F484799
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 889 | 462 | 856 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300028794|Ga0307515_10338516|Ga0307515_103385162 |
| Length | 180 |
| Sequence | MNKKHPEPSATPTSPPKGVEQPGKASSAQEKTSFVYVTYIRSTPEKVFEAITRPEVARRYWGHENVSDWKPGSDWQHVRANEERTVNIVGKVVEAVPPTRLVITWASPSQAADPASYSRVAFDVEAYDDMVRLTVTHNELEAGSGMANGIQKGWPIVLSSLKSLLETGQGIDVFAKPKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 5 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 6 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 7 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 8 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 9 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 10 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 11 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 12 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 13 | 2791355199 | |||
| 14 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 15 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 16 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 17 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 18 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 19 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 20 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 21 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 22 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 23 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 24 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 25 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 26 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 27 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 28 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 29 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 30 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 31 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 32 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 33 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 34 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 35 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 47 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 87 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 95 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 97 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 98 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 99 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 101 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 102 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 103 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 104 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 105 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 106 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 107 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 108 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 109 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 110 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 111 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 112 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 113 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 114 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 116 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 117 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 118 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 119 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 122 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 123 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 124 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 125 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 127 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 128 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 129 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 130 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 131 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 132 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 133 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 134 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 135 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 137 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 154 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 163 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 167 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 168 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 169 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 170 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 173 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 174 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 249 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 253 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 254 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 256 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 257 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 258 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 259 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 260 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 261 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 262 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 263 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 264 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 265 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 266 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 267 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 268 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 269 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 270 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 271 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 278 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 283 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 284 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 285 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 286 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 287 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 290 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 291 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 292 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 293 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 294 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 295 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 296 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 298 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 299 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 300 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 301 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 302 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 303 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 304 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 305 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 306 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 307 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 308 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 309 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 310 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 311 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 312 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 313 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 314 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 315 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 316 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 317 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 318 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 319 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 320 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 321 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 322 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 323 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 324 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 392 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 393 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 394 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 395 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 396 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 397 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 400 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 401 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 402 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 403 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 404 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 405 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 406 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 407 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 408 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 409 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 410 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 411 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 412 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 413 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 416 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 418 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 419 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 420 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 421 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 422 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 423 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 424 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 433 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 435 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 436 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 437 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 438 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 439 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 440 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 441 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 442 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 443 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 444 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 445 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 446 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 447 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 448 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 449 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 450 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 451 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 452 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 453 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 454 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 455 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 456 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 457 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 458 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 459 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 460 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 461 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 462 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.17 |
| Metatranscriptomes | 0.23 |
| Isolates | 3.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.81 |
| Nodule | 1.8 |
| Rhizoplane | 4.61 |
| Rhizosphere | 77.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1515736 | 2162886007 | Bacteria | 1477 |
| 2 | JGI25159J45721_1021508 | 3300002987 | Bacteria | 1214 |
| 3 | JGI25151J46595_10003752 | 3300003187 | Bacteria | 8249 |
| 4 | JGI25153J46596_10001158 | 3300003215 | Bacteria | 15941 |
| 5 | rootH1_10043371 | 3300003316 | Bacteria | 1440 |
| 6 | rootH2_10121193 | 3300003320 | Bacteria | 6167 |
| 7 | JGI25404J52841_10026573 | 3300003659 | Bacteria | 1245 |
| 8 | Ga0055524_1000137 | 3300003775 | Bacteria | 87107 |
| 9 | Ga0055534_1050564 | 3300003784 | Bacteria | 592 |
| 10 | Ga0065165_1029138 | 3300005262 | Bacteria | 1773 |
| 11 | Ga0065704_10140138 | 3300005289 | Bacteria | 1526 |
| 12 | Ga0065707_10316564 | 3300005295 | Bacteria | 974 |
| 13 | Ga0065707_10353841 | 3300005295 | Bacteria | 901 |
| 14 | Ga0065707_10377784 | 3300005295 | Bacteria | 881 |
| 15 | Ga0070658_10861092 | 3300005327 | Bacteria | 788 |
| 16 | Ga0070676_10039829 | 3300005328 | Bacteria | 2719 |
| 17 | Ga0070676_10536095 | 3300005328 | Bacteria | 836 |
| 18 | Ga0070676_10879175 | 3300005328 | Bacteria | 666 |
| 19 | Ga0070690_100035946 | 3300005330 | Bacteria | 3111 |
| 20 | Ga0070690_100507090 | 3300005330 | Bacteria | 903 |
| 21 | Ga0070670_100004124 | 3300005331 | Bacteria | 12144 |
| 22 | Ga0070670_100087383 | 3300005331 | Bacteria | 2679 |
| 23 | Ga0070670_100147753 | 3300005331 | Bacteria | 2034 |
| 24 | Ga0070670_100557042 | 3300005331 | Bacteria | 1023 |
| 25 | Ga0070670_100691180 | 3300005331 | Bacteria | 917 |
| 26 | Ga0070670_101497051 | 3300005331 | Bacteria | 620 |
| 27 | Ga0070677_10193196 | 3300005333 | Bacteria | 977 |
| 28 | Ga0068869_100007638 | 3300005334 | Bacteria | 6923 |
| 29 | Ga0068869_100011532 | 3300005334 | Bacteria | 5800 |
| 30 | Ga0068869_100100004 | 3300005334 | Bacteria | 2192 |
| 31 | Ga0068869_100108458 | 3300005334 | Bacteria | 2109 |
| 32 | Ga0068869_101976401 | 3300005334 | Bacteria | 523 |
| 33 | Ga0070666_10000334 | 3300005335 | Bacteria | 29652 |
| 34 | Ga0070666_10169935 | 3300005335 | Bacteria | 1527 |
| 35 | Ga0070666_10490529 | 3300005335 | Bacteria | 890 |
| 36 | Ga0070680_100011020 | 3300005336 | Bacteria | 6989 |
| 37 | Ga0070682_100006830 | 3300005337 | Bacteria | 6407 |
| 38 | Ga0068868_100008484 | 3300005338 | Bacteria | 7356 |
| 39 | Ga0068868_100049789 | 3300005338 | Bacteria | 3288 |
| 40 | Ga0068868_100076000 | 3300005338 | Bacteria | 2685 |
| 41 | Ga0070660_100052028 | 3300005339 | Bacteria | 3156 |
| 42 | Ga0070689_100001229 | 3300005340 | Bacteria | 16275 |
| 43 | Ga0070689_100028459 | 3300005340 | Bacteria | 4224 |
| 44 | Ga0070691_10002807 | 3300005341 | Bacteria | 7775 |
| 45 | Ga0070691_10014898 | 3300005341 | Bacteria | 3570 |
| 46 | Ga0070691_10540913 | 3300005341 | Unclassified | 679 |
| 47 | Ga0070687_100007347 | 3300005343 | Bacteria | 4587 |
| 48 | Ga0070687_100071123 | 3300005343 | Bacteria | 1868 |
| 49 | Ga0070661_100001029 | 3300005344 | Bacteria | 19751 |
| 50 | Ga0070661_100381286 | 3300005344 | Bacteria | 1111 |
| 51 | Ga0070661_100458095 | 3300005344 | Bacteria | 1015 |
| 52 | Ga0070692_10021996 | 3300005345 | Bacteria | 3110 |
| 53 | Ga0070692_10050097 | 3300005345 | Bacteria | 2168 |
| 54 | Ga0070668_100101106 | 3300005347 | Bacteria | 2284 |
| 55 | Ga0070668_100117982 | 3300005347 | Bacteria | 2118 |
| 56 | Ga0070668_100637243 | 3300005347 | Bacteria | 935 |
| 57 | Ga0070669_100101857 | 3300005353 | Bacteria | 2167 |
| 58 | Ga0070669_101005627 | 3300005353 | Bacteria | 715 |
| 59 | Ga0070675_100041361 | 3300005354 | Bacteria | 3765 |
| 60 | Ga0070671_100017688 | 3300005355 | Bacteria | 5778 |
| 61 | Ga0070673_100009931 | 3300005364 | Bacteria | 6415 |
| 62 | Ga0070673_100015597 | 3300005364 | Bacteria | 5344 |
| 63 | Ga0070688_100001653 | 3300005365 | Bacteria | 11155 |
| 64 | Ga0070688_100256564 | 3300005365 | Bacteria | 1247 |
| 65 | Ga0070659_100012395 | 3300005366 | Bacteria | 6323 |
| 66 | Ga0070667_100652428 | 3300005367 | Bacteria | 972 |
| 67 | Ga0070703_10001628 | 3300005406 | Bacteria | 6671 |
| 68 | Ga0070703_10149018 | 3300005406 | Bacteria | 877 |
| 69 | Ga0070709_10259021 | 3300005434 | Bacteria | 1256 |
| 70 | Ga0070713_101398130 | 3300005436 | Bacteria | 679 |
| 71 | Ga0070710_10225712 | 3300005437 | Bacteria | 1194 |
| 72 | Ga0070701_10002577 | 3300005438 | Bacteria | 7025 |
| 73 | Ga0070701_10011908 | 3300005438 | Bacteria | 3905 |
| 74 | Ga0070711_100418326 | 3300005439 | Bacteria | 1091 |
| 75 | Ga0070705_100001468 | 3300005440 | Bacteria | 12477 |
| 76 | Ga0070705_100558158 | 3300005440 | Bacteria | 879 |
| 77 | Ga0070700_100038106 | 3300005441 | Bacteria | 2928 |
| 78 | Ga0070694_100009542 | 3300005444 | Bacteria | 5953 |
| 79 | Ga0070694_100023909 | 3300005444 | Bacteria | 3937 |
| 80 | Ga0070694_100095143 | 3300005444 | Bacteria | 2097 |
| 81 | Ga0070708_100220898 | 3300005445 | Bacteria | 1777 |
| 82 | Ga0070663_100011222 | 3300005455 | Bacteria | 5613 |
| 83 | Ga0070663_100014671 | 3300005455 | Bacteria | 5035 |
| 84 | Ga0070663_100202207 | 3300005455 | Bacteria | 1551 |
| 85 | Ga0070663_100325044 | 3300005455 | Bacteria | 1238 |
| 86 | Ga0070678_100005734 | 3300005456 | Bacteria | 7216 |
| 87 | Ga0070678_101032419 | 3300005456 | Bacteria | 757 |
| 88 | Ga0070662_100004392 | 3300005457 | Bacteria | 8912 |
| 89 | Ga0070662_100042618 | 3300005457 | Bacteria | 3242 |
| 90 | Ga0070681_10292809 | 3300005458 | Bacteria | 1538 |
| 91 | Ga0068867_100009633 | 3300005459 | Bacteria | 6811 |
| 92 | Ga0068867_100276687 | 3300005459 | Bacteria | 1375 |
| 93 | Ga0068867_101121393 | 3300005459 | Bacteria | 719 |
| 94 | Ga0070685_10002114 | 3300005466 | Bacteria | 10261 |
| 95 | Ga0070685_10003699 | 3300005466 | Bacteria | 7743 |
| 96 | Ga0070685_10612182 | 3300005466 | Bacteria | 785 |
| 97 | Ga0070706_100765960 | 3300005467 | Bacteria | 894 |
| 98 | Ga0070706_101677565 | 3300005467 | Bacteria | 579 |
| 99 | Ga0070698_100000332 | 3300005471 | Bacteria | 48527 |
| 100 | Ga0070699_100222618 | 3300005518 | Bacteria | 1682 |
| 101 | Ga0070699_102156121 | 3300005518 | Bacteria | 509 |
| 102 | Ga0070679_100017350 | 3300005530 | Bacteria | 6969 |
| 103 | Ga0070697_100652663 | 3300005536 | Bacteria | 927 |
| 104 | Ga0068853_100010770 | 3300005539 | Bacteria | 7407 |
| 105 | Ga0068853_100070079 | 3300005539 | Bacteria | 3051 |
| 106 | Ga0068853_100170174 | 3300005539 | Bacteria | 1971 |
| 107 | Ga0068853_102034546 | 3300005539 | Bacteria | 557 |
| 108 | Ga0070672_100000535 | 3300005543 | Bacteria | 22337 |
| 109 | Ga0070686_100001557 | 3300005544 | Bacteria | 12882 |
| 110 | Ga0070695_100002056 | 3300005545 | Bacteria | 11510 |
| 111 | Ga0070696_100002711 | 3300005546 | Bacteria | 11749 |
| 112 | Ga0070693_100000154 | 3300005547 | Bacteria | 31511 |
| 113 | Ga0070665_100002080 | 3300005548 | Bacteria | 22457 |
| 114 | Ga0070665_100031156 | 3300005548 | Bacteria | 5368 |
| 115 | Ga0070665_100171687 | 3300005548 | Bacteria | 2169 |
| 116 | Ga0070665_101732989 | 3300005548 | Bacteria | 632 |
| 117 | Ga0070704_100004467 | 3300005549 | Bacteria | 8078 |
| 118 | Ga0070704_100055291 | 3300005549 | Bacteria | 2813 |
| 119 | Ga0070704_101465364 | 3300005549 | Bacteria | 627 |
| 120 | Ga0068855_100025696 | 3300005563 | Bacteria | 7043 |
| 121 | Ga0068855_100042076 | 3300005563 | Bacteria | 5413 |
| 122 | Ga0068855_100643912 | 3300005563 | Bacteria | 1139 |
| 123 | Ga0070664_100134904 | 3300005564 | Bacteria | 2170 |
| 124 | Ga0070664_100711813 | 3300005564 | Bacteria | 936 |
| 125 | Ga0070664_101727368 | 3300005564 | Bacteria | 593 |
| 126 | Ga0068857_100165253 | 3300005577 | Bacteria | 2010 |
| 127 | Ga0068854_100055986 | 3300005578 | Bacteria | 2841 |
| 128 | Ga0068854_100289637 | 3300005578 | Bacteria | 1321 |
| 129 | Ga0068854_100823551 | 3300005578 | Bacteria | 811 |
| 130 | Ga0068856_100082746 | 3300005614 | Bacteria | 3186 |
| 131 | Ga0068856_100168664 | 3300005614 | Bacteria | 2200 |
| 132 | Ga0068856_100355589 | 3300005614 | Bacteria | 1483 |
| 133 | Ga0068856_100375329 | 3300005614 | Bacteria | 1441 |
| 134 | Ga0070702_100000735 | 3300005615 | Bacteria | 12415 |
| 135 | Ga0070702_100628446 | 3300005615 | Bacteria | 809 |
| 136 | Ga0068852_100006324 | 3300005616 | Bacteria | 8544 |
| 137 | Ga0068852_100040808 | 3300005616 | Bacteria | 3918 |
| 138 | Ga0068852_100230335 | 3300005616 | Bacteria | 1766 |
| 139 | Ga0068852_100672713 | 3300005616 | Bacteria | 1044 |
| 140 | Ga0068859_100007318 | 3300005617 | Bacteria | 11194 |
| 141 | Ga0068859_100059562 | 3300005617 | Bacteria | 3847 |
| 142 | Ga0068859_102794065 | 3300005617 | Bacteria | 536 |
| 143 | Ga0068864_100033819 | 3300005618 | Bacteria | 4346 |
| 144 | Ga0068864_100035855 | 3300005618 | Bacteria | 4224 |
| 145 | Ga0068864_100240958 | 3300005618 | Bacteria | 1676 |
| 146 | Ga0068866_10011784 | 3300005718 | Bacteria | 3793 |
| 147 | Ga0068866_10832658 | 3300005718 | Bacteria | 644 |
| 148 | Ga0068866_10982131 | 3300005718 | Bacteria | 599 |
| 149 | Ga0068861_100007761 | 3300005719 | Bacteria | 7371 |
| 150 | Ga0068861_100015603 | 3300005719 | Bacteria | 5358 |
| 151 | Ga0068861_100060602 | 3300005719 | Bacteria | 2901 |
| 152 | Ga0068861_100616611 | 3300005719 | Bacteria | 998 |
| 153 | Ga0068861_100753878 | 3300005719 | Bacteria | 910 |
| 154 | Ga0068851_10003102 | 3300005834 | Bacteria | 7359 |
| 155 | Ga0068851_10086087 | 3300005834 | Bacteria | 1648 |
| 156 | Ga0068870_10071101 | 3300005840 | Bacteria | 1898 |
| 157 | Ga0068863_100073454 | 3300005841 | Bacteria | 3235 |
| 158 | Ga0068863_100146383 | 3300005841 | Bacteria | 2259 |
| 159 | Ga0068863_100228353 | 3300005841 | Bacteria | 1795 |
| 160 | Ga0068858_100000756 | 3300005842 | Bacteria | 33914 |
| 161 | Ga0068858_100003657 | 3300005842 | Bacteria | 15222 |
| 162 | Ga0068858_100217629 | 3300005842 | Bacteria | 1808 |
| 163 | Ga0068858_100291441 | 3300005842 | Bacteria | 1556 |
| 164 | Ga0068860_100044984 | 3300005843 | Bacteria | 4208 |
| 165 | Ga0068860_100059465 | 3300005843 | Bacteria | 3633 |
| 166 | Ga0068860_100063051 | 3300005843 | Bacteria | 3521 |
| 167 | Ga0068860_100134028 | 3300005843 | Bacteria | 2378 |
| 168 | Ga0068862_100011814 | 3300005844 | Bacteria | 7212 |
| 169 | Ga0068862_100305414 | 3300005844 | Bacteria | 1465 |
| 170 | Ga0068862_100432315 | 3300005844 | Bacteria | 1237 |
| 171 | Ga0068862_101199244 | 3300005844 | Bacteria | 757 |
| 172 | Ga0081455_10003737 | 3300005937 | Bacteria | 17391 |
| 173 | Ga0081455_10074169 | 3300005937 | Bacteria | 2811 |
| 174 | Ga0081538_10037787 | 3300005981 | Bacteria | 3124 |
| 175 | Ga0081540_1006094 | 3300005983 | Bacteria | 8860 |
| 176 | Ga0081540_1017056 | 3300005983 | Bacteria | 4514 |
| 177 | Ga0081540_1030764 | 3300005983 | Bacteria | 2967 |
| 178 | Ga0070717_10522973 | 3300006028 | Bacteria | 1073 |
| 179 | Ga0075365_10008443 | 3300006038 | Bacteria | 5849 |
| 180 | Ga0075365_10202781 | 3300006038 | Bacteria | 1390 |
| 181 | Ga0075368_10110641 | 3300006042 | Bacteria | 1132 |
| 182 | Ga0075363_100000455 | 3300006048 | Bacteria | 12847 |
| 183 | Ga0075363_100060704 | 3300006048 | Bacteria | 2036 |
| 184 | Ga0075363_100079633 | 3300006048 | Bacteria | 1790 |
| 185 | Ga0075363_100326450 | 3300006048 | Bacteria | 893 |
| 186 | Ga0075364_10087364 | 3300006051 | Bacteria | 2066 |
| 187 | Ga0075364_10398619 | 3300006051 | Bacteria | 939 |
| 188 | Ga0075364_10494718 | 3300006051 | Bacteria | 836 |
| 189 | Ga0070715_10067289 | 3300006163 | Bacteria | 1590 |
| 190 | Ga0070715_10118611 | 3300006163 | Unclassified | 1258 |
| 191 | Ga0070712_100241719 | 3300006175 | Bacteria | 1438 |
| 192 | Ga0075362_10003653 | 3300006177 | Bacteria | 5423 |
| 193 | Ga0075362_10045697 | 3300006177 | Bacteria | 1945 |
| 194 | Ga0075362_10135936 | 3300006177 | Bacteria | 1172 |
| 195 | Ga0075367_10010124 | 3300006178 | Bacteria | 4944 |
| 196 | Ga0075367_10141495 | 3300006178 | Bacteria | 1490 |
| 197 | Ga0075367_10224715 | 3300006178 | Bacteria | 1175 |
| 198 | Ga0075367_10242518 | 3300006178 | Bacteria | 1129 |
| 199 | Ga0075367_10990864 | 3300006178 | Bacteria | 537 |
| 200 | Ga0075369_10012436 | 3300006186 | Bacteria | 3363 |
| 201 | Ga0075369_10127358 | 3300006186 | Bacteria | 1155 |
| 202 | Ga0075366_10008197 | 3300006195 | Bacteria | 5796 |
| 203 | Ga0075366_10014177 | 3300006195 | Bacteria | 4550 |
| 204 | Ga0075366_10205783 | 3300006195 | Bacteria | 1197 |
| 205 | Ga0075366_10259606 | 3300006195 | Bacteria | 1060 |
| 206 | Ga0075366_10395482 | 3300006195 | Bacteria | 850 |
| 207 | Ga0097621_100002904 | 3300006237 | Bacteria | 11770 |
| 208 | Ga0097621_100059011 | 3300006237 | Bacteria | 3140 |
| 209 | Ga0097621_100088621 | 3300006237 | Bacteria | 2586 |
| 210 | Ga0097621_100901204 | 3300006237 | Bacteria | 824 |
| 211 | Ga0097621_101001081 | 3300006237 | Bacteria | 782 |
| 212 | Ga0075370_10005629 | 3300006353 | Bacteria | 6251 |
| 213 | Ga0075370_10075093 | 3300006353 | Bacteria | 1938 |
| 214 | Ga0075370_10286135 | 3300006353 | Bacteria | 979 |
| 215 | Ga0075370_10489794 | 3300006353 | Bacteria | 741 |
| 216 | Ga0075370_10576002 | 3300006353 | Bacteria | 681 |
| 217 | Ga0068871_100014807 | 3300006358 | Bacteria | 5823 |
| 218 | Ga0068871_100581905 | 3300006358 | Bacteria | 1016 |
| 219 | Ga0068871_101370700 | 3300006358 | Bacteria | 666 |
| 220 | Ga0075428_100470496 | 3300006844 | Bacteria | 1345 |
| 221 | Ga0075430_100961025 | 3300006846 | Bacteria | 704 |
| 222 | Ga0075431_100501602 | 3300006847 | Bacteria | 1205 |
| 223 | Ga0075433_10024317 | 3300006852 | Bacteria | 5110 |
| 224 | Ga0075433_10488130 | 3300006852 | Bacteria | 1085 |
| 225 | Ga0075434_100000268 | 3300006871 | Bacteria | 37082 |
| 226 | Ga0075434_100144196 | 3300006871 | Bacteria | 2402 |
| 227 | Ga0075434_100522103 | 3300006871 | Bacteria | 1208 |
| 228 | Ga0075429_100202806 | 3300006880 | Bacteria | 1738 |
| 229 | Ga0075429_101506537 | 3300006880 | Unclassified | 585 |
| 230 | Ga0068865_100042182 | 3300006881 | Bacteria | 3110 |
| 231 | Ga0068865_100490731 | 3300006881 | Bacteria | 1022 |
| 232 | Ga0068865_100759089 | 3300006881 | Bacteria | 834 |
| 233 | Ga0097620_100007318 | 3300006931 | Bacteria | 11194 |
| 234 | Ga0097620_100059562 | 3300006931 | Bacteria | 3847 |
| 235 | Ga0097620_102793466 | 3300006931 | Bacteria | 536 |
| 236 | Ga0075435_100019709 | 3300007076 | Bacteria | 5156 |
| 237 | Ga0075435_100197793 | 3300007076 | Bacteria | 1703 |
| 238 | Ga0075435_100221421 | 3300007076 | Bacteria | 1607 |
| 239 | Ga0075435_101567756 | 3300007076 | Bacteria | 578 |
| 240 | Ga0105251_10318812 | 3300009011 | Bacteria | 706 |
| 241 | Ga0105244_10102018 | 3300009036 | Bacteria | 1403 |
| 242 | Ga0105240_10001365 | 3300009093 | Bacteria | 41929 |
| 243 | Ga0105240_10001750 | 3300009093 | Bacteria | 36686 |
| 244 | Ga0105240_10137221 | 3300009093 | Bacteria | 2928 |
| 245 | Ga0105240_10938822 | 3300009093 | Bacteria | 929 |
| 246 | Ga0111539_10095595 | 3300009094 | Bacteria | 3490 |
| 247 | Ga0111539_10105416 | 3300009094 | Bacteria | 3307 |
| 248 | Ga0111539_10404302 | 3300009094 | Bacteria | 1590 |
| 249 | Ga0111539_11734348 | 3300009094 | Bacteria | 724 |
| 250 | Ga0111539_12099748 | 3300009094 | Bacteria | 655 |
| 251 | Ga0111539_12478649 | 3300009094 | Bacteria | 602 |
| 252 | Ga0105245_10055110 | 3300009098 | Bacteria | 3570 |
| 253 | Ga0105245_10153904 | 3300009098 | Bacteria | 2176 |
| 254 | Ga0105245_10244437 | 3300009098 | Bacteria | 1741 |
| 255 | Ga0105245_10500778 | 3300009098 | Bacteria | 1231 |
| 256 | Ga0105245_10582627 | 3300009098 | Bacteria | 1143 |
| 257 | Ga0105247_10151404 | 3300009101 | Bacteria | 1529 |
| 258 | Ga0114129_10194241 | 3300009147 | Bacteria | 2754 |
| 259 | Ga0114129_10781676 | 3300009147 | Bacteria | 1220 |
| 260 | Ga0105243_10003084 | 3300009148 | Bacteria | 13721 |
| 261 | Ga0105243_10162546 | 3300009148 | Bacteria | 1927 |
| 262 | Ga0105243_10447539 | 3300009148 | Bacteria | 1211 |
| 263 | Ga0105243_10565717 | 3300009148 | Bacteria | 1089 |
| 264 | Ga0105243_10907788 | 3300009148 | Bacteria | 877 |
| 265 | Ga0105243_11097085 | 3300009148 | Bacteria | 804 |
| 266 | Ga0105241_10027594 | 3300009174 | Bacteria | 4228 |
| 267 | Ga0105241_10078094 | 3300009174 | Bacteria | 2586 |
| 268 | Ga0105241_10419789 | 3300009174 | Bacteria | 1177 |
| 269 | Ga0105242_10053170 | 3300009176 | Bacteria | 3306 |
| 270 | Ga0105242_10990553 | 3300009176 | Bacteria | 847 |
| 271 | Ga0105248_10000352 | 3300009177 | Bacteria | 53816 |
| 272 | Ga0105248_10061335 | 3300009177 | Bacteria | 4222 |
| 273 | Ga0105248_10356690 | 3300009177 | Bacteria | 1646 |
| 274 | Ga0105248_10399875 | 3300009177 | Bacteria | 1547 |
| 275 | Ga0105248_12448166 | 3300009177 | Bacteria | 595 |
| 276 | Ga0105237_10002406 | 3300009545 | Bacteria | 23232 |
| 277 | Ga0105237_10137513 | 3300009545 | Bacteria | 2437 |
| 278 | Ga0105237_10161891 | 3300009545 | Bacteria | 2236 |
| 279 | Ga0105237_10207704 | 3300009545 | Bacteria | 1958 |
| 280 | Ga0105237_10344713 | 3300009545 | Bacteria | 1494 |
| 281 | Ga0105237_10458474 | 3300009545 | Bacteria | 1281 |
| 282 | Ga0105238_10005159 | 3300009551 | Bacteria | 12913 |
| 283 | Ga0105238_10015404 | 3300009551 | Bacteria | 7737 |
| 284 | Ga0105249_10004799 | 3300009553 | Bacteria | 11670 |
| 285 | Ga0105249_10005381 | 3300009553 | Bacteria | 11047 |
| 286 | Ga0105249_11756889 | 3300009553 | Bacteria | 693 |
| 287 | Ga0105239_10003462 | 3300010375 | Bacteria | 19314 |
| 288 | Ga0105239_10060043 | 3300010375 | Bacteria | 4173 |
| 289 | Ga0105239_10290002 | 3300010375 | Bacteria | 1843 |
| 290 | Ga0105239_10339377 | 3300010375 | Bacteria | 1695 |
| 291 | Ga0105239_10796167 | 3300010375 | Bacteria | 1083 |
| 292 | Ga0105239_11050534 | 3300010375 | Bacteria | 937 |
| 293 | Ga0105246_10423131 | 3300011119 | Bacteria | 1112 |
| 294 | Ga0105246_10792331 | 3300011119 | Bacteria | 840 |
| 295 | Ga0157344_1016619 | 3300012476 | Bacteria | 596 |
| 296 | Ga0157369_10128044 | 3300013105 | Bacteria | 2691 |
| 297 | Ga0157369_10248046 | 3300013105 | Bacteria | 1859 |
| 298 | Ga0157374_10010141 | 3300013296 | Bacteria | 8092 |
| 299 | Ga0157374_10040465 | 3300013296 | Bacteria | 4293 |
| 300 | Ga0157374_10343849 | 3300013296 | Bacteria | 1481 |
| 301 | Ga0157378_10017932 | 3300013297 | Bacteria | 6214 |
| 302 | Ga0157378_12755335 | 3300013297 | Bacteria | 544 |
| 303 | Ga0163162_10012590 | 3300013306 | Bacteria | 8261 |
| 304 | Ga0163162_10077409 | 3300013306 | Bacteria | 3389 |
| 305 | Ga0163162_10938433 | 3300013306 | Bacteria | 977 |
| 306 | Ga0163162_11510754 | 3300013306 | Bacteria | 765 |
| 307 | Ga0163162_11614292 | 3300013306 | Bacteria | 740 |
| 308 | Ga0157372_10012358 | 3300013307 | Bacteria | 9098 |
| 309 | Ga0157372_10199654 | 3300013307 | Bacteria | 2317 |
| 310 | Ga0157372_10442654 | 3300013307 | Bacteria | 1515 |
| 311 | Ga0157375_10025113 | 3300013308 | Bacteria | 5528 |
| 312 | Ga0157375_10197154 | 3300013308 | Bacteria | 2169 |
| 313 | Ga0157375_11550506 | 3300013308 | Bacteria | 783 |
| 314 | Ga0163163_10575374 | 3300014325 | Bacteria | 1189 |
| 315 | Ga0163163_12274217 | 3300014325 | Unclassified | 601 |
| 316 | Ga0157380_10177063 | 3300014326 | Bacteria | 1870 |
| 317 | Ga0182008_10002443 | 3300014497 | Bacteria | 11651 |
| 318 | Ga0157377_10003140 | 3300014745 | Bacteria | 7441 |
| 319 | Ga0157379_10012182 | 3300014968 | Bacteria | 7512 |
| 320 | Ga0157379_10078488 | 3300014968 | Bacteria | 2957 |
| 321 | Ga0157379_10316922 | 3300014968 | Bacteria | 1423 |
| 322 | Ga0157379_10537474 | 3300014968 | Bacteria | 1086 |
| 323 | Ga0157379_10713621 | 3300014968 | Bacteria | 942 |
| 324 | Ga0157379_10716067 | 3300014968 | Bacteria | 940 |
| 325 | Ga0157376_10010318 | 3300014969 | Bacteria | 6826 |
| 326 | Ga0157376_10011188 | 3300014969 | Bacteria | 6603 |
| 327 | Ga0157376_10014392 | 3300014969 | Bacteria | 5938 |
| 328 | Ga0157376_10019400 | 3300014969 | Bacteria | 5240 |
| 329 | Ga0157376_10362243 | 3300014969 | Bacteria | 1391 |
| 330 | Ga0182006_1015371 | 3300015261 | Bacteria | 3282 |
| 331 | Ga0182006_1032465 | 3300015261 | Bacteria | 2098 |
| 332 | Ga0182007_10000248 | 3300015262 | Bacteria | 36273 |
| 333 | Ga0182005_1060862 | 3300015265 | Bacteria | 1031 |
| 334 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 335 | Ga0163161_10023592 | 3300017792 | Bacteria | 4341 |
| 336 | Ga0163161_10103072 | 3300017792 | Bacteria | 2126 |
| 337 | Ga0163161_10130342 | 3300017792 | Bacteria | 1896 |
| 338 | Ga0163161_10140371 | 3300017792 | Bacteria | 1829 |
| 339 | Ga0163161_10456352 | 3300017792 | Bacteria | 1034 |
| 340 | Ga0197907_11110502 | 3300020069 | Bacteria | 1147 |
| 341 | Ga0213872_10098361 | 3300021361 | Bacteria | 1306 |
| 342 | Ga0228598_1066106 | 3300024227 | Bacteria | 721 |
| 343 | Ga0209129_1013505 | 3300025258 | Bacteria | 1795 |
| 344 | Ga0209233_1000834 | 3300025261 | Bacteria | 13644 |
| 345 | Ga0209565_1006958 | 3300025263 | Bacteria | 3106 |
| 346 | Ga0209673_1032050 | 3300025273 | Bacteria | 1624 |
| 347 | Ga0209130_1002478 | 3300025284 | Bacteria | 9198 |
| 348 | Ga0209675_1001541 | 3300025291 | Bacteria | 13114 |
| 349 | Ga0209675_1050220 | 3300025291 | Bacteria | 864 |
| 350 | Ga0209676_1026211 | 3300025292 | Bacteria | 1855 |
| 351 | Ga0209025_1000183 | 3300025294 | Bacteria | 155799 |
| 352 | Ga0209025_1056343 | 3300025294 | Bacteria | 1512 |
| 353 | Ga0209025_1063136 | 3300025294 | Bacteria | 1369 |
| 354 | Ga0209564_1028907 | 3300025295 | Bacteria | 1758 |
| 355 | Ga0209758_1000146 | 3300025297 | Bacteria | 169246 |
| 356 | Ga0209050_1010058 | 3300025298 | Bacteria | 4724 |
| 357 | Ga0209256_1000030 | 3300025299 | Bacteria | 414828 |
| 358 | Ga0209051_1045816 | 3300025303 | Bacteria | 1509 |
| 359 | Ga0209257_1015596 | 3300025304 | Bacteria | 3148 |
| 360 | Ga0207697_10141647 | 3300025315 | Bacteria | 1043 |
| 361 | Ga0207656_10001704 | 3300025321 | Bacteria | 7303 |
| 362 | Ga0207656_10098113 | 3300025321 | Bacteria | 1340 |
| 363 | Ga0207696_1063097 | 3300025711 | Bacteria | 1039 |
| 364 | Ga0207653_10001915 | 3300025885 | Bacteria | 6658 |
| 365 | Ga0207682_10151563 | 3300025893 | Bacteria | 1046 |
| 366 | Ga0207642_10025520 | 3300025899 | Bacteria | 2392 |
| 367 | Ga0207642_10042446 | 3300025899 | Bacteria | 1999 |
| 368 | Ga0207710_10115502 | 3300025900 | Bacteria | 1278 |
| 369 | Ga0207710_10291184 | 3300025900 | Bacteria | 823 |
| 370 | Ga0207688_10013633 | 3300025901 | Bacteria | 4419 |
| 371 | Ga0207688_10065787 | 3300025901 | Bacteria | 2049 |
| 372 | Ga0207680_10000514 | 3300025903 | Bacteria | 18482 |
| 373 | Ga0207680_10242256 | 3300025903 | Bacteria | 1243 |
| 374 | Ga0207647_10000343 | 3300025904 | Bacteria | 37699 |
| 375 | Ga0207647_10102521 | 3300025904 | Bacteria | 1697 |
| 376 | Ga0207685_10020467 | 3300025905 | Bacteria | 2199 |
| 377 | Ga0207685_10351298 | 3300025905 | Unclassified | 743 |
| 378 | Ga0207645_10127703 | 3300025907 | Bacteria | 1653 |
| 379 | Ga0207645_10304743 | 3300025907 | Bacteria | 1061 |
| 380 | Ga0207645_10574841 | 3300025907 | Bacteria | 765 |
| 381 | Ga0207643_10132907 | 3300025908 | Bacteria | 1482 |
| 382 | Ga0207643_10575302 | 3300025908 | Bacteria | 724 |
| 383 | Ga0207705_10126912 | 3300025909 | Bacteria | 1897 |
| 384 | Ga0207654_10023245 | 3300025911 | Bacteria | 3318 |
| 385 | Ga0207654_10046619 | 3300025911 | Bacteria | 2472 |
| 386 | Ga0207654_10199287 | 3300025911 | Bacteria | 1317 |
| 387 | Ga0207707_10225892 | 3300025912 | Bacteria | 1629 |
| 388 | Ga0207695_10000014 | 3300025913 | Bacteria | 812599 |
| 389 | Ga0207695_10002945 | 3300025913 | Bacteria | 24564 |
| 390 | Ga0207695_10050167 | 3300025913 | Bacteria | 4393 |
| 391 | Ga0207695_10334421 | 3300025913 | Bacteria | 1403 |
| 392 | Ga0207671_10012055 | 3300025914 | Bacteria | 6984 |
| 393 | Ga0207671_10019307 | 3300025914 | Bacteria | 5213 |
| 394 | Ga0207671_10112050 | 3300025914 | Bacteria | 2077 |
| 395 | Ga0207671_10122883 | 3300025914 | Bacteria | 1985 |
| 396 | Ga0207693_10200331 | 3300025915 | Bacteria | 1570 |
| 397 | Ga0207663_10531075 | 3300025916 | Bacteria | 917 |
| 398 | Ga0207662_10002400 | 3300025918 | Bacteria | 9397 |
| 399 | Ga0207662_10006313 | 3300025918 | Bacteria | 6387 |
| 400 | Ga0207657_10061175 | 3300025919 | Bacteria | 3230 |
| 401 | Ga0207649_10000037 | 3300025920 | Bacteria | 131159 |
| 402 | Ga0207649_10018425 | 3300025920 | Bacteria | 3971 |
| 403 | Ga0207649_10047013 | 3300025920 | Bacteria | 2654 |
| 404 | Ga0207649_10660470 | 3300025920 | Bacteria | 808 |
| 405 | Ga0207646_10198791 | 3300025922 | Bacteria | 1810 |
| 406 | Ga0207646_10368091 | 3300025922 | Bacteria | 1299 |
| 407 | Ga0207694_10001692 | 3300025924 | Bacteria | 18479 |
| 408 | Ga0207694_10002417 | 3300025924 | Bacteria | 15274 |
| 409 | Ga0207694_10006199 | 3300025924 | Bacteria | 9130 |
| 410 | Ga0207694_10375558 | 3300025924 | Bacteria | 1179 |
| 411 | Ga0207650_10009560 | 3300025925 | Bacteria | 6629 |
| 412 | Ga0207650_10134352 | 3300025925 | Bacteria | 1939 |
| 413 | Ga0207650_10304619 | 3300025925 | Bacteria | 1302 |
| 414 | Ga0207650_10360867 | 3300025925 | Bacteria | 1197 |
| 415 | Ga0207650_10496649 | 3300025925 | Bacteria | 1019 |
| 416 | Ga0207659_10003322 | 3300025926 | Bacteria | 9640 |
| 417 | Ga0207659_10231911 | 3300025926 | Bacteria | 1489 |
| 418 | Ga0207659_10611412 | 3300025926 | Bacteria | 930 |
| 419 | Ga0207687_10005772 | 3300025927 | Bacteria | 8192 |
| 420 | Ga0207687_10010087 | 3300025927 | Bacteria | 6178 |
| 421 | Ga0207687_10073584 | 3300025927 | Bacteria | 2446 |
| 422 | Ga0207687_10087223 | 3300025927 | Bacteria | 2267 |
| 423 | Ga0207700_10420148 | 3300025928 | Bacteria | 1174 |
| 424 | Ga0207644_10026728 | 3300025931 | Bacteria | 3981 |
| 425 | Ga0207644_10038506 | 3300025931 | Bacteria | 3369 |
| 426 | Ga0207690_10085940 | 3300025932 | Bacteria | 2209 |
| 427 | Ga0207706_10004142 | 3300025933 | Bacteria | 13672 |
| 428 | Ga0207706_10085844 | 3300025933 | Bacteria | 2767 |
| 429 | Ga0207686_10005427 | 3300025934 | Bacteria | 6842 |
| 430 | Ga0207686_10211192 | 3300025934 | Bacteria | 1395 |
| 431 | Ga0207709_10001965 | 3300025935 | Bacteria | 13429 |
| 432 | Ga0207709_10110682 | 3300025935 | Bacteria | 1836 |
| 433 | Ga0207709_10198219 | 3300025935 | Bacteria | 1432 |
| 434 | Ga0207709_10257228 | 3300025935 | Bacteria | 1278 |
| 435 | Ga0207709_10576392 | 3300025935 | Bacteria | 888 |
| 436 | Ga0207670_10103945 | 3300025936 | Bacteria | 2033 |
| 437 | Ga0207670_10600520 | 3300025936 | Bacteria | 904 |
| 438 | Ga0207670_11273334 | 3300025936 | Bacteria | 623 |
| 439 | Ga0207669_10221230 | 3300025937 | Bacteria | 1390 |
| 440 | Ga0207669_10258611 | 3300025937 | Bacteria | 1301 |
| 441 | Ga0207704_10002727 | 3300025938 | Bacteria | 7961 |
| 442 | Ga0207691_10446324 | 3300025940 | Bacteria | 1101 |
| 443 | Ga0207711_10000928 | 3300025941 | Bacteria | 28240 |
| 444 | Ga0207711_10073901 | 3300025941 | Bacteria | 2964 |
| 445 | Ga0207711_10485257 | 3300025941 | Bacteria | 1151 |
| 446 | Ga0207711_11196663 | 3300025941 | Bacteria | 701 |
| 447 | Ga0207689_10002939 | 3300025942 | Bacteria | 15741 |
| 448 | Ga0207689_10014348 | 3300025942 | Bacteria | 6741 |
| 449 | Ga0207689_10035623 | 3300025942 | Bacteria | 4133 |
| 450 | Ga0207679_10049414 | 3300025945 | Bacteria | 3068 |
| 451 | Ga0207679_10374574 | 3300025945 | Bacteria | 1247 |
| 452 | Ga0207667_10017288 | 3300025949 | Bacteria | 8123 |
| 453 | Ga0207667_10163814 | 3300025949 | Bacteria | 2286 |
| 454 | Ga0207667_10191956 | 3300025949 | Bacteria | 2096 |
| 455 | Ga0207667_10525803 | 3300025949 | Bacteria | 1198 |
| 456 | Ga0207651_10020681 | 3300025960 | Bacteria | 3979 |
| 457 | Ga0207651_10064267 | 3300025960 | Bacteria | 2567 |
| 458 | Ga0207712_10001310 | 3300025961 | Bacteria | 17057 |
| 459 | Ga0207712_10003403 | 3300025961 | Bacteria | 10055 |
| 460 | Ga0207712_10343103 | 3300025961 | Bacteria | 1239 |
| 461 | Ga0207712_11029086 | 3300025961 | Bacteria | 731 |
| 462 | Ga0207712_11565065 | 3300025961 | Bacteria | 591 |
| 463 | Ga0207668_10073153 | 3300025972 | Bacteria | 2455 |
| 464 | Ga0207668_10079616 | 3300025972 | Bacteria | 2371 |
| 465 | Ga0207668_10314933 | 3300025972 | Bacteria | 1296 |
| 466 | Ga0207668_10612526 | 3300025972 | Bacteria | 949 |
| 467 | Ga0207640_10060009 | 3300025981 | Bacteria | 2512 |
| 468 | Ga0207640_10143177 | 3300025981 | Bacteria | 1745 |
| 469 | Ga0207640_10188242 | 3300025981 | Bacteria | 1554 |
| 470 | Ga0207658_10006474 | 3300025986 | Bacteria | 7992 |
| 471 | Ga0207658_10433451 | 3300025986 | Bacteria | 1161 |
| 472 | Ga0207658_10655717 | 3300025986 | Bacteria | 946 |
| 473 | Ga0207677_10003660 | 3300026023 | Bacteria | 8159 |
| 474 | Ga0207677_10039752 | 3300026023 | Bacteria | 3095 |
| 475 | Ga0207677_10061805 | 3300026023 | Bacteria | 2595 |
| 476 | Ga0207703_10000809 | 3300026035 | Bacteria | 30827 |
| 477 | Ga0207703_10027080 | 3300026035 | Bacteria | 4515 |
| 478 | Ga0207703_10123860 | 3300026035 | Bacteria | 2223 |
| 479 | Ga0207703_10386200 | 3300026035 | Bacteria | 1296 |
| 480 | Ga0207639_10003037 | 3300026041 | Bacteria | 11300 |
| 481 | Ga0207639_10056299 | 3300026041 | Bacteria | 3013 |
| 482 | Ga0207639_10133417 | 3300026041 | Bacteria | 2059 |
| 483 | Ga0207639_10143782 | 3300026041 | Bacteria | 1990 |
| 484 | Ga0207639_11260974 | 3300026041 | Bacteria | 694 |
| 485 | Ga0207678_10019586 | 3300026067 | Bacteria | 5948 |
| 486 | Ga0207678_10035028 | 3300026067 | Bacteria | 4370 |
| 487 | Ga0207678_10189322 | 3300026067 | Bacteria | 1758 |
| 488 | Ga0207678_10200056 | 3300026067 | Bacteria | 1708 |
| 489 | Ga0207678_10500377 | 3300026067 | Bacteria | 1059 |
| 490 | Ga0207708_10000761 | 3300026075 | Bacteria | 24206 |
| 491 | Ga0207708_10093621 | 3300026075 | Bacteria | 2319 |
| 492 | Ga0207708_10112522 | 3300026075 | Bacteria | 2114 |
| 493 | Ga0207702_10164430 | 3300026078 | Bacteria | 2029 |
| 494 | Ga0207702_10185644 | 3300026078 | Bacteria | 1917 |
| 495 | Ga0207641_10074603 | 3300026088 | Bacteria | 2926 |
| 496 | Ga0207641_10124314 | 3300026088 | Bacteria | 2307 |
| 497 | Ga0207641_10176091 | 3300026088 | Bacteria | 1956 |
| 498 | Ga0207648_10006903 | 3300026089 | Bacteria | 11247 |
| 499 | Ga0207648_10020283 | 3300026089 | Bacteria | 5989 |
| 500 | Ga0207648_10054061 | 3300026089 | Bacteria | 3508 |
| 501 | Ga0207648_10388115 | 3300026089 | Bacteria | 1263 |
| 502 | Ga0207648_11085464 | 3300026089 | Bacteria | 750 |
| 503 | Ga0207648_11186481 | 3300026089 | Bacteria | 717 |
| 504 | Ga0207676_10009546 | 3300026095 | Bacteria | 6907 |
| 505 | Ga0207676_10036609 | 3300026095 | Bacteria | 3735 |
| 506 | Ga0207676_10183074 | 3300026095 | Bacteria | 1836 |
| 507 | Ga0207675_100004533 | 3300026118 | Bacteria | 13400 |
| 508 | Ga0207675_100069868 | 3300026118 | Bacteria | 3282 |
| 509 | Ga0207675_100103318 | 3300026118 | Bacteria | 2685 |
| 510 | Ga0207675_101334879 | 3300026118 | Bacteria | 738 |
| 511 | Ga0207675_102250165 | 3300026118 | Bacteria | 560 |
| 512 | Ga0207683_10021200 | 3300026121 | Bacteria | 5560 |
| 513 | Ga0207683_11537410 | 3300026121 | Bacteria | 614 |
| 514 | Ga0207698_10010939 | 3300026142 | Bacteria | 5861 |
| 515 | Ga0207698_10059238 | 3300026142 | Bacteria | 2972 |
| 516 | Ga0207698_10119779 | 3300026142 | Bacteria | 2225 |
| 517 | Ga0207698_10248185 | 3300026142 | Bacteria | 1627 |
| 518 | Ga0207698_10309415 | 3300026142 | Bacteria | 1475 |
| 519 | Ga0207698_11042732 | 3300026142 | Bacteria | 829 |
| 520 | Ga0209813_10134718 | 3300027866 | Bacteria | 872 |
| 521 | Ga0207428_10028203 | 3300027907 | Bacteria | 4666 |
| 522 | Ga0207428_10219789 | 3300027907 | Bacteria | 1424 |
| 523 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 524 | Ga0268266_10008473 | 3300028379 | Bacteria | 9138 |
| 525 | Ga0268266_10282193 | 3300028379 | Bacteria | 1544 |
| 526 | Ga0268266_10850377 | 3300028379 | Bacteria | 882 |
| 527 | Ga0268266_11013865 | 3300028379 | Bacteria | 803 |
| 528 | Ga0268265_10127381 | 3300028380 | Bacteria | 2110 |
| 529 | Ga0268265_10155113 | 3300028380 | Bacteria | 1936 |
| 530 | Ga0268265_10169456 | 3300028380 | Bacteria | 1864 |
| 531 | Ga0268264_10014865 | 3300028381 | Bacteria | 6393 |
| 532 | Ga0268264_10140100 | 3300028381 | Bacteria | 2156 |
| 533 | Ga0268264_10178257 | 3300028381 | Bacteria | 1928 |
| 534 | Ga0268264_10514206 | 3300028381 | Bacteria | 1169 |
| 535 | Ga0307517_10187960 | 3300028786 | Bacteria | 1318 |
| 536 | Ga0307515_10084357 | 3300028794 | Bacteria | 4081 |
| 537 | Ga0307515_10338516 | 3300028794 | Bacteria | 1158 |
| 538 | Ga0265760_10121233 | 3300031090 | Bacteria | 840 |
| 539 | Ga0265327_10240060 | 3300031251 | Bacteria | 810 |
| 540 | Ga0307513_10037594 | 3300031456 | Bacteria | 5386 |
| 541 | Ga0307513_10398454 | 3300031456 | Bacteria | 1111 |
| 542 | Ga0307513_10961020 | 3300031456 | Bacteria | 563 |
| 543 | Ga0307509_10224369 | 3300031507 | Bacteria | 1688 |
| 544 | Ga0307408_100256560 | 3300031548 | Bacteria | 1445 |
| 545 | Ga0307508_10415536 | 3300031616 | Bacteria | 937 |
| 546 | Ga0307508_10683725 | 3300031616 | Bacteria | 634 |
| 547 | Ga0307516_10353758 | 3300031730 | Bacteria | 1134 |
| 548 | Ga0307516_10782661 | 3300031730 | Bacteria | 615 |
| 549 | Ga0307412_10002067 | 3300031911 | Bacteria | 11137 |
| 550 | Ga0307412_10751925 | 3300031911 | Bacteria | 842 |
| 551 | Ga0307409_100686024 | 3300031995 | Bacteria | 1022 |
| 552 | Ga0307416_100554192 | 3300032002 | Bacteria | 1223 |
| 553 | Ga0307414_10015644 | 3300032004 | Bacteria | 4584 |
| 554 | Ga0307414_10031431 | 3300032004 | Bacteria | 3482 |
| 555 | Ga0307414_10062929 | 3300032004 | Bacteria | 2635 |
| 556 | Ga0307414_10337673 | 3300032004 | Bacteria | 1288 |
| 557 | Ga0307414_10350776 | 3300032004 | Bacteria | 1266 |
| 558 | Ga0307414_10797192 | 3300032004 | Bacteria | 861 |
| 559 | Ga0307507_10271211 | 3300033179 | Bacteria | 1072 |
| 560 | Ga0307510_10055864 | 3300033180 | Bacteria | 4119 |
| 561 | Ga0373948_0035731 | 3300034817 | Bacteria | 1021 |
| 562 | Ga0373938_0043981 | 3300034957 | Bacteria | 1001 |
| 563 | Ga0373938_0083114 | 3300034957 | Bacteria | 782 |
| 564 | Ga0373926_0150119 | 3300035083 | Unclassified | 887 |
| 565 | Ga0373929_0015780 | 3300035085 | Bacteria | 1473 |
| 566 | Ga0373934_0111668 | 3300035086 | Bacteria | 1109 |
| 567 | Ga0373940_0311132 | 3300035088 | Bacteria | 544 |
| 568 | Ga0373949_0112229 | 3300035090 | Bacteria | 757 |
| 569 | Ga0373951_0008700 | 3300035091 | Bacteria | 2288 |
| 570 | Ga0373952_0123576 | 3300035092 | Bacteria | 704 |
| 571 | Ga0373932_0006748 | 3300035112 | Bacteria | 2722 |
| 572 | Ga0373932_0130089 | 3300035112 | Bacteria | 848 |
| 573 | Ga0373939_0006074 | 3300035114 | Bacteria | 2900 |
| 574 | Ga0373941_0067073 | 3300035115 | Bacteria | 1182 |
| 575 | Ga0373956_0345455 | 3300035119 | Bacteria | 709 |
| 576 | Ga0373942_0022164 | 3300035207 | Bacteria | 1609 |
| 577 | Ga0373961_0356979 | 3300035241 | Bacteria | 552 |
| 578 | Ga0373962_0195340 | 3300035242 | Bacteria | 683 |
| 579 | Ga0373931_0009571 | 3300035691 | Bacteria | 4635 |
| 580 | Ga0373931_0034502 | 3300035691 | Bacteria | 2626 |
| 581 | Ga0373935_1171713 | 3300035692 | Bacteria | 573 |
| 582 | Ga0373927_0693648 | 3300035695 | Bacteria | 673 |
| 583 | Ga0373933_0172990 | 3300035724 | Bacteria | 1375 |
| 584 | Ga0373933_0624264 | 3300035724 | Bacteria | 708 |
| 585 | Ga0373937_0281918 | 3300036401 | Unclassified | 1569 |
| 586 | Ga0373937_1338728 | 3300036401 | Bacteria | 664 |
| 587 | Ga0373925_0075599 | 3300037068 | Bacteria | 2553 |
| 588 | Ga0395905_0008017 | 3300037471 | Bacteria | 10435 |
| 589 | Ga0395905_0919983 | 3300037471 | Bacteria | 778 |
| 590 | Ga0395905_1142011 | 3300037471 | Bacteria | 682 |
| 591 | Ga0436361_0293969 | 3300039447 | Bacteria | 1857 |
| 592 | Ga0439436_0020251 | 3300041404 | Bacteria | 1981 |
| 593 | Ga0439439_0081823 | 3300041406 | Bacteria | 874 |
| 594 | Ga0439453_0023047 | 3300041408 | Bacteria | 1134 |
| 595 | Ga0439466_0001152 | 3300041411 | Bacteria | 10285 |
| 596 | Ga0439465_0023660 | 3300041413 | Bacteria | 1933 |
| 597 | Ga0451800_1417645 | 3300041459 | Bacteria | 661 |
| 598 | Ga0451807_2500867 | 3300041486 | Bacteria | 610 |
| 599 | Ga0439431_0000492 | 3300041997 | Bacteria | 8361 |
| 600 | Ga0439433_0000544 | 3300041999 | Bacteria | 7112 |
| 601 | Ga0439442_009444 | 3300042002 | Bacteria | 1973 |
| 602 | Ga0439445_0003464 | 3300042004 | Bacteria | 3538 |
| 603 | Ga0439432_000899 | 3300042006 | Bacteria | 11161 |
| 604 | Ga0439449_0001320 | 3300042007 | Bacteria | 9713 |
| 605 | Ga0439452_001474 | 3300042010 | Bacteria | 9582 |
| 606 | Ga0439457_127838 | 3300042014 | Bacteria | 603 |
| 607 | Ga0439462_0010319 | 3300042015 | Bacteria | 2365 |
| 608 | Ga0439462_0010713 | 3300042015 | Bacteria | 2326 |
| 609 | Ga0450911_000674 | 3300042115 | Bacteria | 10220 |
| 610 | Ga0450921_012501 | 3300042123 | Bacteria | 737 |
| 611 | Ga0450923_033822 | 3300042125 | Bacteria | 1052 |
| 612 | Ga0450899_020533 | 3300042135 | Bacteria | 771 |
| 613 | Ga0439446_0008427 | 3300042156 | Bacteria | 2736 |
| 614 | Ga0439434_0006793 | 3300042435 | Bacteria | 3343 |
| 615 | Ga0451577_0636036 | 3300042876 | Bacteria | 968 |
| 616 | Ga0466969_0057023 | 3300044656 | Bacteria | 1905 |
| 617 | Ga0466961_0307626 | 3300044693 | Bacteria | 967 |
| 618 | Ga0466964_0154252 | 3300044706 | Bacteria | 1068 |
| 619 | Ga0453684_0253483 | 3300044712 | Bacteria | 2020 |
| 620 | Ga0466968_0073615 | 3300044735 | Bacteria | 1491 |
| 621 | Ga0466970_0024375 | 3300044765 | Bacteria | 3163 |
| 622 | Ga0466957_0149423 | 3300044842 | Bacteria | 1510 |
| 623 | Ga0466959_0094204 | 3300045049 | Bacteria | 2148 |
| 624 | Ga0466959_0723687 | 3300045049 | Bacteria | 667 |
| 625 | Ga0451576_0000756 | 3300045051 | Bacteria | 64364 |
| 626 | Ga0451576_0063519 | 3300045051 | Bacteria | 3849 |
| 627 | Ga0451576_0097489 | 3300045051 | Bacteria | 3057 |
| 628 | Ga0451576_0179222 | 3300045051 | Bacteria | 2212 |
| 629 | Ga0451576_0295841 | 3300045051 | Bacteria | 1692 |
| 630 | Ga0451576_0599656 | 3300045051 | Bacteria | 1157 |
| 631 | Ga0451576_0850506 | 3300045051 | Bacteria | 957 |
| 632 | Ga0451576_1813450 | 3300045051 | Bacteria | 630 |
| 633 | Ga0466958_0631066 | 3300045836 | Bacteria | 697 |
| 634 | Ga0495617_105608 | 3300046452 | Bacteria | 913 |
| 635 | Ga0495592_0288778 | 3300046454 | Bacteria | 1070 |
| 636 | Ga0495603_0029113 | 3300046455 | Bacteria | 3331 |
| 637 | Ga0495603_0201348 | 3300046455 | Bacteria | 1151 |
| 638 | Ga0495629_0000008 | 3300046459 | Bacteria | 352138 |
| 639 | Ga0495629_0057102 | 3300046459 | Bacteria | 2730 |
| 640 | Ga0495638_0082463 | 3300046460 | Bacteria | 1950 |
| 641 | Ga0495638_0204954 | 3300046460 | Bacteria | 1111 |
| 642 | Ga0495653_0321950 | 3300046463 | Unclassified | 1002 |
| 643 | Ga0495653_0542660 | 3300046463 | Unclassified | 720 |
| 644 | Ga0495650_0099792 | 3300046471 | Bacteria | 1092 |
| 645 | Ga0495582_0674775 | 3300046473 | Bacteria | 598 |
| 646 | Ga0495664_0416636 | 3300046477 | Bacteria | 806 |
| 647 | Ga0495584_0471175 | 3300046491 | Bacteria | 639 |
| 648 | Ga0495584_0582862 | 3300046491 | Bacteria | 570 |
| 649 | Ga0495585_0174459 | 3300046492 | Bacteria | 1108 |
| 650 | Ga0495594_0119664 | 3300046499 | Bacteria | 1488 |
| 651 | Ga0495607_0418186 | 3300046501 | Bacteria | 607 |
| 652 | Ga0495606_0207598 | 3300046507 | Bacteria | 1112 |
| 653 | Ga0495606_0276653 | 3300046507 | Bacteria | 920 |
| 654 | Ga0495608_0003267 | 3300046511 | Bacteria | 11580 |
| 655 | Ga0495608_0102807 | 3300046511 | Bacteria | 1842 |
| 656 | Ga0495616_0032869 | 3300046513 | Bacteria | 2707 |
| 657 | Ga0495620_0083564 | 3300046515 | Bacteria | 1289 |
| 658 | Ga0495628_0554772 | 3300046516 | Bacteria | 824 |
| 659 | Ga0495632_0058932 | 3300046519 | Bacteria | 1869 |
| 660 | Ga0495632_0209603 | 3300046519 | Bacteria | 884 |
| 661 | Ga0495637_0177352 | 3300046520 | Bacteria | 792 |
| 662 | Ga0495643_0307107 | 3300046522 | Bacteria | 721 |
| 663 | Ga0495643_0346058 | 3300046522 | Bacteria | 667 |
| 664 | Ga0495663_0001336 | 3300046525 | Bacteria | 7791 |
| 665 | Ga0495642_0045754 | 3300046528 | Bacteria | 1789 |
| 666 | Ga0495640_0331961 | 3300046533 | Unclassified | 941 |
| 667 | Ga0495586_0505439 | 3300046535 | Bacteria | 697 |
| 668 | Ga0495587_0270497 | 3300046536 | Bacteria | 953 |
| 669 | Ga0495598_0082289 | 3300046537 | Bacteria | 1035 |
| 670 | Ga0495609_0171341 | 3300046538 | Bacteria | 916 |
| 671 | Ga0495621_0126242 | 3300046539 | Bacteria | 992 |
| 672 | Ga0495622_0053012 | 3300046557 | Bacteria | 1882 |
| 673 | Ga0495622_0182991 | 3300046557 | Bacteria | 939 |
| 674 | Ga0495633_0006199 | 3300046558 | Bacteria | 7143 |
| 675 | Ga0495667_0036342 | 3300046559 | Unclassified | 3289 |
| 676 | Ga0495656_0003280 | 3300046615 | Bacteria | 5457 |
| 677 | Ga0495656_0104827 | 3300046615 | Bacteria | 1313 |
| 678 | Ga0495656_0284002 | 3300046615 | Bacteria | 844 |
| 679 | Ga0495668_0386557 | 3300046616 | Bacteria | 769 |
| 680 | Ga0495611_0370529 | 3300046648 | Bacteria | 656 |
| 681 | Ga0495625_0558563 | 3300046660 | Bacteria | 692 |
| 682 | Ga0495635_0439183 | 3300046663 | Bacteria | 864 |
| 683 | Ga0495659_0220730 | 3300046664 | Bacteria | 783 |
| 684 | Ga0495659_0355867 | 3300046664 | Bacteria | 626 |
| 685 | Ga0495588_0026527 | 3300046674 | Bacteria | 2893 |
| 686 | Ga0495657_0129382 | 3300046675 | Bacteria | 1583 |
| 687 | Ga0495657_0320263 | 3300046675 | Bacteria | 922 |
| 688 | Ga0495657_0440519 | 3300046675 | Bacteria | 764 |
| 689 | Ga0495599_0118626 | 3300046678 | Bacteria | 1645 |
| 690 | Ga0495647_0134897 | 3300046681 | Bacteria | 1049 |
| 691 | Ga0495658_0163611 | 3300046683 | Bacteria | 1374 |
| 692 | Ga0495658_0761843 | 3300046683 | Unclassified | 620 |
| 693 | Ga0495613_0590161 | 3300046689 | Bacteria | 740 |
| 694 | Ga0495624_0171618 | 3300046690 | Bacteria | 1323 |
| 695 | Ga0495624_0401892 | 3300046690 | Bacteria | 822 |
| 696 | Ga0495624_0596835 | 3300046690 | Bacteria | 658 |
| 697 | Ga0495670_0090661 | 3300046691 | Bacteria | 1564 |
| 698 | Ga0495670_0233202 | 3300046691 | Bacteria | 979 |
| 699 | Ga0495671_0104821 | 3300046692 | Bacteria | 1381 |
| 700 | Ga0495649_0001665 | 3300046694 | Bacteria | 16510 |
| 701 | Ga0495600_0449531 | 3300046809 | Bacteria | 797 |
| 702 | Ga0495660_0058223 | 3300046810 | Bacteria | 2082 |
| 703 | Ga0495660_0133190 | 3300046810 | Bacteria | 1245 |
| 704 | Ga0495581_0688306 | 3300047315 | Bacteria | 590 |
| 705 | Ga0495636_0246165 | 3300047318 | Bacteria | 826 |
| 706 | Ga0495636_0607055 | 3300047318 | Bacteria | 535 |
| 707 | Ga0495672_0104127 | 3300047320 | Bacteria | 1534 |
| 708 | Ga0495676_0045195 | 3300047321 | Bacteria | 3587 |
| 709 | Ga0495676_0099067 | 3300047321 | Bacteria | 2161 |
| 710 | Ga0495680_0071991 | 3300047322 | Unclassified | 2630 |
| 711 | Ga0495683_0189872 | 3300047323 | Bacteria | 933 |
| 712 | Ga0495687_008648 | 3300047443 | Bacteria | 5799 |
| 713 | Ga0495687_059520 | 3300047443 | Bacteria | 1579 |
| 714 | Ga0495685_172500 | 3300047447 | Bacteria | 698 |
| 715 | Ga0495681_0349180 | 3300047470 | Bacteria | 563 |
| 716 | Ga0495684_0000691 | 3300047471 | Bacteria | 27167 |
| 717 | Ga0495686_0000478 | 3300047472 | Bacteria | 59593 |
| 718 | Ga0495686_0102336 | 3300047472 | Bacteria | 1726 |
| 719 | Ga0495686_0102430 | 3300047472 | Bacteria | 1725 |
| 720 | Ga0495686_0218347 | 3300047472 | Bacteria | 1086 |
| 721 | Ga0495593_0443050 | 3300047673 | Bacteria | 650 |
| 722 | Ga0495602_0590597 | 3300048088 | Bacteria | 765 |
| 723 | Ga0495615_0001947 | 3300048090 | Bacteria | 3195 |
| 724 | Ga0495615_0036958 | 3300048090 | Bacteria | 1201 |
| 725 | Ga0495626_0068486 | 3300048091 | Bacteria | 1600 |
| 726 | Ga0496100_0017819 | 3300048903 | Bacteria | 4201 |
| 727 | Ga0496100_0050598 | 3300048903 | Bacteria | 2693 |
| 728 | Ga0496101_0012043 | 3300048904 | Bacteria | 5762 |
| 729 | Ga0496101_0012131 | 3300048904 | Bacteria | 5744 |
| 730 | Ga0496102_0019066 | 3300048905 | Bacteria | 6038 |
| 731 | Ga0496102_0101892 | 3300048905 | Bacteria | 2668 |
| 732 | Ga0496102_0316653 | 3300048905 | Bacteria | 1470 |
| 733 | Ga0496102_0573682 | 3300048905 | Bacteria | 1051 |
| 734 | Ga0496103_0384545 | 3300048906 | Bacteria | 902 |
| 735 | Ga0496104_0038566 | 3300048907 | Bacteria | 4471 |
| 736 | Ga0496104_0375199 | 3300048907 | Bacteria | 1335 |
| 737 | Ga0496105_0002707 | 3300048908 | Bacteria | 12922 |
| 738 | Ga0496106_0054826 | 3300048909 | Bacteria | 3012 |
| 739 | Ga0496106_0113752 | 3300048909 | Bacteria | 2110 |
| 740 | Ga0496106_0204280 | 3300048909 | Bacteria | 1573 |
| 741 | Ga0496106_0481811 | 3300048909 | Bacteria | 997 |
| 742 | Ga0496107_0119804 | 3300048910 | Bacteria | 1938 |
| 743 | Ga0496107_0267265 | 3300048910 | Bacteria | 1273 |
| 744 | Ga0496108_0015709 | 3300048911 | Bacteria | 6176 |
| 745 | Ga0496108_0042495 | 3300048911 | Bacteria | 3795 |
| 746 | Ga0496108_0082179 | 3300048911 | Bacteria | 2731 |
| 747 | Ga0496108_0220030 | 3300048911 | Bacteria | 1650 |
| 748 | Ga0496108_0671352 | 3300048911 | Bacteria | 900 |
| 749 | Ga0496109_0014190 | 3300048912 | Bacteria | 6929 |
| 750 | Ga0496109_0057212 | 3300048912 | Bacteria | 3559 |
| 751 | Ga0496109_0099704 | 3300048912 | Bacteria | 2694 |
| 752 | Ga0496109_0435650 | 3300048912 | Bacteria | 1238 |
| 753 | Ga0496110_0111462 | 3300048913 | Bacteria | 2459 |
| 754 | Ga0496110_0330956 | 3300048913 | Bacteria | 1387 |
| 755 | Ga0496110_0441118 | 3300048913 | Bacteria | 1187 |
| 756 | Ga0496111_0027198 | 3300048914 | Bacteria | 4045 |
| 757 | Ga0496111_0120729 | 3300048914 | Bacteria | 1936 |
| 758 | Ga0496111_0126926 | 3300048914 | Bacteria | 1886 |
| 759 | Ga0496112_0520490 | 3300048915 | Bacteria | 1124 |
| 760 | Ga0496113_0143784 | 3300048916 | Bacteria | 1878 |
| 761 | Ga0496114_0002742 | 3300048917 | Bacteria | 13470 |
| 762 | Ga0496114_0068903 | 3300048917 | Bacteria | 2970 |
| 763 | Ga0496114_0288187 | 3300048917 | Bacteria | 1448 |
| 764 | Ga0496115_0029002 | 3300048918 | Bacteria | 4343 |
| 765 | Ga0496116_0000370 | 3300048919 | Bacteria | 67584 |
| 766 | Ga0496118_0017779 | 3300048921 | Bacteria | 6453 |
| 767 | Ga0496118_0078896 | 3300048921 | Bacteria | 2327 |
| 768 | Ga0496121_0004954 | 3300048924 | Bacteria | 17469 |
| 769 | Ga0496121_0168228 | 3300048924 | Bacteria | 1595 |
| 770 | Ga0496121_0318318 | 3300048924 | Bacteria | 1048 |
| 771 | Ga0496122_0030764 | 3300048925 | Bacteria | 4487 |
| 772 | Ga0496122_0505246 | 3300048925 | Bacteria | 586 |
| 773 | Ga0496123_0023620 | 3300048926 | Bacteria | 4701 |
| 774 | Ga0496124_0142044 | 3300048927 | Bacteria | 1893 |
| 775 | Ga0496124_0183000 | 3300048927 | Bacteria | 1611 |
| 776 | Ga0496124_0299631 | 3300048927 | Bacteria | 1162 |
| 777 | Ga0496124_0304386 | 3300048927 | Bacteria | 1149 |
| 778 | Ga0496125_0044534 | 3300048928 | Bacteria | 3751 |
| 779 | Ga0496125_0079102 | 3300048928 | Bacteria | 2523 |
| 780 | Ga0496126_0004800 | 3300048929 | Bacteria | 15883 |
| 781 | Ga0496126_0014970 | 3300048929 | Bacteria | 7820 |
| 782 | Ga0496126_0168632 | 3300048929 | Bacteria | 1867 |
| 783 | Ga0496126_0336530 | 3300048929 | Bacteria | 1237 |
| 784 | Ga0495678_058037 | 3300049459 | Bacteria | 1464 |
| 785 | Ga0501046_0277044 | 3300049580 | Bacteria | 1229 |
| 786 | Ga0501253_001678 | 3300049683 | Bacteria | 2323 |
| 787 | Ga0501035_0033759 | 3300049822 | Bacteria | 4651 |
| 788 | nmdc:mga03683_113908_c1 | 3300050489 | Bacteria | 1198 |
| 789 | nmdc:mga03683_16375_c1 | 3300050489 | Bacteria | 2784 |
| 790 | nmdc:mga03683_178440_c1 | 3300050489 | Bacteria | 968 |
| 791 | nmdc:mga03683_73065_c1 | 3300050489 | Bacteria | 1470 |
| 792 | nmdc:mga03n38_140710_c1 | 3300050490 | Bacteria | 1205 |
| 793 | nmdc:mga00v17_160761_c1 | 3300050491 | Bacteria | 1446 |
| 794 | nmdc:mga00v17_206551_c1 | 3300050491 | Bacteria | 1270 |
| 795 | nmdc:mga0yw44_16659_c1 | 3300050492 | Bacteria | 3978 |
| 796 | nmdc:mga0yw44_39719_c1 | 3300050492 | Bacteria | 2792 |
| 797 | nmdc:mga0yw44_771708_c1 | 3300050492 | Bacteria | 653 |
| 798 | nmdc:mga0k408_15743_c1 | 3300050493 | Bacteria | 4187 |
| 799 | nmdc:mga0k408_215103_c1 | 3300050493 | Bacteria | 1148 |
| 800 | nmdc:mga0k408_25116_c1 | 3300050493 | Bacteria | 3372 |
| 801 | nmdc:mga0k408_285659_c1 | 3300050493 | Bacteria | 985 |
| 802 | nmdc:mga0k408_371395_c1 | 3300050493 | Bacteria | 852 |
| 803 | nmdc:mga0k408_43188_c1 | 3300050493 | Bacteria | 2597 |
| 804 | nmdc:mga06z11_287434_c1 | 3300050494 | Bacteria | 975 |
| 805 | nmdc:mga06z11_575805_c1 | 3300050494 | Bacteria | 684 |
| 806 | nmdc:mga06z11_805013_c1 | 3300050494 | Bacteria | 573 |
| 807 | nmdc:mga07m45_141082_c1 | 3300050496 | Bacteria | 1396 |
| 808 | nmdc:mga07m45_38124_c1 | 3300050496 | Bacteria | 2682 |
| 809 | nmdc:mga07m45_6048_c1 | 3300050496 | Bacteria | 6092 |
| 810 | nmdc:mga07m45_72906_c1 | 3300050496 | Bacteria | 1955 |
| 811 | nmdc:mga07m45_896_c1 | 3300050496 | Bacteria | 3108 |
| 812 | nmdc:mga05p37_381692_c1 | 3300050507 | Bacteria | 1651 |
| 813 | nmdc:mga09592_716109_c1 | 3300050508 | Bacteria | 851 |
| 814 | nmdc:mga06r32_2023656_c1 | 3300050510 | Bacteria | 509 |
| 815 | nmdc:mga08y16_211707_c1 | 3300050511 | Bacteria | 2008 |
| 816 | nmdc:mga08y16_29543_c1 | 3300050511 | Bacteria | 5774 |
| 817 | nmdc:mga08y16_305202_c1 | 3300050511 | Bacteria | 1640 |
| 818 | nmdc:mga0n895_41470_c1 | 3300050512 | Bacteria | 4475 |
| 819 | nmdc:mga0n895_802118_c1 | 3300050512 | Bacteria | 932 |
| 820 | nmdc:mga0n895_83244_c1 | 3300050512 | Bacteria | 3191 |
| 821 | nmdc:mga0rr50_1054745_c1 | 3300050513 | Bacteria | 692 |
| 822 | nmdc:mga0rr50_267198_c1 | 3300050513 | Bacteria | 1425 |
| 823 | nmdc:mga0rr50_330631_c1 | 3300050513 | Bacteria | 1279 |
| 824 | nmdc:mga08x19_178555_c1 | 3300050514 | Bacteria | 1448 |
| 825 | nmdc:mga08x19_283377_c1 | 3300050514 | Bacteria | 1148 |
| 826 | nmdc:mga0a205_209579_c2 | 3300050515 | Bacteria | 1474 |
| 827 | nmdc:mga0a205_26067_c1 | 3300050515 | Bacteria | 5570 |
| 828 | nmdc:mga0sz30_18350_c1 | 3300050516 | Bacteria | 2799 |
| 829 | Ga0495601_0366609 | 3300053077 | Bacteria | 936 |
| 830 | Ga0500578_0060252 | 3300053086 | Bacteria | 2425 |
| 831 | Ga0500644_0026432 | 3300053088 | Bacteria | 1796 |
| 832 | Ga0500644_0048263 | 3300053088 | Bacteria | 1448 |
| 833 | Ga0500646_0121039 | 3300053090 | Bacteria | 842 |
| 834 | Ga0500646_0156192 | 3300053090 | Bacteria | 759 |
| 835 | Ga0500557_070692 | 3300053105 | Bacteria | 1144 |
| 836 | Ga0500562_004456 | 3300053108 | Bacteria | 3541 |
| 837 | Ga0500595_009175 | 3300053119 | Bacteria | 4004 |
| 838 | Ga0500621_215512 | 3300053126 | Bacteria | 669 |
| 839 | Ga0500642_0001506 | 3300053130 | Bacteria | 6719 |
| 840 | Ga0500655_072100 | 3300053133 | Bacteria | 705 |
| 841 | Ga0500658_0006918 | 3300053134 | Bacteria | 4198 |
| 842 | Ga0500568_0151235 | 3300053139 | Bacteria | 859 |
| 843 | Ga0500577_0165746 | 3300053142 | Bacteria | 943 |
| 844 | Ga0500588_0101422 | 3300053146 | Bacteria | 993 |
| 845 | Ga0500603_189308 | 3300053150 | Bacteria | 650 |
| 846 | Ga0500604_0144979 | 3300053151 | Bacteria | 804 |
| 847 | Ga0500616_0249811 | 3300053153 | Bacteria | 758 |
| 848 | Ga0500622_0000548 | 3300053156 | Bacteria | 34530 |
| 849 | Ga0500627_0238885 | 3300053158 | Bacteria | 807 |
| 850 | Ga0500627_0420783 | 3300053158 | Bacteria | 566 |
| 851 | Ga0500633_0107593 | 3300053160 | Bacteria | 1031 |
| 852 | Ga0500634_0240700 | 3300053161 | Bacteria | 760 |
| 853 | Ga0500637_0266664 | 3300053178 | Bacteria | 949 |
| 854 | Ga0500611_217242 | 3300053727 | Bacteria | 545 |
| 855 | Ga0500656_005697 | 3300053732 | Bacteria | 1241 |
| 856 | Ga0590075_098398 | 3300059424 | Bacteria | 761 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009176 | Ga0105242_10990553 | Ga0105242_109905532 | 129 |
| 2 | 3300046683 | Ga0495658_0761843 | Ga0495658_0761843_59_460 | 133 |
| 3 | 3300046463 | Ga0495653_0321950 | Ga0495653_0321950_107_550 | 138 |
| 4 | 3300009177 | Ga0105248_10399875 | Ga0105248_103998753 | 140 |
| 5 | 3300035086 | Ga0373934_0111668 | Ga0373934_0111668_224_658 | 140 |
| 6 | 3300035112 | Ga0373932_0130089 | Ga0373932_0130089_245_676 | 140 |
| 7 | 3300035119 | Ga0373956_0345455 | Ga0373956_0345455_105_539 | 140 |
| 8 | 3300035692 | Ga0373935_1171713 | Ga0373935_1171713_55_489 | 140 |
| 9 | 3300036401 | Ga0373937_0281918 | Ga0373937_0281918_777_1211 | 140 |
| 10 | 3300045051 | Ga0451576_1813450 | Ga0451576_1813450_120_551 | 140 |
| 11 | 3300046533 | Ga0495640_0331961 | Ga0495640_0331961_110_544 | 140 |
| 12 | 3300046689 | Ga0495613_0590161 | Ga0495613_0590161_109_540 | 140 |
| 13 | 3300046809 | Ga0495600_0449531 | Ga0495600_0449531_177_611 | 140 |
| 14 | 3300047322 | Ga0495680_0071991 | Ga0495680_0071991_2156_2590 | 140 |
| 15 | 3300047673 | Ga0495593_0443050 | Ga0495593_0443050_140_574 | 140 |
| 16 | 3300050512 | nmdc:mga0n895_41470_c1 | nmdc:mga0n895_41470_c1_3643_4074 | 140 |
| 17 | 3300050513 | nmdc:mga0rr50_267198_c1 | nmdc:mga0rr50_267198_c1_836_1267 | 140 |
| 18 | 3300050514 | nmdc:mga08x19_283377_c1 | nmdc:mga08x19_283377_c1_126_557 | 140 |
| 19 | 3300046692 | Ga0495671_0104821 | Ga0495671_0104821_927_1361 | 142 |
| 20 | 3300053161 | Ga0500634_0240700 | Ga0500634_0240700_306_740 | 142 |
| 21 | 3300053153 | Ga0500616_0249811 | Ga0500616_0249811_295_735 | 144 |
| 22 | 3300007076 | Ga0075435_100221421 | Ga0075435_1002214212 | 146 |
| 23 | 3300050513 | nmdc:mga0rr50_330631_c1 | nmdc:mga0rr50_330631_c1_515_958 | 146 |
| 24 | 3300005295 | Ga0065707_10353841 | Ga0065707_103538412 | 147 |
| 25 | 3300005295 | Ga0065707_10377784 | Ga0065707_103777842 | 147 |
| 26 | 3300005330 | Ga0070690_100035946 | Ga0070690_1000359462 | 147 |
| 27 | 3300005334 | Ga0068869_100007638 | Ga0068869_1000076384 | 147 |
| 28 | 3300005336 | Ga0070680_100011020 | Ga0070680_1000110207 | 147 |
| 29 | 3300005337 | Ga0070682_100006830 | Ga0070682_1000068307 | 147 |
| 30 | 3300005338 | Ga0068868_100008484 | Ga0068868_1000084844 | 147 |
| 31 | 3300005340 | Ga0070689_100001229 | Ga0070689_10000122920 | 147 |
| 32 | 3300005341 | Ga0070691_10002807 | Ga0070691_100028077 | 147 |
| 33 | 3300005343 | Ga0070687_100007347 | Ga0070687_1000073475 | 147 |
| 34 | 3300005345 | Ga0070692_10050097 | Ga0070692_100500973 | 147 |
| 35 | 3300005364 | Ga0070673_100015597 | Ga0070673_1000155974 | 147 |
| 36 | 3300005406 | Ga0070703_10001628 | Ga0070703_100016285 | 147 |
| 37 | 3300005438 | Ga0070701_10002577 | Ga0070701_100025779 | 147 |
| 38 | 3300005440 | Ga0070705_100001468 | Ga0070705_1000014689 | 147 |
| 39 | 3300005441 | Ga0070700_100038106 | Ga0070700_1000381064 | 147 |
| 40 | 3300005444 | Ga0070694_100009542 | Ga0070694_1000095422 | 147 |
| 41 | 3300005445 | Ga0070708_100220898 | Ga0070708_1002208983 | 147 |
| 42 | 3300005458 | Ga0070681_10292809 | Ga0070681_102928092 | 147 |
| 43 | 3300005459 | Ga0068867_100009633 | Ga0068867_1000096337 | 147 |
| 44 | 3300005530 | Ga0070679_100017350 | Ga0070679_1000173507 | 147 |
| 45 | 3300005544 | Ga0070686_100001557 | Ga0070686_1000015579 | 147 |
| 46 | 3300005545 | Ga0070695_100002056 | Ga0070695_1000020567 | 147 |
| 47 | 3300005546 | Ga0070696_100002711 | Ga0070696_1000027116 | 147 |
| 48 | 3300005547 | Ga0070693_100000154 | Ga0070693_10000015438 | 147 |
| 49 | 3300005549 | Ga0070704_100004467 | Ga0070704_1000044678 | 147 |
| 50 | 3300005563 | Ga0068855_100025696 | Ga0068855_1000256968 | 147 |
| 51 | 3300005564 | Ga0070664_101727368 | Ga0070664_1017273682 | 147 |
| 52 | 3300005578 | Ga0068854_100055986 | Ga0068854_1000559865 | 147 |
| 53 | 3300005615 | Ga0070702_100000735 | Ga0070702_1000007357 | 147 |
| 54 | 3300005617 | Ga0068859_100007318 | Ga0068859_1000073186 | 147 |
| 55 | 3300005718 | Ga0068866_10011784 | Ga0068866_100117842 | 147 |
| 56 | 3300005719 | Ga0068861_100007761 | Ga0068861_1000077612 | 147 |
| 57 | 3300005840 | Ga0068870_10071101 | Ga0068870_100711013 | 147 |
| 58 | 3300005842 | Ga0068858_100003657 | Ga0068858_1000036577 | 147 |
| 59 | 3300005843 | Ga0068860_100063051 | Ga0068860_1000630514 | 147 |
| 60 | 3300005844 | Ga0068862_100011814 | Ga0068862_1000118144 | 147 |
| 61 | 3300006237 | Ga0097621_100002904 | Ga0097621_1000029048 | 147 |
| 62 | 3300006852 | Ga0075433_10488130 | Ga0075433_104881302 | 147 |
| 63 | 3300006881 | Ga0068865_100042182 | Ga0068865_1000421824 | 147 |
| 64 | 3300006931 | Ga0097620_100007318 | Ga0097620_1000073189 | 147 |
| 65 | 3300025885 | Ga0207653_10001915 | Ga0207653_100019155 | 147 |
| 66 | 3300025899 | Ga0207642_10025520 | Ga0207642_100255202 | 147 |
| 67 | 3300025901 | Ga0207688_10013633 | Ga0207688_100136335 | 147 |
| 68 | 3300025904 | Ga0207647_10102521 | Ga0207647_101025213 | 147 |
| 69 | 3300025908 | Ga0207643_10132907 | Ga0207643_101329073 | 147 |
| 70 | 3300025912 | Ga0207707_10225892 | Ga0207707_102258923 | 147 |
| 71 | 3300025918 | Ga0207662_10002400 | Ga0207662_1000240010 | 147 |
| 72 | 3300025927 | Ga0207687_10010087 | Ga0207687_100100874 | 147 |
| 73 | 3300025934 | Ga0207686_10005427 | Ga0207686_100054273 | 147 |
| 74 | 3300025935 | Ga0207709_10198219 | Ga0207709_101982193 | 147 |
| 75 | 3300025936 | Ga0207670_11273334 | Ga0207670_112733341 | 147 |
| 76 | 3300025938 | Ga0207704_10002727 | Ga0207704_100027278 | 147 |
| 77 | 3300025942 | Ga0207689_10002939 | Ga0207689_1000293910 | 147 |
| 78 | 3300025949 | Ga0207667_10017288 | Ga0207667_100172886 | 147 |
| 79 | 3300025960 | Ga0207651_10020681 | Ga0207651_100206815 | 147 |
| 80 | 3300025961 | Ga0207712_10003403 | Ga0207712_100034035 | 147 |
| 81 | 3300025981 | Ga0207640_10143177 | Ga0207640_101431771 | 147 |
| 82 | 3300026023 | Ga0207677_10061805 | Ga0207677_100618054 | 147 |
| 83 | 3300026035 | Ga0207703_10027080 | Ga0207703_100270805 | 147 |
| 84 | 3300026041 | Ga0207639_10133417 | Ga0207639_101334173 | 147 |
| 85 | 3300026075 | Ga0207708_10000761 | Ga0207708_1000076123 | 147 |
| 86 | 3300026089 | Ga0207648_10020283 | Ga0207648_100202832 | 147 |
| 87 | 3300026118 | Ga0207675_100103318 | Ga0207675_1001033184 | 147 |
| 88 | 3300026142 | Ga0207698_10010939 | Ga0207698_100109394 | 147 |
| 89 | 3300028381 | Ga0268264_10014865 | Ga0268264_100148653 | 147 |
| 90 | 3300044712 | Ga0453684_0253483 | Ga0453684_0253483_691_1134 | 147 |
| 91 | 3300045051 | Ga0451576_0000756 | Ga0451576_0000756_63236_63679 | 147 |
| 92 | 3300045051 | Ga0451576_0179222 | Ga0451576_0179222_1236_1679 | 147 |
| 93 | 3300046463 | Ga0495653_0542660 | Ga0495653_0542660_219_662 | 147 |
| 94 | 3300046511 | Ga0495608_0003267 | Ga0495608_0003267_6366_6809 | 147 |
| 95 | 3300046559 | Ga0495667_0036342 | Ga0495667_0036342_1557_2000 | 147 |
| 96 | 3300046663 | Ga0495635_0439183 | Ga0495635_0439183_245_688 | 147 |
| 97 | 3300046675 | Ga0495657_0129382 | Ga0495657_0129382_459_902 | 147 |
| 98 | 3300047471 | Ga0495684_0000691 | Ga0495684_0000691_22481_22924 | 147 |
| 99 | 3300050515 | nmdc:mga0a205_209579_c2 | nmdc:mga0a205_209579_c2_151_594 | 147 |
| 100 | 3300005341 | Ga0070691_10540913 | Ga0070691_105409132 | 148 |
| 101 | 3300005344 | Ga0070661_100001029 | Ga0070661_10000102910 | 148 |
| 102 | 3300005345 | Ga0070692_10021996 | Ga0070692_100219964 | 148 |
| 103 | 3300005444 | Ga0070694_100095143 | Ga0070694_1000951434 | 148 |
| 104 | 3300005549 | Ga0070704_100055291 | Ga0070704_1000552913 | 148 |
| 105 | 3300005614 | Ga0068856_100375329 | Ga0068856_1003753292 | 148 |
| 106 | 3300006880 | Ga0075429_101506537 | Ga0075429_1015065372 | 148 |
| 107 | 3300006881 | Ga0068865_100490731 | Ga0068865_1004907312 | 148 |
| 108 | 3300009094 | Ga0111539_10105416 | Ga0111539_101054165 | 148 |
| 109 | 3300014325 | Ga0163163_12274217 | Ga0163163_122742172 | 148 |
| 110 | 3300025920 | Ga0207649_10000037 | Ga0207649_10000037107 | 148 |
| 111 | 3300025935 | Ga0207709_10257228 | Ga0207709_102572282 | 148 |
| 112 | 3300027907 | Ga0207428_10219789 | Ga0207428_102197893 | 148 |
| 113 | 3300037471 | Ga0395905_0919983 | Ga0395905_0919983_305_757 | 148 |
| 114 | 3300049580 | Ga0501046_0277044 | Ga0501046_0277044_47_517 | 148 |
| 115 | 3300050508 | nmdc:mga09592_716109_c1 | nmdc:mga09592_716109_c1_265_720 | 148 |
| 116 | 3300050511 | nmdc:mga08y16_29543_c1 | nmdc:mga08y16_29543_c1_2451_2906 | 148 |
| 117 | iso_pu_bacteria | 2513237101 | 2513692641 | 148 |
| 118 | iso_pu_bacteria | 2558860100 | 2558865095 | 148 |
| 119 | iso_pu_bacteria | 2585428057 | 2587729440 | 148 |
| 120 | iso_pu_bacteria | 2588253510 | 2588292990 | 148 |
| 121 | iso_pu_bacteria | 2643221643 | 2644241297 | 148 |
| 122 | iso_pu_bacteria | 2721755755 | 2723844982 | 148 |
| 123 | iso_pu_bacteria | 2738543013 | 2739252101 | 148 |
| 124 | iso_pu_bacteria | 2738543024 | 2739308724 | 148 |
| 125 | iso_pu_bacteria | 2775506901 | 2776264409 | 148 |
| 126 | iso_pu_bacteria | 2791355199 | 2793082161 | 148 |
| 127 | iso_pu_bacteria | 2854916844 | 2854918679 | 148 |
| 128 | iso_pu_bacteria | 2874604998 | 2874605310 | 148 |
| 129 | iso_pu_bacteria | 2879110137 | 2879111301 | 148 |
| 130 | iso_pu_bacteria | 2885192300 | 2885197119 | 148 |
| 131 | iso_pu_bacteria | 2904541872 | 2904543787 | 148 |
| 132 | iso_pu_bacteria | 2919089067 | 2919091918 | 148 |
| 133 | iso_pu_bacteria | 2919134579 | 2919137962 | 148 |
| 134 | iso_pu_bacteria | 2922361189 | 2922365456 | 148 |
| 135 | iso_pu_bacteria | 2929160207 | 2929162660 | 148 |
| 136 | iso_pu_bacteria | 2933016740 | 2933019188 | 148 |
| 137 | iso_pu_bacteria | 2939626828 | 2939629834 | 148 |
| 138 | iso_pu_bacteria | 2939631187 | 2939631888 | 148 |
| 139 | iso_pu_bacteria | 2939669807 | 2939671288 | 148 |
| 140 | iso_pu_bacteria | 8002285264 | 8002289229 | 148 |
| 141 | iso_pu_bacteria | 8006964411 | 8006965849 | 148 |
| 142 | iso_pu_bacteria | 8006984368 | 8006986494 | 148 |
| 143 | iso_pu_bacteria | 8006994254 | 8006995928 | 148 |
| 144 | iso_pu_bacteria | 8056673599 | 8056673762 | 148 |
| 145 | 3300005330 | Ga0070690_100507090 | Ga0070690_1005070902 | 149 |
| 146 | 3300005340 | Ga0070689_100028459 | Ga0070689_1000284592 | 149 |
| 147 | 3300005343 | Ga0070687_100071123 | Ga0070687_1000711232 | 149 |
| 148 | 3300005365 | Ga0070688_100001653 | Ga0070688_1000016534 | 149 |
| 149 | 3300005438 | Ga0070701_10011908 | Ga0070701_100119084 | 149 |
| 150 | 3300005440 | Ga0070705_100558158 | Ga0070705_1005581582 | 149 |
| 151 | 3300005444 | Ga0070694_100023909 | Ga0070694_1000239094 | 149 |
| 152 | 3300005466 | Ga0070685_10003699 | Ga0070685_100036999 | 149 |
| 153 | 3300005467 | Ga0070706_100765960 | Ga0070706_1007659601 | 149 |
| 154 | 3300005615 | Ga0070702_100628446 | Ga0070702_1006284462 | 149 |
| 155 | 3300005617 | Ga0068859_100059562 | Ga0068859_1000595623 | 149 |
| 156 | 3300005618 | Ga0068864_100033819 | Ga0068864_1000338193 | 149 |
| 157 | 3300005841 | Ga0068863_100073454 | Ga0068863_1000734544 | 149 |
| 158 | 3300005843 | Ga0068860_100044984 | Ga0068860_1000449842 | 149 |
| 159 | 3300006163 | Ga0070715_10067289 | Ga0070715_100672893 | 149 |
| 160 | 3300006163 | Ga0070715_10118611 | Ga0070715_101186111 | 149 |
| 161 | 3300006871 | Ga0075434_100144196 | Ga0075434_1001441964 | 149 |
| 162 | 3300006931 | Ga0097620_100059562 | Ga0097620_1000595623 | 149 |
| 163 | 3300007076 | Ga0075435_100019709 | Ga0075435_1000197095 | 149 |
| 164 | 3300009094 | Ga0111539_10404302 | Ga0111539_104043022 | 149 |
| 165 | 3300009098 | Ga0105245_10055110 | Ga0105245_100551104 | 149 |
| 166 | 3300009148 | Ga0105243_10003084 | Ga0105243_1000308413 | 149 |
| 167 | 3300009176 | Ga0105242_10053170 | Ga0105242_100531702 | 149 |
| 168 | 3300009177 | Ga0105248_10061335 | Ga0105248_100613355 | 149 |
| 169 | 3300009553 | Ga0105249_10004799 | Ga0105249_100047997 | 149 |
| 170 | 3300010375 | Ga0105239_10290002 | Ga0105239_102900023 | 149 |
| 171 | 3300011119 | Ga0105246_10423131 | Ga0105246_104231312 | 149 |
| 172 | 3300012476 | Ga0157344_1016619 | Ga0157344_10166192 | 149 |
| 173 | 3300013297 | Ga0157378_10017932 | Ga0157378_100179327 | 149 |
| 174 | 3300014325 | Ga0163163_10575374 | Ga0163163_105753742 | 149 |
| 175 | 3300014326 | Ga0157380_10177063 | Ga0157380_101770633 | 149 |
| 176 | 3300014968 | Ga0157379_10316922 | Ga0157379_103169222 | 149 |
| 177 | 3300014969 | Ga0157376_10014392 | Ga0157376_100143922 | 149 |
| 178 | 3300025905 | Ga0207685_10020467 | Ga0207685_100204673 | 149 |
| 179 | 3300025905 | Ga0207685_10351298 | Ga0207685_103512982 | 149 |
| 180 | 3300025918 | Ga0207662_10006313 | Ga0207662_100063132 | 149 |
| 181 | 3300025922 | Ga0207646_10198791 | Ga0207646_101987913 | 149 |
| 182 | 3300025936 | Ga0207670_10103945 | Ga0207670_101039452 | 149 |
| 183 | 3300025941 | Ga0207711_10485257 | Ga0207711_104852571 | 149 |
| 184 | 3300026075 | Ga0207708_10093621 | Ga0207708_100936213 | 149 |
| 185 | 3300026095 | Ga0207676_10036609 | Ga0207676_100366093 | 149 |
| 186 | 3300028380 | Ga0268265_10127381 | Ga0268265_101273812 | 149 |
| 187 | 3300028381 | Ga0268264_10178257 | Ga0268264_101782572 | 149 |
| 188 | 3300034817 | Ga0373948_0035731 | Ga0373948_0035731_304_753 | 149 |
| 189 | 3300034957 | Ga0373938_0043981 | Ga0373938_0043981_285_734 | 149 |
| 190 | 3300035083 | Ga0373926_0150119 | Ga0373926_0150119_43_501 | 149 |
| 191 | 3300035085 | Ga0373929_0015780 | Ga0373929_0015780_155_604 | 149 |
| 192 | 3300035090 | Ga0373949_0112229 | Ga0373949_0112229_139_588 | 149 |
| 193 | 3300035091 | Ga0373951_0008700 | Ga0373951_0008700_15_464 | 149 |
| 194 | 3300035092 | Ga0373952_0123576 | Ga0373952_0123576_120_569 | 149 |
| 195 | 3300035112 | Ga0373932_0006748 | Ga0373932_0006748_1013_1462 | 149 |
| 196 | 3300035114 | Ga0373939_0006074 | Ga0373939_0006074_1919_2368 | 149 |
| 197 | 3300035115 | Ga0373941_0067073 | Ga0373941_0067073_12_461 | 149 |
| 198 | 3300035207 | Ga0373942_0022164 | Ga0373942_0022164_1037_1486 | 149 |
| 199 | 3300035241 | Ga0373961_0356979 | Ga0373961_0356979_93_542 | 149 |
| 200 | 3300035242 | Ga0373962_0195340 | Ga0373962_0195340_27_476 | 149 |
| 201 | 3300035691 | Ga0373931_0009571 | Ga0373931_0009571_4076_4525 | 149 |
| 202 | 3300035724 | Ga0373933_0624264 | Ga0373933_0624264_83_544 | 149 |
| 203 | 3300036401 | Ga0373937_1338728 | Ga0373937_1338728_71_529 | 149 |
| 204 | 3300037068 | Ga0373925_0075599 | Ga0373925_0075599_1818_2276 | 149 |
| 205 | 3300045051 | Ga0451576_0295841 | Ga0451576_0295841_44_493 | 149 |
| 206 | 3300045051 | Ga0451576_0599656 | Ga0451576_0599656_598_1047 | 149 |
| 207 | 3300045051 | Ga0451576_0850506 | Ga0451576_0850506_246_704 | 149 |
| 208 | 3300046454 | Ga0495592_0288778 | Ga0495592_0288778_495_953 | 149 |
| 209 | 3300046455 | Ga0495603_0201348 | Ga0495603_0201348_633_1085 | 149 |
| 210 | 3300046459 | Ga0495629_0000008 | Ga0495629_0000008_57986_58435 | 149 |
| 211 | 3300046473 | Ga0495582_0674775 | Ga0495582_0674775_132_581 | 149 |
| 212 | 3300046516 | Ga0495628_0554772 | Ga0495628_0554772_10_468 | 149 |
| 213 | 3300047315 | Ga0495581_0688306 | Ga0495581_0688306_77_535 | 149 |
| 214 | 3300047321 | Ga0495676_0099067 | Ga0495676_0099067_904_1362 | 149 |
| 215 | 3300050513 | nmdc:mga0rr50_1054745_c1 | nmdc:mga0rr50_1054745_c1_40_489 | 149 |
| 216 | iso_pu_bacteria | 2512875024 | 2512962049 | 149 |
| 217 | iso_pu_bacteria | 2513237164 | 2514039145 | 149 |
| 218 | iso_pu_bacteria | 2844002411 | 2844003403 | 149 |
| 219 | iso_pu_bacteria | 2871466892 | 2871471710 | 149 |
| 220 | iso_pu_bacteria | 2906378014 | 2906382015 | 149 |
| 221 | 3300005365 | Ga0070688_100256564 | Ga0070688_1002565642 | 150 |
| 222 | 3300005719 | Ga0068861_100616611 | Ga0068861_1006166111 | 150 |
| 223 | 3300009148 | Ga0105243_11097085 | Ga0105243_110970851 | 150 |
| 224 | 3300025936 | Ga0207670_10600520 | Ga0207670_106005201 | 150 |
| 225 | 3300026118 | Ga0207675_101334879 | Ga0207675_1013348791 | 150 |
| 226 | 3300035724 | Ga0373933_0172990 | Ga0373933_0172990_728_1189 | 150 |
| 227 | 3300046675 | Ga0495657_0440519 | Ga0495657_0440519_35_496 | 150 |
| 228 | 3300047472 | Ga0495686_0000478 | Ga0495686_0000478_14480_14938 | 150 |
| 229 | 3300053108 | Ga0500562_004456 | Ga0500562_004456_965_1423 | 150 |
| 230 | 3300041408 | Ga0439453_0023047 | Ga0439453_0023047_193_672 | 151 |
| 231 | 3300042123 | Ga0450921_012501 | Ga0450921_012501_219_680 | 151 |
| 232 | 3300042125 | Ga0450923_033822 | Ga0450923_033822_12_473 | 151 |
| 233 | 3300042135 | Ga0450899_020533 | Ga0450899_020533_12_473 | 151 |
| 234 | 3300042435 | Ga0439434_0006793 | Ga0439434_0006793_2231_2692 | 151 |
| 235 | 3300048905 | Ga0496102_0573682 | Ga0496102_0573682_455_916 | 151 |
| 236 | 3300053088 | Ga0500644_0026432 | Ga0500644_0026432_32_493 | 151 |
| 237 | 3300002987 | JGI25159J45721_1021508 | JGI25159J45721_10215083 | 152 |
| 238 | 3300003187 | JGI25151J46595_10003752 | JGI25151J46595_100037524 | 152 |
| 239 | 3300003215 | JGI25153J46596_10001158 | JGI25153J46596_100011589 | 152 |
| 240 | 3300003316 | rootH1_10043371 | rootH1_100433712 | 152 |
| 241 | 3300003320 | rootH2_10121193 | rootH2_101211938 | 152 |
| 242 | 3300003659 | JGI25404J52841_10026573 | JGI25404J52841_100265732 | 152 |
| 243 | 3300003775 | Ga0055524_1000137 | Ga0055524_10001378 | 152 |
| 244 | 3300003784 | Ga0055534_1050564 | Ga0055534_10505641 | 152 |
| 245 | 3300005262 | Ga0065165_1029138 | Ga0065165_10291383 | 152 |
| 246 | 3300005289 | Ga0065704_10140138 | Ga0065704_101401382 | 152 |
| 247 | 3300005295 | Ga0065707_10316564 | Ga0065707_103165642 | 152 |
| 248 | 3300005327 | Ga0070658_10861092 | Ga0070658_108610922 | 152 |
| 249 | 3300005328 | Ga0070676_10039829 | Ga0070676_100398294 | 152 |
| 250 | 3300005328 | Ga0070676_10536095 | Ga0070676_105360951 | 152 |
| 251 | 3300005328 | Ga0070676_10879175 | Ga0070676_108791752 | 152 |
| 252 | 3300005331 | Ga0070670_100004124 | Ga0070670_1000041249 | 152 |
| 253 | 3300005331 | Ga0070670_100087383 | Ga0070670_1000873833 | 152 |
| 254 | 3300005331 | Ga0070670_100147753 | Ga0070670_1001477532 | 152 |
| 255 | 3300005331 | Ga0070670_100557042 | Ga0070670_1005570422 | 152 |
| 256 | 3300005331 | Ga0070670_100691180 | Ga0070670_1006911802 | 152 |
| 257 | 3300005331 | Ga0070670_101497051 | Ga0070670_1014970511 | 152 |
| 258 | 3300005333 | Ga0070677_10193196 | Ga0070677_101931962 | 152 |
| 259 | 3300005334 | Ga0068869_100011532 | Ga0068869_1000115323 | 152 |
| 260 | 3300005334 | Ga0068869_100100004 | Ga0068869_1001000043 | 152 |
| 261 | 3300005334 | Ga0068869_100108458 | Ga0068869_1001084581 | 152 |
| 262 | 3300005334 | Ga0068869_101976401 | Ga0068869_1019764011 | 152 |
| 263 | 3300005335 | Ga0070666_10000334 | Ga0070666_1000033429 | 152 |
| 264 | 3300005335 | Ga0070666_10169935 | Ga0070666_101699352 | 152 |
| 265 | 3300005335 | Ga0070666_10490529 | Ga0070666_104905292 | 152 |
| 266 | 3300005338 | Ga0068868_100049789 | Ga0068868_1000497893 | 152 |
| 267 | 3300005338 | Ga0068868_100076000 | Ga0068868_1000760003 | 152 |
| 268 | 3300005339 | Ga0070660_100052028 | Ga0070660_1000520282 | 152 |
| 269 | 3300005341 | Ga0070691_10014898 | Ga0070691_100148985 | 152 |
| 270 | 3300005344 | Ga0070661_100381286 | Ga0070661_1003812862 | 152 |
| 271 | 3300005344 | Ga0070661_100458095 | Ga0070661_1004580952 | 152 |
| 272 | 3300005347 | Ga0070668_100101106 | Ga0070668_1001011062 | 152 |
| 273 | 3300005347 | Ga0070668_100117982 | Ga0070668_1001179823 | 152 |
| 274 | 3300005347 | Ga0070668_100637243 | Ga0070668_1006372432 | 152 |
| 275 | 3300005353 | Ga0070669_100101857 | Ga0070669_1001018573 | 152 |
| 276 | 3300005353 | Ga0070669_101005627 | Ga0070669_1010056271 | 152 |
| 277 | 3300005354 | Ga0070675_100041361 | Ga0070675_1000413615 | 152 |
| 278 | 3300005355 | Ga0070671_100017688 | Ga0070671_1000176886 | 152 |
| 279 | 3300005364 | Ga0070673_100009931 | Ga0070673_1000099316 | 152 |
| 280 | 3300005366 | Ga0070659_100012395 | Ga0070659_1000123954 | 152 |
| 281 | 3300005367 | Ga0070667_100652428 | Ga0070667_1006524282 | 152 |
| 282 | 3300005406 | Ga0070703_10149018 | Ga0070703_101490182 | 152 |
| 283 | 3300005434 | Ga0070709_10259021 | Ga0070709_102590212 | 152 |
| 284 | 3300005436 | Ga0070713_101398130 | Ga0070713_1013981301 | 152 |
| 285 | 3300005437 | Ga0070710_10225712 | Ga0070710_102257122 | 152 |
| 286 | 3300005439 | Ga0070711_100418326 | Ga0070711_1004183262 | 152 |
| 287 | 3300005455 | Ga0070663_100011222 | Ga0070663_1000112223 | 152 |
| 288 | 3300005455 | Ga0070663_100014671 | Ga0070663_1000146713 | 152 |
| 289 | 3300005455 | Ga0070663_100202207 | Ga0070663_1002022074 | 152 |
| 290 | 3300005455 | Ga0070663_100325044 | Ga0070663_1003250442 | 152 |
| 291 | 3300005456 | Ga0070678_100005734 | Ga0070678_1000057348 | 152 |
| 292 | 3300005456 | Ga0070678_101032419 | Ga0070678_1010324192 | 152 |
| 293 | 3300005457 | Ga0070662_100004392 | Ga0070662_1000043928 | 152 |
| 294 | 3300005457 | Ga0070662_100042618 | Ga0070662_1000426182 | 152 |
| 295 | 3300005459 | Ga0068867_100276687 | Ga0068867_1002766872 | 152 |
| 296 | 3300005459 | Ga0068867_101121393 | Ga0068867_1011213932 | 152 |
| 297 | 3300005466 | Ga0070685_10002114 | Ga0070685_100021147 | 152 |
| 298 | 3300005466 | Ga0070685_10612182 | Ga0070685_106121821 | 152 |
| 299 | 3300005467 | Ga0070706_101677565 | Ga0070706_1016775651 | 152 |
| 300 | 3300005471 | Ga0070698_100000332 | Ga0070698_1000003322 | 152 |
| 301 | 3300005518 | Ga0070699_100222618 | Ga0070699_1002226182 | 152 |
| 302 | 3300005518 | Ga0070699_102156121 | Ga0070699_1021561211 | 152 |
| 303 | 3300005536 | Ga0070697_100652663 | Ga0070697_1006526631 | 152 |
| 304 | 3300005539 | Ga0068853_100010770 | Ga0068853_1000107703 | 152 |
| 305 | 3300005539 | Ga0068853_100070079 | Ga0068853_1000700793 | 152 |
| 306 | 3300005539 | Ga0068853_100170174 | Ga0068853_1001701743 | 152 |
| 307 | 3300005539 | Ga0068853_102034546 | Ga0068853_1020345461 | 152 |
| 308 | 3300005543 | Ga0070672_100000535 | Ga0070672_10000053528 | 152 |
| 309 | 3300005548 | Ga0070665_100002080 | Ga0070665_1000020807 | 152 |
| 310 | 3300005548 | Ga0070665_100031156 | Ga0070665_1000311563 | 152 |
| 311 | 3300005548 | Ga0070665_100171687 | Ga0070665_1001716873 | 152 |
| 312 | 3300005548 | Ga0070665_101732989 | Ga0070665_1017329892 | 152 |
| 313 | 3300005549 | Ga0070704_101465364 | Ga0070704_1014653642 | 152 |
| 314 | 3300005563 | Ga0068855_100042076 | Ga0068855_1000420764 | 152 |
| 315 | 3300005563 | Ga0068855_100643912 | Ga0068855_1006439122 | 152 |
| 316 | 3300005564 | Ga0070664_100134904 | Ga0070664_1001349044 | 152 |
| 317 | 3300005564 | Ga0070664_100711813 | Ga0070664_1007118131 | 152 |
| 318 | 3300005577 | Ga0068857_100165253 | Ga0068857_1001652533 | 152 |
| 319 | 3300005578 | Ga0068854_100289637 | Ga0068854_1002896371 | 152 |
| 320 | 3300005578 | Ga0068854_100823551 | Ga0068854_1008235512 | 152 |
| 321 | 3300005614 | Ga0068856_100082746 | Ga0068856_1000827463 | 152 |
| 322 | 3300005614 | Ga0068856_100168664 | Ga0068856_1001686641 | 152 |
| 323 | 3300005614 | Ga0068856_100355589 | Ga0068856_1003555893 | 152 |
| 324 | 3300005616 | Ga0068852_100006324 | Ga0068852_1000063243 | 152 |
| 325 | 3300005616 | Ga0068852_100040808 | Ga0068852_1000408081 | 152 |
| 326 | 3300005616 | Ga0068852_100230335 | Ga0068852_1002303352 | 152 |
| 327 | 3300005616 | Ga0068852_100672713 | Ga0068852_1006727132 | 152 |
| 328 | 3300005617 | Ga0068859_102794065 | Ga0068859_1027940651 | 152 |
| 329 | 3300005618 | Ga0068864_100035855 | Ga0068864_1000358555 | 152 |
| 330 | 3300005618 | Ga0068864_100240958 | Ga0068864_1002409582 | 152 |
| 331 | 3300005718 | Ga0068866_10832658 | Ga0068866_108326582 | 152 |
| 332 | 3300005718 | Ga0068866_10982131 | Ga0068866_109821311 | 152 |
| 333 | 3300005719 | Ga0068861_100015603 | Ga0068861_1000156035 | 152 |
| 334 | 3300005719 | Ga0068861_100060602 | Ga0068861_1000606023 | 152 |
| 335 | 3300005719 | Ga0068861_100753878 | Ga0068861_1007538781 | 152 |
| 336 | 3300005834 | Ga0068851_10003102 | Ga0068851_100031025 | 152 |
| 337 | 3300005834 | Ga0068851_10086087 | Ga0068851_100860873 | 152 |
| 338 | 3300005841 | Ga0068863_100146383 | Ga0068863_1001463834 | 152 |
| 339 | 3300005841 | Ga0068863_100228353 | Ga0068863_1002283532 | 152 |
| 340 | 3300005842 | Ga0068858_100000756 | Ga0068858_10000075627 | 152 |
| 341 | 3300005842 | Ga0068858_100217629 | Ga0068858_1002176293 | 152 |
| 342 | 3300005842 | Ga0068858_100291441 | Ga0068858_1002914413 | 152 |
| 343 | 3300005843 | Ga0068860_100059465 | Ga0068860_1000594654 | 152 |
| 344 | 3300005843 | Ga0068860_100134028 | Ga0068860_1001340283 | 152 |
| 345 | 3300005844 | Ga0068862_100305414 | Ga0068862_1003054142 | 152 |
| 346 | 3300005844 | Ga0068862_100432315 | Ga0068862_1004323151 | 152 |
| 347 | 3300005844 | Ga0068862_101199244 | Ga0068862_1011992441 | 152 |
| 348 | 3300005937 | Ga0081455_10003737 | Ga0081455_1000373711 | 152 |
| 349 | 3300005937 | Ga0081455_10074169 | Ga0081455_100741693 | 152 |
| 350 | 3300005981 | Ga0081538_10037787 | Ga0081538_100377873 | 152 |
| 351 | 3300005983 | Ga0081540_1006094 | Ga0081540_10060947 | 152 |
| 352 | 3300005983 | Ga0081540_1017056 | Ga0081540_10170563 | 152 |
| 353 | 3300005983 | Ga0081540_1030764 | Ga0081540_10307643 | 152 |
| 354 | 3300006028 | Ga0070717_10522973 | Ga0070717_105229732 | 152 |
| 355 | 3300006038 | Ga0075365_10008443 | Ga0075365_100084436 | 152 |
| 356 | 3300006038 | Ga0075365_10202781 | Ga0075365_102027813 | 152 |
| 357 | 3300006042 | Ga0075368_10110641 | Ga0075368_101106412 | 152 |
| 358 | 3300006048 | Ga0075363_100000455 | Ga0075363_1000004554 | 152 |
| 359 | 3300006048 | Ga0075363_100060704 | Ga0075363_1000607043 | 152 |
| 360 | 3300006048 | Ga0075363_100079633 | Ga0075363_1000796334 | 152 |
| 361 | 3300006048 | Ga0075363_100326450 | Ga0075363_1003264502 | 152 |
| 362 | 3300006051 | Ga0075364_10087364 | Ga0075364_100873642 | 152 |
| 363 | 3300006051 | Ga0075364_10494718 | Ga0075364_104947181 | 152 |
| 364 | 3300006175 | Ga0070712_100241719 | Ga0070712_1002417192 | 152 |
| 365 | 3300006177 | Ga0075362_10045697 | Ga0075362_100456973 | 152 |
| 366 | 3300006177 | Ga0075362_10135936 | Ga0075362_101359362 | 152 |
| 367 | 3300006178 | Ga0075367_10141495 | Ga0075367_101414952 | 152 |
| 368 | 3300006178 | Ga0075367_10224715 | Ga0075367_102247152 | 152 |
| 369 | 3300006178 | Ga0075367_10242518 | Ga0075367_102425181 | 152 |
| 370 | 3300006178 | Ga0075367_10990864 | Ga0075367_109908641 | 152 |
| 371 | 3300006186 | Ga0075369_10127358 | Ga0075369_101273581 | 152 |
| 372 | 3300006195 | Ga0075366_10008197 | Ga0075366_100081974 | 152 |
| 373 | 3300006195 | Ga0075366_10014177 | Ga0075366_100141773 | 152 |
| 374 | 3300006195 | Ga0075366_10205783 | Ga0075366_102057832 | 152 |
| 375 | 3300006195 | Ga0075366_10259606 | Ga0075366_102596062 | 152 |
| 376 | 3300006195 | Ga0075366_10395482 | Ga0075366_103954822 | 152 |
| 377 | 3300006237 | Ga0097621_100059011 | Ga0097621_1000590113 | 152 |
| 378 | 3300006237 | Ga0097621_100088621 | Ga0097621_1000886213 | 152 |
| 379 | 3300006237 | Ga0097621_100901204 | Ga0097621_1009012042 | 152 |
| 380 | 3300006237 | Ga0097621_101001081 | Ga0097621_1010010812 | 152 |
| 381 | 3300006353 | Ga0075370_10075093 | Ga0075370_100750933 | 152 |
| 382 | 3300006353 | Ga0075370_10286135 | Ga0075370_102861352 | 152 |
| 383 | 3300006353 | Ga0075370_10489794 | Ga0075370_104897941 | 152 |
| 384 | 3300006353 | Ga0075370_10576002 | Ga0075370_105760021 | 152 |
| 385 | 3300006358 | Ga0068871_100014807 | Ga0068871_1000148075 | 152 |
| 386 | 3300006358 | Ga0068871_100581905 | Ga0068871_1005819051 | 152 |
| 387 | 3300006358 | Ga0068871_101370700 | Ga0068871_1013707001 | 152 |
| 388 | 3300006844 | Ga0075428_100470496 | Ga0075428_1004704963 | 152 |
| 389 | 3300006846 | Ga0075430_100961025 | Ga0075430_1009610252 | 152 |
| 390 | 3300006847 | Ga0075431_100501602 | Ga0075431_1005016022 | 152 |
| 391 | 3300006852 | Ga0075433_10024317 | Ga0075433_100243174 | 152 |
| 392 | 3300006871 | Ga0075434_100000268 | Ga0075434_10000026824 | 152 |
| 393 | 3300006871 | Ga0075434_100522103 | Ga0075434_1005221033 | 152 |
| 394 | 3300006880 | Ga0075429_100202806 | Ga0075429_1002028062 | 152 |
| 395 | 3300006881 | Ga0068865_100759089 | Ga0068865_1007590892 | 152 |
| 396 | 3300006931 | Ga0097620_102793466 | Ga0097620_1027934661 | 152 |
| 397 | 3300007076 | Ga0075435_100197793 | Ga0075435_1001977932 | 152 |
| 398 | 3300007076 | Ga0075435_101567756 | Ga0075435_1015677561 | 152 |
| 399 | 3300009011 | Ga0105251_10318812 | Ga0105251_103188122 | 152 |
| 400 | 3300009036 | Ga0105244_10102018 | Ga0105244_101020182 | 152 |
| 401 | 3300009093 | Ga0105240_10001365 | Ga0105240_100013659 | 152 |
| 402 | 3300009093 | Ga0105240_10001750 | Ga0105240_100017506 | 152 |
| 403 | 3300009093 | Ga0105240_10137221 | Ga0105240_101372213 | 152 |
| 404 | 3300009093 | Ga0105240_10938822 | Ga0105240_109388222 | 152 |
| 405 | 3300009094 | Ga0111539_10095595 | Ga0111539_100955953 | 152 |
| 406 | 3300009094 | Ga0111539_11734348 | Ga0111539_117343482 | 152 |
| 407 | 3300009094 | Ga0111539_12099748 | Ga0111539_120997482 | 152 |
| 408 | 3300009094 | Ga0111539_12478649 | Ga0111539_124786491 | 152 |
| 409 | 3300009098 | Ga0105245_10153904 | Ga0105245_101539041 | 152 |
| 410 | 3300009098 | Ga0105245_10244437 | Ga0105245_102444373 | 152 |
| 411 | 3300009098 | Ga0105245_10582627 | Ga0105245_105826272 | 152 |
| 412 | 3300009147 | Ga0114129_10781676 | Ga0114129_107816761 | 152 |
| 413 | 3300009148 | Ga0105243_10162546 | Ga0105243_101625463 | 152 |
| 414 | 3300009148 | Ga0105243_10565717 | Ga0105243_105657172 | 152 |
| 415 | 3300009148 | Ga0105243_10907788 | Ga0105243_109077882 | 152 |
| 416 | 3300009174 | Ga0105241_10027594 | Ga0105241_100275944 | 152 |
| 417 | 3300009174 | Ga0105241_10419789 | Ga0105241_104197893 | 152 |
| 418 | 3300009177 | Ga0105248_10000352 | Ga0105248_100003525 | 152 |
| 419 | 3300009177 | Ga0105248_12448166 | Ga0105248_124481662 | 152 |
| 420 | 3300009545 | Ga0105237_10002406 | Ga0105237_100024067 | 152 |
| 421 | 3300009545 | Ga0105237_10137513 | Ga0105237_101375132 | 152 |
| 422 | 3300009545 | Ga0105237_10161891 | Ga0105237_101618913 | 152 |
| 423 | 3300009545 | Ga0105237_10344713 | Ga0105237_103447132 | 152 |
| 424 | 3300009545 | Ga0105237_10458474 | Ga0105237_104584742 | 152 |
| 425 | 3300009551 | Ga0105238_10005159 | Ga0105238_100051599 | 152 |
| 426 | 3300009551 | Ga0105238_10015404 | Ga0105238_100154046 | 152 |
| 427 | 3300009553 | Ga0105249_10005381 | Ga0105249_100053818 | 152 |
| 428 | 3300009553 | Ga0105249_11756889 | Ga0105249_117568892 | 152 |
| 429 | 3300010375 | Ga0105239_10003462 | Ga0105239_1000346213 | 152 |
| 430 | 3300010375 | Ga0105239_10796167 | Ga0105239_107961672 | 152 |
| 431 | 3300010375 | Ga0105239_11050534 | Ga0105239_110505341 | 152 |
| 432 | 3300011119 | Ga0105246_10792331 | Ga0105246_107923312 | 152 |
| 433 | 3300013105 | Ga0157369_10128044 | Ga0157369_101280443 | 152 |
| 434 | 3300013105 | Ga0157369_10248046 | Ga0157369_102480463 | 152 |
| 435 | 3300013296 | Ga0157374_10010141 | Ga0157374_100101415 | 152 |
| 436 | 3300013296 | Ga0157374_10040465 | Ga0157374_100404653 | 152 |
| 437 | 3300013296 | Ga0157374_10343849 | Ga0157374_103438492 | 152 |
| 438 | 3300013306 | Ga0163162_10012590 | Ga0163162_100125905 | 152 |
| 439 | 3300013306 | Ga0163162_10077409 | Ga0163162_100774096 | 152 |
| 440 | 3300013306 | Ga0163162_10938433 | Ga0163162_109384331 | 152 |
| 441 | 3300013306 | Ga0163162_11510754 | Ga0163162_115107542 | 152 |
| 442 | 3300013306 | Ga0163162_11614292 | Ga0163162_116142921 | 152 |
| 443 | 3300013307 | Ga0157372_10012358 | Ga0157372_100123583 | 152 |
| 444 | 3300013307 | Ga0157372_10199654 | Ga0157372_101996541 | 152 |
| 445 | 3300013307 | Ga0157372_10442654 | Ga0157372_104426542 | 152 |
| 446 | 3300013308 | Ga0157375_10025113 | Ga0157375_100251138 | 152 |
| 447 | 3300013308 | Ga0157375_10197154 | Ga0157375_101971543 | 152 |
| 448 | 3300013308 | Ga0157375_11550506 | Ga0157375_115505062 | 152 |
| 449 | 3300014497 | Ga0182008_10002443 | Ga0182008_1000244312 | 152 |
| 450 | 3300014745 | Ga0157377_10003140 | Ga0157377_100031404 | 152 |
| 451 | 3300014968 | Ga0157379_10012182 | Ga0157379_100121824 | 152 |
| 452 | 3300014968 | Ga0157379_10078488 | Ga0157379_100784882 | 152 |
| 453 | 3300014968 | Ga0157379_10537474 | Ga0157379_105374742 | 152 |
| 454 | 3300014968 | Ga0157379_10713621 | Ga0157379_107136211 | 152 |
| 455 | 3300014969 | Ga0157376_10010318 | Ga0157376_100103186 | 152 |
| 456 | 3300014969 | Ga0157376_10011188 | Ga0157376_100111888 | 152 |
| 457 | 3300014969 | Ga0157376_10019400 | Ga0157376_100194004 | 152 |
| 458 | 3300015261 | Ga0182006_1015371 | Ga0182006_10153713 | 152 |
| 459 | 3300015262 | Ga0182007_10000248 | Ga0182007_100002487 | 152 |
| 460 | 3300015265 | Ga0182005_1060862 | Ga0182005_10608622 | 152 |
| 461 | 3300015683 | Ga0183362_10002 | Ga0183362_10002195 | 152 |
| 462 | 3300017792 | Ga0163161_10023592 | Ga0163161_100235922 | 152 |
| 463 | 3300017792 | Ga0163161_10103072 | Ga0163161_101030724 | 152 |
| 464 | 3300017792 | Ga0163161_10130342 | Ga0163161_101303422 | 152 |
| 465 | 3300017792 | Ga0163161_10140371 | Ga0163161_101403712 | 152 |
| 466 | 3300017792 | Ga0163161_10456352 | Ga0163161_104563521 | 152 |
| 467 | 3300020069 | Ga0197907_11110502 | Ga0197907_111105022 | 152 |
| 468 | 3300021361 | Ga0213872_10098361 | Ga0213872_100983612 | 152 |
| 469 | 3300024227 | Ga0228598_1066106 | Ga0228598_10661061 | 152 |
| 470 | 3300025258 | Ga0209129_1013505 | Ga0209129_10135053 | 152 |
| 471 | 3300025261 | Ga0209233_1000834 | Ga0209233_100083410 | 152 |
| 472 | 3300025263 | Ga0209565_1006958 | Ga0209565_10069582 | 152 |
| 473 | 3300025273 | Ga0209673_1032050 | Ga0209673_10320502 | 152 |
| 474 | 3300025284 | Ga0209130_1002478 | Ga0209130_10024787 | 152 |
| 475 | 3300025291 | Ga0209675_1001541 | Ga0209675_100154111 | 152 |
| 476 | 3300025291 | Ga0209675_1050220 | Ga0209675_10502201 | 152 |
| 477 | 3300025292 | Ga0209676_1026211 | Ga0209676_10262113 | 152 |
| 478 | 3300025294 | Ga0209025_1000183 | Ga0209025_1000183101 | 152 |
| 479 | 3300025294 | Ga0209025_1056343 | Ga0209025_10563432 | 152 |
| 480 | 3300025294 | Ga0209025_1063136 | Ga0209025_10631362 | 152 |
| 481 | 3300025295 | Ga0209564_1028907 | Ga0209564_10289073 | 152 |
| 482 | 3300025297 | Ga0209758_1000146 | Ga0209758_1000146152 | 152 |
| 483 | 3300025298 | Ga0209050_1010058 | Ga0209050_10100583 | 152 |
| 484 | 3300025299 | Ga0209256_1000030 | Ga0209256_1000030217 | 152 |
| 485 | 3300025303 | Ga0209051_1045816 | Ga0209051_10458162 | 152 |
| 486 | 3300025304 | Ga0209257_1015596 | Ga0209257_10155963 | 152 |
| 487 | 3300025315 | Ga0207697_10141647 | Ga0207697_101416473 | 152 |
| 488 | 3300025321 | Ga0207656_10001704 | Ga0207656_100017047 | 152 |
| 489 | 3300025321 | Ga0207656_10098113 | Ga0207656_100981133 | 152 |
| 490 | 3300025711 | Ga0207696_1063097 | Ga0207696_10630972 | 152 |
| 491 | 3300025893 | Ga0207682_10151563 | Ga0207682_101515632 | 152 |
| 492 | 3300025899 | Ga0207642_10042446 | Ga0207642_100424462 | 152 |
| 493 | 3300025900 | Ga0207710_10115502 | Ga0207710_101155022 | 152 |
| 494 | 3300025900 | Ga0207710_10291184 | Ga0207710_102911841 | 152 |
| 495 | 3300025901 | Ga0207688_10065787 | Ga0207688_100657873 | 152 |
| 496 | 3300025903 | Ga0207680_10000514 | Ga0207680_100005149 | 152 |
| 497 | 3300025903 | Ga0207680_10242256 | Ga0207680_102422563 | 152 |
| 498 | 3300025904 | Ga0207647_10000343 | Ga0207647_100003438 | 152 |
| 499 | 3300025907 | Ga0207645_10127703 | Ga0207645_101277033 | 152 |
| 500 | 3300025907 | Ga0207645_10304743 | Ga0207645_103047432 | 152 |
| 501 | 3300025907 | Ga0207645_10574841 | Ga0207645_105748412 | 152 |
| 502 | 3300025908 | Ga0207643_10575302 | Ga0207643_105753021 | 152 |
| 503 | 3300025909 | Ga0207705_10126912 | Ga0207705_101269123 | 152 |
| 504 | 3300025911 | Ga0207654_10023245 | Ga0207654_100232452 | 152 |
| 505 | 3300025911 | Ga0207654_10046619 | Ga0207654_100466193 | 152 |
| 506 | 3300025911 | Ga0207654_10199287 | Ga0207654_101992872 | 152 |
| 507 | 3300025913 | Ga0207695_10000014 | Ga0207695_10000014648 | 152 |
| 508 | 3300025913 | Ga0207695_10002945 | Ga0207695_100029459 | 152 |
| 509 | 3300025913 | Ga0207695_10050167 | Ga0207695_100501671 | 152 |
| 510 | 3300025913 | Ga0207695_10334421 | Ga0207695_103344213 | 152 |
| 511 | 3300025914 | Ga0207671_10012055 | Ga0207671_100120554 | 152 |
| 512 | 3300025914 | Ga0207671_10019307 | Ga0207671_100193074 | 152 |
| 513 | 3300025914 | Ga0207671_10112050 | Ga0207671_101120503 | 152 |
| 514 | 3300025914 | Ga0207671_10122883 | Ga0207671_101228833 | 152 |
| 515 | 3300025915 | Ga0207693_10200331 | Ga0207693_102003312 | 152 |
| 516 | 3300025916 | Ga0207663_10531075 | Ga0207663_105310751 | 152 |
| 517 | 3300025919 | Ga0207657_10061175 | Ga0207657_100611753 | 152 |
| 518 | 3300025920 | Ga0207649_10018425 | Ga0207649_100184251 | 152 |
| 519 | 3300025920 | Ga0207649_10047013 | Ga0207649_100470132 | 152 |
| 520 | 3300025920 | Ga0207649_10660470 | Ga0207649_106604702 | 152 |
| 521 | 3300025922 | Ga0207646_10368091 | Ga0207646_103680912 | 152 |
| 522 | 3300025924 | Ga0207694_10001692 | Ga0207694_100016929 | 152 |
| 523 | 3300025924 | Ga0207694_10002417 | Ga0207694_100024177 | 152 |
| 524 | 3300025924 | Ga0207694_10006199 | Ga0207694_100061996 | 152 |
| 525 | 3300025924 | Ga0207694_10375558 | Ga0207694_103755582 | 152 |
| 526 | 3300025925 | Ga0207650_10009560 | Ga0207650_100095608 | 152 |
| 527 | 3300025925 | Ga0207650_10134352 | Ga0207650_101343522 | 152 |
| 528 | 3300025925 | Ga0207650_10304619 | Ga0207650_103046193 | 152 |
| 529 | 3300025925 | Ga0207650_10360867 | Ga0207650_103608672 | 152 |
| 530 | 3300025925 | Ga0207650_10496649 | Ga0207650_104966492 | 152 |
| 531 | 3300025926 | Ga0207659_10003322 | Ga0207659_100033225 | 152 |
| 532 | 3300025926 | Ga0207659_10231911 | Ga0207659_102319113 | 152 |
| 533 | 3300025926 | Ga0207659_10611412 | Ga0207659_106114122 | 152 |
| 534 | 3300025927 | Ga0207687_10005772 | Ga0207687_100057726 | 152 |
| 535 | 3300025927 | Ga0207687_10073584 | Ga0207687_100735844 | 152 |
| 536 | 3300025927 | Ga0207687_10087223 | Ga0207687_100872233 | 152 |
| 537 | 3300025928 | Ga0207700_10420148 | Ga0207700_104201482 | 152 |
| 538 | 3300025931 | Ga0207644_10026728 | Ga0207644_100267282 | 152 |
| 539 | 3300025931 | Ga0207644_10038506 | Ga0207644_100385065 | 152 |
| 540 | 3300025932 | Ga0207690_10085940 | Ga0207690_100859402 | 152 |
| 541 | 3300025933 | Ga0207706_10004142 | Ga0207706_100041425 | 152 |
| 542 | 3300025933 | Ga0207706_10085844 | Ga0207706_100858442 | 152 |
| 543 | 3300025934 | Ga0207686_10211192 | Ga0207686_102111922 | 152 |
| 544 | 3300025935 | Ga0207709_10001965 | Ga0207709_100019652 | 152 |
| 545 | 3300025935 | Ga0207709_10110682 | Ga0207709_101106823 | 152 |
| 546 | 3300025935 | Ga0207709_10576392 | Ga0207709_105763921 | 152 |
| 547 | 3300025937 | Ga0207669_10221230 | Ga0207669_102212302 | 152 |
| 548 | 3300025937 | Ga0207669_10258611 | Ga0207669_102586112 | 152 |
| 549 | 3300025940 | Ga0207691_10446324 | Ga0207691_104463242 | 152 |
| 550 | 3300025941 | Ga0207711_10000928 | Ga0207711_1000092825 | 152 |
| 551 | 3300025941 | Ga0207711_10073901 | Ga0207711_100739012 | 152 |
| 552 | 3300025941 | Ga0207711_11196663 | Ga0207711_111966631 | 152 |
| 553 | 3300025942 | Ga0207689_10014348 | Ga0207689_100143485 | 152 |
| 554 | 3300025942 | Ga0207689_10035623 | Ga0207689_100356235 | 152 |
| 555 | 3300025945 | Ga0207679_10049414 | Ga0207679_100494143 | 152 |
| 556 | 3300025945 | Ga0207679_10374574 | Ga0207679_103745742 | 152 |
| 557 | 3300025949 | Ga0207667_10163814 | Ga0207667_101638142 | 152 |
| 558 | 3300025949 | Ga0207667_10191956 | Ga0207667_101919563 | 152 |
| 559 | 3300025949 | Ga0207667_10525803 | Ga0207667_105258032 | 152 |
| 560 | 3300025960 | Ga0207651_10064267 | Ga0207651_100642674 | 152 |
| 561 | 3300025961 | Ga0207712_10001310 | Ga0207712_1000131014 | 152 |
| 562 | 3300025961 | Ga0207712_10343103 | Ga0207712_103431033 | 152 |
| 563 | 3300025961 | Ga0207712_11029086 | Ga0207712_110290862 | 152 |
| 564 | 3300025961 | Ga0207712_11565065 | Ga0207712_115650651 | 152 |
| 565 | 3300025972 | Ga0207668_10073153 | Ga0207668_100731532 | 152 |
| 566 | 3300025972 | Ga0207668_10079616 | Ga0207668_100796164 | 152 |
| 567 | 3300025972 | Ga0207668_10314933 | Ga0207668_103149332 | 152 |
| 568 | 3300025972 | Ga0207668_10612526 | Ga0207668_106125262 | 152 |
| 569 | 3300025981 | Ga0207640_10060009 | Ga0207640_100600092 | 152 |
| 570 | 3300025981 | Ga0207640_10188242 | Ga0207640_101882423 | 152 |
| 571 | 3300025986 | Ga0207658_10006474 | Ga0207658_100064743 | 152 |
| 572 | 3300025986 | Ga0207658_10433451 | Ga0207658_104334512 | 152 |
| 573 | 3300025986 | Ga0207658_10655717 | Ga0207658_106557171 | 152 |
| 574 | 3300026023 | Ga0207677_10003660 | Ga0207677_100036603 | 152 |
| 575 | 3300026023 | Ga0207677_10039752 | Ga0207677_100397523 | 152 |
| 576 | 3300026035 | Ga0207703_10000809 | Ga0207703_100008097 | 152 |
| 577 | 3300026035 | Ga0207703_10123860 | Ga0207703_101238603 | 152 |
| 578 | 3300026035 | Ga0207703_10386200 | Ga0207703_103862002 | 152 |
| 579 | 3300026041 | Ga0207639_10003037 | Ga0207639_100030373 | 152 |
| 580 | 3300026041 | Ga0207639_10056299 | Ga0207639_100562993 | 152 |
| 581 | 3300026041 | Ga0207639_10143782 | Ga0207639_101437823 | 152 |
| 582 | 3300026041 | Ga0207639_11260974 | Ga0207639_112609742 | 152 |
| 583 | 3300026067 | Ga0207678_10019586 | Ga0207678_100195863 | 152 |
| 584 | 3300026067 | Ga0207678_10035028 | Ga0207678_100350283 | 152 |
| 585 | 3300026067 | Ga0207678_10189322 | Ga0207678_101893223 | 152 |
| 586 | 3300026067 | Ga0207678_10200056 | Ga0207678_102000563 | 152 |
| 587 | 3300026067 | Ga0207678_10500377 | Ga0207678_105003773 | 152 |
| 588 | 3300026075 | Ga0207708_10112522 | Ga0207708_101125223 | 152 |
| 589 | 3300026078 | Ga0207702_10164430 | Ga0207702_101644302 | 152 |
| 590 | 3300026078 | Ga0207702_10185644 | Ga0207702_101856443 | 152 |
| 591 | 3300026088 | Ga0207641_10074603 | Ga0207641_100746033 | 152 |
| 592 | 3300026088 | Ga0207641_10124314 | Ga0207641_101243143 | 152 |
| 593 | 3300026088 | Ga0207641_10176091 | Ga0207641_101760912 | 152 |
| 594 | 3300026089 | Ga0207648_10006903 | Ga0207648_100069039 | 152 |
| 595 | 3300026089 | Ga0207648_10054061 | Ga0207648_100540613 | 152 |
| 596 | 3300026089 | Ga0207648_10388115 | Ga0207648_103881153 | 152 |
| 597 | 3300026089 | Ga0207648_11085464 | Ga0207648_110854642 | 152 |
| 598 | 3300026089 | Ga0207648_11186481 | Ga0207648_111864812 | 152 |
| 599 | 3300026095 | Ga0207676_10009546 | Ga0207676_100095467 | 152 |
| 600 | 3300026095 | Ga0207676_10183074 | Ga0207676_101830743 | 152 |
| 601 | 3300026118 | Ga0207675_100004533 | Ga0207675_1000045335 | 152 |
| 602 | 3300026118 | Ga0207675_100069868 | Ga0207675_1000698683 | 152 |
| 603 | 3300026118 | Ga0207675_102250165 | Ga0207675_1022501651 | 152 |
| 604 | 3300026121 | Ga0207683_10021200 | Ga0207683_100212004 | 152 |
| 605 | 3300026121 | Ga0207683_11537410 | Ga0207683_115374101 | 152 |
| 606 | 3300026142 | Ga0207698_10059238 | Ga0207698_100592385 | 152 |
| 607 | 3300026142 | Ga0207698_10119779 | Ga0207698_101197793 | 152 |
| 608 | 3300026142 | Ga0207698_10248185 | Ga0207698_102481852 | 152 |
| 609 | 3300026142 | Ga0207698_10309415 | Ga0207698_103094152 | 152 |
| 610 | 3300026142 | Ga0207698_11042732 | Ga0207698_110427322 | 152 |
| 611 | 3300027866 | Ga0209813_10134718 | Ga0209813_101347181 | 152 |
| 612 | 3300027907 | Ga0207428_10028203 | Ga0207428_100282038 | 152 |
| 613 | 3300028379 | Ga0268266_10000006 | Ga0268266_100000061087 | 152 |
| 614 | 3300028379 | Ga0268266_10008473 | Ga0268266_1000847310 | 152 |
| 615 | 3300028379 | Ga0268266_10282193 | Ga0268266_102821933 | 152 |
| 616 | 3300028379 | Ga0268266_10850377 | Ga0268266_108503771 | 152 |
| 617 | 3300028379 | Ga0268266_11013865 | Ga0268266_110138651 | 152 |
| 618 | 3300028380 | Ga0268265_10155113 | Ga0268265_101551134 | 152 |
| 619 | 3300028380 | Ga0268265_10169456 | Ga0268265_101694563 | 152 |
| 620 | 3300028381 | Ga0268264_10140100 | Ga0268264_101401003 | 152 |
| 621 | 3300028381 | Ga0268264_10514206 | Ga0268264_105142062 | 152 |
| 622 | 3300028786 | Ga0307517_10187960 | Ga0307517_101879602 | 152 |
| 623 | 3300028794 | Ga0307515_10084357 | Ga0307515_100843575 | 152 |
| 624 | 3300028794 | Ga0307515_10338516 | Ga0307515_103385162 | 152 |
| 625 | 3300031251 | Ga0265327_10240060 | Ga0265327_102400602 | 152 |
| 626 | 3300031456 | Ga0307513_10037594 | Ga0307513_100375945 | 152 |
| 627 | 3300031456 | Ga0307513_10398454 | Ga0307513_103984542 | 152 |
| 628 | 3300031456 | Ga0307513_10961020 | Ga0307513_109610201 | 152 |
| 629 | 3300031507 | Ga0307509_10224369 | Ga0307509_102243692 | 152 |
| 630 | 3300031548 | Ga0307408_100256560 | Ga0307408_1002565602 | 152 |
| 631 | 3300031616 | Ga0307508_10415536 | Ga0307508_104155362 | 152 |
| 632 | 3300031616 | Ga0307508_10683725 | Ga0307508_106837252 | 152 |
| 633 | 3300031730 | Ga0307516_10353758 | Ga0307516_103537582 | 152 |
| 634 | 3300031730 | Ga0307516_10782661 | Ga0307516_107826611 | 152 |
| 635 | 3300031911 | Ga0307412_10002067 | Ga0307412_1000206711 | 152 |
| 636 | 3300031911 | Ga0307412_10751925 | Ga0307412_107519251 | 152 |
| 637 | 3300031995 | Ga0307409_100686024 | Ga0307409_1006860242 | 152 |
| 638 | 3300032002 | Ga0307416_100554192 | Ga0307416_1005541923 | 152 |
| 639 | 3300032004 | Ga0307414_10015644 | Ga0307414_100156447 | 152 |
| 640 | 3300032004 | Ga0307414_10031431 | Ga0307414_100314315 | 152 |
| 641 | 3300032004 | Ga0307414_10062929 | Ga0307414_100629293 | 152 |
| 642 | 3300032004 | Ga0307414_10337673 | Ga0307414_103376732 | 152 |
| 643 | 3300032004 | Ga0307414_10350776 | Ga0307414_103507762 | 152 |
| 644 | 3300032004 | Ga0307414_10797192 | Ga0307414_107971922 | 152 |
| 645 | 3300033179 | Ga0307507_10271211 | Ga0307507_102712112 | 152 |
| 646 | 3300033180 | Ga0307510_10055864 | Ga0307510_100558643 | 152 |
| 647 | 3300034957 | Ga0373938_0083114 | Ga0373938_0083114_301_765 | 152 |
| 648 | 3300035088 | Ga0373940_0311132 | Ga0373940_0311132_64_528 | 152 |
| 649 | 3300035691 | Ga0373931_0034502 | Ga0373931_0034502_546_1010 | 152 |
| 650 | 3300035695 | Ga0373927_0693648 | Ga0373927_0693648_163_627 | 152 |
| 651 | 3300037471 | Ga0395905_0008017 | Ga0395905_0008017_977_1441 | 152 |
| 652 | 3300037471 | Ga0395905_1142011 | Ga0395905_1142011_144_608 | 152 |
| 653 | 3300039447 | Ga0436361_0293969 | Ga0436361_0293969_1130_1594 | 152 |
| 654 | 3300041404 | Ga0439436_0020251 | Ga0439436_0020251_934_1398 | 152 |
| 655 | 3300041406 | Ga0439439_0081823 | Ga0439439_0081823_55_519 | 152 |
| 656 | 3300041411 | Ga0439466_0001152 | Ga0439466_0001152_1369_1833 | 152 |
| 657 | 3300041413 | Ga0439465_0023660 | Ga0439465_0023660_880_1344 | 152 |
| 658 | 3300041486 | Ga0451807_2500867 | Ga0451807_2500867_20_535 | 152 |
| 659 | 3300041997 | Ga0439431_0000492 | Ga0439431_0000492_3199_3663 | 152 |
| 660 | 3300041999 | Ga0439433_0000544 | Ga0439433_0000544_3178_3642 | 152 |
| 661 | 3300042004 | Ga0439445_0003464 | Ga0439445_0003464_1873_2337 | 152 |
| 662 | 3300042006 | Ga0439432_000899 | Ga0439432_000899_5110_5574 | 152 |
| 663 | 3300042007 | Ga0439449_0001320 | Ga0439449_0001320_6466_6930 | 152 |
| 664 | 3300042010 | Ga0439452_001474 | Ga0439452_001474_357_821 | 152 |
| 665 | 3300042014 | Ga0439457_127838 | Ga0439457_127838_53_517 | 152 |
| 666 | 3300042015 | Ga0439462_0010319 | Ga0439462_0010319_120_584 | 152 |
| 667 | 3300042015 | Ga0439462_0010713 | Ga0439462_0010713_1486_1950 | 152 |
| 668 | 3300042156 | Ga0439446_0008427 | Ga0439446_0008427_666_1130 | 152 |
| 669 | 3300042876 | Ga0451577_0636036 | Ga0451577_0636036_193_675 | 152 |
| 670 | 3300044656 | Ga0466969_0057023 | Ga0466969_0057023_1324_1788 | 152 |
| 671 | 3300044693 | Ga0466961_0307626 | Ga0466961_0307626_371_835 | 152 |
| 672 | 3300044706 | Ga0466964_0154252 | Ga0466964_0154252_467_943 | 152 |
| 673 | 3300044735 | Ga0466968_0073615 | Ga0466968_0073615_811_1275 | 152 |
| 674 | 3300044765 | Ga0466970_0024375 | Ga0466970_0024375_2687_3151 | 152 |
| 675 | 3300044842 | Ga0466957_0149423 | Ga0466957_0149423_568_1032 | 152 |
| 676 | 3300045049 | Ga0466959_0094204 | Ga0466959_0094204_1440_1904 | 152 |
| 677 | 3300045049 | Ga0466959_0723687 | Ga0466959_0723687_129_593 | 152 |
| 678 | 3300045051 | Ga0451576_0063519 | Ga0451576_0063519_1943_2407 | 152 |
| 679 | 3300045836 | Ga0466958_0631066 | Ga0466958_0631066_188_652 | 152 |
| 680 | 3300046452 | Ga0495617_105608 | Ga0495617_105608_97_561 | 152 |
| 681 | 3300046455 | Ga0495603_0029113 | Ga0495603_0029113_58_522 | 152 |
| 682 | 3300046459 | Ga0495629_0057102 | Ga0495629_0057102_490_954 | 152 |
| 683 | 3300046460 | Ga0495638_0082463 | Ga0495638_0082463_1414_1878 | 152 |
| 684 | 3300046471 | Ga0495650_0099792 | Ga0495650_0099792_274_738 | 152 |
| 685 | 3300046477 | Ga0495664_0416636 | Ga0495664_0416636_218_682 | 152 |
| 686 | 3300046491 | Ga0495584_0471175 | Ga0495584_0471175_146_610 | 152 |
| 687 | 3300046507 | Ga0495606_0207598 | Ga0495606_0207598_407_871 | 152 |
| 688 | 3300046507 | Ga0495606_0276653 | Ga0495606_0276653_316_780 | 152 |
| 689 | 3300046511 | Ga0495608_0102807 | Ga0495608_0102807_1114_1578 | 152 |
| 690 | 3300046519 | Ga0495632_0058932 | Ga0495632_0058932_49_513 | 152 |
| 691 | 3300046519 | Ga0495632_0209603 | Ga0495632_0209603_386_850 | 152 |
| 692 | 3300046520 | Ga0495637_0177352 | Ga0495637_0177352_235_699 | 152 |
| 693 | 3300046522 | Ga0495643_0346058 | Ga0495643_0346058_95_559 | 152 |
| 694 | 3300046528 | Ga0495642_0045754 | Ga0495642_0045754_1300_1764 | 152 |
| 695 | 3300046535 | Ga0495586_0505439 | Ga0495586_0505439_137_601 | 152 |
| 696 | 3300046536 | Ga0495587_0270497 | Ga0495587_0270497_127_591 | 152 |
| 697 | 3300046538 | Ga0495609_0171341 | Ga0495609_0171341_201_665 | 152 |
| 698 | 3300046539 | Ga0495621_0126242 | Ga0495621_0126242_158_622 | 152 |
| 699 | 3300046557 | Ga0495622_0182991 | Ga0495622_0182991_204_668 | 152 |
| 700 | 3300046615 | Ga0495656_0003280 | Ga0495656_0003280_3825_4289 | 152 |
| 701 | 3300046615 | Ga0495656_0284002 | Ga0495656_0284002_291_755 | 152 |
| 702 | 3300046616 | Ga0495668_0386557 | Ga0495668_0386557_75_539 | 152 |
| 703 | 3300046660 | Ga0495625_0558563 | Ga0495625_0558563_147_611 | 152 |
| 704 | 3300046664 | Ga0495659_0220730 | Ga0495659_0220730_210_674 | 152 |
| 705 | 3300046664 | Ga0495659_0355867 | Ga0495659_0355867_31_495 | 152 |
| 706 | 3300046675 | Ga0495657_0320263 | Ga0495657_0320263_68_532 | 152 |
| 707 | 3300046678 | Ga0495599_0118626 | Ga0495599_0118626_1081_1545 | 152 |
| 708 | 3300046683 | Ga0495658_0163611 | Ga0495658_0163611_754_1218 | 152 |
| 709 | 3300046690 | Ga0495624_0171618 | Ga0495624_0171618_594_1058 | 152 |
| 710 | 3300046690 | Ga0495624_0401892 | Ga0495624_0401892_137_601 | 152 |
| 711 | 3300046690 | Ga0495624_0596835 | Ga0495624_0596835_60_524 | 152 |
| 712 | 3300046691 | Ga0495670_0090661 | Ga0495670_0090661_782_1246 | 152 |
| 713 | 3300046694 | Ga0495649_0001665 | Ga0495649_0001665_13715_14179 | 152 |
| 714 | 3300046810 | Ga0495660_0058223 | Ga0495660_0058223_171_635 | 152 |
| 715 | 3300046810 | Ga0495660_0133190 | Ga0495660_0133190_559_1023 | 152 |
| 716 | 3300047318 | Ga0495636_0607055 | Ga0495636_0607055_58_522 | 152 |
| 717 | 3300047320 | Ga0495672_0104127 | Ga0495672_0104127_854_1318 | 152 |
| 718 | 3300047443 | Ga0495687_008648 | Ga0495687_008648_254_718 | 152 |
| 719 | 3300047443 | Ga0495687_059520 | Ga0495687_059520_254_718 | 152 |
| 720 | 3300047470 | Ga0495681_0349180 | Ga0495681_0349180_86_550 | 152 |
| 721 | 3300047472 | Ga0495686_0102336 | Ga0495686_0102336_547_1014 | 152 |
| 722 | 3300047472 | Ga0495686_0102430 | Ga0495686_0102430_664_1128 | 152 |
| 723 | 3300047472 | Ga0495686_0218347 | Ga0495686_0218347_159_623 | 152 |
| 724 | 3300048088 | Ga0495602_0590597 | Ga0495602_0590597_203_667 | 152 |
| 725 | 3300048090 | Ga0495615_0001947 | Ga0495615_0001947_341_805 | 152 |
| 726 | 3300048090 | Ga0495615_0036958 | Ga0495615_0036958_33_497 | 152 |
| 727 | 3300048091 | Ga0495626_0068486 | Ga0495626_0068486_933_1397 | 152 |
| 728 | 3300048903 | Ga0496100_0017819 | Ga0496100_0017819_288_752 | 152 |
| 729 | 3300048903 | Ga0496100_0050598 | Ga0496100_0050598_873_1337 | 152 |
| 730 | 3300048904 | Ga0496101_0012043 | Ga0496101_0012043_4447_4911 | 152 |
| 731 | 3300048904 | Ga0496101_0012131 | Ga0496101_0012131_1497_1961 | 152 |
| 732 | 3300048905 | Ga0496102_0019066 | Ga0496102_0019066_4097_4561 | 152 |
| 733 | 3300048905 | Ga0496102_0101892 | Ga0496102_0101892_652_1116 | 152 |
| 734 | 3300048905 | Ga0496102_0316653 | Ga0496102_0316653_902_1366 | 152 |
| 735 | 3300048906 | Ga0496103_0384545 | Ga0496103_0384545_326_790 | 152 |
| 736 | 3300048907 | Ga0496104_0038566 | Ga0496104_0038566_101_565 | 152 |
| 737 | 3300048908 | Ga0496105_0002707 | Ga0496105_0002707_12095_12559 | 152 |
| 738 | 3300048909 | Ga0496106_0054826 | Ga0496106_0054826_1731_2195 | 152 |
| 739 | 3300048909 | Ga0496106_0113752 | Ga0496106_0113752_1151_1615 | 152 |
| 740 | 3300048909 | Ga0496106_0481811 | Ga0496106_0481811_253_717 | 152 |
| 741 | 3300048910 | Ga0496107_0119804 | Ga0496107_0119804_324_788 | 152 |
| 742 | 3300048911 | Ga0496108_0015709 | Ga0496108_0015709_2443_2907 | 152 |
| 743 | 3300048911 | Ga0496108_0082179 | Ga0496108_0082179_674_1138 | 152 |
| 744 | 3300048911 | Ga0496108_0671352 | Ga0496108_0671352_411_875 | 152 |
| 745 | 3300048912 | Ga0496109_0099704 | Ga0496109_0099704_1801_2265 | 152 |
| 746 | 3300048912 | Ga0496109_0435650 | Ga0496109_0435650_124_588 | 152 |
| 747 | 3300048913 | Ga0496110_0111462 | Ga0496110_0111462_997_1461 | 152 |
| 748 | 3300048913 | Ga0496110_0330956 | Ga0496110_0330956_141_605 | 152 |
| 749 | 3300048914 | Ga0496111_0027198 | Ga0496111_0027198_2925_3389 | 152 |
| 750 | 3300048914 | Ga0496111_0126926 | Ga0496111_0126926_1003_1467 | 152 |
| 751 | 3300048917 | Ga0496114_0002742 | Ga0496114_0002742_8457_8921 | 152 |
| 752 | 3300048917 | Ga0496114_0068903 | Ga0496114_0068903_1634_2098 | 152 |
| 753 | 3300048917 | Ga0496114_0288187 | Ga0496114_0288187_19_483 | 152 |
| 754 | 3300048918 | Ga0496115_0029002 | Ga0496115_0029002_461_925 | 152 |
| 755 | 3300048921 | Ga0496118_0078896 | Ga0496118_0078896_1846_2310 | 152 |
| 756 | 3300048927 | Ga0496124_0183000 | Ga0496124_0183000_305_769 | 152 |
| 757 | 3300048929 | Ga0496126_0168632 | Ga0496126_0168632_887_1351 | 152 |
| 758 | 3300049459 | Ga0495678_058037 | Ga0495678_058037_475_939 | 152 |
| 759 | 3300049683 | Ga0501253_001678 | Ga0501253_001678_1712_2176 | 152 |
| 760 | 3300049822 | Ga0501035_0033759 | Ga0501035_0033759_3722_4186 | 152 |
| 761 | 3300050489 | nmdc:mga03683_113908_c1 | nmdc:mga03683_113908_c1_606_1070 | 152 |
| 762 | 3300050489 | nmdc:mga03683_16375_c1 | nmdc:mga03683_16375_c1_1977_2441 | 152 |
| 763 | 3300050489 | nmdc:mga03683_178440_c1 | nmdc:mga03683_178440_c1_32_496 | 152 |
| 764 | 3300050490 | nmdc:mga03n38_140710_c1 | nmdc:mga03n38_140710_c1_577_1041 | 152 |
| 765 | 3300050491 | nmdc:mga00v17_206551_c1 | nmdc:mga00v17_206551_c1_375_839 | 152 |
| 766 | 3300050492 | nmdc:mga0yw44_39719_c1 | nmdc:mga0yw44_39719_c1_2192_2656 | 152 |
| 767 | 3300050492 | nmdc:mga0yw44_771708_c1 | nmdc:mga0yw44_771708_c1_56_523 | 152 |
| 768 | 3300050493 | nmdc:mga0k408_15743_c1 | nmdc:mga0k408_15743_c1_344_808 | 152 |
| 769 | 3300050493 | nmdc:mga0k408_215103_c1 | nmdc:mga0k408_215103_c1_80_544 | 152 |
| 770 | 3300050493 | nmdc:mga0k408_25116_c1 | nmdc:mga0k408_25116_c1_1600_2082 | 152 |
| 771 | 3300050493 | nmdc:mga0k408_285659_c1 | nmdc:mga0k408_285659_c1_136_600 | 152 |
| 772 | 3300050493 | nmdc:mga0k408_371395_c1 | nmdc:mga0k408_371395_c1_265_729 | 152 |
| 773 | 3300050493 | nmdc:mga0k408_43188_c1 | nmdc:mga0k408_43188_c1_832_1311 | 152 |
| 774 | 3300050494 | nmdc:mga06z11_575805_c1 | nmdc:mga06z11_575805_c1_103_570 | 152 |
| 775 | 3300050496 | nmdc:mga07m45_141082_c1 | nmdc:mga07m45_141082_c1_27_491 | 152 |
| 776 | 3300050496 | nmdc:mga07m45_38124_c1 | nmdc:mga07m45_38124_c1_945_1409 | 152 |
| 777 | 3300050496 | nmdc:mga07m45_6048_c1 | nmdc:mga07m45_6048_c1_4089_4553 | 152 |
| 778 | 3300050496 | nmdc:mga07m45_896_c1 | nmdc:mga07m45_896_c1_2536_3000 | 152 |
| 779 | 3300050510 | nmdc:mga06r32_2023656_c1 | nmdc:mga06r32_2023656_c1_22_486 | 152 |
| 780 | 3300050511 | nmdc:mga08y16_211707_c1 | nmdc:mga08y16_211707_c1_64_528 | 152 |
| 781 | 3300050511 | nmdc:mga08y16_305202_c1 | nmdc:mga08y16_305202_c1_98_562 | 152 |
| 782 | 3300050512 | nmdc:mga0n895_802118_c1 | nmdc:mga0n895_802118_c1_304_768 | 152 |
| 783 | 3300050512 | nmdc:mga0n895_83244_c1 | nmdc:mga0n895_83244_c1_1452_1916 | 152 |
| 784 | 3300050515 | nmdc:mga0a205_26067_c1 | nmdc:mga0a205_26067_c1_1409_1873 | 152 |
| 785 | 3300053077 | Ga0495601_0366609 | Ga0495601_0366609_21_485 | 152 |
| 786 | 3300053086 | Ga0500578_0060252 | Ga0500578_0060252_1034_1498 | 152 |
| 787 | 3300053088 | Ga0500644_0048263 | Ga0500644_0048263_173_640 | 152 |
| 788 | 3300053090 | Ga0500646_0121039 | Ga0500646_0121039_155_619 | 152 |
| 789 | 3300053105 | Ga0500557_070692 | Ga0500557_070692_531_995 | 152 |
| 790 | 3300053126 | Ga0500621_215512 | Ga0500621_215512_141_608 | 152 |
| 791 | 3300053130 | Ga0500642_0001506 | Ga0500642_0001506_2001_2465 | 152 |
| 792 | 3300053134 | Ga0500658_0006918 | Ga0500658_0006918_2297_2761 | 152 |
| 793 | 3300053156 | Ga0500622_0000548 | Ga0500622_0000548_2821_3288 | 152 |
| 794 | 3300053158 | Ga0500627_0238885 | Ga0500627_0238885_108_575 | 152 |
| 795 | 3300053158 | Ga0500627_0420783 | Ga0500627_0420783_36_500 | 152 |
| 796 | 3300053727 | Ga0500611_217242 | Ga0500611_217242_49_513 | 152 |
| 797 | 3300053732 | Ga0500656_005697 | Ga0500656_005697_355_819 | 152 |
| 798 | 3300059424 | Ga0590075_098398 | Ga0590075_098398_130_606 | 152 |
| 799 | 3300048911 | Ga0496108_0042495 | Ga0496108_0042495_3260_3727 | 153 |
| 800 | 3300048912 | Ga0496109_0014190 | Ga0496109_0014190_3784_4251 | 153 |
| 801 | 3300048913 | Ga0496110_0441118 | Ga0496110_0441118_705_1172 | 153 |
| 802 | 3300048915 | Ga0496112_0520490 | Ga0496112_0520490_547_1014 | 153 |
| 803 | 2162886007 | SwRhRL2b_contig_1515736 | SwRhRL2b_0080.00005450 | 154 |
| 804 | 3300006051 | Ga0075364_10398619 | Ga0075364_103986192 | 154 |
| 805 | 3300006177 | Ga0075362_10003653 | Ga0075362_100036534 | 154 |
| 806 | 3300006178 | Ga0075367_10010124 | Ga0075367_100101246 | 154 |
| 807 | 3300006186 | Ga0075369_10012436 | Ga0075369_100124364 | 154 |
| 808 | 3300006353 | Ga0075370_10005629 | Ga0075370_100056294 | 154 |
| 809 | 3300009098 | Ga0105245_10500778 | Ga0105245_105007782 | 154 |
| 810 | 3300009101 | Ga0105247_10151404 | Ga0105247_101514042 | 154 |
| 811 | 3300009147 | Ga0114129_10194241 | Ga0114129_101942414 | 154 |
| 812 | 3300009148 | Ga0105243_10447539 | Ga0105243_104475393 | 154 |
| 813 | 3300009174 | Ga0105241_10078094 | Ga0105241_100780943 | 154 |
| 814 | 3300009177 | Ga0105248_10356690 | Ga0105248_103566902 | 154 |
| 815 | 3300009545 | Ga0105237_10207704 | Ga0105237_102077043 | 154 |
| 816 | 3300010375 | Ga0105239_10060043 | Ga0105239_100600434 | 154 |
| 817 | 3300010375 | Ga0105239_10339377 | Ga0105239_103393772 | 154 |
| 818 | 3300013297 | Ga0157378_12755335 | Ga0157378_127553351 | 154 |
| 819 | 3300014968 | Ga0157379_10716067 | Ga0157379_107160672 | 154 |
| 820 | 3300014969 | Ga0157376_10362243 | Ga0157376_103622433 | 154 |
| 821 | 3300015261 | Ga0182006_1032465 | Ga0182006_10324651 | 154 |
| 822 | 3300031090 | Ga0265760_10121233 | Ga0265760_101212332 | 154 |
| 823 | 3300041459 | Ga0451800_1417645 | Ga0451800_1417645_117_584 | 154 |
| 824 | 3300042002 | Ga0439442_009444 | Ga0439442_009444_49_519 | 154 |
| 825 | 3300042115 | Ga0450911_000674 | Ga0450911_000674_8815_9279 | 154 |
| 826 | 3300045051 | Ga0451576_0097489 | Ga0451576_0097489_1623_2093 | 154 |
| 827 | 3300046460 | Ga0495638_0204954 | Ga0495638_0204954_25_489 | 154 |
| 828 | 3300046491 | Ga0495584_0582862 | Ga0495584_0582862_63_533 | 154 |
| 829 | 3300046492 | Ga0495585_0174459 | Ga0495585_0174459_74_544 | 154 |
| 830 | 3300046499 | Ga0495594_0119664 | Ga0495594_0119664_651_1121 | 154 |
| 831 | 3300046501 | Ga0495607_0418186 | Ga0495607_0418186_125_595 | 154 |
| 832 | 3300046513 | Ga0495616_0032869 | Ga0495616_0032869_2099_2569 | 154 |
| 833 | 3300046515 | Ga0495620_0083564 | Ga0495620_0083564_262_732 | 154 |
| 834 | 3300046522 | Ga0495643_0307107 | Ga0495643_0307107_42_512 | 154 |
| 835 | 3300046525 | Ga0495663_0001336 | Ga0495663_0001336_3829_4293 | 154 |
| 836 | 3300046537 | Ga0495598_0082289 | Ga0495598_0082289_525_995 | 154 |
| 837 | 3300046557 | Ga0495622_0053012 | Ga0495622_0053012_1266_1736 | 154 |
| 838 | 3300046558 | Ga0495633_0006199 | Ga0495633_0006199_5739_6203 | 154 |
| 839 | 3300046615 | Ga0495656_0104827 | Ga0495656_0104827_567_1037 | 154 |
| 840 | 3300046648 | Ga0495611_0370529 | Ga0495611_0370529_35_505 | 154 |
| 841 | 3300046674 | Ga0495588_0026527 | Ga0495588_0026527_314_784 | 154 |
| 842 | 3300046681 | Ga0495647_0134897 | Ga0495647_0134897_544_1014 | 154 |
| 843 | 3300046691 | Ga0495670_0233202 | Ga0495670_0233202_340_810 | 154 |
| 844 | 3300047318 | Ga0495636_0246165 | Ga0495636_0246165_205_675 | 154 |
| 845 | 3300047321 | Ga0495676_0045195 | Ga0495676_0045195_205_675 | 154 |
| 846 | 3300047323 | Ga0495683_0189872 | Ga0495683_0189872_94_564 | 154 |
| 847 | 3300047447 | Ga0495685_172500 | Ga0495685_172500_94_564 | 154 |
| 848 | 3300048907 | Ga0496104_0375199 | Ga0496104_0375199_700_1170 | 154 |
| 849 | 3300048909 | Ga0496106_0204280 | Ga0496106_0204280_680_1150 | 154 |
| 850 | 3300048910 | Ga0496107_0267265 | Ga0496107_0267265_121_591 | 154 |
| 851 | 3300048911 | Ga0496108_0220030 | Ga0496108_0220030_836_1306 | 154 |
| 852 | 3300048912 | Ga0496109_0057212 | Ga0496109_0057212_403_873 | 154 |
| 853 | 3300048914 | Ga0496111_0120729 | Ga0496111_0120729_818_1288 | 154 |
| 854 | 3300048916 | Ga0496113_0143784 | Ga0496113_0143784_207_677 | 154 |
| 855 | 3300048919 | Ga0496116_0000370 | Ga0496116_0000370_3182_3646 | 154 |
| 856 | 3300048921 | Ga0496118_0017779 | Ga0496118_0017779_1152_1616 | 154 |
| 857 | 3300048924 | Ga0496121_0004954 | Ga0496121_0004954_4031_4495 | 154 |
| 858 | 3300048924 | Ga0496121_0168228 | Ga0496121_0168228_941_1405 | 154 |
| 859 | 3300048924 | Ga0496121_0318318 | Ga0496121_0318318_499_969 | 154 |
| 860 | 3300048925 | Ga0496122_0030764 | Ga0496122_0030764_3627_4100 | 154 |
| 861 | 3300048925 | Ga0496122_0505246 | Ga0496122_0505246_14_478 | 154 |
| 862 | 3300048926 | Ga0496123_0023620 | Ga0496123_0023620_551_1024 | 154 |
| 863 | 3300048927 | Ga0496124_0142044 | Ga0496124_0142044_1026_1490 | 154 |
| 864 | 3300048927 | Ga0496124_0299631 | Ga0496124_0299631_220_690 | 154 |
| 865 | 3300048927 | Ga0496124_0304386 | Ga0496124_0304386_404_868 | 154 |
| 866 | 3300048928 | Ga0496125_0044534 | Ga0496125_0044534_935_1399 | 154 |
| 867 | 3300048928 | Ga0496125_0079102 | Ga0496125_0079102_29_493 | 154 |
| 868 | 3300048929 | Ga0496126_0004800 | Ga0496126_0004800_3738_4211 | 154 |
| 869 | 3300048929 | Ga0496126_0014970 | Ga0496126_0014970_3001_3471 | 154 |
| 870 | 3300048929 | Ga0496126_0336530 | Ga0496126_0336530_471_935 | 154 |
| 871 | 3300050489 | nmdc:mga03683_73065_c1 | nmdc:mga03683_73065_c1_106_576 | 154 |
| 872 | 3300050491 | nmdc:mga00v17_160761_c1 | nmdc:mga00v17_160761_c1_887_1357 | 154 |
| 873 | 3300050492 | nmdc:mga0yw44_16659_c1 | nmdc:mga0yw44_16659_c1_3140_3610 | 154 |
| 874 | 3300050494 | nmdc:mga06z11_287434_c1 | nmdc:mga06z11_287434_c1_372_842 | 154 |
| 875 | 3300050494 | nmdc:mga06z11_805013_c1 | nmdc:mga06z11_805013_c1_88_558 | 154 |
| 876 | 3300050496 | nmdc:mga07m45_72906_c1 | nmdc:mga07m45_72906_c1_180_650 | 154 |
| 877 | 3300050507 | nmdc:mga05p37_381692_c1 | nmdc:mga05p37_381692_c1_509_979 | 154 |
| 878 | 3300050514 | nmdc:mga08x19_178555_c1 | nmdc:mga08x19_178555_c1_759_1229 | 154 |
| 879 | 3300050516 | nmdc:mga0sz30_18350_c1 | nmdc:mga0sz30_18350_c1_1034_1504 | 154 |
| 880 | 3300053090 | Ga0500646_0156192 | Ga0500646_0156192_242_712 | 154 |
| 881 | 3300053119 | Ga0500595_009175 | Ga0500595_009175_1423_1893 | 154 |
| 882 | 3300053133 | Ga0500655_072100 | Ga0500655_072100_80_550 | 154 |
| 883 | 3300053139 | Ga0500568_0151235 | Ga0500568_0151235_297_773 | 154 |
| 884 | 3300053142 | Ga0500577_0165746 | Ga0500577_0165746_94_564 | 154 |
| 885 | 3300053146 | Ga0500588_0101422 | Ga0500588_0101422_160_630 | 154 |
| 886 | 3300053150 | Ga0500603_189308 | Ga0500603_189308_169_639 | 154 |
| 887 | 3300053151 | Ga0500604_0144979 | Ga0500604_0144979_81_551 | 154 |
| 888 | 3300053160 | Ga0500633_0107593 | Ga0500633_0107593_226_696 | 154 |
| 889 | 3300053178 | Ga0500637_0266664 | Ga0500637_0266664_58_528 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3q6a-assembly1.cif.gz_A | x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 | 0.8442 | 8 | 148 |
| 3q6a-assembly1.cif.gz_D | x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 | 0.84 | 8 | 147 |
| 2m89-assembly1.cif.gz_B | solution structure of the aha1 dimer from colwellia psychrerythraea | 0.8374 | 8 | 146 |
| 3q63-assembly2.cif.gz_D | x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. | 0.8347 | 8 | 141 |
| 2nn5-assembly1.cif.gz_A | structure of conserved protein of unknown function ef2215 from enterococcus faecalis | 0.8309 | 7 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9V9Q4_218_347_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8417 | 6 | 141 | 3.30.530.20 |
| af_Q55DB6_248_379_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8414 | 6 | 141 | 3.30.530.20 |
| 2m89B00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8374 | 8 | 146 | 3.30.530.20 |
| af_Q4E5D5_198_328_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8351 | 6 | 141 | 3.30.530.20 |
| af_O53773_104_241_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8351 | 10 | 154 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A528FRZ6-F1-model_v4 | Polyketide cyclase | 0.9933 | 14 | 96 |
|
| AF-A0A4V1M889-F1-model_v4 | Polyketide cyclase | 0.991 | 3 | 110 |
|
| AF-A0A1F9DD81-F1-model_v4 | Polyketide cyclase | 0.9909 | 7 | 148 |
|
| AF-I4B4N7-F1-model_v4 | Activator of Hsp90 ATPase 1 family protein | 0.9886 | 16 | 154 |
|
| AF-A0A1N7N7S5-F1-model_v4 | Uncharacterized conserved protein YndB, AHSA1/START domain | 0.9855 | 3 | 154 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar