria 1129
199 Ga0075367_10990864 3300006178 Bacteria 537
200 Ga0075369_10012436 3300006186 Bacteria 3363
201 Ga0075369_10127358 3300006186 Bacteria 1155
202 Ga0075366_10008197 3300006195 Bacteria 5796
203 Ga0075366_10014177 3300006195 Bacteria 4550
204 Ga0075366_10205783 3300006195 Bacteria 1197
205 Ga0075366_10259606 3300006195 Bacteria 1060
206 Ga0075366_10395482 3300006195 Bacteria 850
207 Ga0097621_100002904 3300006237 Bacteria 11770
208 Ga0097621_100059011 3300006237 Bacteria 3140
209 Ga0097621_100088621 3300006237 Bacteria 2586
210 Ga0097621_100901204 3300006237 Bacteria 824
211 Ga0097621_101001081 3300006237 Bacteria 782
212 Ga0075370_10005629 3300006353 Bacteria 6251
213 Ga0075370_10075093 3300006353 Bacteria 1938
214 Ga0075370_10286135 3300006353 Bacteria 979
215 Ga0075370_10489794 3300006353 Bacteria 741
216 Ga0075370_10576002 3300006353 Bacteria 681
217 Ga0068871_100014807 3300006358 Bacteria 5823
218 Ga0068871_100581905 3300006358 Bacteria 1016
219 Ga0068871_101370700 3300006358 Bacteria 666
220 Ga0075428_100470496 3300006844 Bacteria 1345
221 Ga0075430_100961025 3300006846 Bacteria 704
222 Ga0075431_100501602 3300006847 Bacteria 1205
223 Ga0075433_10024317 3300006852 Bacteria 5110
224 Ga0075433_10488130 3300006852 Bacteria 1085
225 Ga0075434_100000268 3300006871 Bacteria 37082
226 Ga0075434_100144196 3300006871 Bacteria 2402
227 Ga0075434_100522103 3300006871 Bacteria 1208
228 Ga0075429_100202806 3300006880 Bacteria 1738
229 Ga0075429_101506537 3300006880 Unclassified 585
230 Ga0068865_100042182 3300006881 Bacteria 3110
231 Ga0068865_100490731 3300006881 Bacteria 1022
232 Ga0068865_100759089 3300006881 Bacteria 834
233 Ga0097620_100007318 3300006931 Bacteria 11194
234 Ga0097620_100059562 3300006931 Bacteria 3847
235 Ga0097620_102793466 3300006931 Bacteria 536
236 Ga0075435_100019709 3300007076 Bacteria 5156
237 Ga0075435_100197793 3300007076 Bacteria 1703
238 Ga0075435_100221421 3300007076 Bacteria 1607
239 Ga0075435_101567756 3300007076 Bacteria 578
240 Ga0105251_10318812 3300009011 Bacteria 706
241 Ga0105244_10102018 3300009036 Bacteria 1403
242 Ga0105240_10001365 3300009093 Bacteria 41929
243 Ga0105240_10001750 3300009093 Bacteria 36686
244 Ga0105240_10137221 3300009093 Bacteria 2928
245 Ga0105240_10938822 3300009093 Bacteria 929
246 Ga0111539_10095595 3300009094 Bacteria 3490
247 Ga0111539_10105416 3300009094 Bacteria 3307
248 Ga0111539_10404302 3300009094 Bacteria 1590
249 Ga0111539_11734348 3300009094 Bacteria 724
250 Ga0111539_12099748 3300009094 Bacteria 655
251 Ga0111539_12478649 3300009094 Bacteria 602
252 Ga0105245_10055110 3300009098 Bacteria 3570
253 Ga0105245_10153904 3300009098 Bacteria 2176
254 Ga0105245_10244437 3300009098 Bacteria 1741
255 Ga0105245_10500778 3300009098 Bacteria 1231
256 Ga0105245_10582627 3300009098 Bacteria 1143
257 Ga0105247_10151404 3300009101 Bacteria 1529
258 Ga0114129_10194241 3300009147 Bacteria 2754
259 Ga0114129_10781676 3300009147 Bacteria 1220
260 Ga0105243_10003084 3300009148 Bacteria 13721
261 Ga0105243_10162546 3300009148 Bacteria 1927
262 Ga0105243_10447539 3300009148 Bacteria 1211
263 Ga0105243_10565717 3300009148 Bacteria 1089
264 Ga0105243_10907788 3300009148 Bacteria 877
265 Ga0105243_11097085 3300009148 Bacteria 804
266 Ga0105241_10027594 3300009174 Bacteria 4228
267 Ga0105241_10078094 3300009174 Bacteria 2586
268 Ga0105241_10419789 3300009174 Bacteria 1177
269 Ga0105242_10053170 3300009176 Bacteria 3306
270 Ga0105242_10990553 3300009176 Bacteria 847
271 Ga0105248_10000352 3300009177 Bacteria 53816
272 Ga0105248_10061335 3300009177 Bacteria 4222
273 Ga0105248_10356690 3300009177 Bacteria 1646
274 Ga0105248_10399875 3300009177 Bacteria 1547
275 Ga0105248_12448166 3300009177 Bacteria 595
276 Ga0105237_10002406 3300009545 Bacteria 23232
277 Ga0105237_10137513 3300009545 Bacteria 2437
278 Ga0105237_10161891 3300009545 Bacteria 2236
279 Ga0105237_10207704 3300009545 Bacteria 1958
280 Ga0105237_10344713 3300009545 Bacteria 1494
281 Ga0105237_10458474 3300009545 Bacteria 1281
282 Ga0105238_10005159 3300009551 Bacteria 12913
283 Ga0105238_10015404 3300009551 Bacteria 7737
284 Ga0105249_10004799 3300009553 Bacteria 11670
285 Ga0105249_10005381 3300009553 Bacteria 11047
286 Ga0105249_11756889 3300009553 Bacteria 693
287 Ga0105239_10003462 3300010375 Bacteria 19314
288 Ga0105239_10060043 3300010375 Bacteria 4173
289 Ga0105239_10290002 3300010375 Bacteria 1843
290 Ga0105239_10339377 3300010375 Bacteria 1695
291 Ga0105239_10796167 3300010375 Bacteria 1083
292 Ga0105239_11050534 3300010375 Bacteria 937
293 Ga0105246_10423131 3300011119 Bacteria 1112
294 Ga0105246_10792331 3300011119 Bacteria 840
295 Ga0157344_1016619 3300012476 Bacteria 596
296 Ga0157369_10128044 3300013105 Bacteria 2691
297 Ga0157369_10248046 3300013105 Bacteria 1859
298 Ga0157374_10010141 3300013296 Bacteria 8092
299 Ga0157374_10040465 3300013296 Bacteria 4293
300 Ga0157374_10343849 3300013296 Bacteria 1481
301 Ga0157378_10017932 3300013297 Bacteria 6214
302 Ga0157378_12755335 3300013297 Bacteria 544
303 Ga0163162_10012590 3300013306 Bacteria 8261
304 Ga0163162_10077409 3300013306 Bacteria 3389
305 Ga0163162_10938433 3300013306 Bacteria 977
306 Ga0163162_11510754 3300013306 Bacteria 765
307 Ga0163162_11614292 3300013306 Bacteria 740
308 Ga0157372_10012358 3300013307 Bacteria 9098
309 Ga0157372_10199654 3300013307 Bacteria 2317
310 Ga0157372_10442654 3300013307 Bacteria 1515
311 Ga0157375_10025113 3300013308 Bacteria 5528
312 Ga0157375_10197154 3300013308 Bacteria 2169
313 Ga0157375_11550506 3300013308 Bacteria 783
314 Ga0163163_10575374 3300014325 Bacteria 1189
315 Ga0163163_12274217 3300014325 Unclassified 601
316 Ga0157380_10177063 3300014326 Bacteria 1870
317 Ga0182008_10002443 3300014497 Bacteria 11651
318 Ga0157377_10003140 3300014745 Bacteria 7441
319 Ga0157379_10012182 3300014968 Bacteria 7512
320 Ga0157379_10078488 3300014968 Bacteria 2957
321 Ga0157379_10316922 3300014968 Bacteria 1423
322 Ga0157379_10537474 3300014968 Bacteria 1086
323 Ga0157379_10713621 3300014968 Bacteria 942
324 Ga0157379_10716067 3300014968 Bacteria 940
325 Ga0157376_10010318 3300014969 Bacteria 6826
326 Ga0157376_10011188 3300014969 Bacteria 6603
327 Ga0157376_10014392 3300014969 Bacteria 5938
328 Ga0157376_10019400 3300014969 Bacteria 5240
329 Ga0157376_10362243 3300014969 Bacteria 1391
330 Ga0182006_1015371 3300015261 Bacteria 3282
331 Ga0182006_1032465 3300015261 Bacteria 2098
332 Ga0182007_10000248 3300015262 Bacteria 36273
333 Ga0182005_1060862 3300015265 Bacteria 1031
334 Ga0183362_10002 3300015683 Bacteria 1432711
335 Ga0163161_10023592 3300017792 Bacteria 4341
336 Ga0163161_10103072 3300017792 Bacteria 2126
337 Ga0163161_10130342 3300017792 Bacteria 1896
338 Ga0163161_10140371 3300017792 Bacteria 1829
339 Ga0163161_10456352 3300017792 Bacteria 1034
340 Ga0197907_11110502 3300020069 Bacteria 1147
341 Ga0213872_10098361 3300021361 Bacteria 1306
342 Ga0228598_1066106 3300024227 Bacteria 721
343 Ga0209129_1013505 3300025258 Bacteria 1795
344 Ga0209233_1000834 3300025261 Bacteria 13644
345 Ga0209565_1006958 3300025263 Bacteria 3106
346 Ga0209673_1032050 3300025273 Bacteria 1624
347 Ga0209130_1002478 3300025284 Bacteria 9198
348 Ga0209675_1001541 3300025291 Bacteria 13114
349 Ga0209675_1050220 3300025291 Bacteria 864
350 Ga0209676_1026211 3300025292 Bacteria 1855
351 Ga0209025_1000183 3300025294 Bacteria 155799
352 Ga0209025_1056343 3300025294 Bacteria 1512
353 Ga0209025_1063136 3300025294 Bacteria 1369
354 Ga0209564_1028907 3300025295 Bacteria 1758
355 Ga0209758_1000146 3300025297 Bacteria 169246
356 Ga0209050_1010058 3300025298 Bacteria 4724
357 Ga0209256_1000030 3300025299 Bacteria 414828
358 Ga0209051_1045816 3300025303 Bacteria 1509
359 Ga0209257_1015596 3300025304 Bacteria 3148
360 Ga0207697_10141647 3300025315 Bacteria 1043
361 Ga0207656_10001704 3300025321 Bacteria 7303
362 Ga0207656_10098113 3300025321 Bacteria 1340
363 Ga0207696_1063097 3300025711 Bacteria 1039
364 Ga0207653_10001915 3300025885 Bacteria 6658
365 Ga0207682_10151563 3300025893 Bacteria 1046
366 Ga0207642_10025520 3300025899 Bacteria 2392
367 Ga0207642_10042446 3300025899 Bacteria 1999
368 Ga0207710_10115502 3300025900 Bacteria 1278
369 Ga0207710_10291184 3300025900 Bacteria 823
370 Ga0207688_10013633 3300025901 Bacteria 4419
371 Ga0207688_10065787 3300025901 Bacteria 2049
372 Ga0207680_10000514 3300025903 Bacteria 18482
373 Ga0207680_10242256 3300025903 Bacteria 1243
374 Ga0207647_10000343 3300025904 Bacteria 37699
375 Ga0207647_10102521 3300025904 Bacteria 1697
376 Ga0207685_10020467 3300025905 Bacteria 2199
377 Ga0207685_10351298 3300025905 Unclassified 743
378 Ga0207645_10127703 3300025907 Bacteria 1653
379 Ga0207645_10304743 3300025907 Bacteria 1061
380 Ga0207645_10574841 3300025907 Bacteria 765
381 Ga0207643_10132907 3300025908 Bacteria 1482
382 Ga0207643_10575302 3300025908 Bacteria 724
383 Ga0207705_10126912 3300025909 Bacteria 1897
384 Ga0207654_10023245 3300025911 Bacteria 3318
385 Ga0207654_10046619 3300025911 Bacteria 2472
386 Ga0207654_10199287 3300025911 Bacteria 1317
387 Ga0207707_10225892 3300025912 Bacteria 1629
388 Ga0207695_10000014 3300025913 Bacteria 812599
389 Ga0207695_10002945 3300025913 Bacteria 24564
390 Ga0207695_10050167 3300025913 Bacteria 4393
391 Ga0207695_10334421 3300025913 Bacteria 1403
392 Ga0207671_10012055 3300025914 Bacteria 6984
393 Ga0207671_10019307 3300025914 Bacteria 5213
394 Ga0207671_10112050 3300025914 Bacteria 2077
395 Ga0207671_10122883 3300025914 Bacteria 1985
396 Ga0207693_10200331 3300025915 Bacteria 1570
397 Ga0207663_10531075 3300025916 Bacteria 917
398 Ga0207662_10002400 3300025918 Bacteria 9397
399 Ga0207662_10006313 3300025918 Bacteria 6387
400 Ga0207657_10061175 3300025919 Bacteria 3230
401 Ga0207649_10000037 3300025920 Bacteria 131159
402 Ga0207649_10018425 3300025920 Bacteria 3971
403 Ga0207649_10047013 3300025920 Bacteria 2654
404 Ga0207649_10660470 3300025920 Bacteria 808
405 Ga0207646_10198791 3300025922 Bacteria 1810
406 Ga0207646_10368091 3300025922 Bacteria 1299
407 Ga0207694_10001692 3300025924 Bacteria 18479
408 Ga0207694_10002417 3300025924 Bacteria 15274
409 Ga0207694_10006199 3300025924 Bacteria 9130
410 Ga0207694_10375558 3300025924 Bacteria 1179
411 Ga0207650_10009560 3300025925 Bacteria 6629
412 Ga0207650_10134352 3300025925 Bacteria 1939
413 Ga0207650_10304619 3300025925 Bacteria 1302
414 Ga0207650_10360867 3300025925 Bacteria 1197
415 Ga0207650_10496649 3300025925 Bacteria 1019
416 Ga0207659_10003322 3300025926 Bacteria 9640
417 Ga0207659_10231911 3300025926 Bacteria 1489
418 Ga0207659_10611412 3300025926 Bacteria 930
419 Ga0207687_10005772 3300025927 Bacteria 8192
420 Ga0207687_10010087 3300025927 Bacteria 6178
421 Ga0207687_10073584 3300025927 Bacteria 2446
422 Ga0207687_10087223 3300025927 Bacteria 2267
423 Ga0207700_10420148 3300025928 Bacteria 1174
424 Ga0207644_10026728 3300025931 Bacteria 3981
425 Ga0207644_10038506 3300025931 Bacteria 3369
426 Ga0207690_10085940 3300025932 Bacteria 2209
427 Ga0207706_10004142 3300025933 Bacteria 13672
428 Ga0207706_10085844 3300025933 Bacteria 2767
429 Ga0207686_10005427 3300025934 Bacteria 6842
430 Ga0207686_10211192 3300025934 Bacteria 1395
431 Ga0207709_10001965 3300025935 Bacteria 13429
432 Ga0207709_10110682 3300025935 Bacteria 1836
433 Ga0207709_10198219 3300025935 Bacteria 1432
434 Ga0207709_10257228 3300025935 Bacteria 1278
435 Ga0207709_10576392 3300025935 Bacteria 888
436 Ga0207670_10103945 3300025936 Bacteria 2033
437 Ga0207670_10600520 3300025936 Bacteria 904
438 Ga0207670_11273334 3300025936 Bacteria 623
439 Ga0207669_10221230 3300025937 Bacteria 1390
440 Ga0207669_10258611 3300025937 Bacteria 1301
441 Ga0207704_10002727 3300025938 Bacteria 7961
442 Ga0207691_10446324 3300025940 Bacteria 1101
443 Ga0207711_10000928 3300025941 Bacteria 28240
444 Ga0207711_10073901 3300025941 Bacteria 2964
445 Ga0207711_10485257 3300025941 Bacteria 1151
446 Ga0207711_11196663 3300025941 Bacteria 701
447 Ga0207689_10002939 3300025942 Bacteria 15741
448 Ga0207689_10014348 3300025942 Bacteria 6741
449 Ga0207689_10035623 3300025942 Bacteria 4133
450 Ga0207679_10049414 3300025945 Bacteria 3068
451 Ga0207679_10374574 3300025945 Bacteria 1247
452 Ga0207667_10017288 3300025949 Bacteria 8123
453 Ga0207667_10163814 3300025949 Bacteria 2286
454 Ga0207667_10191956 3300025949 Bacteria 2096
455 Ga0207667_10525803 3300025949 Bacteria 1198
456 Ga0207651_10020681 3300025960 Bacteria 3979
457 Ga0207651_10064267 3300025960 Bacteria 2567
458 Ga0207712_10001310 3300025961 Bacteria 17057
459 Ga0207712_10003403 3300025961 Bacteria 10055
460 Ga0207712_10343103 3300025961 Bacteria 1239
461 Ga0207712_11029086 3300025961 Bacteria 731
462 Ga0207712_11565065 3300025961 Bacteria 591
463 Ga0207668_10073153 3300025972 Bacteria 2455
464 Ga0207668_10079616 3300025972 Bacteria 2371
465 Ga0207668_10314933 3300025972 Bacteria 1296
466 Ga0207668_10612526 3300025972 Bacteria 949
467 Ga0207640_10060009 3300025981 Bacteria 2512
468 Ga0207640_10143177 3300025981 Bacteria 1745
469 Ga0207640_10188242 3300025981 Bacteria 1554
470 Ga0207658_10006474 3300025986 Bacteria 7992
471 Ga0207658_10433451 3300025986 Bacteria 1161
472 Ga0207658_10655717 3300025986 Bacteria 946
473 Ga0207677_10003660 3300026023 Bacteria 8159
474 Ga0207677_10039752 3300026023 Bacteria 3095
475 Ga0207677_10061805 3300026023 Bacteria 2595
476 Ga0207703_10000809 3300026035 Bacteria 30827
477 Ga0207703_10027080 3300026035 Bacteria 4515
478 Ga0207703_10123860 3300026035 Bacteria 2223
479 Ga0207703_10386200 3300026035 Bacteria 1296
480 Ga0207639_10003037 3300026041 Bacteria 11300
481 Ga0207639_10056299 3300026041 Bacteria 3013
482 Ga0207639_10133417 3300026041 Bacteria 2059
483 Ga0207639_10143782 3300026041 Bacteria 1990
484 Ga0207639_11260974 3300026041 Bacteria 694
485 Ga0207678_10019586 3300026067 Bacteria 5948
486 Ga0207678_10035028 3300026067 Bacteria 4370
487 Ga0207678_10189322 3300026067 Bacteria 1758
488 Ga0207678_10200056 3300026067 Bacteria 1708
489 Ga0207678_10500377 3300026067 Bacteria 1059
490 Ga0207708_10000761 3300026075 Bacteria 24206
491 Ga0207708_10093621 3300026075 Bacteria 2319
492 Ga0207708_10112522 3300026075 Bacteria 2114
493 Ga0207702_10164430 3300026078 Bacteria 2029
494 Ga0207702_10185644 3300026078 Bacteria 1917
495 Ga0207641_10074603 3300026088 Bacteria 2926
496 Ga0207641_10124314 3300026088 Bacteria 2307
497 Ga0207641_10176091 3300026088 Bacteria 1956
498 Ga0207648_10006903 3300026089 Bacteria 11247
499 Ga0207648_10020283 3300026089 Bacteria 5989
500 Ga0207648_10054061 3300026089 Bacteria 3508
501 Ga0207648_10388115 3300026089 Bacteria 1263
502 Ga0207648_11085464 3300026089 Bacteria 750
503 Ga0207648_11186481 3300026089 Bacteria 717
504 Ga0207676_10009546 3300026095 Bacteria 6907
505 Ga0207676_10036609 3300026095 Bacteria 3735
506 Ga0207676_10183074 3300026095 Bacteria 1836
507 Ga0207675_100004533 3300026118 Bacteria 13400
508 Ga0207675_100069868 3300026118 Bacteria 3282
509 Ga0207675_100103318 3300026118 Bacteria 2685
510 Ga0207675_101334879 3300026118 Bacteria 738
511 Ga0207675_102250165 3300026118 Bacteria 560
512 Ga0207683_10021200 3300026121 Bacteria 5560
513 Ga0207683_11537410 3300026121 Bacteria 614
514 Ga0207698_10010939 3300026142 Bacteria 5861
515 Ga0207698_10059238 3300026142 Bacteria 2972
516 Ga0207698_10119779 3300026142 Bacteria 2225
517 Ga0207698_10248185 3300026142 Bacteria 1627
518 Ga0207698_10309415 3300026142 Bacteria 1475
519 Ga0207698_11042732 3300026142 Bacteria 829
520 Ga0209813_10134718 3300027866 Bacteria 872
521 Ga0207428_10028203 3300027907 Bacteria 4666
522 Ga0207428_10219789 3300027907 Bacteria 1424
523 Ga0268266_10000006 3300028379 Bacteria 1410021
524 Ga0268266_10008473 3300028379 Bacteria 9138
525 Ga0268266_10282193 3300028379 Bacteria 1544
526 Ga0268266_10850377 3300028379 Bacteria 882
527 Ga0268266_11013865 3300028379 Bacteria 803
528 Ga0268265_10127381 3300028380 Bacteria 2110
529 Ga0268265_10155113 3300028380 Bacteria 1936
530 Ga0268265_10169456 3300028380 Bacteria 1864
531 Ga0268264_10014865 3300028381 Bacteria 6393
532 Ga0268264_10140100 3300028381 Bacteria 2156
533 Ga0268264_10178257 3300028381 Bacteria 1928
534 Ga0268264_10514206 3300028381 Bacteria 1169
535 Ga0307517_10187960 3300028786 Bacteria 1318
536 Ga0307515_10084357 3300028794 Bacteria 4081
537 Ga0307515_10338516 3300028794 Bacteria 1158
538 Ga0265760_10121233 3300031090 Bacteria 840
539 Ga0265327_10240060 3300031251 Bacteria 810
540 Ga0307513_10037594 3300031456 Bacteria 5386
541 Ga0307513_10398454 3300031456 Bacteria 1111
542 Ga0307513_10961020 3300031456 Bacteria 563
543 Ga0307509_10224369 3300031507 Bacteria 1688
544 Ga0307408_100256560 3300031548 Bacteria 1445
545 Ga0307508_10415536 3300031616 Bacteria 937
546 Ga0307508_10683725 3300031616 Bacteria 634
547 Ga0307516_10353758 3300031730 Bacteria 1134
548 Ga0307516_10782661 3300031730 Bacteria 615
549 Ga0307412_10002067 3300031911 Bacteria 11137
550 Ga0307412_10751925 3300031911 Bacteria 842
551 Ga0307409_100686024 3300031995 Bacteria 1022
552 Ga0307416_100554192 3300032002 Bacteria 1223
553 Ga0307414_10015644 3300032004 Bacteria 4584
554 Ga0307414_10031431 3300032004 Bacteria 3482
555 Ga0307414_10062929 3300032004 Bacteria 2635
556 Ga0307414_10337673 3300032004 Bacteria 1288
557 Ga0307414_10350776 3300032004 Bacteria 1266
558 Ga0307414_10797192 3300032004 Bacteria 861
559 Ga0307507_10271211 3300033179 Bacteria 1072
560 Ga0307510_10055864 3300033180 Bacteria 4119
561 Ga0373948_0035731 3300034817 Bacteria 1021
562 Ga0373938_0043981 3300034957 Bacteria 1001
563 Ga0373938_0083114 3300034957 Bacteria 782
564 Ga0373926_0150119 3300035083 Unclassified 887
565 Ga0373929_0015780 3300035085 Bacteria 1473
566 Ga0373934_0111668 3300035086 Bacteria 1109
567 Ga0373940_0311132 3300035088 Bacteria 544
568 Ga0373949_0112229 3300035090 Bacteria 757
569 Ga0373951_0008700 3300035091 Bacteria 2288
570 Ga0373952_0123576 3300035092 Bacteria 704
571 Ga0373932_0006748 3300035112 Bacteria 2722
572 Ga0373932_0130089 3300035112 Bacteria 848
573 Ga0373939_0006074 3300035114 Bacteria 2900
574 Ga0373941_0067073 3300035115 Bacteria 1182
575 Ga0373956_0345455 3300035119 Bacteria 709
576 Ga0373942_0022164 3300035207 Bacteria 1609
577 Ga0373961_0356979 3300035241 Bacteria 552
578 Ga0373962_0195340 3300035242 Bacteria 683
579 Ga0373931_0009571 3300035691 Bacteria 4635
580 Ga0373931_0034502 3300035691 Bacteria 2626
581 Ga0373935_1171713 3300035692 Bacteria 573
582 Ga0373927_0693648 3300035695 Bacteria 673
583 Ga0373933_0172990 3300035724 Bacteria 1375
584 Ga0373933_0624264 3300035724 Bacteria 708
585 Ga0373937_0281918 3300036401 Unclassified 1569
586 Ga0373937_1338728 3300036401 Bacteria 664
587 Ga0373925_0075599 3300037068 Bacteria 2553
588 Ga0395905_0008017 3300037471 Bacteria 10435
589 Ga0395905_0919983 3300037471 Bacteria 778
590 Ga0395905_1142011 3300037471 Bacteria 682
591 Ga0436361_0293969 3300039447 Bacteria 1857
592 Ga0439436_0020251 3300041404 Bacteria 1981
593 Ga0439439_0081823 3300041406 Bacteria 874
594 Ga0439453_0023047 3300041408 Bacteria 1134
595 Ga0439466_0001152 3300041411 Bacteria 10285
596 Ga0439465_0023660 3300041413 Bacteria 1933
597 Ga0451800_1417645 3300041459 Bacteria 661
598 Ga0451807_2500867 3300041486 Bacteria 610
599 Ga0439431_0000492 3300041997 Bacteria 8361
600 Ga0439433_0000544 3300041999 Bacteria 7112
601 Ga0439442_009444 3300042002 Bacteria 1973
602 Ga0439445_0003464 3300042004 Bacteria 3538
603 Ga0439432_000899 3300042006 Bacteria 11161
604 Ga0439449_0001320 3300042007 Bacteria 9713
605 Ga0439452_001474 3300042010 Bacteria 9582
606 Ga0439457_127838 3300042014 Bacteria 603
607 Ga0439462_0010319 3300042015 Bacteria 2365
608 Ga0439462_0010713 3300042015 Bacteria 2326
609 Ga0450911_000674 3300042115 Bacteria 10220
610 Ga0450921_012501 3300042123 Bacteria 737
611 Ga0450923_033822 3300042125 Bacteria 1052
612 Ga0450899_020533 3300042135 Bacteria 771
613 Ga0439446_0008427 3300042156 Bacteria 2736
614 Ga0439434_0006793 3300042435 Bacteria 3343
615 Ga0451577_0636036 3300042876 Bacteria 968
616 Ga0466969_0057023 3300044656 Bacteria 1905
617 Ga0466961_0307626 3300044693 Bacteria 967
618 Ga0466964_0154252 3300044706 Bacteria 1068
619 Ga0453684_0253483 3300044712 Bacteria 2020
620 Ga0466968_0073615 3300044735 Bacteria 1491
621 Ga0466970_0024375 3300044765 Bacteria 3163
622 Ga0466957_0149423 3300044842 Bacteria 1510
623 Ga0466959_0094204 3300045049 Bacteria 2148
624 Ga0466959_0723687 3300045049 Bacteria 667
625 Ga0451576_0000756 3300045051 Bacteria 64364
626 Ga0451576_0063519 3300045051 Bacteria 3849
627 Ga0451576_0097489 3300045051 Bacteria 3057
628 Ga0451576_0179222 3300045051 Bacteria 2212
629 Ga0451576_0295841 3300045051 Bacteria 1692
630 Ga0451576_0599656 3300045051 Bacteria 1157
631 Ga0451576_0850506 3300045051 Bacteria 957
632 Ga0451576_1813450 3300045051 Bacteria 630
633 Ga0466958_0631066 3300045836 Bacteria 697
634 Ga0495617_105608 3300046452 Bacteria 913
635 Ga0495592_0288778 3300046454 Bacteria 1070
636 Ga0495603_0029113 3300046455 Bacteria 3331
637 Ga0495603_0201348 3300046455 Bacteria 1151
638 Ga0495629_0000008 3300046459 Bacteria 352138
639 Ga0495629_0057102 3300046459 Bacteria 2730
640 Ga0495638_0082463 3300046460 Bacteria 1950
641 Ga0495638_0204954 3300046460 Bacteria 1111
642 Ga0495653_0321950 3300046463 Unclassified 1002
643 Ga0495653_0542660 3300046463 Unclassified 720
644 Ga0495650_0099792 3300046471 Bacteria 1092
645 Ga0495582_0674775 3300046473 Bacteria 598
646 Ga0495664_0416636 3300046477 Bacteria 806
647 Ga0495584_0471175 3300046491 Bacteria 639
648 Ga0495584_0582862 3300046491 Bacteria 570
649 Ga0495585_0174459 3300046492 Bacteria 1108
650 Ga0495594_0119664 3300046499 Bacteria 1488
651 Ga0495607_0418186 3300046501 Bacteria 607
652 Ga0495606_0207598 3300046507 Bacteria 1112
653 Ga0495606_0276653 3300046507 Bacteria 920
654 Ga0495608_0003267 3300046511 Bacteria 11580
655 Ga0495608_0102807 3300046511 Bacteria 1842
656 Ga0495616_0032869 3300046513 Bacteria 2707
657 Ga0495620_0083564 3300046515 Bacteria 1289
658 Ga0495628_0554772 3300046516 Bacteria 824
659 Ga0495632_0058932 3300046519 Bacteria 1869
660 Ga0495632_0209603 3300046519 Bacteria 884
661 Ga0495637_0177352 3300046520 Bacteria 792
662 Ga0495643_0307107 3300046522 Bacteria 721
663 Ga0495643_0346058 3300046522 Bacteria 667
664 Ga0495663_0001336 3300046525 Bacteria 7791
665 Ga0495642_0045754 3300046528 Bacteria 1789
666 Ga0495640_0331961 3300046533 Unclassified 941
667 Ga0495586_0505439 3300046535 Bacteria 697
668 Ga0495587_0270497 3300046536 Bacteria 953
669 Ga0495598_0082289 3300046537 Bacteria 1035
670 Ga0495609_0171341 3300046538 Bacteria 916
671 Ga0495621_0126242 3300046539 Bacteria 992
672 Ga0495622_0053012 3300046557 Bacteria 1882
673 Ga0495622_0182991 3300046557 Bacteria 939
674 Ga0495633_0006199 3300046558 Bacteria 7143
675 Ga0495667_0036342 3300046559 Unclassified 3289
676 Ga0495656_0003280 3300046615 Bacteria 5457
677 Ga0495656_0104827 3300046615 Bacteria 1313
678 Ga0495656_0284002 3300046615 Bacteria 844
679 Ga0495668_0386557 3300046616 Bacteria 769
680 Ga0495611_0370529 3300046648 Bacteria 656
681 Ga0495625_0558563 3300046660 Bacteria 692
682 Ga0495635_0439183 3300046663 Bacteria 864
683 Ga0495659_0220730 3300046664 Bacteria 783
684 Ga0495659_0355867 3300046664 Bacteria 626
685 Ga0495588_0026527 3300046674 Bacteria 2893
686 Ga0495657_0129382 3300046675 Bacteria 1583
687 Ga0495657_0320263 3300046675 Bacteria 922
688 Ga0495657_0440519 3300046675 Bacteria 764
689 Ga0495599_0118626 3300046678 Bacteria 1645
690 Ga0495647_0134897 3300046681 Bacteria 1049
691 Ga0495658_0163611 3300046683 Bacteria 1374
692 Ga0495658_0761843 3300046683 Unclassified 620
693 Ga0495613_0590161 3300046689 Bacteria 740
694 Ga0495624_0171618 3300046690 Bacteria 1323
695 Ga0495624_0401892 3300046690 Bacteria 822
696 Ga0495624_0596835 3300046690 Bacteria 658
697 Ga0495670_0090661 3300046691 Bacteria 1564
698 Ga0495670_0233202 3300046691 Bacteria 979
699 Ga0495671_0104821 3300046692 Bacteria 1381
700 Ga0495649_0001665 3300046694 Bacteria 16510
701 Ga0495600_0449531 3300046809 Bacteria 797
702 Ga0495660_0058223 3300046810 Bacteria 2082
703 Ga0495660_0133190 3300046810 Bacteria 1245
704 Ga0495581_0688306 3300047315 Bacteria 590
705 Ga0495636_0246165 3300047318 Bacteria 826
706 Ga0495636_0607055 3300047318 Bacteria 535
707 Ga0495672_0104127 3300047320 Bacteria 1534
708 Ga0495676_0045195 3300047321 Bacteria 3587
709 Ga0495676_0099067 3300047321 Bacteria 2161
710 Ga0495680_0071991 3300047322 Unclassified 2630
711 Ga0495683_0189872 3300047323 Bacteria 933
712 Ga0495687_008648 3300047443 Bacteria 5799
713 Ga0495687_059520 3300047443 Bacteria 1579
714 Ga0495685_172500 3300047447 Bacteria 698
715 Ga0495681_0349180 3300047470 Bacteria 563
716 Ga0495684_0000691 3300047471 Bacteria 27167
717 Ga0495686_0000478 3300047472 Bacteria 59593
718 Ga0495686_0102336 3300047472 Bacteria 1726
719 Ga0495686_0102430 3300047472 Bacteria 1725
720 Ga0495686_0218347 3300047472 Bacteria 1086
721 Ga0495593_0443050 3300047673 Bacteria 650
722 Ga0495602_0590597 3300048088 Bacteria 765
723 Ga0495615_0001947 3300048090 Bacteria 3195
724 Ga0495615_0036958 3300048090 Bacteria 1201
725 Ga0495626_0068486 3300048091 Bacteria 1600
726 Ga0496100_0017819 3300048903 Bacteria 4201
727 Ga0496100_0050598 3300048903 Bacteria 2693
728 Ga0496101_0012043 3300048904 Bacteria 5762
729 Ga0496101_0012131 3300048904 Bacteria 5744
730 Ga0496102_0019066 3300048905 Bacteria 6038
731 Ga0496102_0101892 3300048905 Bacteria 2668
732 Ga0496102_0316653 3300048905 Bacteria 1470
733 Ga0496102_0573682 3300048905 Bacteria 1051
734 Ga0496103_0384545 3300048906 Bacteria 902
735 Ga0496104_0038566 3300048907 Bacteria 4471
736 Ga0496104_0375199 3300048907 Bacteria 1335
737 Ga0496105_0002707 3300048908 Bacteria 12922
738 Ga0496106_0054826 3300048909 Bacteria 3012
739 Ga0496106_0113752 3300048909 Bacteria 2110
740 Ga0496106_0204280 3300048909 Bacteria 1573
741 Ga0496106_0481811 3300048909 Bacteria 997
742 Ga0496107_0119804 3300048910 Bacteria 1938
743 Ga0496107_0267265 3300048910 Bacteria 1273
744 Ga0496108_0015709 3300048911 Bacteria 6176
745 Ga0496108_0042495 3300048911 Bacteria 3795
746 Ga0496108_0082179 3300048911 Bacteria 2731
747 Ga0496108_0220030 3300048911 Bacteria 1650
748 Ga0496108_0671352 3300048911 Bacteria 900
749 Ga0496109_0014190 3300048912 Bacteria 6929
750 Ga0496109_0057212 3300048912 Bacteria 3559
751 Ga0496109_0099704 3300048912 Bacteria 2694
752 Ga0496109_0435650 3300048912 Bacteria 1238
753 Ga0496110_0111462 3300048913 Bacteria 2459
754 Ga0496110_0330956 3300048913 Bacteria 1387
755 Ga0496110_0441118 3300048913 Bacteria 1187
756 Ga0496111_0027198 3300048914 Bacteria 4045
757 Ga0496111_0120729 3300048914 Bacteria 1936
758 Ga0496111_0126926 3300048914 Bacteria 1886
759 Ga0496112_0520490 3300048915 Bacteria 1124
760 Ga0496113_0143784 3300048916 Bacteria 1878
761 Ga0496114_0002742 3300048917 Bacteria 13470
762 Ga0496114_0068903 3300048917 Bacteria 2970
763 Ga0496114_0288187 3300048917 Bacteria 1448
764 Ga0496115_0029002 3300048918 Bacteria 4343
765 Ga0496116_0000370 3300048919 Bacteria 67584
766 Ga0496118_0017779 3300048921 Bacteria 6453
767 Ga0496118_0078896 3300048921 Bacteria 2327
768 Ga0496121_0004954 3300048924 Bacteria 17469
769 Ga0496121_0168228 3300048924 Bacteria 1595
770 Ga0496121_0318318 3300048924 Bacteria 1048
771 Ga0496122_0030764 3300048925 Bacteria 4487
772 Ga0496122_0505246 3300048925 Bacteria 586
773 Ga0496123_0023620 3300048926 Bacteria 4701
774 Ga0496124_0142044 3300048927 Bacteria 1893
775 Ga0496124_0183000 3300048927 Bacteria 1611
776 Ga0496124_0299631 3300048927 Bacteria 1162
777 Ga0496124_0304386 3300048927 Bacteria 1149
778 Ga0496125_0044534 3300048928 Bacteria 3751
779 Ga0496125_0079102 3300048928 Bacteria 2523
780 Ga0496126_0004800 3300048929 Bacteria 15883
781 Ga0496126_0014970 3300048929 Bacteria 7820
782 Ga0496126_0168632 3300048929 Bacteria 1867
783 Ga0496126_0336530 3300048929 Bacteria 1237
784 Ga0495678_058037 3300049459 Bacteria 1464
785 Ga0501046_0277044 3300049580 Bacteria 1229
786 Ga0501253_001678 3300049683 Bacteria 2323
787 Ga0501035_0033759 3300049822 Bacteria 4651
788 nmdc:mga03683_113908_c1 3300050489 Bacteria 1198
789 nmdc:mga03683_16375_c1 3300050489 Bacteria 2784
790 nmdc:mga03683_178440_c1 3300050489 Bacteria 968
791 nmdc:mga03683_73065_c1 3300050489 Bacteria 1470
792 nmdc:mga03n38_140710_c1 3300050490 Bacteria 1205
793 nmdc:mga00v17_160761_c1 3300050491 Bacteria 1446
794 nmdc:mga00v17_206551_c1 3300050491 Bacteria 1270
795 nmdc:mga0yw44_16659_c1 3300050492 Bacteria 3978
796 nmdc:mga0yw44_39719_c1 3300050492 Bacteria 2792
797 nmdc:mga0yw44_771708_c1 3300050492 Bacteria 653
798 nmdc:mga0k408_15743_c1 3300050493 Bacteria 4187
799 nmdc:mga0k408_215103_c1 3300050493 Bacteria 1148
800 nmdc:mga0k408_25116_c1 3300050493 Bacteria 3372
801 nmdc:mga0k408_285659_c1 3300050493 Bacteria 985
802 nmdc:mga0k408_371395_c1 3300050493 Bacteria 852
803 nmdc:mga0k408_43188_c1 3300050493 Bacteria 2597
804 nmdc:mga06z11_287434_c1 3300050494 Bacteria 975
805 nmdc:mga06z11_575805_c1 3300050494 Bacteria 684
806 nmdc:mga06z11_805013_c1 3300050494 Bacteria 573
807 nmdc:mga07m45_141082_c1 3300050496 Bacteria 1396
808 nmdc:mga07m45_38124_c1 3300050496 Bacteria 2682
809 nmdc:mga07m45_6048_c1 3300050496 Bacteria 6092
810 nmdc:mga07m45_72906_c1 3300050496 Bacteria 1955
811 nmdc:mga07m45_896_c1 3300050496 Bacteria 3108
812 nmdc:mga05p37_381692_c1 3300050507 Bacteria 1651
813 nmdc:mga09592_716109_c1 3300050508 Bacteria 851
814 nmdc:mga06r32_2023656_c1 3300050510 Bacteria 509
815 nmdc:mga08y16_211707_c1 3300050511 Bacteria 2008
816 nmdc:mga08y16_29543_c1 3300050511 Bacteria 5774
817 nmdc:mga08y16_305202_c1 3300050511 Bacteria 1640
818 nmdc:mga0n895_41470_c1 3300050512 Bacteria 4475
819 nmdc:mga0n895_802118_c1 3300050512 Bacteria 932
820 nmdc:mga0n895_83244_c1 3300050512 Bacteria 3191
821 nmdc:mga0rr50_1054745_c1 3300050513 Bacteria 692
822 nmdc:mga0rr50_267198_c1 3300050513 Bacteria 1425
823 nmdc:mga0rr50_330631_c1 3300050513 Bacteria 1279
824 nmdc:mga08x19_178555_c1 3300050514 Bacteria 1448
825 nmdc:mga08x19_283377_c1 3300050514 Bacteria 1148
826 nmdc:mga0a205_209579_c2 3300050515 Bacteria 1474
827 nmdc:mga0a205_26067_c1 3300050515 Bacteria 5570
828 nmdc:mga0sz30_18350_c1 3300050516 Bacteria 2799
829 Ga0495601_0366609 3300053077 Bacteria 936
830 Ga0500578_0060252 3300053086 Bacteria 2425
831 Ga0500644_0026432 3300053088 Bacteria 1796
832 Ga0500644_0048263 3300053088 Bacteria 1448
833 Ga0500646_0121039 3300053090 Bacteria 842
834 Ga0500646_0156192 3300053090 Bacteria 759
835 Ga0500557_070692 3300053105 Bacteria 1144
836 Ga0500562_004456 3300053108 Bacteria 3541
837 Ga0500595_009175 3300053119 Bacteria 4004
838 Ga0500621_215512 3300053126 Bacteria 669
839 Ga0500642_0001506 3300053130 Bacteria 6719
840 Ga0500655_072100 3300053133 Bacteria 705
841 Ga0500658_0006918 3300053134 Bacteria 4198
842 Ga0500568_0151235 3300053139 Bacteria 859
843 Ga0500577_0165746 3300053142 Bacteria 943
844 Ga0500588_0101422 3300053146 Bacteria 993
845 Ga0500603_189308 3300053150 Bacteria 650
846 Ga0500604_0144979 3300053151 Bacteria 804
847 Ga0500616_0249811 3300053153 Bacteria 758
848 Ga0500622_0000548 3300053156 Bacteria 34530
849 Ga0500627_0238885 3300053158 Bacteria 807
850 Ga0500627_0420783 3300053158 Bacteria 566
851 Ga0500633_0107593 3300053160 Bacteria 1031
852 Ga0500634_0240700 3300053161 Bacteria 760
853 Ga0500637_0266664 3300053178 Bacteria 949
854 Ga0500611_217242 3300053727 Bacteria 545
855 Ga0500656_005697 3300053732 Bacteria 1241
856 Ga0590075_098398 3300059424 Bacteria 761

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_10990553 Ga0105242_109905532 129
2 3300046683 Ga0495658_0761843 Ga0495658_0761843_59_460 133
3 3300046463 Ga0495653_0321950 Ga0495653_0321950_107_550 138
4 3300009177 Ga0105248_10399875 Ga0105248_103998753 140
5 3300035086 Ga0373934_0111668 Ga0373934_0111668_224_658 140
6 3300035112 Ga0373932_0130089 Ga0373932_0130089_245_676 140
7 3300035119 Ga0373956_0345455 Ga0373956_0345455_105_539 140
8 3300035692 Ga0373935_1171713 Ga0373935_1171713_55_489 140
9 3300036401 Ga0373937_0281918 Ga0373937_0281918_777_1211 140
10 3300045051 Ga0451576_1813450 Ga0451576_1813450_120_551 140
11 3300046533 Ga0495640_0331961 Ga0495640_0331961_110_544 140
12 3300046689 Ga0495613_0590161 Ga0495613_0590161_109_540 140
13 3300046809 Ga0495600_0449531 Ga0495600_0449531_177_611 140
14 3300047322 Ga0495680_0071991 Ga0495680_0071991_2156_2590 140
15 3300047673 Ga0495593_0443050 Ga0495593_0443050_140_574 140
16 3300050512 nmdc:mga0n895_41470_c1 nmdc:mga0n895_41470_c1_3643_4074 140
17 3300050513 nmdc:mga0rr50_267198_c1 nmdc:mga0rr50_267198_c1_836_1267 140
18 3300050514 nmdc:mga08x19_283377_c1 nmdc:mga08x19_283377_c1_126_557 140
19 3300046692 Ga0495671_0104821 Ga0495671_0104821_927_1361 142
20 3300053161 Ga0500634_0240700 Ga0500634_0240700_306_740 142
21 3300053153 Ga0500616_0249811 Ga0500616_0249811_295_735 144
22 3300007076 Ga0075435_100221421 Ga0075435_1002214212 146
23 3300050513 nmdc:mga0rr50_330631_c1 nmdc:mga0rr50_330631_c1_515_958 146
24 3300005295 Ga0065707_10353841 Ga0065707_103538412 147
25 3300005295 Ga0065707_10377784 Ga0065707_103777842 147
26 3300005330 Ga0070690_100035946 Ga0070690_1000359462 147
27 3300005334 Ga0068869_100007638 Ga0068869_1000076384 147
28 3300005336 Ga0070680_100011020 Ga0070680_1000110207 147
29 3300005337 Ga0070682_100006830 Ga0070682_1000068307 147
30 3300005338 Ga0068868_100008484 Ga0068868_1000084844 147
31 3300005340 Ga0070689_100001229 Ga0070689_10000122920 147
32 3300005341 Ga0070691_10002807 Ga0070691_100028077 147
33 3300005343 Ga0070687_100007347 Ga0070687_1000073475 147
34 3300005345 Ga0070692_10050097 Ga0070692_100500973 147
35 3300005364 Ga0070673_100015597 Ga0070673_1000155974 147
36 3300005406 Ga0070703_10001628 Ga0070703_100016285 147
37 3300005438 Ga0070701_10002577 Ga0070701_100025779 147
38 3300005440 Ga0070705_100001468 Ga0070705_1000014689 147
39 3300005441 Ga0070700_100038106 Ga0070700_1000381064 147
40 3300005444 Ga0070694_100009542 Ga0070694_1000095422 147
41 3300005445 Ga0070708_100220898 Ga0070708_1002208983 147
42 3300005458 Ga0070681_10292809 Ga0070681_102928092 147
43 3300005459 Ga0068867_100009633 Ga0068867_1000096337 147
44 3300005530 Ga0070679_100017350 Ga0070679_1000173507 147
45 3300005544 Ga0070686_100001557 Ga0070686_1000015579 147
46 3300005545 Ga0070695_100002056 Ga0070695_1000020567 147
47 3300005546 Ga0070696_100002711 Ga0070696_1000027116 147
48 3300005547 Ga0070693_100000154 Ga0070693_10000015438 147
49 3300005549 Ga0070704_100004467 Ga0070704_1000044678 147
50 3300005563 Ga0068855_100025696 Ga0068855_1000256968 147
51 3300005564 Ga0070664_101727368 Ga0070664_1017273682 147
52 3300005578 Ga0068854_100055986 Ga0068854_1000559865 147
53 3300005615 Ga0070702_100000735 Ga0070702_1000007357 147
54 3300005617 Ga0068859_100007318 Ga0068859_1000073186 147
55 3300005718 Ga0068866_10011784 Ga0068866_100117842 147
56 3300005719 Ga0068861_100007761 Ga0068861_1000077612 147
57 3300005840 Ga0068870_10071101 Ga0068870_100711013 147
58 3300005842 Ga0068858_100003657 Ga0068858_1000036577 147
59 3300005843 Ga0068860_100063051 Ga0068860_1000630514 147
60 3300005844 Ga0068862_100011814 Ga0068862_1000118144 147
61 3300006237 Ga0097621_100002904 Ga0097621_1000029048 147
62 3300006852 Ga0075433_10488130 Ga0075433_104881302 147
63 3300006881 Ga0068865_100042182 Ga0068865_1000421824 147
64 3300006931 Ga0097620_100007318 Ga0097620_1000073189 147
65 3300025885 Ga0207653_10001915 Ga0207653_100019155 147
66 3300025899 Ga0207642_10025520 Ga0207642_100255202 147
67 3300025901 Ga0207688_10013633 Ga0207688_100136335 147
68 3300025904 Ga0207647_10102521 Ga0207647_101025213 147
69 3300025908 Ga0207643_10132907 Ga0207643_101329073 147
70 3300025912 Ga0207707_10225892 Ga0207707_102258923 147
71 3300025918 Ga0207662_10002400 Ga0207662_1000240010 147
72 3300025927 Ga0207687_10010087 Ga0207687_100100874 147
73 3300025934 Ga0207686_10005427 Ga0207686_100054273 147
74 3300025935 Ga0207709_10198219 Ga0207709_101982193 147
75 3300025936 Ga0207670_11273334 Ga0207670_112733341 147
76 3300025938 Ga0207704_10002727 Ga0207704_100027278 147
77 3300025942 Ga0207689_10002939 Ga0207689_1000293910 147
78 3300025949 Ga0207667_10017288 Ga0207667_100172886 147
79 3300025960 Ga0207651_10020681 Ga0207651_100206815 147
80 3300025961 Ga0207712_10003403 Ga0207712_100034035 147
81 3300025981 Ga0207640_10143177 Ga0207640_101431771 147
82 3300026023 Ga0207677_10061805 Ga0207677_100618054 147
83 3300026035 Ga0207703_10027080 Ga0207703_100270805 147
84 3300026041 Ga0207639_10133417 Ga0207639_101334173 147
85 3300026075 Ga0207708_10000761 Ga0207708_1000076123 147
86 3300026089 Ga0207648_10020283 Ga0207648_100202832 147
87 3300026118 Ga0207675_100103318 Ga0207675_1001033184 147
88 3300026142 Ga0207698_10010939 Ga0207698_100109394 147
89 3300028381 Ga0268264_10014865 Ga0268264_100148653 147
90 3300044712 Ga0453684_0253483 Ga0453684_0253483_691_1134 147
91 3300045051 Ga0451576_0000756 Ga0451576_0000756_63236_63679 147
92 3300045051 Ga0451576_0179222 Ga0451576_0179222_1236_1679 147
93 3300046463 Ga0495653_0542660 Ga0495653_0542660_219_662 147
94 3300046511 Ga0495608_0003267 Ga0495608_0003267_6366_6809 147
95 3300046559 Ga0495667_0036342 Ga0495667_0036342_1557_2000 147
96 3300046663 Ga0495635_0439183 Ga0495635_0439183_245_688 147
97 3300046675 Ga0495657_0129382 Ga0495657_0129382_459_902 147
98 3300047471 Ga0495684_0000691 Ga0495684_0000691_22481_22924 147
99 3300050515 nmdc:mga0a205_209579_c2 nmdc:mga0a205_209579_c2_151_594 147
100 3300005341 Ga0070691_10540913 Ga0070691_105409132 148
101 3300005344 Ga0070661_100001029 Ga0070661_10000102910 148
102 3300005345 Ga0070692_10021996 Ga0070692_100219964 148
103 3300005444 Ga0070694_100095143 Ga0070694_1000951434 148
104 3300005549 Ga0070704_100055291 Ga0070704_1000552913 148
105 3300005614 Ga0068856_100375329 Ga0068856_1003753292 148
106 3300006880 Ga0075429_101506537 Ga0075429_1015065372 148
107 3300006881 Ga0068865_100490731 Ga0068865_1004907312 148
108 3300009094 Ga0111539_10105416 Ga0111539_101054165 148
109 3300014325 Ga0163163_12274217 Ga0163163_122742172 148
110 3300025920 Ga0207649_10000037 Ga0207649_10000037107 148
111 3300025935 Ga0207709_10257228 Ga0207709_102572282 148
112 3300027907 Ga0207428_10219789 Ga0207428_102197893 148
113 3300037471 Ga0395905_0919983 Ga0395905_0919983_305_757 148
114 3300049580 Ga0501046_0277044 Ga0501046_0277044_47_517 148
115 3300050508 nmdc:mga09592_716109_c1 nmdc:mga09592_716109_c1_265_720 148
116 3300050511 nmdc:mga08y16_29543_c1 nmdc:mga08y16_29543_c1_2451_2906 148
117 iso_pu_bacteria 2513237101 2513692641 148
118 iso_pu_bacteria 2558860100 2558865095 148
119 iso_pu_bacteria 2585428057 2587729440 148
120 iso_pu_bacteria 2588253510 2588292990 148
121 iso_pu_bacteria 2643221643 2644241297 148
122 iso_pu_bacteria 2721755755 2723844982 148
123 iso_pu_bacteria 2738543013 2739252101 148
124 iso_pu_bacteria 2738543024 2739308724 148
125 iso_pu_bacteria 2775506901 2776264409 148
126 iso_pu_bacteria 2791355199 2793082161 148
127 iso_pu_bacteria 2854916844 2854918679 148
128 iso_pu_bacteria 2874604998 2874605310 148
129 iso_pu_bacteria 2879110137 2879111301 148
130 iso_pu_bacteria 2885192300 2885197119 148
131 iso_pu_bacteria 2904541872 2904543787 148
132 iso_pu_bacteria 2919089067 2919091918 148
133 iso_pu_bacteria 2919134579 2919137962 148
134 iso_pu_bacteria 2922361189 2922365456 148
135 iso_pu_bacteria 2929160207 2929162660 148
136 iso_pu_bacteria 2933016740 2933019188 148
137 iso_pu_bacteria 2939626828 2939629834 148
138 iso_pu_bacteria 2939631187 2939631888 148
139 iso_pu_bacteria 2939669807 2939671288 148
140 iso_pu_bacteria 8002285264 8002289229 148
141 iso_pu_bacteria 8006964411 8006965849 148
142 iso_pu_bacteria 8006984368 8006986494 148
143 iso_pu_bacteria 8006994254 8006995928 148
144 iso_pu_bacteria 8056673599 8056673762 148
145 3300005330 Ga0070690_100507090 Ga0070690_1005070902 149
146 3300005340 Ga0070689_100028459 Ga0070689_1000284592 149
147 3300005343 Ga0070687_100071123 Ga0070687_1000711232 149
148 3300005365 Ga0070688_100001653 Ga0070688_1000016534 149
149 3300005438 Ga0070701_10011908 Ga0070701_100119084 149
150 3300005440 Ga0070705_100558158 Ga0070705_1005581582 149
151 3300005444 Ga0070694_100023909 Ga0070694_1000239094 149
152 3300005466 Ga0070685_10003699 Ga0070685_100036999 149
153 3300005467 Ga0070706_100765960 Ga0070706_1007659601 149
154 3300005615 Ga0070702_100628446 Ga0070702_1006284462 149
155 3300005617 Ga0068859_100059562 Ga0068859_1000595623 149
156 3300005618 Ga0068864_100033819 Ga0068864_1000338193 149
157 3300005841 Ga0068863_100073454 Ga0068863_1000734544 149
158 3300005843 Ga0068860_100044984 Ga0068860_1000449842 149
159 3300006163 Ga0070715_10067289 Ga0070715_100672893 149
160 3300006163 Ga0070715_10118611 Ga0070715_101186111 149
161 3300006871 Ga0075434_100144196 Ga0075434_1001441964 149
162 3300006931 Ga0097620_100059562 Ga0097620_1000595623 149
163 3300007076 Ga0075435_100019709 Ga0075435_1000197095 149
164 3300009094 Ga0111539_10404302 Ga0111539_104043022 149
165 3300009098 Ga0105245_10055110 Ga0105245_100551104 149
166 3300009148 Ga0105243_10003084 Ga0105243_1000308413 149
167 3300009176 Ga0105242_10053170 Ga0105242_100531702 149
168 3300009177 Ga0105248_10061335 Ga0105248_100613355 149
169 3300009553 Ga0105249_10004799 Ga0105249_100047997 149
170 3300010375 Ga0105239_10290002 Ga0105239_102900023 149
171 3300011119 Ga0105246_10423131 Ga0105246_104231312 149
172 3300012476 Ga0157344_1016619 Ga0157344_10166192 149
173 3300013297 Ga0157378_10017932 Ga0157378_100179327 149
174 3300014325 Ga0163163_10575374 Ga0163163_105753742 149
175 3300014326 Ga0157380_10177063 Ga0157380_101770633 149
176 3300014968 Ga0157379_10316922 Ga0157379_103169222 149
177 3300014969 Ga0157376_10014392 Ga0157376_100143922 149
178 3300025905 Ga0207685_10020467 Ga0207685_100204673 149
179 3300025905 Ga0207685_10351298 Ga0207685_103512982 149
180 3300025918 Ga0207662_10006313 Ga0207662_100063132 149
181 3300025922 Ga0207646_10198791 Ga0207646_101987913 149
182 3300025936 Ga0207670_10103945 Ga0207670_101039452 149
183 3300025941 Ga0207711_10485257 Ga0207711_104852571 149
184 3300026075 Ga0207708_10093621 Ga0207708_100936213 149
185 3300026095 Ga0207676_10036609 Ga0207676_100366093 149
186 3300028380 Ga0268265_10127381 Ga0268265_101273812 149
187 3300028381 Ga0268264_10178257 Ga0268264_101782572 149
188 3300034817 Ga0373948_0035731 Ga0373948_0035731_304_753 149
189 3300034957 Ga0373938_0043981 Ga0373938_0043981_285_734 149
190 3300035083 Ga0373926_0150119 Ga0373926_0150119_43_501 149
191 3300035085 Ga0373929_0015780 Ga0373929_0015780_155_604 149
192 3300035090 Ga0373949_0112229 Ga0373949_0112229_139_588 149
193 3300035091 Ga0373951_0008700 Ga0373951_0008700_15_464 149
194 3300035092 Ga0373952_0123576 Ga0373952_0123576_120_569 149
195 3300035112 Ga0373932_0006748 Ga0373932_0006748_1013_1462 149
196 3300035114 Ga0373939_0006074 Ga0373939_0006074_1919_2368 149
197 3300035115 Ga0373941_0067073 Ga0373941_0067073_12_461 149
198 3300035207 Ga0373942_0022164 Ga0373942_0022164_1037_1486 149
199 3300035241 Ga0373961_0356979 Ga0373961_0356979_93_542 149
200 3300035242 Ga0373962_0195340 Ga0373962_0195340_27_476 149
201 3300035691 Ga0373931_0009571 Ga0373931_0009571_4076_4525 149
202 3300035724 Ga0373933_0624264 Ga0373933_0624264_83_544 149
203 3300036401 Ga0373937_1338728 Ga0373937_1338728_71_529 149
204 3300037068 Ga0373925_0075599 Ga0373925_0075599_1818_2276 149
205 3300045051 Ga0451576_0295841 Ga0451576_0295841_44_493 149
206 3300045051 Ga0451576_0599656 Ga0451576_0599656_598_1047 149
207 3300045051 Ga0451576_0850506 Ga0451576_0850506_246_704 149
208 3300046454 Ga0495592_0288778 Ga0495592_0288778_495_953 149
209 3300046455 Ga0495603_0201348 Ga0495603_0201348_633_1085 149
210 3300046459 Ga0495629_0000008 Ga0495629_0000008_57986_58435 149
211 3300046473 Ga0495582_0674775 Ga0495582_0674775_132_581 149
212 3300046516 Ga0495628_0554772 Ga0495628_0554772_10_468 149
213 3300047315 Ga0495581_0688306 Ga0495581_0688306_77_535 149
214 3300047321 Ga0495676_0099067 Ga0495676_0099067_904_1362 149
215 3300050513 nmdc:mga0rr50_1054745_c1 nmdc:mga0rr50_1054745_c1_40_489 149
216 iso_pu_bacteria 2512875024 2512962049 149
217 iso_pu_bacteria 2513237164 2514039145 149
218 iso_pu_bacteria 2844002411 2844003403 149
219 iso_pu_bacteria 2871466892 2871471710 149
220 iso_pu_bacteria 2906378014 2906382015 149
221 3300005365 Ga0070688_100256564 Ga0070688_1002565642 150
222 3300005719 Ga0068861_100616611 Ga0068861_1006166111 150
223 3300009148 Ga0105243_11097085 Ga0105243_110970851 150
224 3300025936 Ga0207670_10600520 Ga0207670_106005201 150
225 3300026118 Ga0207675_101334879 Ga0207675_1013348791 150
226 3300035724 Ga0373933_0172990 Ga0373933_0172990_728_1189 150
227 3300046675 Ga0495657_0440519 Ga0495657_0440519_35_496 150
228 3300047472 Ga0495686_0000478 Ga0495686_0000478_14480_14938 150
229 3300053108 Ga0500562_004456 Ga0500562_004456_965_1423 150
230 3300041408 Ga0439453_0023047 Ga0439453_0023047_193_672 151
231 3300042123 Ga0450921_012501 Ga0450921_012501_219_680 151
232 3300042125 Ga0450923_033822 Ga0450923_033822_12_473 151
233 3300042135 Ga0450899_020533 Ga0450899_020533_12_473 151
234 3300042435 Ga0439434_0006793 Ga0439434_0006793_2231_2692 151
235 3300048905 Ga0496102_0573682 Ga0496102_0573682_455_916 151
236 3300053088 Ga0500644_0026432 Ga0500644_0026432_32_493 151
237 3300002987 JGI25159J45721_1021508 JGI25159J45721_10215083 152
238 3300003187 JGI25151J46595_10003752 JGI25151J46595_100037524 152
239 3300003215 JGI25153J46596_10001158 JGI25153J46596_100011589 152
240 3300003316 rootH1_10043371 rootH1_100433712 152
241 3300003320 rootH2_10121193 rootH2_101211938 152
242 3300003659 JGI25404J52841_10026573 JGI25404J52841_100265732 152
243 3300003775 Ga0055524_1000137 Ga0055524_10001378 152
244 3300003784 Ga0055534_1050564 Ga0055534_10505641 152
245 3300005262 Ga0065165_1029138 Ga0065165_10291383 152
246 3300005289 Ga0065704_10140138 Ga0065704_101401382 152
247 3300005295 Ga0065707_10316564 Ga0065707_103165642 152
248 3300005327 Ga0070658_10861092 Ga0070658_108610922 152
249 3300005328 Ga0070676_10039829 Ga0070676_100398294 152
250 3300005328 Ga0070676_10536095 Ga0070676_105360951 152
251 3300005328 Ga0070676_10879175 Ga0070676_108791752 152
252 3300005331 Ga0070670_100004124 Ga0070670_1000041249 152
253 3300005331 Ga0070670_100087383 Ga0070670_1000873833 152
254 3300005331 Ga0070670_100147753 Ga0070670_1001477532 152
255 3300005331 Ga0070670_100557042 Ga0070670_1005570422 152
256 3300005331 Ga0070670_100691180 Ga0070670_1006911802 152
257 3300005331 Ga0070670_101497051 Ga0070670_1014970511 152
258 3300005333 Ga0070677_10193196 Ga0070677_101931962 152
259 3300005334 Ga0068869_100011532 Ga0068869_1000115323 152
260 3300005334 Ga0068869_100100004 Ga0068869_1001000043 152
261 3300005334 Ga0068869_100108458 Ga0068869_1001084581 152
262 3300005334 Ga0068869_101976401 Ga0068869_1019764011 152
263 3300005335 Ga0070666_10000334 Ga0070666_1000033429 152
264 3300005335 Ga0070666_10169935 Ga0070666_101699352 152
265 3300005335 Ga0070666_10490529 Ga0070666_104905292 152
266 3300005338 Ga0068868_100049789 Ga0068868_1000497893 152
267 3300005338 Ga0068868_100076000 Ga0068868_1000760003 152
268 3300005339 Ga0070660_100052028 Ga0070660_1000520282 152
269 3300005341 Ga0070691_10014898 Ga0070691_100148985 152
270 3300005344 Ga0070661_100381286 Ga0070661_1003812862 152
271 3300005344 Ga0070661_100458095 Ga0070661_1004580952 152
272 3300005347 Ga0070668_100101106 Ga0070668_1001011062 152
273 3300005347 Ga0070668_100117982 Ga0070668_1001179823 152
274 3300005347 Ga0070668_100637243 Ga0070668_1006372432 152
275 3300005353 Ga0070669_100101857 Ga0070669_1001018573 152
276 3300005353 Ga0070669_101005627 Ga0070669_1010056271 152
277 3300005354 Ga0070675_100041361 Ga0070675_1000413615 152
278 3300005355 Ga0070671_100017688 Ga0070671_1000176886 152
279 3300005364 Ga0070673_100009931 Ga0070673_1000099316 152
280 3300005366 Ga0070659_100012395 Ga0070659_1000123954 152
281 3300005367 Ga0070667_100652428 Ga0070667_1006524282 152
282 3300005406 Ga0070703_10149018 Ga0070703_101490182 152
283 3300005434 Ga0070709_10259021 Ga0070709_102590212 152
284 3300005436 Ga0070713_101398130 Ga0070713_1013981301 152
285 3300005437 Ga0070710_10225712 Ga0070710_102257122 152
286 3300005439 Ga0070711_100418326 Ga0070711_1004183262 152
287 3300005455 Ga0070663_100011222 Ga0070663_1000112223 152
288 3300005455 Ga0070663_100014671 Ga0070663_1000146713 152
289 3300005455 Ga0070663_100202207 Ga0070663_1002022074 152
290 3300005455 Ga0070663_100325044 Ga0070663_1003250442 152
291 3300005456 Ga0070678_100005734 Ga0070678_1000057348 152
292 3300005456 Ga0070678_101032419 Ga0070678_1010324192 152
293 3300005457 Ga0070662_100004392 Ga0070662_1000043928 152
294 3300005457 Ga0070662_100042618 Ga0070662_1000426182 152
295 3300005459 Ga0068867_100276687 Ga0068867_1002766872 152
296 3300005459 Ga0068867_101121393 Ga0068867_1011213932 152
297 3300005466 Ga0070685_10002114 Ga0070685_100021147 152
298 3300005466 Ga0070685_10612182 Ga0070685_106121821 152
299 3300005467 Ga0070706_101677565 Ga0070706_1016775651 152
300 3300005471 Ga0070698_100000332 Ga0070698_1000003322 152
301 3300005518 Ga0070699_100222618 Ga0070699_1002226182 152
302 3300005518 Ga0070699_102156121 Ga0070699_1021561211 152
303 3300005536 Ga0070697_100652663 Ga0070697_1006526631 152
304 3300005539 Ga0068853_100010770 Ga0068853_1000107703 152
305 3300005539 Ga0068853_100070079 Ga0068853_1000700793 152
306 3300005539 Ga0068853_100170174 Ga0068853_1001701743 152
307 3300005539 Ga0068853_102034546 Ga0068853_1020345461 152
308 3300005543 Ga0070672_100000535 Ga0070672_10000053528 152
309 3300005548 Ga0070665_100002080 Ga0070665_1000020807 152
310 3300005548 Ga0070665_100031156 Ga0070665_1000311563 152
311 3300005548 Ga0070665_100171687 Ga0070665_1001716873 152
312 3300005548 Ga0070665_101732989 Ga0070665_1017329892 152
313 3300005549 Ga0070704_101465364 Ga0070704_1014653642 152
314 3300005563 Ga0068855_100042076 Ga0068855_1000420764 152
315 3300005563 Ga0068855_100643912 Ga0068855_1006439122 152
316 3300005564 Ga0070664_100134904 Ga0070664_1001349044 152
317 3300005564 Ga0070664_100711813 Ga0070664_1007118131 152
318 3300005577 Ga0068857_100165253 Ga0068857_1001652533 152
319 3300005578 Ga0068854_100289637 Ga0068854_1002896371 152
320 3300005578 Ga0068854_100823551 Ga0068854_1008235512 152
321 3300005614 Ga0068856_100082746 Ga0068856_1000827463 152
322 3300005614 Ga0068856_100168664 Ga0068856_1001686641 152
323 3300005614 Ga0068856_100355589 Ga0068856_1003555893 152
324 3300005616 Ga0068852_100006324 Ga0068852_1000063243 152
325 3300005616 Ga0068852_100040808 Ga0068852_1000408081 152
326 3300005616 Ga0068852_100230335 Ga0068852_1002303352 152
327 3300005616 Ga0068852_100672713 Ga0068852_1006727132 152
328 3300005617 Ga0068859_102794065 Ga0068859_1027940651 152
329 3300005618 Ga0068864_100035855 Ga0068864_1000358555 152
330 3300005618 Ga0068864_100240958 Ga0068864_1002409582 152
331 3300005718 Ga0068866_10832658 Ga0068866_108326582 152
332 3300005718 Ga0068866_10982131 Ga0068866_109821311 152
333 3300005719 Ga0068861_100015603 Ga0068861_1000156035 152
334 3300005719 Ga0068861_100060602 Ga0068861_1000606023 152
335 3300005719 Ga0068861_100753878 Ga0068861_1007538781 152
336 3300005834 Ga0068851_10003102 Ga0068851_100031025 152
337 3300005834 Ga0068851_10086087 Ga0068851_100860873 152
338 3300005841 Ga0068863_100146383 Ga0068863_1001463834 152
339 3300005841 Ga0068863_100228353 Ga0068863_1002283532 152
340 3300005842 Ga0068858_100000756 Ga0068858_10000075627 152
341 3300005842 Ga0068858_100217629 Ga0068858_1002176293 152
342 3300005842 Ga0068858_100291441 Ga0068858_1002914413 152
343 3300005843 Ga0068860_100059465 Ga0068860_1000594654 152
344 3300005843 Ga0068860_100134028 Ga0068860_1001340283 152
345 3300005844 Ga0068862_100305414 Ga0068862_1003054142 152
346 3300005844 Ga0068862_100432315 Ga0068862_1004323151 152
347 3300005844 Ga0068862_101199244 Ga0068862_1011992441 152
348 3300005937 Ga0081455_10003737 Ga0081455_1000373711 152
349 3300005937 Ga0081455_10074169 Ga0081455_100741693 152
350 3300005981 Ga0081538_10037787 Ga0081538_100377873 152
351 3300005983 Ga0081540_1006094 Ga0081540_10060947 152
352 3300005983 Ga0081540_1017056 Ga0081540_10170563 152
353 3300005983 Ga0081540_1030764 Ga0081540_10307643 152
354 3300006028 Ga0070717_10522973 Ga0070717_105229732 152
355 3300006038 Ga0075365_10008443 Ga0075365_100084436 152
356 3300006038 Ga0075365_10202781 Ga0075365_102027813 152
357 3300006042 Ga0075368_10110641 Ga0075368_101106412 152
358 3300006048 Ga0075363_100000455 Ga0075363_1000004554 152
359 3300006048 Ga0075363_100060704 Ga0075363_1000607043 152
360 3300006048 Ga0075363_100079633 Ga0075363_1000796334 152
361 3300006048 Ga0075363_100326450 Ga0075363_1003264502 152
362 3300006051 Ga0075364_10087364 Ga0075364_100873642 152
363 3300006051 Ga0075364_10494718 Ga0075364_104947181 152
364 3300006175 Ga0070712_100241719 Ga0070712_1002417192 152
365 3300006177 Ga0075362_10045697 Ga0075362_100456973 152
366 3300006177 Ga0075362_10135936 Ga0075362_101359362 152
367 3300006178 Ga0075367_10141495 Ga0075367_101414952 152
368 3300006178 Ga0075367_10224715 Ga0075367_102247152 152
369 3300006178 Ga0075367_10242518 Ga0075367_102425181 152
370 3300006178 Ga0075367_10990864 Ga0075367_109908641 152
371 3300006186 Ga0075369_10127358 Ga0075369_101273581 152
372 3300006195 Ga0075366_10008197 Ga0075366_100081974 152
373 3300006195 Ga0075366_10014177 Ga0075366_100141773 152
374 3300006195 Ga0075366_10205783 Ga0075366_102057832 152
375 3300006195 Ga0075366_10259606 Ga0075366_102596062 152
376 3300006195 Ga0075366_10395482 Ga0075366_103954822 152
377 3300006237 Ga0097621_100059011 Ga0097621_1000590113 152
378 3300006237 Ga0097621_100088621 Ga0097621_1000886213 152
379 3300006237 Ga0097621_100901204 Ga0097621_1009012042 152
380 3300006237 Ga0097621_101001081 Ga0097621_1010010812 152
381 3300006353 Ga0075370_10075093 Ga0075370_100750933 152
382 3300006353 Ga0075370_10286135 Ga0075370_102861352 152
383 3300006353 Ga0075370_10489794 Ga0075370_104897941 152
384 3300006353 Ga0075370_10576002 Ga0075370_105760021 152
385 3300006358 Ga0068871_100014807 Ga0068871_1000148075 152
386 3300006358 Ga0068871_100581905 Ga0068871_1005819051 152
387 3300006358 Ga0068871_101370700 Ga0068871_1013707001 152
388 3300006844 Ga0075428_100470496 Ga0075428_1004704963 152
389 3300006846 Ga0075430_100961025 Ga0075430_1009610252 152
390 3300006847 Ga0075431_100501602 Ga0075431_1005016022 152
391 3300006852 Ga0075433_10024317 Ga0075433_100243174 152
392 3300006871 Ga0075434_100000268 Ga0075434_10000026824 152
393 3300006871 Ga0075434_100522103 Ga0075434_1005221033 152
394 3300006880 Ga0075429_100202806 Ga0075429_1002028062 152
395 3300006881 Ga0068865_100759089 Ga0068865_1007590892 152
396 3300006931 Ga0097620_102793466 Ga0097620_1027934661 152
397 3300007076 Ga0075435_100197793 Ga0075435_1001977932 152
398 3300007076 Ga0075435_101567756 Ga0075435_1015677561 152
399 3300009011 Ga0105251_10318812 Ga0105251_103188122 152
400 3300009036 Ga0105244_10102018 Ga0105244_101020182 152
401 3300009093 Ga0105240_10001365 Ga0105240_100013659 152
402 3300009093 Ga0105240_10001750 Ga0105240_100017506 152
403 3300009093 Ga0105240_10137221 Ga0105240_101372213 152
404 3300009093 Ga0105240_10938822 Ga0105240_109388222 152
405 3300009094 Ga0111539_10095595 Ga0111539_100955953 152
406 3300009094 Ga0111539_11734348 Ga0111539_117343482 152
407 3300009094 Ga0111539_12099748 Ga0111539_120997482 152
408 3300009094 Ga0111539_12478649 Ga0111539_124786491 152
409 3300009098 Ga0105245_10153904 Ga0105245_101539041 152
410 3300009098 Ga0105245_10244437 Ga0105245_102444373 152
411 3300009098 Ga0105245_10582627 Ga0105245_105826272 152
412 3300009147 Ga0114129_10781676 Ga0114129_107816761 152
413 3300009148 Ga0105243_10162546 Ga0105243_101625463 152
414 3300009148 Ga0105243_10565717 Ga0105243_105657172 152
415 3300009148 Ga0105243_10907788 Ga0105243_109077882 152
416 3300009174 Ga0105241_10027594 Ga0105241_100275944 152
417 3300009174 Ga0105241_10419789 Ga0105241_104197893 152
418 3300009177 Ga0105248_10000352 Ga0105248_100003525 152
419 3300009177 Ga0105248_12448166 Ga0105248_124481662 152
420 3300009545 Ga0105237_10002406 Ga0105237_100024067 152
421 3300009545 Ga0105237_10137513 Ga0105237_101375132 152
422 3300009545 Ga0105237_10161891 Ga0105237_101618913 152
423 3300009545 Ga0105237_10344713 Ga0105237_103447132 152
424 3300009545 Ga0105237_10458474 Ga0105237_104584742 152
425 3300009551 Ga0105238_10005159 Ga0105238_100051599 152
426 3300009551 Ga0105238_10015404 Ga0105238_100154046 152
427 3300009553 Ga0105249_10005381 Ga0105249_100053818 152
428 3300009553 Ga0105249_11756889 Ga0105249_117568892 152
429 3300010375 Ga0105239_10003462 Ga0105239_1000346213 152
430 3300010375 Ga0105239_10796167 Ga0105239_107961672 152
431 3300010375 Ga0105239_11050534 Ga0105239_110505341 152
432 3300011119 Ga0105246_10792331 Ga0105246_107923312 152
433 3300013105 Ga0157369_10128044 Ga0157369_101280443 152
434 3300013105 Ga0157369_10248046 Ga0157369_102480463 152
435 3300013296 Ga0157374_10010141 Ga0157374_100101415 152
436 3300013296 Ga0157374_10040465 Ga0157374_100404653 152
437 3300013296 Ga0157374_10343849 Ga0157374_103438492 152
438 3300013306 Ga0163162_10012590 Ga0163162_100125905 152
439 3300013306 Ga0163162_10077409 Ga0163162_100774096 152
440 3300013306 Ga0163162_10938433 Ga0163162_109384331 152
441 3300013306 Ga0163162_11510754 Ga0163162_115107542 152
442 3300013306 Ga0163162_11614292 Ga0163162_116142921 152
443 3300013307 Ga0157372_10012358 Ga0157372_100123583 152
444 3300013307 Ga0157372_10199654 Ga0157372_101996541 152
445 3300013307 Ga0157372_10442654 Ga0157372_104426542 152
446 3300013308 Ga0157375_10025113 Ga0157375_100251138 152
447 3300013308 Ga0157375_10197154 Ga0157375_101971543 152
448 3300013308 Ga0157375_11550506 Ga0157375_115505062 152
449 3300014497 Ga0182008_10002443 Ga0182008_1000244312 152
450 3300014745 Ga0157377_10003140 Ga0157377_100031404 152
451 3300014968 Ga0157379_10012182 Ga0157379_100121824 152
452 3300014968 Ga0157379_10078488 Ga0157379_100784882 152
453 3300014968 Ga0157379_10537474 Ga0157379_105374742 152
454 3300014968 Ga0157379_10713621 Ga0157379_107136211 152
455 3300014969 Ga0157376_10010318 Ga0157376_100103186 152
456 3300014969 Ga0157376_10011188 Ga0157376_100111888 152
457 3300014969 Ga0157376_10019400 Ga0157376_100194004 152
458 3300015261 Ga0182006_1015371 Ga0182006_10153713 152
459 3300015262 Ga0182007_10000248 Ga0182007_100002487 152
460 3300015265 Ga0182005_1060862 Ga0182005_10608622 152
461 3300015683 Ga0183362_10002 Ga0183362_10002195 152
462 3300017792 Ga0163161_10023592 Ga0163161_100235922 152
463 3300017792 Ga0163161_10103072 Ga0163161_101030724 152
464 3300017792 Ga0163161_10130342 Ga0163161_101303422 152
465 3300017792 Ga0163161_10140371 Ga0163161_101403712 152
466 3300017792 Ga0163161_10456352 Ga0163161_104563521 152
467 3300020069 Ga0197907_11110502 Ga0197907_111105022 152
468 3300021361 Ga0213872_10098361 Ga0213872_100983612 152
469 3300024227 Ga0228598_1066106 Ga0228598_10661061 152
470 3300025258 Ga0209129_1013505 Ga0209129_10135053 152
471 3300025261 Ga0209233_1000834 Ga0209233_100083410 152
472 3300025263 Ga0209565_1006958 Ga0209565_10069582 152
473 3300025273 Ga0209673_1032050 Ga0209673_10320502 152
474 3300025284 Ga0209130_1002478 Ga0209130_10024787 152
475 3300025291 Ga0209675_1001541 Ga0209675_100154111 152
476 3300025291 Ga0209675_1050220 Ga0209675_10502201 152
477 3300025292 Ga0209676_1026211 Ga0209676_10262113 152
478 3300025294 Ga0209025_1000183 Ga0209025_1000183101 152
479 3300025294 Ga0209025_1056343 Ga0209025_10563432 152
480 3300025294 Ga0209025_1063136 Ga0209025_10631362 152
481 3300025295 Ga0209564_1028907 Ga0209564_10289073 152
482 3300025297 Ga0209758_1000146 Ga0209758_1000146152 152
483 3300025298 Ga0209050_1010058 Ga0209050_10100583 152
484 3300025299 Ga0209256_1000030 Ga0209256_1000030217 152
485 3300025303 Ga0209051_1045816 Ga0209051_10458162 152
486 3300025304 Ga0209257_1015596 Ga0209257_10155963 152
487 3300025315 Ga0207697_10141647 Ga0207697_101416473 152
488 3300025321 Ga0207656_10001704 Ga0207656_100017047 152
489 3300025321 Ga0207656_10098113 Ga0207656_100981133 152
490 3300025711 Ga0207696_1063097 Ga0207696_10630972 152
491 3300025893 Ga0207682_10151563 Ga0207682_101515632 152
492 3300025899 Ga0207642_10042446 Ga0207642_100424462 152
493 3300025900 Ga0207710_10115502 Ga0207710_101155022 152
494 3300025900 Ga0207710_10291184 Ga0207710_102911841 152
495 3300025901 Ga0207688_10065787 Ga0207688_100657873 152
496 3300025903 Ga0207680_10000514 Ga0207680_100005149 152
497 3300025903 Ga0207680_10242256 Ga0207680_102422563 152
498 3300025904 Ga0207647_10000343 Ga0207647_100003438 152
499 3300025907 Ga0207645_10127703 Ga0207645_101277033 152
500 3300025907 Ga0207645_10304743 Ga0207645_103047432 152
501 3300025907 Ga0207645_10574841 Ga0207645_105748412 152
502 3300025908 Ga0207643_10575302 Ga0207643_105753021 152
503 3300025909 Ga0207705_10126912 Ga0207705_101269123 152
504 3300025911 Ga0207654_10023245 Ga0207654_100232452 152
505 3300025911 Ga0207654_10046619 Ga0207654_100466193 152
506 3300025911 Ga0207654_10199287 Ga0207654_101992872 152
507 3300025913 Ga0207695_10000014 Ga0207695_10000014648 152
508 3300025913 Ga0207695_10002945 Ga0207695_100029459 152
509 3300025913 Ga0207695_10050167 Ga0207695_100501671 152
510 3300025913 Ga0207695_10334421 Ga0207695_103344213 152
511 3300025914 Ga0207671_10012055 Ga0207671_100120554 152
512 3300025914 Ga0207671_10019307 Ga0207671_100193074 152
513 3300025914 Ga0207671_10112050 Ga0207671_101120503 152
514 3300025914 Ga0207671_10122883 Ga0207671_101228833 152
515 3300025915 Ga0207693_10200331 Ga0207693_102003312 152
516 3300025916 Ga0207663_10531075 Ga0207663_105310751 152
517 3300025919 Ga0207657_10061175 Ga0207657_100611753 152
518 3300025920 Ga0207649_10018425 Ga0207649_100184251 152
519 3300025920 Ga0207649_10047013 Ga0207649_100470132 152
520 3300025920 Ga0207649_10660470 Ga0207649_106604702 152
521 3300025922 Ga0207646_10368091 Ga0207646_103680912 152
522 3300025924 Ga0207694_10001692 Ga0207694_100016929 152
523 3300025924 Ga0207694_10002417 Ga0207694_100024177 152
524 3300025924 Ga0207694_10006199 Ga0207694_100061996 152
525 3300025924 Ga0207694_10375558 Ga0207694_103755582 152
526 3300025925 Ga0207650_10009560 Ga0207650_100095608 152
527 3300025925 Ga0207650_10134352 Ga0207650_101343522 152
528 3300025925 Ga0207650_10304619 Ga0207650_103046193 152
529 3300025925 Ga0207650_10360867 Ga0207650_103608672 152
530 3300025925 Ga0207650_10496649 Ga0207650_104966492 152
531 3300025926 Ga0207659_10003322 Ga0207659_100033225 152
532 3300025926 Ga0207659_10231911 Ga0207659_102319113 152
533 3300025926 Ga0207659_10611412 Ga0207659_106114122 152
534 3300025927 Ga0207687_10005772 Ga0207687_100057726 152
535 3300025927 Ga0207687_10073584 Ga0207687_100735844 152
536 3300025927 Ga0207687_10087223 Ga0207687_100872233 152
537 3300025928 Ga0207700_10420148 Ga0207700_104201482 152
538 3300025931 Ga0207644_10026728 Ga0207644_100267282 152
539 3300025931 Ga0207644_10038506 Ga0207644_100385065 152
540 3300025932 Ga0207690_10085940 Ga0207690_100859402 152
541 3300025933 Ga0207706_10004142 Ga0207706_100041425 152
542 3300025933 Ga0207706_10085844 Ga0207706_100858442 152
543 3300025934 Ga0207686_10211192 Ga0207686_102111922 152
544 3300025935 Ga0207709_10001965 Ga0207709_100019652 152
545 3300025935 Ga0207709_10110682 Ga0207709_101106823 152
546 3300025935 Ga0207709_10576392 Ga0207709_105763921 152
547 3300025937 Ga0207669_10221230 Ga0207669_102212302 152
548 3300025937 Ga0207669_10258611 Ga0207669_102586112 152
549 3300025940 Ga0207691_10446324 Ga0207691_104463242 152
550 3300025941 Ga0207711_10000928 Ga0207711_1000092825 152
551 3300025941 Ga0207711_10073901 Ga0207711_100739012 152
552 3300025941 Ga0207711_11196663 Ga0207711_111966631 152
553 3300025942 Ga0207689_10014348 Ga0207689_100143485 152
554 3300025942 Ga0207689_10035623 Ga0207689_100356235 152
555 3300025945 Ga0207679_10049414 Ga0207679_100494143 152
556 3300025945 Ga0207679_10374574 Ga0207679_103745742 152
557 3300025949 Ga0207667_10163814 Ga0207667_101638142 152
558 3300025949 Ga0207667_10191956 Ga0207667_101919563 152
559 3300025949 Ga0207667_10525803 Ga0207667_105258032 152
560 3300025960 Ga0207651_10064267 Ga0207651_100642674 152
561 3300025961 Ga0207712_10001310 Ga0207712_1000131014 152
562 3300025961 Ga0207712_10343103 Ga0207712_103431033 152
563 3300025961 Ga0207712_11029086 Ga0207712_110290862 152
564 3300025961 Ga0207712_11565065 Ga0207712_115650651 152
565 3300025972 Ga0207668_10073153 Ga0207668_100731532 152
566 3300025972 Ga0207668_10079616 Ga0207668_100796164 152
567 3300025972 Ga0207668_10314933 Ga0207668_103149332 152
568 3300025972 Ga0207668_10612526 Ga0207668_106125262 152
569 3300025981 Ga0207640_10060009 Ga0207640_100600092 152
570 3300025981 Ga0207640_10188242 Ga0207640_101882423 152
571 3300025986 Ga0207658_10006474 Ga0207658_100064743 152
572 3300025986 Ga0207658_10433451 Ga0207658_104334512 152
573 3300025986 Ga0207658_10655717 Ga0207658_106557171 152
574 3300026023 Ga0207677_10003660 Ga0207677_100036603 152
575 3300026023 Ga0207677_10039752 Ga0207677_100397523 152
576 3300026035 Ga0207703_10000809 Ga0207703_100008097 152
577 3300026035 Ga0207703_10123860 Ga0207703_101238603 152
578 3300026035 Ga0207703_10386200 Ga0207703_103862002 152
579 3300026041 Ga0207639_10003037 Ga0207639_100030373 152
580 3300026041 Ga0207639_10056299 Ga0207639_100562993 152
581 3300026041 Ga0207639_10143782 Ga0207639_101437823 152
582 3300026041 Ga0207639_11260974 Ga0207639_112609742 152
583 3300026067 Ga0207678_10019586 Ga0207678_100195863 152
584 3300026067 Ga0207678_10035028 Ga0207678_100350283 152
585 3300026067 Ga0207678_10189322 Ga0207678_101893223 152
586 3300026067 Ga0207678_10200056 Ga0207678_102000563 152
587 3300026067 Ga0207678_10500377 Ga0207678_105003773 152
588 3300026075 Ga0207708_10112522 Ga0207708_101125223 152
589 3300026078 Ga0207702_10164430 Ga0207702_101644302 152
590 3300026078 Ga0207702_10185644 Ga0207702_101856443 152
591 3300026088 Ga0207641_10074603 Ga0207641_100746033 152
592 3300026088 Ga0207641_10124314 Ga0207641_101243143 152
593 3300026088 Ga0207641_10176091 Ga0207641_101760912 152
594 3300026089 Ga0207648_10006903 Ga0207648_100069039 152
595 3300026089 Ga0207648_10054061 Ga0207648_100540613 152
596 3300026089 Ga0207648_10388115 Ga0207648_103881153 152
597 3300026089 Ga0207648_11085464 Ga0207648_110854642 152
598 3300026089 Ga0207648_11186481 Ga0207648_111864812 152
599 3300026095 Ga0207676_10009546 Ga0207676_100095467 152
600 3300026095 Ga0207676_10183074 Ga0207676_101830743 152
601 3300026118 Ga0207675_100004533 Ga0207675_1000045335 152
602 3300026118 Ga0207675_100069868 Ga0207675_1000698683 152
603 3300026118 Ga0207675_102250165 Ga0207675_1022501651 152
604 3300026121 Ga0207683_10021200 Ga0207683_100212004 152
605 3300026121 Ga0207683_11537410 Ga0207683_115374101 152
606 3300026142 Ga0207698_10059238 Ga0207698_100592385 152
607 3300026142 Ga0207698_10119779 Ga0207698_101197793 152
608 3300026142 Ga0207698_10248185 Ga0207698_102481852 152
609 3300026142 Ga0207698_10309415 Ga0207698_103094152 152
610 3300026142 Ga0207698_11042732 Ga0207698_110427322 152
611 3300027866 Ga0209813_10134718 Ga0209813_101347181 152
612 3300027907 Ga0207428_10028203 Ga0207428_100282038 152
613 3300028379 Ga0268266_10000006 Ga0268266_100000061087 152
614 3300028379 Ga0268266_10008473 Ga0268266_1000847310 152
615 3300028379 Ga0268266_10282193 Ga0268266_102821933 152
616 3300028379 Ga0268266_10850377 Ga0268266_108503771 152
617 3300028379 Ga0268266_11013865 Ga0268266_110138651 152
618 3300028380 Ga0268265_10155113 Ga0268265_101551134 152
619 3300028380 Ga0268265_10169456 Ga0268265_101694563 152
620 3300028381 Ga0268264_10140100 Ga0268264_101401003 152
621 3300028381 Ga0268264_10514206 Ga0268264_105142062 152
622 3300028786 Ga0307517_10187960 Ga0307517_101879602 152
623 3300028794 Ga0307515_10084357 Ga0307515_100843575 152
624 3300028794 Ga0307515_10338516 Ga0307515_103385162 152
625 3300031251 Ga0265327_10240060 Ga0265327_102400602 152
626 3300031456 Ga0307513_10037594 Ga0307513_100375945 152
627 3300031456 Ga0307513_10398454 Ga0307513_103984542 152
628 3300031456 Ga0307513_10961020 Ga0307513_109610201 152
629 3300031507 Ga0307509_10224369 Ga0307509_102243692 152
630 3300031548 Ga0307408_100256560 Ga0307408_1002565602 152
631 3300031616 Ga0307508_10415536 Ga0307508_104155362 152
632 3300031616 Ga0307508_10683725 Ga0307508_106837252 152
633 3300031730 Ga0307516_10353758 Ga0307516_103537582 152
634 3300031730 Ga0307516_10782661 Ga0307516_107826611 152
635 3300031911 Ga0307412_10002067 Ga0307412_1000206711 152
636 3300031911 Ga0307412_10751925 Ga0307412_107519251 152
637 3300031995 Ga0307409_100686024 Ga0307409_1006860242 152
638 3300032002 Ga0307416_100554192 Ga0307416_1005541923 152
639 3300032004 Ga0307414_10015644 Ga0307414_100156447 152
640 3300032004 Ga0307414_10031431 Ga0307414_100314315 152
641 3300032004 Ga0307414_10062929 Ga0307414_100629293 152
642 3300032004 Ga0307414_10337673 Ga0307414_103376732 152
643 3300032004 Ga0307414_10350776 Ga0307414_103507762 152
644 3300032004 Ga0307414_10797192 Ga0307414_107971922 152
645 3300033179 Ga0307507_10271211 Ga0307507_102712112 152
646 3300033180 Ga0307510_10055864 Ga0307510_100558643 152
647 3300034957 Ga0373938_0083114 Ga0373938_0083114_301_765 152
648 3300035088 Ga0373940_0311132 Ga0373940_0311132_64_528 152
649 3300035691 Ga0373931_0034502 Ga0373931_0034502_546_1010 152
650 3300035695 Ga0373927_0693648 Ga0373927_0693648_163_627 152
651 3300037471 Ga0395905_0008017 Ga0395905_0008017_977_1441 152
652 3300037471 Ga0395905_1142011 Ga0395905_1142011_144_608 152
653 3300039447 Ga0436361_0293969 Ga0436361_0293969_1130_1594 152
654 3300041404 Ga0439436_0020251 Ga0439436_0020251_934_1398 152
655 3300041406 Ga0439439_0081823 Ga0439439_0081823_55_519 152
656 3300041411 Ga0439466_0001152 Ga0439466_0001152_1369_1833 152
657 3300041413 Ga0439465_0023660 Ga0439465_0023660_880_1344 152
658 3300041486 Ga0451807_2500867 Ga0451807_2500867_20_535 152
659 3300041997 Ga0439431_0000492 Ga0439431_0000492_3199_3663 152
660 3300041999 Ga0439433_0000544 Ga0439433_0000544_3178_3642 152
661 3300042004 Ga0439445_0003464 Ga0439445_0003464_1873_2337 152
662 3300042006 Ga0439432_000899 Ga0439432_000899_5110_5574 152
663 3300042007 Ga0439449_0001320 Ga0439449_0001320_6466_6930 152
664 3300042010 Ga0439452_001474 Ga0439452_001474_357_821 152
665 3300042014 Ga0439457_127838 Ga0439457_127838_53_517 152
666 3300042015 Ga0439462_0010319 Ga0439462_0010319_120_584 152
667 3300042015 Ga0439462_0010713 Ga0439462_0010713_1486_1950 152
668 3300042156 Ga0439446_0008427 Ga0439446_0008427_666_1130 152
669 3300042876 Ga0451577_0636036 Ga0451577_0636036_193_675 152
670 3300044656 Ga0466969_0057023 Ga0466969_0057023_1324_1788 152
671 3300044693 Ga0466961_0307626 Ga0466961_0307626_371_835 152
672 3300044706 Ga0466964_0154252 Ga0466964_0154252_467_943 152
673 3300044735 Ga0466968_0073615 Ga0466968_0073615_811_1275 152
674 3300044765 Ga0466970_0024375 Ga0466970_0024375_2687_3151 152
675 3300044842 Ga0466957_0149423 Ga0466957_0149423_568_1032 152
676 3300045049 Ga0466959_0094204 Ga0466959_0094204_1440_1904 152
677 3300045049 Ga0466959_0723687 Ga0466959_0723687_129_593 152
678 3300045051 Ga0451576_0063519 Ga0451576_0063519_1943_2407 152
679 3300045836 Ga0466958_0631066 Ga0466958_0631066_188_652 152
680 3300046452 Ga0495617_105608 Ga0495617_105608_97_561 152
681 3300046455 Ga0495603_0029113 Ga0495603_0029113_58_522 152
682 3300046459 Ga0495629_0057102 Ga0495629_0057102_490_954 152
683 3300046460 Ga0495638_0082463 Ga0495638_0082463_1414_1878 152
684 3300046471 Ga0495650_0099792 Ga0495650_0099792_274_738 152
685 3300046477 Ga0495664_0416636 Ga0495664_0416636_218_682 152
686 3300046491 Ga0495584_0471175 Ga0495584_0471175_146_610 152
687 3300046507 Ga0495606_0207598 Ga0495606_0207598_407_871 152
688 3300046507 Ga0495606_0276653 Ga0495606_0276653_316_780 152
689 3300046511 Ga0495608_0102807 Ga0495608_0102807_1114_1578 152
690 3300046519 Ga0495632_0058932 Ga0495632_0058932_49_513 152
691 3300046519 Ga0495632_0209603 Ga0495632_0209603_386_850 152
692 3300046520 Ga0495637_0177352 Ga0495637_0177352_235_699 152
693 3300046522 Ga0495643_0346058 Ga0495643_0346058_95_559 152
694 3300046528 Ga0495642_0045754 Ga0495642_0045754_1300_1764 152
695 3300046535 Ga0495586_0505439 Ga0495586_0505439_137_601 152
696 3300046536 Ga0495587_0270497 Ga0495587_0270497_127_591 152
697 3300046538 Ga0495609_0171341 Ga0495609_0171341_201_665 152
698 3300046539 Ga0495621_0126242 Ga0495621_0126242_158_622 152
699 3300046557 Ga0495622_0182991 Ga0495622_0182991_204_668 152
700 3300046615 Ga0495656_0003280 Ga0495656_0003280_3825_4289 152
701 3300046615 Ga0495656_0284002 Ga0495656_0284002_291_755 152
702 3300046616 Ga0495668_0386557 Ga0495668_0386557_75_539 152
703 3300046660 Ga0495625_0558563 Ga0495625_0558563_147_611 152
704 3300046664 Ga0495659_0220730 Ga0495659_0220730_210_674 152
705 3300046664 Ga0495659_0355867 Ga0495659_0355867_31_495 152
706 3300046675 Ga0495657_0320263 Ga0495657_0320263_68_532 152
707 3300046678 Ga0495599_0118626 Ga0495599_0118626_1081_1545 152
708 3300046683 Ga0495658_0163611 Ga0495658_0163611_754_1218 152
709 3300046690 Ga0495624_0171618 Ga0495624_0171618_594_1058 152
710 3300046690 Ga0495624_0401892 Ga0495624_0401892_137_601 152
711 3300046690 Ga0495624_0596835 Ga0495624_0596835_60_524 152
712 3300046691 Ga0495670_0090661 Ga0495670_0090661_782_1246 152
713 3300046694 Ga0495649_0001665 Ga0495649_0001665_13715_14179 152
714 3300046810 Ga0495660_0058223 Ga0495660_0058223_171_635 152
715 3300046810 Ga0495660_0133190 Ga0495660_0133190_559_1023 152
716 3300047318 Ga0495636_0607055 Ga0495636_0607055_58_522 152
717 3300047320 Ga0495672_0104127 Ga0495672_0104127_854_1318 152
718 3300047443 Ga0495687_008648 Ga0495687_008648_254_718 152
719 3300047443 Ga0495687_059520 Ga0495687_059520_254_718 152
720 3300047470 Ga0495681_0349180 Ga0495681_0349180_86_550 152
721 3300047472 Ga0495686_0102336 Ga0495686_0102336_547_1014 152
722 3300047472 Ga0495686_0102430 Ga0495686_0102430_664_1128 152
723 3300047472 Ga0495686_0218347 Ga0495686_0218347_159_623 152
724 3300048088 Ga0495602_0590597 Ga0495602_0590597_203_667 152
725 3300048090 Ga0495615_0001947 Ga0495615_0001947_341_805 152
726 3300048090 Ga0495615_0036958 Ga0495615_0036958_33_497 152
727 3300048091 Ga0495626_0068486 Ga0495626_0068486_933_1397 152
728 3300048903 Ga0496100_0017819 Ga0496100_0017819_288_752 152
729 3300048903 Ga0496100_0050598 Ga0496100_0050598_873_1337 152
730 3300048904 Ga0496101_0012043 Ga0496101_0012043_4447_4911 152
731 3300048904 Ga0496101_0012131 Ga0496101_0012131_1497_1961 152
732 3300048905 Ga0496102_0019066 Ga0496102_0019066_4097_4561 152
733 3300048905 Ga0496102_0101892 Ga0496102_0101892_652_1116 152
734 3300048905 Ga0496102_0316653 Ga0496102_0316653_902_1366 152
735 3300048906 Ga0496103_0384545 Ga0496103_0384545_326_790 152
736 3300048907 Ga0496104_0038566 Ga0496104_0038566_101_565 152
737 3300048908 Ga0496105_0002707 Ga0496105_0002707_12095_12559 152
738 3300048909 Ga0496106_0054826 Ga0496106_0054826_1731_2195 152
739 3300048909 Ga0496106_0113752 Ga0496106_0113752_1151_1615 152
740 3300048909 Ga0496106_0481811 Ga0496106_0481811_253_717 152
741 3300048910 Ga0496107_0119804 Ga0496107_0119804_324_788 152
742 3300048911 Ga0496108_0015709 Ga0496108_0015709_2443_2907 152
743 3300048911 Ga0496108_0082179 Ga0496108_0082179_674_1138 152
744 3300048911 Ga0496108_0671352 Ga0496108_0671352_411_875 152
745 3300048912 Ga0496109_0099704 Ga0496109_0099704_1801_2265 152
746 3300048912 Ga0496109_0435650 Ga0496109_0435650_124_588 152
747 3300048913 Ga0496110_0111462 Ga0496110_0111462_997_1461 152
748 3300048913 Ga0496110_0330956 Ga0496110_0330956_141_605 152
749 3300048914 Ga0496111_0027198 Ga0496111_0027198_2925_3389 152
750 3300048914 Ga0496111_0126926 Ga0496111_0126926_1003_1467 152
751 3300048917 Ga0496114_0002742 Ga0496114_0002742_8457_8921 152
752 3300048917 Ga0496114_0068903 Ga0496114_0068903_1634_2098 152
753 3300048917 Ga0496114_0288187 Ga0496114_0288187_19_483 152
754 3300048918 Ga0496115_0029002 Ga0496115_0029002_461_925 152
755 3300048921 Ga0496118_0078896 Ga0496118_0078896_1846_2310 152
756 3300048927 Ga0496124_0183000 Ga0496124_0183000_305_769 152
757 3300048929 Ga0496126_0168632 Ga0496126_0168632_887_1351 152
758 3300049459 Ga0495678_058037 Ga0495678_058037_475_939 152
759 3300049683 Ga0501253_001678 Ga0501253_001678_1712_2176 152
760 3300049822 Ga0501035_0033759 Ga0501035_0033759_3722_4186 152
761 3300050489 nmdc:mga03683_113908_c1 nmdc:mga03683_113908_c1_606_1070 152
762 3300050489 nmdc:mga03683_16375_c1 nmdc:mga03683_16375_c1_1977_2441 152
763 3300050489 nmdc:mga03683_178440_c1 nmdc:mga03683_178440_c1_32_496 152
764 3300050490 nmdc:mga03n38_140710_c1 nmdc:mga03n38_140710_c1_577_1041 152
765 3300050491 nmdc:mga00v17_206551_c1 nmdc:mga00v17_206551_c1_375_839 152
766 3300050492 nmdc:mga0yw44_39719_c1 nmdc:mga0yw44_39719_c1_2192_2656 152
767 3300050492 nmdc:mga0yw44_771708_c1 nmdc:mga0yw44_771708_c1_56_523 152
768 3300050493 nmdc:mga0k408_15743_c1 nmdc:mga0k408_15743_c1_344_808 152
769 3300050493 nmdc:mga0k408_215103_c1 nmdc:mga0k408_215103_c1_80_544 152
770 3300050493 nmdc:mga0k408_25116_c1 nmdc:mga0k408_25116_c1_1600_2082 152
771 3300050493 nmdc:mga0k408_285659_c1 nmdc:mga0k408_285659_c1_136_600 152
772 3300050493 nmdc:mga0k408_371395_c1 nmdc:mga0k408_371395_c1_265_729 152
773 3300050493 nmdc:mga0k408_43188_c1 nmdc:mga0k408_43188_c1_832_1311 152
774 3300050494 nmdc:mga06z11_575805_c1 nmdc:mga06z11_575805_c1_103_570 152
775 3300050496 nmdc:mga07m45_141082_c1 nmdc:mga07m45_141082_c1_27_491 152
776 3300050496 nmdc:mga07m45_38124_c1 nmdc:mga07m45_38124_c1_945_1409 152
777 3300050496 nmdc:mga07m45_6048_c1 nmdc:mga07m45_6048_c1_4089_4553 152
778 3300050496 nmdc:mga07m45_896_c1 nmdc:mga07m45_896_c1_2536_3000 152
779 3300050510 nmdc:mga06r32_2023656_c1 nmdc:mga06r32_2023656_c1_22_486 152
780 3300050511 nmdc:mga08y16_211707_c1 nmdc:mga08y16_211707_c1_64_528 152
781 3300050511 nmdc:mga08y16_305202_c1 nmdc:mga08y16_305202_c1_98_562 152
782 3300050512 nmdc:mga0n895_802118_c1 nmdc:mga0n895_802118_c1_304_768 152
783 3300050512 nmdc:mga0n895_83244_c1 nmdc:mga0n895_83244_c1_1452_1916 152
784 3300050515 nmdc:mga0a205_26067_c1 nmdc:mga0a205_26067_c1_1409_1873 152
785 3300053077 Ga0495601_0366609 Ga0495601_0366609_21_485 152
786 3300053086 Ga0500578_0060252 Ga0500578_0060252_1034_1498 152
787 3300053088 Ga0500644_0048263 Ga0500644_0048263_173_640 152
788 3300053090 Ga0500646_0121039 Ga0500646_0121039_155_619 152
789 3300053105 Ga0500557_070692 Ga0500557_070692_531_995 152
790 3300053126 Ga0500621_215512 Ga0500621_215512_141_608 152
791 3300053130 Ga0500642_0001506 Ga0500642_0001506_2001_2465 152
792 3300053134 Ga0500658_0006918 Ga0500658_0006918_2297_2761 152
793 3300053156 Ga0500622_0000548 Ga0500622_0000548_2821_3288 152
794 3300053158 Ga0500627_0238885 Ga0500627_0238885_108_575 152
795 3300053158 Ga0500627_0420783 Ga0500627_0420783_36_500 152
796 3300053727 Ga0500611_217242 Ga0500611_217242_49_513 152
797 3300053732 Ga0500656_005697 Ga0500656_005697_355_819 152
798 3300059424 Ga0590075_098398 Ga0590075_098398_130_606 152
799 3300048911 Ga0496108_0042495 Ga0496108_0042495_3260_3727 153
800 3300048912 Ga0496109_0014190 Ga0496109_0014190_3784_4251 153
801 3300048913 Ga0496110_0441118 Ga0496110_0441118_705_1172 153
802 3300048915 Ga0496112_0520490 Ga0496112_0520490_547_1014 153
803 2162886007 SwRhRL2b_contig_1515736 SwRhRL2b_0080.00005450 154
804 3300006051 Ga0075364_10398619 Ga0075364_103986192 154
805 3300006177 Ga0075362_10003653 Ga0075362_100036534 154
806 3300006178 Ga0075367_10010124 Ga0075367_100101246 154
807 3300006186 Ga0075369_10012436 Ga0075369_100124364 154
808 3300006353 Ga0075370_10005629 Ga0075370_100056294 154
809 3300009098 Ga0105245_10500778 Ga0105245_105007782 154
810 3300009101 Ga0105247_10151404 Ga0105247_101514042 154
811 3300009147 Ga0114129_10194241 Ga0114129_101942414 154
812 3300009148 Ga0105243_10447539 Ga0105243_104475393 154
813 3300009174 Ga0105241_10078094 Ga0105241_100780943 154
814 3300009177 Ga0105248_10356690 Ga0105248_103566902 154
815 3300009545 Ga0105237_10207704 Ga0105237_102077043 154
816 3300010375 Ga0105239_10060043 Ga0105239_100600434 154
817 3300010375 Ga0105239_10339377 Ga0105239_103393772 154
818 3300013297 Ga0157378_12755335 Ga0157378_127553351 154
819 3300014968 Ga0157379_10716067 Ga0157379_107160672 154
820 3300014969 Ga0157376_10362243 Ga0157376_103622433 154
821 3300015261 Ga0182006_1032465 Ga0182006_10324651 154
822 3300031090 Ga0265760_10121233 Ga0265760_101212332 154
823 3300041459 Ga0451800_1417645 Ga0451800_1417645_117_584 154
824 3300042002 Ga0439442_009444 Ga0439442_009444_49_519 154
825 3300042115 Ga0450911_000674 Ga0450911_000674_8815_9279 154
826 3300045051 Ga0451576_0097489 Ga0451576_0097489_1623_2093 154
827 3300046460 Ga0495638_0204954 Ga0495638_0204954_25_489 154
828 3300046491 Ga0495584_0582862 Ga0495584_0582862_63_533 154
829 3300046492 Ga0495585_0174459 Ga0495585_0174459_74_544 154
830 3300046499 Ga0495594_0119664 Ga0495594_0119664_651_1121 154
831 3300046501 Ga0495607_0418186 Ga0495607_0418186_125_595 154
832 3300046513 Ga0495616_0032869 Ga0495616_0032869_2099_2569 154
833 3300046515 Ga0495620_0083564 Ga0495620_0083564_262_732 154
834 3300046522 Ga0495643_0307107 Ga0495643_0307107_42_512 154
835 3300046525 Ga0495663_0001336 Ga0495663_0001336_3829_4293 154
836 3300046537 Ga0495598_0082289 Ga0495598_0082289_525_995 154
837 3300046557 Ga0495622_0053012 Ga0495622_0053012_1266_1736 154
838 3300046558 Ga0495633_0006199 Ga0495633_0006199_5739_6203 154
839 3300046615 Ga0495656_0104827 Ga0495656_0104827_567_1037 154
840 3300046648 Ga0495611_0370529 Ga0495611_0370529_35_505 154
841 3300046674 Ga0495588_0026527 Ga0495588_0026527_314_784 154
842 3300046681 Ga0495647_0134897 Ga0495647_0134897_544_1014 154
843 3300046691 Ga0495670_0233202 Ga0495670_0233202_340_810 154
844 3300047318 Ga0495636_0246165 Ga0495636_0246165_205_675 154
845 3300047321 Ga0495676_0045195 Ga0495676_0045195_205_675 154
846 3300047323 Ga0495683_0189872 Ga0495683_0189872_94_564 154
847 3300047447 Ga0495685_172500 Ga0495685_172500_94_564 154
848 3300048907 Ga0496104_0375199 Ga0496104_0375199_700_1170 154
849 3300048909 Ga0496106_0204280 Ga0496106_0204280_680_1150 154
850 3300048910 Ga0496107_0267265 Ga0496107_0267265_121_591 154
851 3300048911 Ga0496108_0220030 Ga0496108_0220030_836_1306 154
852 3300048912 Ga0496109_0057212 Ga0496109_0057212_403_873 154
853 3300048914 Ga0496111_0120729 Ga0496111_0120729_818_1288 154
854 3300048916 Ga0496113_0143784 Ga0496113_0143784_207_677 154
855 3300048919 Ga0496116_0000370 Ga0496116_0000370_3182_3646 154
856 3300048921 Ga0496118_0017779 Ga0496118_0017779_1152_1616 154
857 3300048924 Ga0496121_0004954 Ga0496121_0004954_4031_4495 154
858 3300048924 Ga0496121_0168228 Ga0496121_0168228_941_1405 154
859 3300048924 Ga0496121_0318318 Ga0496121_0318318_499_969 154
860 3300048925 Ga0496122_0030764 Ga0496122_0030764_3627_4100 154
861 3300048925 Ga0496122_0505246 Ga0496122_0505246_14_478 154
862 3300048926 Ga0496123_0023620 Ga0496123_0023620_551_1024 154
863 3300048927 Ga0496124_0142044 Ga0496124_0142044_1026_1490 154
864 3300048927 Ga0496124_0299631 Ga0496124_0299631_220_690 154
865 3300048927 Ga0496124_0304386 Ga0496124_0304386_404_868 154
866 3300048928 Ga0496125_0044534 Ga0496125_0044534_935_1399 154
867 3300048928 Ga0496125_0079102 Ga0496125_0079102_29_493 154
868 3300048929 Ga0496126_0004800 Ga0496126_0004800_3738_4211 154
869 3300048929 Ga0496126_0014970 Ga0496126_0014970_3001_3471 154
870 3300048929 Ga0496126_0336530 Ga0496126_0336530_471_935 154
871 3300050489 nmdc:mga03683_73065_c1 nmdc:mga03683_73065_c1_106_576 154
872 3300050491 nmdc:mga00v17_160761_c1 nmdc:mga00v17_160761_c1_887_1357 154
873 3300050492 nmdc:mga0yw44_16659_c1 nmdc:mga0yw44_16659_c1_3140_3610 154
874 3300050494 nmdc:mga06z11_287434_c1 nmdc:mga06z11_287434_c1_372_842 154
875 3300050494 nmdc:mga06z11_805013_c1 nmdc:mga06z11_805013_c1_88_558 154
876 3300050496 nmdc:mga07m45_72906_c1 nmdc:mga07m45_72906_c1_180_650 154
877 3300050507 nmdc:mga05p37_381692_c1 nmdc:mga05p37_381692_c1_509_979 154
878 3300050514 nmdc:mga08x19_178555_c1 nmdc:mga08x19_178555_c1_759_1229 154
879 3300050516 nmdc:mga0sz30_18350_c1 nmdc:mga0sz30_18350_c1_1034_1504 154
880 3300053090 Ga0500646_0156192 Ga0500646_0156192_242_712 154
881 3300053119 Ga0500595_009175 Ga0500595_009175_1423_1893 154
882 3300053133 Ga0500655_072100 Ga0500655_072100_80_550 154
883 3300053139 Ga0500568_0151235 Ga0500568_0151235_297_773 154
884 3300053142 Ga0500577_0165746 Ga0500577_0165746_94_564 154
885 3300053146 Ga0500588_0101422 Ga0500588_0101422_160_630 154
886 3300053150 Ga0500603_189308 Ga0500603_189308_169_639 154
887 3300053151 Ga0500604_0144979 Ga0500604_0144979_81_551 154
888 3300053160 Ga0500633_0107593 Ga0500633_0107593_226_696 154
889 3300053178 Ga0500637_0266664 Ga0500637_0266664_58_528 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

41

166

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8442 8 148
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.84 8 147
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.8374 8 146
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8347 8 141
2nn5-assembly1.cif.gz_A structure of conserved protein of unknown function ef2215 from enterococcus faecalis 0.8309 7 152
ID Description Score Start End Superfamily
af_Q9V9Q4_218_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8417 6 141 3.30.530.20
af_Q55DB6_248_379_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8414 6 141 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8374 8 146 3.30.530.20
af_Q4E5D5_198_328_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8351 6 141 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8351 10 154 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A528FRZ6-F1-model_v4 Polyketide cyclase 0.9933 14 96
AF-A0A4V1M889-F1-model_v4 Polyketide cyclase 0.991 3 110
AF-A0A1F9DD81-F1-model_v4 Polyketide cyclase 0.9909 7 148
AF-I4B4N7-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.9886 16 154
AF-A0A1N7N7S5-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9855 3 154

Feature Viewer

pLDDT pTM Quality
93.51 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map