F484781

General Info

Members Datasets Scaffolds Average Seq Length
889 606 663 294

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10000726|JGI25153J46596_1000072619
Length 310
Sequence MLVVIAALLPVFILIVLGVVLRHSLMRLDTQWHGLERLTYFVLFPMLLIQTLVRADLTKVPVAGVGGALLLSALAMSLLCLALRPALSRLDVDGPAFTSIFQGATRWQTYVALSVSANLYGDVGLALASVAMVAIXPLVNVFSVAVLAHYASPEKQSMRAIVMTVIRNPLIWACVIGLVINVVHLPLPKIWHEVADALGRSSLAIGLLVTGAGLQLKGLFRPSVSASIGVAFKLVLMPVLALVLAVWFRLSGNSLAIVAICAAVPTSPSAYVLARQMGGDAPLLAQIITLQTILAAITMPIAIALVATGS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
14 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
23 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
24 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
27 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
28 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
29 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
30 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
31 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
32 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
33 2791355199
34 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
35 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
36 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
37 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
38 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
39 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
40 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
41 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
42 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
43 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
44 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
45 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
46 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
47 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
48 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
49 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
50 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
51 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
52 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
53 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
54 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
55 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
56 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
57 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
58 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
59 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
60 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
61 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
62 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
63 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
64 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
65 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
66 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
67 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
68 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
69 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
70 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
71 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
72 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
73 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
74 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
75 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
76 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
77 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
78 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
79 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
80 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
81 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
82 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
83 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
84 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
85 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
86 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
87 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
88 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
89 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
90 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
91 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
92 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
93 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
94 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
95 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
96 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
97 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
98 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
99 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
100 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
101 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
102 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
103 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
104 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
105 2906610324
106 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
107 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
108 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
109 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
110 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
111 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
112 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
113 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
114 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
115 2922368715
116 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
117 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
118 2922425934
119 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
120 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
121 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
122 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
123 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
124 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
125 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
126 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
127 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
128 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
129 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
130 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
131 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
132 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
133 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
134 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
135 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
136 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
137 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
138 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
139 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
140 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
141 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
142 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
143 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
144 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
145 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
146 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
147 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
148 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
149 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
150 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
151 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
152 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
153 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
154 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
155 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
156 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
157 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
158 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
159 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
160 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
161 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
162 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
163 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
164 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
165 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
166 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
167 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
168 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
169 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
170 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
171 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
172 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
173 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
174 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
175 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
176 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
177 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
178 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
179 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
180 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
181 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
182 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
183 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
184 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
185 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
186 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
187 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
188 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
189 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
190 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
191 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
192 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
193 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
194 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
195 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
196 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
197 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
198 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
199 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
200 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
201 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
202 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
203 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
204 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
205 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
206 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
207 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
208 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
209 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
210 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
211 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
212 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
213 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
214 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
215 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
216 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
217 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
218 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
219 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
220 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
221 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
222 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
223 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
224 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
225 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
226 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
227 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
228 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
229 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
230 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
231 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
232 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
233 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
234 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
235 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
236 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
237 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
238 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
239 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
240 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
241 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
242 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
243 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
244 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
245 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
246 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
247 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
248 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
249 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
250 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
251 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
252 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
253 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
254 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
255 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
256 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
257 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
258 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
259 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
260 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
261 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
262 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
263 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
264 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
265 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
266 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
267 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
268 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
269 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
270 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
271 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
272 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
273 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
274 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
275 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
276 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
277 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
278 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
279 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
280 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
281 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
282 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
283 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
284 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
285 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
286 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
287 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
291 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
293 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
294 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
295 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
296 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
334 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
335 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
336 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
337 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
339 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
342 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
343 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
344 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
345 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
346 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
347 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
348 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
349 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
350 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
351 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
352 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
353 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
354 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
355 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
356 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
357 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
358 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
359 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
360 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
361 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
362 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
363 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
364 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
365 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
366 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
367 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
368 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
369 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
370 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
371 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
372 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
373 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
374 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
375 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
376 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
377 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
378 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
379 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
380 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
381 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
382 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
383 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
384 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
385 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
386 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
387 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
388 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
389 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
390 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
391 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
392 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
393 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
394 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
395 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
396 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
397 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
398 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
399 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
400 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
401 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
402 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
403 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
404 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
405 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
406 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
407 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
408 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
409 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
410 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
411 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
412 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
413 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
414 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
415 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
416 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
417 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
418 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
419 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
420 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
421 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
422 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
423 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
424 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
425 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
426 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
427 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
428 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
429 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
430 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
431 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
432 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
433 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
434 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
435 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
436 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
437 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
438 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
439 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
440 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
441 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
442 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
443 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
444 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
445 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
446 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
447 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
448 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
449 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
450 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
451 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
452 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
453 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
454 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
455 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
456 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
457 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
458 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
459 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
460 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
461 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
462 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
463 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
464 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
465 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
466 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
467 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
468 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
469 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
470 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
471 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
472 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
473 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
474 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
475 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
476 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
477 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
478 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
479 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
480 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
481 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
482 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
483 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
486 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
487 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
488 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
489 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
490 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
494 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
495 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
496 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
497 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
498 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
499 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
500 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
501 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
502 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
503 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
504 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
505 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
507 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
508 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
509 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
510 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
511 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
512 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
513 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
514 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
515 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
516 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
517 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
518 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
519 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
520 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
521 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
522 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
523 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
524 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
525 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
526 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
527 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
528 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
529 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
530 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
531 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
532 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
533 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
534 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
535 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
536 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
537 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
538 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
539 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
540 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
541 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
542 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
543 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
544 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
545 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
546 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
547 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
548 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
549 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
550 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
551 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
552 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
553 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
554 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
555 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
556 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
557 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
558 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
559 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
560 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
561 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
562 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
563 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
564 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
565 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
566 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
567 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
568 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
569 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
570 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
571 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
572 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
573 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
574 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
575 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
576 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
577 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
578 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
579 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
580 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
581 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
582 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
583 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
584 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
585 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
586 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
587 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
588 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
589 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
590 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
591 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
592 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
593 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
594 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
595 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
596 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
597 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
598 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
599 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
600 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
601 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
602 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
603 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
604 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
605 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
606 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.92
Metatranscriptomes 0
Isolates 25.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.76
Nodule 20.25
Rhizoplane 3.04
Rhizosphere 44.77
Stem 0
Stem Tuber 0
Unclassified 15.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000853 3300003203 Bacteria 14355
2 JGI25153J46596_10000691 3300003215 Bacteria 20594
3 JGI25153J46596_10000726 3300003215 Bacteria 20196
4 JGI25153J46596_10002725 3300003215 Bacteria 10068
5 JGI25153J46596_10004784 3300003215 Bacteria 7217
6 rootH1_10023786 3300003323 Bacteria 1147
7 rootH1_10136472 3300003323 Bacteria 2161
8 JGI25160J50197_1000742 3300003354 Bacteria 17776
9 JGI25160J50197_1002987 3300003354 Bacteria 7716
10 JGI25404J52841_10003218 3300003659 Bacteria 3202
11 JGI25404J52841_10004496 3300003659 Bacteria 2830
12 JGI25404J52841_10013563 3300003659 Bacteria 1767
13 Ga0055531_10011993 3300003794 Bacteria 4117
14 Ga0055543_1003311 3300004625 Bacteria 4829
15 Ga0065165_1002764 3300005262 Bacteria 13948
16 Ga0065165_1004938 3300005262 Bacteria 7853
17 Ga0065165_1005861 3300005262 Bacteria 6680
18 Ga0065165_1025486 3300005262 Bacteria 1964
19 Ga0070658_10071789 3300005327 Bacteria 2836
20 Ga0070676_10198311 3300005328 Bacteria 1314
21 Ga0070690_100103363 3300005330 Bacteria 1892
22 Ga0070690_100337894 3300005330 Bacteria 1090
23 Ga0068869_100085191 3300005334 Bacteria 2367
24 Ga0070682_100050602 3300005337 Bacteria 2595
25 Ga0068868_100325214 3300005338 Bacteria 1311
26 Ga0070660_100191061 3300005339 Bacteria 1659
27 Ga0070689_100068438 3300005340 Bacteria 2769
28 Ga0070661_100229761 3300005344 Bacteria 1425
29 Ga0070668_100116047 3300005347 Bacteria 2135
30 Ga0070671_100135451 3300005355 Bacteria 2076
31 Ga0070671_100491050 3300005355 Bacteria 1056
32 Ga0070673_100109504 3300005364 Bacteria 2289
33 Ga0070667_100387258 3300005367 Bacteria 1271
34 Ga0070709_10000536 3300005434 Bacteria 22217
35 Ga0070709_10050453 3300005434 Bacteria 2607
36 Ga0070714_100017643 3300005435 Bacteria 5786
37 Ga0070714_100320729 3300005435 Bacteria 1449
38 Ga0070713_100001790 3300005436 Bacteria 13842
39 Ga0070713_100060245 3300005436 Bacteria 3173
40 Ga0070713_100109400 3300005436 Bacteria 2408
41 Ga0070710_10001025 3300005437 Bacteria 13267
42 Ga0070711_100006213 3300005439 Bacteria 7187
43 Ga0070663_100024377 3300005455 Bacteria 4071
44 Ga0070663_100030738 3300005455 Bacteria 3685
45 Ga0070663_100089190 3300005455 Bacteria 2282
46 Ga0070663_100139880 3300005455 Bacteria 1847
47 Ga0070678_100124549 3300005456 Bacteria 2038
48 Ga0070681_10053524 3300005458 Bacteria 4023
49 Ga0070681_10063066 3300005458 Bacteria 3679
50 Ga0070685_10130324 3300005466 Bacteria 1572
51 Ga0070685_10159390 3300005466 Bacteria 1437
52 Ga0070679_100593375 3300005530 Bacteria 1051
53 Ga0070684_100253982 3300005535 Bacteria 1607
54 Ga0070684_100291976 3300005535 Bacteria 1495
55 Ga0070665_100047745 3300005548 Bacteria 4296
56 Ga0070665_100064873 3300005548 Bacteria 3663
57 Ga0070665_100118639 3300005548 Bacteria 2648
58 Ga0070665_100201354 3300005548 Bacteria 1991
59 Ga0068855_100460022 3300005563 Bacteria 1387
60 Ga0070664_100099138 3300005564 Bacteria 2532
61 Ga0068856_100000427 3300005614 Bacteria 46259
62 Ga0068856_100188455 3300005614 Bacteria 2076
63 Ga0068852_100075889 3300005616 Bacteria 2967
64 Ga0068852_100149890 3300005616 Bacteria 2168
65 Ga0068852_100622108 3300005616 Bacteria 1085
66 Ga0068859_100230907 3300005617 Bacteria 1938
67 Ga0068864_100023505 3300005618 Bacteria 5176
68 Ga0068864_100026137 3300005618 Bacteria 4921
69 Ga0068861_100203966 3300005719 Bacteria 1661
70 Ga0068851_10143777 3300005834 Bacteria 1299
71 Ga0068858_100039814 3300005842 Bacteria 4357
72 Ga0068860_100000268 3300005843 Bacteria 76328
73 Ga0068860_100285606 3300005843 Bacteria 1613
74 Ga0068862_100218316 3300005844 Bacteria 1725
75 Ga0081455_10002500 3300005937 Bacteria 21817
76 Ga0081455_10004176 3300005937 Bacteria 16283
77 Ga0081455_10010174 3300005937 Bacteria 9576
78 Ga0081455_10030188 3300005937 Bacteria 4928
79 Ga0081455_10049702 3300005937 Bacteria 3613
80 Ga0081455_10132202 3300005937 Bacteria 1950
81 Ga0081540_1000916 3300005983 Bacteria 26580
82 Ga0081540_1007867 3300005983 Bacteria 7535
83 Ga0081540_1009948 3300005983 Bacteria 6485
84 Ga0081540_1010080 3300005983 Bacteria 6432
85 Ga0081540_1017180 3300005983 Bacteria 4488
86 Ga0081540_1023779 3300005983 Bacteria 3572
87 Ga0081540_1029726 3300005983 Bacteria 3039
88 Ga0081540_1109643 3300005983 Bacteria 1170
89 Ga0081540_1112116 3300005983 Bacteria 1150
90 Ga0081539_10000231 3300005985 Bacteria 131197
91 Ga0081539_10020813 3300005985 Bacteria 4411
92 Ga0070717_10023702 3300006028 Bacteria 4867
93 Ga0075365_10076680 3300006038 Bacteria 2257
94 Ga0075368_10009922 3300006042 Bacteria 3434
95 Ga0075368_10091450 3300006042 Bacteria 1244
96 Ga0075363_100004318 3300006048 Bacteria 6190
97 Ga0075363_100038559 3300006048 Bacteria 2513
98 Ga0075364_10140022 3300006051 Bacteria 1627
99 Ga0070716_100004262 3300006173 Bacteria 6813
100 Ga0070712_100009193 3300006175 Bacteria 6225
101 Ga0075362_10031729 3300006177 Bacteria 2288
102 Ga0075367_10004932 3300006178 Bacteria 6577
103 Ga0075367_10187734 3300006178 Bacteria 1289
104 Ga0075369_10044359 3300006186 Bacteria 1910
105 Ga0075369_10064175 3300006186 Bacteria 1608
106 Ga0075366_10086566 3300006195 Bacteria 1874
107 Ga0075366_10112501 3300006195 Bacteria 1638
108 Ga0097621_100188209 3300006237 Bacteria 1786
109 Ga0075370_10080790 3300006353 Bacteria 1868
110 Ga0075428_100402068 3300006844 Bacteria 1468
111 Ga0075434_100195622 3300006871 Bacteria 2042
112 Ga0068865_100123152 3300006881 Bacteria 1931
113 Ga0097620_100230903 3300006931 Bacteria 1938
114 Ga0099824_1008302 3300006942 Bacteria 13339
115 Ga0099824_1009382 3300006942 Bacteria 12065
116 Ga0099822_1035633 3300006943 Bacteria 3202
117 Ga0099794_10075211 3300007265 Bacteria 1659
118 Ga0099795_10016442 3300007788 Bacteria 2340
119 Ga0105240_10007081 3300009093 Bacteria 16349
120 Ga0105240_10010935 3300009093 Bacteria 12718
121 Ga0111539_10107307 3300009094 Bacteria 3276
122 Ga0105245_10047922 3300009098 Bacteria 3821
123 Ga0105243_10021839 3300009148 Bacteria 4860
124 Ga0105243_10384529 3300009148 Bacteria 1299
125 Ga0105241_10004891 3300009174 Bacteria 9881
126 Ga0105241_10397183 3300009174 Bacteria 1208
127 Ga0105241_10457248 3300009174 Bacteria 1130
128 Ga0105242_10419968 3300009176 Bacteria 1253
129 Ga0105248_10126043 3300009177 Bacteria 2889
130 Ga0105237_10034229 3300009545 Bacteria 5145
131 Ga0105237_10063887 3300009545 Bacteria 3678
132 Ga0105237_10140474 3300009545 Bacteria 2409
133 Ga0105237_10739538 3300009545 Bacteria 990
134 Ga0105249_10484326 3300009553 Bacteria 1280
135 Ga0099796_10007661 3300010159 Bacteria 2834
136 Ga0105239_10269586 3300010375 Bacteria 1914
137 Ga0105246_10010947 3300011119 Bacteria 5624
138 Ga0105246_10033871 3300011119 Bacteria 3398
139 Ga0157371_10202148 3300013102 Bacteria 1424
140 Ga0157370_10197526 3300013104 Bacteria 1867
141 Ga0157369_10020068 3300013105 Bacteria 7474
142 Ga0157374_10285172 3300013296 Bacteria 1631
143 Ga0157378_10017474 3300013297 Bacteria 6296
144 Ga0163162_10069202 3300013306 Bacteria 3581
145 Ga0163162_10174038 3300013306 Bacteria 2277
146 Ga0163162_10656546 3300013306 Bacteria 1172
147 Ga0157372_10042485 3300013307 Bacteria 5029
148 Ga0157372_10141856 3300013307 Bacteria 2769
149 Ga0157375_10260516 3300013308 Bacteria 1896
150 Ga0157375_10418932 3300013308 Bacteria 1505
151 Ga0163163_10013349 3300014325 Bacteria 7518
152 Ga0163163_10075810 3300014325 Bacteria 3357
153 Ga0163163_10540187 3300014325 Bacteria 1228
154 Ga0163163_10745325 3300014325 Bacteria 1043
155 Ga0157380_10086780 3300014326 Bacteria 2572
156 Ga0157376_10033170 3300014969 Bacteria 4154
157 Ga0163161_10041961 3300017792 Bacteria 3289
158 Ga0163161_10229863 3300017792 Bacteria 1439
159 Ga0214544_1000009 3300021320 Bacteria 285865
160 Ga0214542_1000002 3300021321 Bacteria 720798
161 Ga0214542_1039211 3300021321 Bacteria 1264
162 Ga0214545_1000002 3300021324 Bacteria 727485
163 Ga0214545_1040396 3300021324 Bacteria 1264
164 Ga0214543_1000013 3300021327 Bacteria 329117
165 Ga0213876_10002492 3300021384 Bacteria 10803
166 Ga0209563_107305 3300025230 Bacteria 1826
167 Ga0209677_100646 3300025253 Bacteria 18446
168 Ga0209148_1001101 3300025254 Bacteria 16257
169 Ga0209148_1009464 3300025254 Bacteria 1896
170 Ga0209233_1001149 3300025261 Bacteria 10786
171 Ga0209233_1015182 3300025261 Bacteria 2153
172 Ga0209233_1015183 3300025261 Bacteria 2153
173 Ga0209233_1024850 3300025261 Bacteria 1491
174 Ga0209455_1005753 3300025272 Bacteria 3773
175 Ga0209455_1010970 3300025272 Bacteria 2262
176 Ga0209455_1016968 3300025272 Bacteria 1545
177 Ga0209564_1000405 3300025295 Bacteria 76803
178 Ga0209564_1006526 3300025295 Bacteria 6272
179 Ga0209564_1014408 3300025295 Bacteria 3292
180 Ga0209758_1000100 3300025297 Bacteria 227948
181 Ga0209758_1001030 3300025297 Bacteria 36571
182 Ga0209758_1003897 3300025297 Bacteria 13044
183 Ga0209758_1004329 3300025297 Bacteria 11922
184 Ga0209758_1004805 3300025297 Bacteria 10914
185 Ga0209758_1011500 3300025297 Bacteria 5114
186 Ga0209758_1017288 3300025297 Bacteria 3602
187 Ga0209758_1026291 3300025297 Bacteria 2524
188 Ga0209758_1029357 3300025297 Bacteria 2302
189 Ga0209256_1003774 3300025299 Bacteria 10204
190 Ga0207426_1000382 3300025302 Bacteria 76034
191 Ga0207426_1000596 3300025302 Bacteria 47621
192 Ga0207426_1014329 3300025302 Bacteria 2906
193 Ga0207426_1031161 3300025302 Bacteria 1742
194 Ga0209257_1004538 3300025304 Bacteria 10635
195 Ga0209257_1028192 3300025304 Bacteria 1852
196 Ga0207692_10001144 3300025898 Bacteria 9775
197 Ga0207710_10020116 3300025900 Bacteria 2852
198 Ga0207680_10244039 3300025903 Bacteria 1239
199 Ga0207647_10051103 3300025904 Bacteria 2556
200 Ga0207699_10032420 3300025906 Bacteria 2944
201 Ga0207699_10079455 3300025906 Bacteria 2029
202 Ga0207645_10044223 3300025907 Bacteria 2850
203 Ga0207645_10076652 3300025907 Bacteria 2142
204 Ga0207643_10027921 3300025908 Bacteria 3132
205 Ga0207643_10031952 3300025908 Bacteria 2937
206 Ga0207654_10005089 3300025911 Bacteria 6632
207 Ga0207654_10019143 3300025911 Bacteria 3607
208 Ga0207654_10291296 3300025911 Bacteria 1107
209 Ga0207695_10001107 3300025913 Bacteria 46846
210 Ga0207695_10070579 3300025913 Bacteria 3570
211 Ga0207695_10080329 3300025913 Bacteria 3302
212 Ga0207695_10538410 3300025913 Bacteria 1049
213 Ga0207693_10015526 3300025915 Bacteria 6110
214 Ga0207693_10226537 3300025915 Bacteria 1468
215 Ga0207663_10003002 3300025916 Bacteria 8171
216 Ga0207662_10037429 3300025918 Bacteria 2839
217 Ga0207657_10048459 3300025919 Bacteria 3709
218 Ga0207657_10157098 3300025919 Bacteria 1849
219 Ga0207657_10347836 3300025919 Bacteria 1169
220 Ga0207652_10386779 3300025921 Bacteria 1262
221 Ga0207694_10151031 3300025924 Bacteria 1871
222 Ga0207687_10059086 3300025927 Bacteria 2700
223 Ga0207700_10001654 3300025928 Bacteria 12677
224 Ga0207700_10056950 3300025928 Bacteria 2945
225 Ga0207664_10032535 3300025929 Bacteria 3998
226 Ga0207669_10195472 3300025937 Bacteria 1463
227 Ga0207704_10040676 3300025938 Bacteria 2719
228 Ga0207665_10008309 3300025939 Bacteria 6853
229 Ga0207691_10236720 3300025940 Bacteria 1579
230 Ga0207691_10267718 3300025940 Bacteria 1472
231 Ga0207711_10059809 3300025941 Bacteria 3281
232 Ga0207711_10255289 3300025941 Bacteria 1611
233 Ga0207689_10006687 3300025942 Bacteria 10172
234 Ga0207661_10044063 3300025944 Bacteria 3524
235 Ga0207679_10072682 3300025945 Bacteria 2599
236 Ga0207667_10677685 3300025949 Bacteria 1035
237 Ga0207640_10159549 3300025981 Bacteria 1667
238 Ga0207639_10008087 3300026041 Bacteria 7191
239 Ga0207639_10091645 3300026041 Bacteria 2434
240 Ga0207678_10031061 3300026067 Bacteria 4661
241 Ga0207678_10053235 3300026067 Bacteria 3489
242 Ga0207678_10124810 3300026067 Bacteria 2196
243 Ga0207708_10014782 3300026075 Bacteria 5843
244 Ga0207702_10002256 3300026078 Bacteria 18481
245 Ga0207648_10133732 3300026089 Bacteria 2183
246 Ga0207648_10218622 3300026089 Bacteria 1693
247 Ga0207676_10177602 3300026095 Bacteria 1861
248 Ga0207676_10375018 3300026095 Bacteria 1323
249 Ga0207683_10036452 3300026121 Bacteria 4283
250 Ga0207683_10045826 3300026121 Bacteria 3824
251 Ga0207683_10114183 3300026121 Bacteria 2420
252 Ga0207698_10311976 3300026142 Bacteria 1469
253 Ga0209389_1000068 3300027296 Bacteria 98954
254 Ga0209389_1000092 3300027296 Bacteria 82555
255 Ga0209589_1000023 3300027357 Bacteria 177856
256 Ga0209589_1000115 3300027357 Bacteria 82537
257 Ga0209489_100032 3300027361 Bacteria 177856
258 Ga0209489_100340 3300027361 Bacteria 82555
259 Ga0209489_114379 3300027361 Bacteria 5619
260 Ga0209700_100040 3300027363 Bacteria 177856
261 Ga0209700_100117 3300027363 Bacteria 115595
262 Ga0209588_1009662 3300027671 Bacteria 2886
263 Ga0209813_10029960 3300027866 Bacteria 1596
264 Ga0268266_10002460 3300028379 Bacteria 19801
265 Ga0268266_10004661 3300028379 Bacteria 13065
266 Ga0268266_10015920 3300028379 Bacteria 6435
267 Ga0268266_10162189 3300028379 Bacteria 2023
268 Ga0268264_10000084 3300028381 Bacteria 242128
269 Ga0265326_10004149 3300028558 Bacteria 4673
270 Ga0265334_10011479 3300028573 Bacteria 3729
271 Ga0265318_10014241 3300028577 Bacteria 3343
272 Ga0265323_10000386 3300028653 Bacteria 25395
273 Ga0265322_10022462 3300028654 Bacteria 1805
274 Ga0265336_10000204 3300028666 Bacteria 41396
275 Ga0307517_10000369 3300028786 Bacteria 77795
276 Ga0307517_10191934 3300028786 Bacteria 1295
277 Ga0307515_10154665 3300028794 Bacteria 2375
278 Ga0307515_10218882 3300028794 Bacteria 1728
279 Ga0265338_10000306 3300028800 Bacteria 88631
280 Ga0307511_10140180 3300030521 Bacteria 1424
281 Ga0307509_10009184 3300031507 Bacteria 12413
282 Ga0307508_10000010 3300031616 Bacteria 255747
283 Ga0307508_10011929 3300031616 Bacteria 7947
284 Ga0307508_10036379 3300031616 Bacteria 4433
285 Ga0307508_10079274 3300031616 Bacteria 2864
286 Ga0307508_10155564 3300031616 Bacteria 1890
287 Ga0307516_10016189 3300031730 Bacteria 7811
288 Ga0307413_10171523 3300031824 Bacteria 1536
289 Ga0307410_10472508 3300031852 Bacteria 1027
290 Ga0307412_10270297 3300031911 Bacteria 1330
291 Ga0307409_100061736 3300031995 Bacteria 2930
292 Ga0307507_10168095 3300033179 Bacteria 1601
293 Ga0307510_10000998 3300033180 Bacteria 30010
294 Ga0307510_10002011 3300033180 Bacteria 22938
295 Ga0307510_10096190 3300033180 Bacteria 2778
296 Ga0307510_10118778 3300033180 Bacteria 2356
297 Ga0315911_1000029 3300033442 Bacteria 82350
298 Ga0373959_0036988 3300034820 Bacteria 1010
299 Ga0373926_0012429 3300035083 Bacteria 2878
300 Ga0373926_0038286 3300035083 Bacteria 1707
301 Ga0373934_0186966 3300035086 Bacteria 852
302 Ga0373923_0001447 3300035111 Bacteria 6811
303 Ga0373953_0005705 3300035117 Bacteria 4059
304 Ga0373954_0005845 3300035118 Bacteria 5343
305 Ga0373946_0029388 3300035171 Bacteria 2187
306 Ga0373946_0049163 3300035171 Bacteria 1758
307 Ga0373935_0019581 3300035692 Bacteria 4126
308 Ga0373935_0037117 3300035692 Bacteria 3048
309 Ga0373927_0000689 3300035695 Bacteria 25810
310 Ga0373927_0045253 3300035695 Bacteria 2847
311 Ga0373927_0070930 3300035695 Bacteria 2255
312 Ga0373933_0122440 3300035724 Bacteria 1630
313 Ga0373947_0040504 3300035725 Bacteria 2775
314 Ga0373947_0317258 3300035725 Bacteria 1042
315 Ga0373937_0362120 3300036401 Bacteria 1374
316 Ga0373925_0182695 3300037068 Bacteria 1661
317 Ga0373925_0291430 3300037068 Bacteria 1316
318 Ga0395900_0001064 3300037418 Bacteria 35026
319 Ga0395900_0050338 3300037418 Bacteria 4291
320 Ga0395900_0069888 3300037418 Bacteria 3610
321 Ga0395900_0328909 3300037418 Bacteria 1507
322 Ga0395898_0080754 3300037466 Bacteria 3136
323 Ga0395898_0154037 3300037466 Bacteria 2199
324 Ga0395898_0161940 3300037466 Bacteria 2140
325 Ga0395905_0018826 3300037471 Bacteria 6549
326 Ga0395905_0051575 3300037471 Bacteria 3854
327 Ga0395905_0507934 3300037471 Bacteria 1106
328 Ga0436364_0272748 3300037853 Bacteria 1412
329 Ga0436364_0743566 3300037853 Bacteria 3406
330 Ga0395901_0055046 3300038443 Bacteria 4136
331 Ga0395901_0058835 3300038443 Bacteria 3998
332 Ga0395901_0087422 3300038443 Bacteria 3259
333 Ga0395901_0203473 3300038443 Bacteria 2075
334 Ga0436365_0727123 3300039437 Bacteria 7717
335 Ga0436365_1495234 3300039437 Bacteria 1610
336 Ga0436365_1925951 3300039437 Bacteria 2674
337 Ga0436362_0977195 3300039453 Bacteria 1612
338 Ga0466972_0000076 3300044658 Bacteria 92672
339 Ga0466965_0144766 3300044683 Bacteria 1239
340 Ga0466966_0001718 3300044684 Bacteria 14162
341 Ga0466961_0000506 3300044693 Bacteria 24840
342 Ga0466961_0209685 3300044693 Bacteria 1203
343 Ga0466957_0155006 3300044842 Bacteria 1484
344 Ga0466960_0084695 3300044901 Bacteria 1604
345 Ga0466959_0003908 3300045049 Bacteria 9894
346 Ga0466967_0026100 3300045976 Bacteria 4832
347 Ga0466967_0111018 3300045976 Bacteria 2519
348 Ga0466967_0340683 3300045976 Bacteria 1450
349 Ga0466967_0736627 3300045976 Bacteria 977
350 Ga0495592_0055217 3300046454 Bacteria 2939
351 Ga0495592_0087869 3300046454 Bacteria 2235
352 Ga0495603_0000177 3300046455 Bacteria 32632
353 Ga0495603_0009078 3300046455 Bacteria 6010
354 Ga0495603_0034092 3300046455 Bacteria 3063
355 Ga0495603_0045159 3300046455 Bacteria 2628
356 Ga0495629_0002209 3300046459 Bacteria 15014
357 Ga0495638_0014228 3300046460 Bacteria 5385
358 Ga0495638_0029482 3300046460 Bacteria 3538
359 Ga0495638_0262001 3300046460 Bacteria 948
360 Ga0495641_0002006 3300046461 Bacteria 16550
361 Ga0495651_0002653 3300046462 Bacteria 13869
362 Ga0495653_0125391 3300046463 Bacteria 1824
363 Ga0495580_0000787 3300046472 Bacteria 27379
364 Ga0495582_0000270 3300046473 Bacteria 29034
365 Ga0495605_0137850 3300046474 Bacteria 1096
366 Ga0495639_0000934 3300046475 Bacteria 13202
367 Ga0495639_0046735 3300046475 Bacteria 1960
368 Ga0495639_0082452 3300046475 Bacteria 1499
369 Ga0495639_0088919 3300046475 Bacteria 1447
370 Ga0495662_0000993 3300046476 Bacteria 13882
371 Ga0495662_0172048 3300046476 Bacteria 1067
372 Ga0495664_0010266 3300046477 Bacteria 5254
373 Ga0495664_0014441 3300046477 Bacteria 4477
374 Ga0495664_0020156 3300046477 Bacteria 3843
375 Ga0495584_0155781 3300046491 Bacteria 1161
376 Ga0495585_0030399 3300046492 Bacteria 3072
377 Ga0495585_0031512 3300046492 Bacteria 3009
378 Ga0495585_0055170 3300046492 Bacteria 2196
379 Ga0495594_0000850 3300046499 Bacteria 15730
380 Ga0495583_0050853 3300046506 Bacteria 1892
381 Ga0495583_0106175 3300046506 Bacteria 1194
382 Ga0495606_0077656 3300046507 Bacteria 2073
383 Ga0495606_0158486 3300046507 Bacteria 1322
384 Ga0495608_0006579 3300046511 Bacteria 8246
385 Ga0495616_0023351 3300046513 Bacteria 3327
386 Ga0495618_0013130 3300046514 Bacteria 5038
387 Ga0495618_0101711 3300046514 Bacteria 1840
388 Ga0495628_0010035 3300046516 Bacteria 8058
389 Ga0495628_0128905 3300046516 Bacteria 1936
390 Ga0495630_0039607 3300046517 Bacteria 3523
391 Ga0495631_0138436 3300046518 Bacteria 1045
392 Ga0495643_0016764 3300046522 Bacteria 4300
393 Ga0495663_0030854 3300046525 Bacteria 1590
394 Ga0495652_0019244 3300046529 Bacteria 6081
395 Ga0495652_0046801 3300046529 Bacteria 3712
396 Ga0495652_0225265 3300046529 Bacteria 1406
397 Ga0495654_0045108 3300046530 Bacteria 2176
398 Ga0495665_0003851 3300046531 Bacteria 8124
399 Ga0495665_0065492 3300046531 Bacteria 1918
400 Ga0495640_0054645 3300046533 Bacteria 2734
401 Ga0495640_0070633 3300046533 Bacteria 2345
402 Ga0495587_0033782 3300046536 Bacteria 3086
403 Ga0495598_0002292 3300046537 Bacteria 3940
404 Ga0495609_0095888 3300046538 Bacteria 1287
405 Ga0495621_0022733 3300046539 Bacteria 2082
406 Ga0495645_0041833 3300046543 Bacteria 3341
407 Ga0495645_0048587 3300046543 Bacteria 3089
408 Ga0495622_0003129 3300046557 Bacteria 7837
409 Ga0495622_0030220 3300046557 Bacteria 2532
410 Ga0495622_0062758 3300046557 Bacteria 1720
411 Ga0495633_0058152 3300046558 Bacteria 1815
412 Ga0495667_0023767 3300046559 Bacteria 4128
413 Ga0495667_0191495 3300046559 Bacteria 1310
414 Ga0495668_0029903 3300046616 Bacteria 3078
415 Ga0495634_0008690 3300046642 Bacteria 7535
416 Ga0495634_0101163 3300046642 Bacteria 1862
417 Ga0495625_0311696 3300046660 Bacteria 1004
418 Ga0495635_0000463 3300046663 Bacteria 25676
419 Ga0495635_0055242 3300046663 Bacteria 2735
420 Ga0495659_0025665 3300046664 Bacteria 2018
421 Ga0495588_0007900 3300046674 Bacteria 4860
422 Ga0495588_0120913 3300046674 Bacteria 1380
423 Ga0495657_0006529 3300046675 Bacteria 9120
424 Ga0495623_0006459 3300046679 Bacteria 7631
425 Ga0495646_0123473 3300046680 Bacteria 1463
426 Ga0495647_0001462 3300046681 Bacteria 7325
427 Ga0495658_0000636 3300046683 Bacteria 19065
428 Ga0495669_0070545 3300046684 Bacteria 1591
429 Ga0495613_0096208 3300046689 Bacteria 2141
430 Ga0495624_0000635 3300046690 Bacteria 27507
431 Ga0495671_0100980 3300046692 Bacteria 1410
432 Ga0495589_0159337 3300046794 Bacteria 1075
433 Ga0495600_0038968 3300046809 Bacteria 3094
434 Ga0495600_0055325 3300046809 Bacteria 2591
435 Ga0495600_0068961 3300046809 Bacteria 2311
436 Ga0495581_0000666 3300047315 Bacteria 18025
437 Ga0495581_0020283 3300047315 Bacteria 3859
438 Ga0495581_0082171 3300047315 Bacteria 1866
439 Ga0495604_0002893 3300047317 Bacteria 13754
440 Ga0495636_0024541 3300047318 Bacteria 2446
441 Ga0495636_0049865 3300047318 Bacteria 1751
442 Ga0495674_0001332 3300047319 Bacteria 24063
443 Ga0495674_0017963 3300047319 Bacteria 6584
444 Ga0495672_0103170 3300047320 Bacteria 1543
445 Ga0495676_0040448 3300047321 Bacteria 3848
446 Ga0495676_0214214 3300047321 Bacteria 1331
447 Ga0495680_0000866 3300047322 Bacteria 33604
448 Ga0495687_008422 3300047443 Bacteria 5906
449 Ga0495687_087782 3300047443 Bacteria 1199
450 Ga0495675_0006944 3300047444 Bacteria 6955
451 Ga0495677_0030579 3300047445 Bacteria 1960
452 Ga0495602_0023599 3300048088 Bacteria 5989
453 Ga0495614_0017326 3300048089 Bacteria 3130
454 Ga0495615_0025701 3300048090 Bacteria 1369
455 Ga0496101_0005864 3300048904 Bacteria 7864
456 Ga0496101_0042282 3300048904 Bacteria 3253
457 Ga0496102_0003726 3300048905 Bacteria 12881
458 Ga0496102_0075575 3300048905 Bacteria 3097
459 Ga0496102_0082730 3300048905 Bacteria 2961
460 Ga0496102_0181473 3300048905 Bacteria 1983
461 Ga0496103_0007222 3300048906 Bacteria 6625
462 Ga0496103_0096745 3300048906 Bacteria 1866
463 Ga0496104_0025310 3300048907 Bacteria 5470
464 Ga0496105_0017438 3300048908 Bacteria 5757
465 Ga0496106_0001713 3300048909 Bacteria 16366
466 Ga0496106_0050864 3300048909 Bacteria 3124
467 Ga0496106_0267808 3300048909 Bacteria 1368
468 Ga0496107_0052064 3300048910 Bacteria 2953
469 Ga0496108_0005871 3300048911 Bacteria 9953
470 Ga0496108_0082776 3300048911 Bacteria 2722
471 Ga0496108_0173514 3300048911 Bacteria 1866
472 Ga0496109_0438483 3300048912 Bacteria 1234
473 Ga0496110_0069571 3300048913 Bacteria 3117
474 Ga0496110_0155376 3300048913 Bacteria 2072
475 Ga0496112_0019578 3300048915 Bacteria 6391
476 Ga0496114_0024095 3300048917 Bacteria 4967
477 Ga0496115_0013657 3300048918 Bacteria 6147
478 Ga0496115_0256525 3300048918 Bacteria 1438
479 Ga0496115_0284413 3300048918 Bacteria 1357
480 Ga0496116_0000614 3300048919 Bacteria 47004
481 Ga0496117_0053851 3300048920 Bacteria 2823
482 Ga0496117_0094278 3300048920 Bacteria 1916
483 Ga0496117_0101357 3300048920 Bacteria 1821
484 Ga0496118_0019208 3300048921 Bacteria 6117
485 Ga0496118_0136974 3300048921 Bacteria 1560
486 Ga0496118_0161753 3300048921 Bacteria 1383
487 Ga0496119_0025585 3300048922 Bacteria 4117
488 Ga0496119_0087675 3300048922 Bacteria 1776
489 Ga0496119_0130634 3300048922 Bacteria 1369
490 Ga0496120_0018687 3300048923 Bacteria 4458
491 Ga0496120_0059565 3300048923 Bacteria 2140
492 Ga0496121_0000398 3300048924 Bacteria 87272
493 Ga0496121_0000664 3300048924 Bacteria 64277
494 Ga0496121_0001831 3300048924 Bacteria 34280
495 Ga0496121_0004034 3300048924 Bacteria 20175
496 Ga0496121_0030405 3300048924 Bacteria 4960
497 Ga0496121_0030689 3300048924 Bacteria 4931
498 Ga0496121_0044211 3300048924 Bacteria 3846
499 Ga0496121_0117606 3300048924 Bacteria 2014
500 Ga0496121_0152392 3300048924 Bacteria 1699
501 Ga0496121_0187067 3300048924 Bacteria 1488
502 Ga0496122_0025525 3300048925 Bacteria 5128
503 Ga0496122_0082300 3300048925 Bacteria 2237
504 Ga0496123_0026472 3300048926 Bacteria 4342
505 Ga0496124_0001166 3300048927 Bacteria 41149
506 Ga0496124_0044136 3300048927 Bacteria 3827
507 Ga0496124_0079580 3300048927 Bacteria 2698
508 Ga0496124_0127277 3300048927 Bacteria 2028
509 Ga0496124_0259455 3300048927 Bacteria 1280
510 Ga0496125_0000125 3300048928 Bacteria 169979
511 Ga0496125_0005549 3300048928 Bacteria 13958
512 Ga0496125_0009648 3300048928 Bacteria 9869
513 Ga0496125_0018720 3300048928 Bacteria 6566
514 Ga0496125_0024640 3300048928 Bacteria 5527
515 Ga0496125_0041087 3300048928 Bacteria 3958
516 Ga0496125_0058600 3300048928 Bacteria 3110
517 Ga0496125_0107361 3300048928 Bacteria 2034
518 Ga0496125_0196940 3300048928 Bacteria 1324
519 Ga0496125_0209451 3300048928 Bacteria 1267
520 Ga0496126_0007213 3300048929 Bacteria 12228
521 Ga0496126_0010434 3300048929 Bacteria 9735
522 Ga0496126_0026399 3300048929 Bacteria 5569
523 Ga0496126_0053521 3300048929 Bacteria 3661
524 Ga0496126_0135915 3300048929 Bacteria 2121
525 Ga0496126_0225845 3300048929 Bacteria 1570
526 Ga0496126_0243492 3300048929 Bacteria 1501
527 Ga0496126_0360458 3300048929 Bacteria 1187
528 Ga0495682_0115849 3300049460 Bacteria 960
529 Ga0501032_0002066 3300049569 Bacteria 15842
530 Ga0501033_0000241 3300049570 Bacteria 52500
531 Ga0501033_0084800 3300049570 Bacteria 2321
532 Ga0501034_0000021 3300049571 Bacteria 266023
533 Ga0501036_0000055 3300049572 Bacteria 73738
534 Ga0501037_0010878 3300049573 Bacteria 6686
535 Ga0501038_0002132 3300049574 Bacteria 18369
536 Ga0501039_0000293 3300049575 Bacteria 35520
537 Ga0501042_0041869 3300049578 Bacteria 3258
538 Ga0501043_0000033 3300049579 Bacteria 139500
539 Ga0501046_0000452 3300049580 Bacteria 41240
540 Ga0501047_0001106 3300049581 Bacteria 26767
541 Ga0501048_0000261 3300049582 Bacteria 35293
542 Ga0501067_0000045 3300049583 Bacteria 73394
543 Ga0501067_0016119 3300049583 Bacteria 4132
544 Ga0501067_0147642 3300049583 Bacteria 1310
545 Ga0501068_0000661 3300049584 Bacteria 17727
546 Ga0501069_0005255 3300049585 Bacteria 6724
547 Ga0501070_0002298 3300049586 Bacteria 16777
548 Ga0501070_0205637 3300049586 Bacteria 1616
549 Ga0501070_0218030 3300049586 Bacteria 1565
550 Ga0501073_0000064 3300049589 Bacteria 65843
551 Ga0501073_0072474 3300049589 Bacteria 2399
552 Ga0501074_0000044 3300049590 Bacteria 58944
553 Ga0501074_0105420 3300049590 Bacteria 2018
554 Ga0501076_0106065 3300049592 Bacteria 2268
555 Ga0501076_0166294 3300049592 Bacteria 1798
556 Ga0501079_0003287 3300049741 Bacteria 11844
557 Ga0501080_0000072 3300049742 Bacteria 67367
558 Ga0501080_0073518 3300049742 Bacteria 3180
559 Ga0501081_0258301 3300049743 Bacteria 1273
560 Ga0501083_0000182 3300049744 Bacteria 40680
561 Ga0501035_0000241 3300049822 Bacteria 65546
562 Ga0501044_0000640 3300049823 Bacteria 42246
563 Ga0501044_0019619 3300049823 Bacteria 7228
564 Ga0501045_0020657 3300049824 Bacteria 4705
565 nmdc:mga03n38_4403_c1 3300050490 Bacteria 4662
566 nmdc:mga0yw44_18638_c1 3300050492 Bacteria 3807
567 nmdc:mga0yw44_214545_c1 3300050492 Bacteria 1274
568 nmdc:mga0yw44_2168_c1 3300050492 Bacteria 8242
569 nmdc:mga04h51_35861_c1 3300050495 Bacteria 1592
570 nmdc:mga07m45_108977_c1 3300050496 Bacteria 1594
571 nmdc:mga07m45_146664_c1 3300050496 Bacteria 1368
572 nmdc:mga07m45_18542_c1 3300050496 Bacteria 3759
573 nmdc:mga07m45_54096_c1 3300050496 Bacteria 2269
574 nmdc:mga08y16_284683_c1 3300050511 Bacteria 1704
575 nmdc:mga08y16_69054_c1 3300050511 Bacteria 3684
576 nmdc:mga08x19_214517_c1 3300050514 Bacteria 1321
577 Ga0495601_0156468 3300053077 Bacteria 1488
578 Ga0495612_0074401 3300053078 Bacteria 1420
579 Ga0500635_0007984 3300053080 Bacteria 2886
580 Ga0500635_0008305 3300053080 Bacteria 2840
581 Ga0500635_0033076 3300053080 Bacteria 1685
582 Ga0495619_0114767 3300053085 Bacteria 1843
583 Ga0500643_000025 3300053087 Bacteria 259605
584 Ga0500646_0020288 3300053090 Bacteria 1765
585 Ga0500647_0088650 3300053091 Bacteria 1482
586 Ga0500647_0211558 3300053091 Bacteria 874
587 Ga0500583_0100050 3300053092 Bacteria 1419
588 Ga0500651_0139572 3300053093 Bacteria 1462
589 Ga0500566_0000085 3300053094 Bacteria 46377
590 Ga0500566_0000253 3300053094 Bacteria 28776
591 Ga0500566_0000357 3300053094 Bacteria 24893
592 Ga0500566_0008165 3300053094 Bacteria 6193
593 Ga0500566_0187701 3300053094 Bacteria 1055
594 Ga0500640_000189 3300053095 Bacteria 12994
595 Ga0500641_0030588 3300053096 Bacteria 2117
596 Ga0500641_0091407 3300053096 Bacteria 1299
597 Ga0500650_0003633 3300053098 Bacteria 5420
598 Ga0500554_009991 3300053102 Bacteria 2293
599 Ga0500555_001092 3300053103 Bacteria 9037
600 Ga0500556_0000030 3300053104 Bacteria 165098
601 Ga0500556_0038278 3300053104 Bacteria 1673
602 Ga0500557_000001 3300053105 Bacteria 241298
603 Ga0500569_034818 3300053109 Bacteria 1440
604 Ga0500572_001523 3300053111 Bacteria 6213
605 Ga0500592_000845 3300053116 Bacteria 4986
606 Ga0500594_0032547 3300053118 Bacteria 1382
607 Ga0500594_0038047 3300053118 Bacteria 1302
608 Ga0500594_0047142 3300053118 Bacteria 1201
609 Ga0500595_000159 3300053119 Bacteria 44312
610 Ga0500595_001073 3300053119 Bacteria 15180
611 Ga0500595_001169 3300053119 Bacteria 14529
612 Ga0500595_011398 3300053119 Bacteria 3484
613 Ga0500595_027671 3300053119 Bacteria 1939
614 Ga0500607_034332 3300053121 Bacteria 2778
615 Ga0500608_009221 3300053122 Bacteria 4182
616 Ga0500608_038904 3300053122 Bacteria 2276
617 Ga0500614_000847 3300053123 Bacteria 7731
618 Ga0500618_007205 3300053125 Bacteria 3196
619 Ga0500628_013751 3300053129 Bacteria 1517
620 Ga0500642_0000028 3300053130 Bacteria 117281
621 Ga0500642_0000391 3300053130 Bacteria 14423
622 Ga0500642_0031446 3300053130 Bacteria 2218
623 Ga0500652_000170 3300053131 Bacteria 25102
624 Ga0500658_0079238 3300053134 Bacteria 1401
625 Ga0500559_0000204 3300053136 Bacteria 47160
626 Ga0500559_0000947 3300053136 Bacteria 18267
627 Ga0500564_088262 3300053138 Bacteria 1383
628 Ga0500568_0000772 3300053139 Bacteria 22609
629 Ga0500573_0048186 3300053140 Bacteria 2452
630 Ga0500577_0072914 3300053142 Bacteria 1350
631 Ga0500586_005334 3300053145 Bacteria 3243
632 Ga0500588_0011377 3300053146 Bacteria 2177
633 Ga0500590_029490 3300053148 Bacteria 2847
634 Ga0500590_118793 3300053148 Bacteria 1242
635 Ga0500603_000052 3300053150 Bacteria 28617
636 Ga0500616_0000413 3300053153 Bacteria 57779
637 Ga0500622_0000968 3300053156 Bacteria 24366
638 Ga0500627_0033568 3300053158 Bacteria 2169
639 Ga0500630_013631 3300053159 Bacteria 4003
640 Ga0500633_0058264 3300053160 Bacteria 1352
641 Ga0500638_019802 3300053162 Bacteria 3161
642 Ga0500638_047796 3300053162 Bacteria 2071
643 Ga0500639_000004 3300053163 Bacteria 216921
644 Ga0500636_0000518 3300053177 Bacteria 20952
645 Ga0500636_0000598 3300053177 Bacteria 19638
646 Ga0500636_0027080 3300053177 Bacteria 3385
647 Ga0500636_0118996 3300053177 Bacteria 1483
648 Ga0500636_0119451 3300053177 Bacteria 1480
649 Ga0500637_0000349 3300053178 Bacteria 17523
650 Ga0500637_0029118 3300053178 Bacteria 3061
651 Ga0500637_0133002 3300053178 Bacteria 1441
652 Ga0500611_019071 3300053727 Bacteria 1275
653 Ga0500611_020984 3300053727 Bacteria 1241
654 Ga0500657_100850 3300053728 Bacteria 1192
655 Ga0500645_043502 3300053730 Bacteria 1323
656 Ga0500596_000187 3300053735 Bacteria 10076
657 Ga0500596_001142 3300053735 Bacteria 5343
658 Ga0500599_002700 3300053736 Bacteria 2140
659 Ga0500601_000594 3300053737 Bacteria 5166
660 Ga0500601_001185 3300053737 Bacteria 2910
661 Ga0500661_000182 3300055283 Bacteria 10958
662 Ga0500661_008383 3300055283 Bacteria 1901
663 Ga0501082_0007533 3300060353 Bacteria 9392

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035086 Ga0373934_0186966 Ga0373934_0186966_18_725 225
2 3300046475 Ga0495639_0046735 Ga0495639_0046735_27_875 229
3 3300025254 Ga0209148_1009464 Ga0209148_10094642 239
4 3300025272 Ga0209455_1005753 Ga0209455_10057533 239
5 3300031616 Ga0307508_10011929 Ga0307508_100119293 239
6 3300053091 Ga0500647_0211558 Ga0500647_0211558_13_861 241
7 3300005548 Ga0070665_100047745 Ga0070665_1000477452 242
8 3300046529 Ga0495652_0225265 Ga0495652_0225265_543_1391 242
9 3300046476 Ga0495662_0172048 Ga0495662_0172048_263_1045 243
10 iso_pu_bacteria 8016583857 8016592977 244
11 3300047443 Ga0495687_087782 Ga0495687_087782_399_1187 245
12 3300048921 Ga0496118_0136974 Ga0496118_0136974_761_1549 245
13 3300025981 Ga0207640_10159549 Ga0207640_101595493 248
14 iso_pu_bacteria 8019586578 8019589143 248
15 3300009174 Ga0105241_10397183 Ga0105241_103971831 249
16 3300005614 Ga0068856_100000427 Ga0068856_10000042742 251
17 3300026067 Ga0207678_10053235 Ga0207678_100532352 251
18 3300026078 Ga0207702_10002256 Ga0207702_1000225616 251
19 3300053080 Ga0500635_0007984 Ga0500635_0007984_498_1433 251
20 3300047320 Ga0495672_0103170 Ga0495672_0103170_378_1301 252
21 3300035083 Ga0373926_0012429 Ga0373926_0012429_1804_2727 253
22 3300035111 Ga0373923_0001447 Ga0373923_0001447_5613_6536 253
23 3300035117 Ga0373953_0005705 Ga0373953_0005705_983_1906 253
24 3300035118 Ga0373954_0005845 Ga0373954_0005845_3516_4439 253
25 3300035171 Ga0373946_0049163 Ga0373946_0049163_13_936 253
26 3300036401 Ga0373937_0362120 Ga0373937_0362120_202_1125 253
27 3300046514 Ga0495618_0013130 Ga0495618_0013130_3590_4513 253
28 3300046531 Ga0495665_0065492 Ga0495665_0065492_937_1860 253
29 3300046680 Ga0495646_0123473 Ga0495646_0123473_53_976 253
30 3300047315 Ga0495581_0020283 Ga0495581_0020283_1720_2643 253
31 3300005355 Ga0070671_100135451 Ga0070671_1001354511 254
32 3300005937 Ga0081455_10132202 Ga0081455_101322022 254
33 3300044683 Ga0466965_0144766 Ga0466965_0144766_367_1215 255
34 3300046455 Ga0495603_0045159 Ga0495603_0045159_217_1140 255
35 3300028786 Ga0307517_10000369 Ga0307517_1000036917 256
36 3300045976 Ga0466967_0340683 Ga0466967_0340683_421_1344 256
37 3300048929 Ga0496126_0243492 Ga0496126_0243492_346_1278 257
38 3300053094 Ga0500566_0000085 Ga0500566_0000085_2415_3350 257
39 3300053095 Ga0500640_000189 Ga0500640_000189_6209_7144 257
40 3300053111 Ga0500572_001523 Ga0500572_001523_2844_3779 257
41 3300053122 Ga0500608_009221 Ga0500608_009221_3066_4001 257
42 3300053123 Ga0500614_000847 Ga0500614_000847_4572_5507 257
43 3300053136 Ga0500559_0000947 Ga0500559_0000947_4950_5885 257
44 3300053148 Ga0500590_029490 Ga0500590_029490_367_1302 257
45 3300053150 Ga0500603_000052 Ga0500603_000052_10120_11055 257
46 3300053159 Ga0500630_013631 Ga0500630_013631_1299_2234 257
47 3300053162 Ga0500638_019802 Ga0500638_019802_297_1232 257
48 3300053163 Ga0500639_000004 Ga0500639_000004_154243_155178 257
49 3300053735 Ga0500596_000187 Ga0500596_000187_789_1724 257
50 3300053737 Ga0500601_001185 Ga0500601_001185_275_1210 257
51 3300046616 Ga0495668_0029903 Ga0495668_0029903_1531_2454 258
52 3300050492 nmdc:mga0yw44_214545_c1 nmdc:mga0yw44_214545_c1_409_1257 259
53 3300005434 Ga0070709_10050453 Ga0070709_100504532 260
54 3300025906 Ga0207699_10032420 Ga0207699_100324203 260
55 3300046455 Ga0495603_0034092 Ga0495603_0034092_142_1065 260
56 3300053080 Ga0500635_0008305 Ga0500635_0008305_811_1734 260
57 3300053178 Ga0500637_0029118 Ga0500637_0029118_804_1727 260
58 3300009545 Ga0105237_10063887 Ga0105237_100638873 261
59 3300017792 Ga0163161_10229863 Ga0163161_102298632 261
60 3300046460 Ga0495638_0262001 Ga0495638_0262001_13_852 261
61 3300048929 Ga0496126_0007213 Ga0496126_0007213_8638_9561 261
62 3300053129 Ga0500628_013751 Ga0500628_013751_395_1324 261
63 3300010159 Ga0099796_10007661 Ga0099796_100076614 262
64 3300028786 Ga0307517_10191934 Ga0307517_101919342 262
65 3300035695 Ga0373927_0045253 Ga0373927_0045253_1394_2323 262
66 3300035725 Ga0373947_0317258 Ga0373947_0317258_68_997 262
67 3300047315 Ga0495581_0082171 Ga0495581_0082171_238_1167 262
68 3300048924 Ga0496121_0000664 Ga0496121_0000664_26650_27573 262
69 3300053094 Ga0500566_0187701 Ga0500566_0187701_25_954 262
70 3300031616 Ga0307508_10155564 Ga0307508_101555642 263
71 3300046514 Ga0495618_0101711 Ga0495618_0101711_42_965 263
72 3300046663 Ga0495635_0055242 Ga0495635_0055242_1435_2358 263
73 3300046809 Ga0495600_0055325 Ga0495600_0055325_832_1755 263
74 3300047321 Ga0495676_0040448 Ga0495676_0040448_1903_2826 263
75 3300048922 Ga0496119_0025585 Ga0496119_0025585_1435_2358 263
76 3300048923 Ga0496120_0018687 Ga0496120_0018687_1642_2565 263
77 3300048924 Ga0496121_0117606 Ga0496121_0117606_158_1087 263
78 3300048927 Ga0496124_0259455 Ga0496124_0259455_13_870 263
79 3300004625 Ga0055543_1003311 Ga0055543_10033112 264
80 3300005262 Ga0065165_1002764 Ga0065165_100276413 264
81 3300025261 Ga0209233_1015183 Ga0209233_10151834 264
82 3300025900 Ga0207710_10020116 Ga0207710_100201162 264
83 3300045976 Ga0466967_0736627 Ga0466967_0736627_15_938 264
84 3300046660 Ga0495625_0311696 Ga0495625_0311696_134_982 264
85 3300046689 Ga0495613_0096208 Ga0495613_0096208_1264_2112 264
86 3300049460 Ga0495682_0115849 Ga0495682_0115849_16_864 264
87 3300053093 Ga0500651_0139572 Ga0500651_0139572_585_1439 264
88 3300025253 Ga0209677_100646 Ga0209677_10064617 265
89 3300046474 Ga0495605_0137850 Ga0495605_0137850_232_1080 265
90 3300049586 Ga0501070_0205637 Ga0501070_0205637_248_1180 265
91 3300049589 Ga0501073_0072474 Ga0501073_0072474_612_1544 265
92 3300049590 Ga0501074_0105420 Ga0501074_0105420_850_1782 265
93 3300049742 Ga0501080_0073518 Ga0501080_0073518_811_1743 265
94 3300049823 Ga0501044_0019619 Ga0501044_0019619_1286_2218 265
95 3300053158 Ga0500627_0033568 Ga0500627_0033568_1298_2146 265
96 3300005983 Ga0081540_1109643 Ga0081540_11096431 266
97 3300028794 Ga0307515_10154665 Ga0307515_101546653 266
98 3300030521 Ga0307511_10140180 Ga0307511_101401802 266
99 3300031507 Ga0307509_10009184 Ga0307509_100091849 266
100 3300031616 Ga0307508_10079274 Ga0307508_100792743 266
101 3300035692 Ga0373935_0037117 Ga0373935_0037117_1840_2763 266
102 3300037418 Ga0395900_0328909 Ga0395900_0328909_232_1155 266
103 3300037471 Ga0395905_0018826 Ga0395905_0018826_2128_3051 266
104 3300038443 Ga0395901_0203473 Ga0395901_0203473_1141_2064 266
105 3300046557 Ga0495622_0030220 Ga0495622_0030220_84_1007 266
106 3300053138 Ga0500564_088262 Ga0500564_088262_54_977 266
107 3300053140 Ga0500573_0048186 Ga0500573_0048186_1281_2204 266
108 3300053177 Ga0500636_0118996 Ga0500636_0118996_325_1248 266
109 3300053178 Ga0500637_0133002 Ga0500637_0133002_386_1309 266
110 3300053735 Ga0500596_001142 Ga0500596_001142_1495_2418 266
111 3300003659 JGI25404J52841_10004496 JGI25404J52841_100044963 267
112 3300005983 Ga0081540_1029726 Ga0081540_10297263 267
113 3300025904 Ga0207647_10051103 Ga0207647_100511032 267
114 3300048928 Ga0496125_0058600 Ga0496125_0058600_1947_2870 267
115 3300048929 Ga0496126_0053521 Ga0496126_0053521_2472_3395 267
116 3300033442 Ga0315911_1000029 Ga0315911_100002942 268
117 3300044842 Ga0466957_0155006 Ga0466957_0155006_251_1174 268
118 3300046475 Ga0495639_0088919 Ga0495639_0088919_49_972 268
119 3300048921 Ga0496118_0161753 Ga0496118_0161753_339_1268 268
120 3300048924 Ga0496121_0044211 Ga0496121_0044211_2589_3518 268
121 3300005535 Ga0070684_100291976 Ga0070684_1002919762 269
122 3300006942 Ga0099824_1009382 Ga0099824_10093825 269
123 3300006943 Ga0099822_1035633 Ga0099822_10356332 269
124 3300025919 Ga0207657_10048459 Ga0207657_100484592 269
125 3300025921 Ga0207652_10386779 Ga0207652_103867792 269
126 3300027357 Ga0209589_1000023 Ga0209589_1000023154 269
127 3300027361 Ga0209489_100032 Ga0209489_100032154 269
128 3300027363 Ga0209700_100040 Ga0209700_100040154 269
129 3300037853 Ga0436364_0272748 Ga0436364_0272748_171_1100 269
130 3300039437 Ga0436365_1495234 Ga0436365_1495234_51_980 269
131 3300053728 Ga0500657_100850 Ga0500657_100850_136_1071 269
132 3300005983 Ga0081540_1009948 Ga0081540_10099486 270
133 3300035083 Ga0373926_0038286 Ga0373926_0038286_154_1077 270
134 3300003354 JGI25160J50197_1002987 JGI25160J50197_10029878 271
135 3300005330 Ga0070690_100337894 Ga0070690_1003378941 271
136 3300005436 Ga0070713_100109400 Ga0070713_1001094003 271
137 3300005458 Ga0070681_10063066 Ga0070681_100630663 271
138 3300005616 Ga0068852_100149890 Ga0068852_1001498903 271
139 3300005719 Ga0068861_100203966 Ga0068861_1002039662 271
140 3300009148 Ga0105243_10021839 Ga0105243_100218393 271
141 3300013306 Ga0163162_10174038 Ga0163162_101740382 271
142 3300013308 Ga0157375_10260516 Ga0157375_102605162 271
143 3300014326 Ga0157380_10086780 Ga0157380_100867803 271
144 3300017792 Ga0163161_10041961 Ga0163161_100419613 271
145 3300026075 Ga0207708_10014782 Ga0207708_100147827 271
146 3300026089 Ga0207648_10133732 Ga0207648_101337323 271
147 3300031730 Ga0307516_10016189 Ga0307516_100161896 271
148 3300046794 Ga0495589_0159337 Ga0495589_0159337_26_955 271
149 3300048905 Ga0496102_0082730 Ga0496102_0082730_1753_2682 271
150 3300048909 Ga0496106_0050864 Ga0496106_0050864_170_1096 271
151 3300048918 Ga0496115_0284413 Ga0496115_0284413_159_1088 271
152 3300049583 Ga0501067_0016119 Ga0501067_0016119_1840_2763 271
153 3300009174 Ga0105241_10457248 Ga0105241_104572482 272
154 3300010375 Ga0105239_10269586 Ga0105239_102695861 272
155 3300025911 Ga0207654_10291296 Ga0207654_102912961 272
156 3300046674 Ga0495588_0120913 Ga0495588_0120913_356_1285 272
157 3300033179 Ga0307507_10168095 Ga0307507_101680952 273
158 3300035171 Ga0373946_0029388 Ga0373946_0029388_709_1641 273
159 3300035692 Ga0373935_0019581 Ga0373935_0019581_1211_2143 273
160 3300035695 Ga0373927_0000689 Ga0373927_0000689_21502_22434 273
161 3300035724 Ga0373933_0122440 Ga0373933_0122440_86_1018 273
162 3300035725 Ga0373947_0040504 Ga0373947_0040504_1636_2568 273
163 3300037068 Ga0373925_0182695 Ga0373925_0182695_49_981 273
164 3300037068 Ga0373925_0291430 Ga0373925_0291430_355_1278 273
165 3300037418 Ga0395900_0050338 Ga0395900_0050338_83_1012 273
166 3300037466 Ga0395898_0154037 Ga0395898_0154037_743_1672 273
167 3300037471 Ga0395905_0507934 Ga0395905_0507934_11_940 273
168 3300038443 Ga0395901_0087422 Ga0395901_0087422_94_1023 273
169 3300045976 Ga0466967_0026100 Ga0466967_0026100_2445_3368 273
170 3300046454 Ga0495592_0087869 Ga0495592_0087869_657_1589 273
171 3300046455 Ga0495603_0000177 Ga0495603_0000177_8107_9039 273
172 3300046459 Ga0495629_0002209 Ga0495629_0002209_510_1442 273
173 3300046461 Ga0495641_0002006 Ga0495641_0002006_1067_1999 273
174 3300046472 Ga0495580_0000787 Ga0495580_0000787_7536_8468 273
175 3300046473 Ga0495582_0000270 Ga0495582_0000270_4558_5490 273
176 3300046475 Ga0495639_0000934 Ga0495639_0000934_4114_5046 273
177 3300046476 Ga0495662_0000993 Ga0495662_0000993_8667_9599 273
178 3300046477 Ga0495664_0010266 Ga0495664_0010266_104_1036 273
179 3300046499 Ga0495594_0000850 Ga0495594_0000850_637_1569 273
180 3300046516 Ga0495628_0128905 Ga0495628_0128905_612_1544 273
181 3300046517 Ga0495630_0039607 Ga0495630_0039607_1454_2386 273
182 3300046529 Ga0495652_0046801 Ga0495652_0046801_1555_2487 273
183 3300046531 Ga0495665_0003851 Ga0495665_0003851_4559_5491 273
184 3300046533 Ga0495640_0070633 Ga0495640_0070633_233_1165 273
185 3300046557 Ga0495622_0003129 Ga0495622_0003129_615_1547 273
186 3300046559 Ga0495667_0191495 Ga0495667_0191495_16_948 273
187 3300046642 Ga0495634_0008690 Ga0495634_0008690_6138_7070 273
188 3300046663 Ga0495635_0000463 Ga0495635_0000463_1735_2667 273
189 3300046681 Ga0495647_0001462 Ga0495647_0001462_4685_5617 273
190 3300046683 Ga0495658_0000636 Ga0495658_0000636_7296_8228 273
191 3300046690 Ga0495624_0000635 Ga0495624_0000635_7654_8586 273
192 3300046809 Ga0495600_0068961 Ga0495600_0068961_824_1756 273
193 3300047315 Ga0495581_0000666 Ga0495581_0000666_8859_9791 273
194 3300047319 Ga0495674_0001332 Ga0495674_0001332_2132_3064 273
195 3300048089 Ga0495614_0017326 Ga0495614_0017326_153_1085 273
196 3300048922 Ga0496119_0087675 Ga0496119_0087675_744_1670 273
197 3300048924 Ga0496121_0001831 Ga0496121_0001831_17963_18889 273
198 3300048929 Ga0496126_0026399 Ga0496126_0026399_3422_4348 273
199 3300005983 Ga0081540_1007867 Ga0081540_10078675 274
200 3300031616 Ga0307508_10000010 Ga0307508_10000010220 274
201 3300005614 Ga0068856_100188455 Ga0068856_1001884551 275
202 3300013307 Ga0157372_10141856 Ga0157372_101418562 275
203 3300021321 Ga0214542_1039211 Ga0214542_10392112 275
204 3300021324 Ga0214545_1040396 Ga0214545_10403962 275
205 3300025949 Ga0207667_10677685 Ga0207667_106776851 275
206 3300045976 Ga0466967_0111018 Ga0466967_0111018_304_1227 275
207 3300048924 Ga0496121_0030689 Ga0496121_0030689_2690_3613 275
208 3300048927 Ga0496124_0079580 Ga0496124_0079580_403_1326 275
209 3300048929 Ga0496126_0360458 Ga0496126_0360458_112_1035 275
210 3300005328 Ga0070676_10198311 Ga0070676_101983111 276
211 3300006844 Ga0075428_100402068 Ga0075428_1004020682 276
212 3300006881 Ga0068865_100123152 Ga0068865_1001231522 276
213 3300009094 Ga0111539_10107307 Ga0111539_101073073 276
214 3300009176 Ga0105242_10419968 Ga0105242_104199682 276
215 3300009553 Ga0105249_10484326 Ga0105249_104843262 276
216 3300025907 Ga0207645_10044223 Ga0207645_100442232 276
217 3300025919 Ga0207657_10347836 Ga0207657_103478362 276
218 3300025937 Ga0207669_10195472 Ga0207669_101954721 276
219 3300025938 Ga0207704_10040676 Ga0207704_100406763 276
220 3300050511 nmdc:mga08y16_69054_c1 nmdc:mga08y16_69054_c1_2484_3413 276
221 3300055283 Ga0500661_008383 Ga0500661_008383_449_1381 276
222 3300005530 Ga0070679_100593375 Ga0070679_1005933751 277
223 3300005843 Ga0068860_100000268 Ga0068860_10000026854 277
224 3300006942 Ga0099824_1008302 Ga0099824_100830213 277
225 3300007265 Ga0099794_10075211 Ga0099794_100752112 277
226 3300009093 Ga0105240_10010935 Ga0105240_100109357 277
227 3300025913 Ga0207695_10070579 Ga0207695_100705794 277
228 3300027296 Ga0209389_1000092 Ga0209389_100009270 277
229 3300027357 Ga0209589_1000115 Ga0209589_100011570 277
230 3300027361 Ga0209489_100340 Ga0209489_10034070 277
231 3300027671 Ga0209588_1009662 Ga0209588_10096622 277
232 3300028381 Ga0268264_10000084 Ga0268264_10000084185 277
233 3300037418 Ga0395900_0069888 Ga0395900_0069888_1309_2232 277
234 3300037466 Ga0395898_0161940 Ga0395898_0161940_722_1645 277
235 3300005937 Ga0081455_10010174 Ga0081455_1001017410 278
236 3300005983 Ga0081540_1112116 Ga0081540_11121162 278
237 3300028558 Ga0265326_10004149 Ga0265326_100041493 278
238 3300028573 Ga0265334_10011479 Ga0265334_100114793 278
239 3300028577 Ga0265318_10014241 Ga0265318_100142413 278
240 3300028653 Ga0265323_10000386 Ga0265323_1000038610 278
241 3300028654 Ga0265322_10022462 Ga0265322_100224622 278
242 3300028666 Ga0265336_10000204 Ga0265336_1000020419 278
243 3300028800 Ga0265338_10000306 Ga0265338_1000030619 278
244 3300046491 Ga0495584_0155781 Ga0495584_0155781_57_980 278
245 3300026121 Ga0207683_10114183 Ga0207683_101141831 279
246 3300025908 Ga0207643_10031952 Ga0207643_100319523 280
247 3300025913 Ga0207695_10538410 Ga0207695_105384102 280
248 3300026095 Ga0207676_10375018 Ga0207676_103750181 280
249 3300039437 Ga0436365_1925951 Ga0436365_1925951_78_1007 280
250 3300044658 Ga0466972_0000076 Ga0466972_0000076_48390_49313 280
251 3300044693 Ga0466961_0209685 Ga0466961_0209685_99_1022 280
252 3300053119 Ga0500595_011398 Ga0500595_011398_1786_2712 280
253 3300053119 Ga0500595_027671 Ga0500595_027671_538_1461 280
254 3300006871 Ga0075434_100195622 Ga0075434_1001956222 281
255 3300031824 Ga0307413_10171523 Ga0307413_101715232 281
256 3300031852 Ga0307410_10472508 Ga0307410_104725081 281
257 3300031995 Ga0307409_100061736 Ga0307409_1000617363 281
258 3300037853 Ga0436364_0743566 Ga0436364_0743566_1235_2167 281
259 3300033180 Ga0307510_10118778 Ga0307510_101187782 282
260 3300037418 Ga0395900_0001064 Ga0395900_0001064_31261_32190 282
261 3300037466 Ga0395898_0080754 Ga0395898_0080754_603_1532 282
262 3300038443 Ga0395901_0055046 Ga0395901_0055046_677_1606 282
263 3300005334 Ga0068869_100085191 Ga0068869_1000851913 283
264 3300005337 Ga0070682_100050602 Ga0070682_1000506023 283
265 3300005344 Ga0070661_100229761 Ga0070661_1002297612 283
266 3300005364 Ga0070673_100109504 Ga0070673_1001095042 283
267 3300005456 Ga0070678_100124549 Ga0070678_1001245492 283
268 3300005466 Ga0070685_10130324 Ga0070685_101303241 283
269 3300005564 Ga0070664_100099138 Ga0070664_1000991382 283
270 3300005616 Ga0068852_100075889 Ga0068852_1000758892 283
271 3300005618 Ga0068864_100023505 Ga0068864_1000235052 283
272 3300005834 Ga0068851_10143777 Ga0068851_101437771 283
273 3300005937 Ga0081455_10049702 Ga0081455_100497022 283
274 3300005983 Ga0081540_1023779 Ga0081540_10237795 283
275 3300006237 Ga0097621_100188209 Ga0097621_1001882092 283
276 3300011119 Ga0105246_10010947 Ga0105246_100109475 283
277 3300013306 Ga0163162_10069202 Ga0163162_100692023 283
278 3300013308 Ga0157375_10418932 Ga0157375_104189322 283
279 3300014969 Ga0157376_10033170 Ga0157376_100331703 283
280 3300025230 Ga0209563_107305 Ga0209563_1073052 283
281 3300025297 Ga0209758_1011500 Ga0209758_10115006 283
282 3300025915 Ga0207693_10226537 Ga0207693_102265372 283
283 3300025927 Ga0207687_10059086 Ga0207687_100590863 283
284 3300025944 Ga0207661_10044063 Ga0207661_100440634 283
285 3300025945 Ga0207679_10072682 Ga0207679_100726823 283
286 3300026121 Ga0207683_10036452 Ga0207683_100364523 283
287 3300048904 Ga0496101_0005864 Ga0496101_0005864_5208_6143 283
288 3300048905 Ga0496102_0003726 Ga0496102_0003726_3820_4755 283
289 3300048907 Ga0496104_0025310 Ga0496104_0025310_4175_5110 283
290 3300048908 Ga0496105_0017438 Ga0496105_0017438_3785_4720 283
291 3300048909 Ga0496106_0267808 Ga0496106_0267808_48_983 283
292 3300048910 Ga0496107_0052064 Ga0496107_0052064_1947_2882 283
293 3300048911 Ga0496108_0005871 Ga0496108_0005871_6904_7839 283
294 3300048913 Ga0496110_0069571 Ga0496110_0069571_222_1157 283
295 3300048915 Ga0496112_0019578 Ga0496112_0019578_4044_4979 283
296 3300048917 Ga0496114_0024095 Ga0496114_0024095_3879_4814 283
297 3300053130 Ga0500642_0000391 Ga0500642_0000391_10707_11630 283
298 3300003215 JGI25153J46596_10000691 JGI25153J46596_1000069118 284
299 3300005339 Ga0070660_100191061 Ga0070660_1001910612 284
300 3300005340 Ga0070689_100068438 Ga0070689_1000684384 284
301 3300005455 Ga0070663_100139880 Ga0070663_1001398802 284
302 3300006038 Ga0075365_10076680 Ga0075365_100766802 284
303 3300006186 Ga0075369_10064175 Ga0075369_100641752 284
304 3300009098 Ga0105245_10047922 Ga0105245_100479223 284
305 3300009545 Ga0105237_10739538 Ga0105237_107395381 284
306 3300013105 Ga0157369_10020068 Ga0157369_100200687 284
307 3300025913 Ga0207695_10080329 Ga0207695_100803292 284
308 3300025919 Ga0207657_10157098 Ga0207657_101570982 284
309 3300046477 Ga0495664_0014441 Ga0495664_0014441_3328_4251 284
310 3300046543 Ga0495645_0048587 Ga0495645_0048587_666_1589 284
311 3300049570 Ga0501033_0084800 Ga0501033_0084800_835_1764 284
312 3300053077 Ga0495601_0156468 Ga0495601_0156468_423_1346 284
313 3300053078 Ga0495612_0074401 Ga0495612_0074401_104_1027 284
314 3300053091 Ga0500647_0088650 Ga0500647_0088650_122_1045 284
315 3300053142 Ga0500577_0072914 Ga0500577_0072914_308_1231 284
316 3300053727 Ga0500611_020984 Ga0500611_020984_162_1085 284
317 3300003323 rootH1_10023786 rootH1_100237861 285
318 3300005548 Ga0070665_100064873 Ga0070665_1000648732 285
319 3300005563 Ga0068855_100460022 Ga0068855_1004600221 285
320 3300005617 Ga0068859_100230907 Ga0068859_1002309072 285
321 3300005843 Ga0068860_100285606 Ga0068860_1002856062 285
322 3300006931 Ga0097620_100230903 Ga0097620_1002309033 285
323 3300014325 Ga0163163_10540187 Ga0163163_105401872 285
324 3300025295 Ga0209564_1000405 Ga0209564_100040522 285
325 3300026121 Ga0207683_10045826 Ga0207683_100458265 285
326 3300027296 Ga0209389_1000068 Ga0209389_100006852 285
327 3300027361 Ga0209489_114379 Ga0209489_1143795 285
328 3300028379 Ga0268266_10015920 Ga0268266_100159201 285
329 3300048911 Ga0496108_0082776 Ga0496108_0082776_719_1642 285
330 3300048918 Ga0496115_0013657 Ga0496115_0013657_1951_2874 285
331 3300048929 Ga0496126_0135915 Ga0496126_0135915_532_1458 285
332 3300049583 Ga0501067_0147642 Ga0501067_0147642_101_1024 285
333 3300049743 Ga0501081_0258301 Ga0501081_0258301_305_1228 285
334 3300053105 Ga0500557_000001 Ga0500557_000001_114366_115289 285
335 3300053134 Ga0500658_0079238 Ga0500658_0079238_426_1349 285
336 3300053162 Ga0500638_047796 Ga0500638_047796_149_1072 285
337 3300053177 Ga0500636_0119451 Ga0500636_0119451_283_1206 285
338 iso_pu_bacteria 2513237102 2513704540 285
339 iso_pu_bacteria 2824617872 2824622916 285
340 iso_pu_bacteria 2824626560 2824630722 285
341 iso_pu_bacteria 2824635225 2824642842 285
342 iso_pu_bacteria 2824644064 2824650847 285
343 iso_pu_bacteria 2824714736 2824720631 285
344 iso_pu_bacteria 2824723954 2824730917 285
345 3300003659 JGI25404J52841_10013563 JGI25404J52841_100135631 286
346 3300005367 Ga0070667_100387258 Ga0070667_1003872582 286
347 3300005455 Ga0070663_100089190 Ga0070663_1000891902 286
348 3300005548 Ga0070665_100118639 Ga0070665_1001186392 286
349 3300005983 Ga0081540_1017180 Ga0081540_10171806 286
350 3300026067 Ga0207678_10031061 Ga0207678_100310616 286
351 3300027363 Ga0209700_100117 Ga0209700_10011751 286
352 3300046455 Ga0495603_0009078 Ga0495603_0009078_466_1395 286
353 3300046460 Ga0495638_0029482 Ga0495638_0029482_992_1918 286
354 3300046492 Ga0495585_0055170 Ga0495585_0055170_664_1593 286
355 3300046506 Ga0495583_0050853 Ga0495583_0050853_255_1181 286
356 3300046507 Ga0495606_0077656 Ga0495606_0077656_919_1845 286
357 3300046513 Ga0495616_0023351 Ga0495616_0023351_1250_2176 286
358 3300046525 Ga0495663_0030854 Ga0495663_0030854_604_1533 286
359 3300046538 Ga0495609_0095888 Ga0495609_0095888_313_1242 286
360 3300046664 Ga0495659_0025665 Ga0495659_0025665_865_1794 286
361 3300046674 Ga0495588_0007900 Ga0495588_0007900_2591_3520 286
362 3300046684 Ga0495669_0070545 Ga0495669_0070545_197_1126 286
363 3300047318 Ga0495636_0049865 Ga0495636_0049865_126_1055 286
364 3300048090 Ga0495615_0025701 Ga0495615_0025701_283_1212 286
365 3300048919 Ga0496116_0000614 Ga0496116_0000614_23185_24111 286
366 3300048920 Ga0496117_0053851 Ga0496117_0053851_651_1577 286
367 3300048920 Ga0496117_0094278 Ga0496117_0094278_50_976 286
368 3300048921 Ga0496118_0019208 Ga0496118_0019208_2772_3698 286
369 3300048923 Ga0496120_0059565 Ga0496120_0059565_911_1837 286
370 3300048924 Ga0496121_0004034 Ga0496121_0004034_6424_7350 286
371 3300048927 Ga0496124_0044136 Ga0496124_0044136_193_1122 286
372 3300048928 Ga0496125_0005549 Ga0496125_0005549_4377_5303 286
373 3300048928 Ga0496125_0024640 Ga0496125_0024640_3490_4416 286
374 3300048928 Ga0496125_0107361 Ga0496125_0107361_896_1825 286
375 3300048928 Ga0496125_0196940 Ga0496125_0196940_71_1000 286
376 3300049592 Ga0501076_0166294 Ga0501076_0166294_649_1578 286
377 3300053094 Ga0500566_0000253 Ga0500566_0000253_20852_21778 286
378 3300053098 Ga0500650_0003633 Ga0500650_0003633_985_1911 286
379 3300053104 Ga0500556_0000030 Ga0500556_0000030_123355_124281 286
380 3300053116 Ga0500592_000845 Ga0500592_000845_3145_4071 286
381 3300053118 Ga0500594_0032547 Ga0500594_0032547_53_979 286
382 3300053121 Ga0500607_034332 Ga0500607_034332_481_1407 286
383 3300053122 Ga0500608_038904 Ga0500608_038904_255_1181 286
384 3300053125 Ga0500618_007205 Ga0500618_007205_1592_2518 286
385 3300053130 Ga0500642_0000028 Ga0500642_0000028_45246_46172 286
386 3300053136 Ga0500559_0000204 Ga0500559_0000204_5880_6806 286
387 3300053139 Ga0500568_0000772 Ga0500568_0000772_17258_18184 286
388 3300053145 Ga0500586_005334 Ga0500586_005334_1257_2183 286
389 3300053148 Ga0500590_118793 Ga0500590_118793_110_1036 286
390 3300053153 Ga0500616_0000413 Ga0500616_0000413_19339_20265 286
391 3300053156 Ga0500622_0000968 Ga0500622_0000968_164_1090 286
392 3300053177 Ga0500636_0000598 Ga0500636_0000598_9384_10310 286
393 3300053727 Ga0500611_019071 Ga0500611_019071_158_1084 286
394 iso_pu_bacteria 2507262055 2507509509 286
395 iso_pu_bacteria 2508501042 2508698658 286
396 iso_pu_bacteria 2513237092 2513624660 286
397 iso_pu_bacteria 2513237094 2513638073 286
398 iso_pu_bacteria 2513237095 2513646473 286
399 iso_pu_bacteria 2513237104 2513717600 286
400 iso_pu_bacteria 2513237139 2513879351 286
401 iso_pu_bacteria 2513237161 2514016660 286
402 iso_pu_bacteria 2515154112 2515631216 286
403 iso_pu_bacteria 2517093001 2517106611 286
404 iso_pu_bacteria 2524023210 2524469886 286
405 iso_pu_bacteria 2602042107 2603859757 286
406 iso_pu_bacteria 2617270735 2617354016 286
407 iso_pu_bacteria 2617270741 2617376630 286
408 iso_pu_bacteria 2721755755 2723845917 286
409 iso_pu_bacteria 2744054633 2745074868 286
410 iso_pu_bacteria 2791355196 2793064734 286
411 iso_pu_bacteria 2791355199 2793082687 286
412 iso_pu_bacteria 2802429603 2805920249 286
413 iso_pu_bacteria 2816332527 2818240336 286
414 iso_pu_bacteria 2824600985 2824606608 286
415 iso_pu_bacteria 2824609381 2824613110 286
416 iso_pu_bacteria 2824653114 2824655832 286
417 iso_pu_bacteria 2824671348 2824678598 286
418 iso_pu_bacteria 2824679649 2824686375 286
419 iso_pu_bacteria 2824687955 2824695034 286
420 iso_pu_bacteria 2824696289 2824703387 286
421 iso_pu_bacteria 2824704595 2824714434 286
422 iso_pu_bacteria 2824732956 2824740148 286
423 iso_pu_bacteria 2824746037 2824750732 286
424 iso_pu_bacteria 2824753945 2824756646 286
425 iso_pu_bacteria 2824763712 2824767289 286
426 iso_pu_bacteria 2824773399 2824779070 286
427 iso_pu_bacteria 2838122688 2838128673 286
428 iso_pu_bacteria 2841941048 2841948526 286
429 iso_pu_bacteria 2841949485 2841956360 286
430 iso_pu_bacteria 2841957949 2841962451 286
431 iso_pu_bacteria 2841966195 2841967133 286
432 iso_pu_bacteria 2841974524 2841979466 286
433 iso_pu_bacteria 2841983080 2841989946 286
434 iso_pu_bacteria 2842038055 2842039923 286
435 iso_pu_bacteria 2842045827 2842047132 286
436 iso_pu_bacteria 2847930680 2847935097 286
437 iso_pu_bacteria 2847939898 2847945661 286
438 iso_pu_bacteria 2849076700 2849080167 286
439 iso_pu_bacteria 2857509624 2857510449 286
440 iso_pu_bacteria 2857524615 2857530639 286
441 iso_pu_bacteria 2874590934 2874591894 286
442 iso_pu_bacteria 2874604998 2874609429 286
443 iso_pu_bacteria 2874612657 2874612681 286
444 iso_pu_bacteria 2874620515 2874627003 286
445 iso_pu_bacteria 2874628541 2874636427 286
446 iso_pu_bacteria 2874645413 2874651218 286
447 iso_pu_bacteria 2876771140 2876771485 286
448 iso_pu_bacteria 2876808645 2876813184 286
449 iso_pu_bacteria 2876818435 2876819438 286
450 iso_pu_bacteria 2879074833 2879075890 286
451 iso_pu_bacteria 2879083081 2879090826 286
452 iso_pu_bacteria 2879099564 2879100153 286
453 iso_pu_bacteria 2879110137 2879110348 286
454 iso_pu_bacteria 2879127579 2879134662 286
455 iso_pu_bacteria 2879142872 2879143386 286
456 iso_pu_bacteria 2881364244 2881366551 286
457 iso_pu_bacteria 2881665667 2881673099 286
458 iso_pu_bacteria 2885366525 2885373402 286
459 iso_pu_bacteria 2885409591 2885410343 286
460 iso_pu_bacteria 2888378607 2888383085 286
461 iso_pu_bacteria 2888388044 2888394744 286
462 iso_pu_bacteria 2888419890 2888423540 286
463 iso_pu_bacteria 2889033259 2889040768 286
464 iso_pu_bacteria 2893066018 2893070284 286
465 iso_pu_bacteria 2904666416 2904669704 286
466 iso_pu_bacteria 2904711408 2904716994 286
467 iso_pu_bacteria 2906626472 2906627972 286
468 iso_pu_bacteria 2906643746 2906647696 286
469 iso_pu_bacteria 2908775508 2908779263 286
470 iso_pu_bacteria 2919073203 2919076237 286
471 iso_pu_bacteria 2922368715 2922373287 286
472 iso_pu_bacteria 2922393267 2922395475 286
473 iso_pu_bacteria 2929615660 2929615683 286
474 iso_pu_bacteria 2929624759 2929630298 286
475 iso_pu_bacteria 2932784394 2932791874 286
476 iso_pu_bacteria 2932809354 2932815615 286
477 iso_pu_bacteria 2932818245 2932819312 286
478 iso_pu_bacteria 2932828146 2932836001 286
479 iso_pu_bacteria 2933577622 2933579030 286
480 iso_pu_bacteria 2935608549 2935611610 286
481 iso_pu_bacteria 2935616580 2935624276 286
482 iso_pu_bacteria 2935638405 2935647752 286
483 iso_pu_bacteria 2935648319 2935648990 286
484 iso_pu_bacteria 2935656913 2935656928 286
485 iso_pu_bacteria 2935665750 2935674775 286
486 iso_pu_bacteria 2935675223 2935678336 286
487 iso_pu_bacteria 2935684952 2935688238 286
488 iso_pu_bacteria 2935694250 2935698902 286
489 iso_pu_bacteria 2935703347 2935708521 286
490 iso_pu_bacteria 2935713505 2935715257 286
491 iso_pu_bacteria 2935722832 2935726178 286
492 iso_pu_bacteria 2935732158 2935734076 286
493 iso_pu_bacteria 2935741537 2935743455 286
494 iso_pu_bacteria 2935750917 2935754507 286
495 iso_pu_bacteria 2935760218 2935768277 286
496 iso_pu_bacteria 2935769743 2935775844 286
497 iso_pu_bacteria 2935777560 2935780730 286
498 iso_pu_bacteria 2935785616 2935791419 286
499 iso_pu_bacteria 2935793552 2935799705 286
500 iso_pu_bacteria 2935801545 2935809354 286
501 iso_pu_bacteria 2935810662 2935819431 286
502 iso_pu_bacteria 2935819856 2935821087 286
503 iso_pu_bacteria 2935827899 2935837236 286
504 iso_pu_bacteria 2935837841 2935846494 286
505 iso_pu_bacteria 2935847175 2935850653 286
506 iso_pu_bacteria 2935855204 2935862690 286
507 iso_pu_bacteria 2935864058 2935871712 286
508 iso_pu_bacteria 2935873716 2935881921 286
509 iso_pu_bacteria 2935883170 2935888762 286
510 iso_pu_bacteria 2935908558 2935915471 286
511 iso_pu_bacteria 2935916978 2935921427 286
512 iso_pu_bacteria 2935926038 2935932930 286
513 iso_pu_bacteria 2935934488 2935941459 286
514 iso_pu_bacteria 2935942939 2935949704 286
515 iso_pu_bacteria 2935951376 2935958399 286
516 iso_pu_bacteria 2935967501 2935974431 286
517 iso_pu_bacteria 2935975950 2935980803 286
518 iso_pu_bacteria 2935984226 2935989171 286
519 iso_pu_bacteria 2935992306 2935998810 286
520 iso_pu_bacteria 2936002035 2936007366 286
521 iso_pu_bacteria 2936011229 2936011899 286
522 iso_pu_bacteria 2936019824 2936028004 286
523 iso_pu_bacteria 2936028420 2936029188 286
524 iso_pu_bacteria 2936037263 2936046276 286
525 iso_pu_bacteria 2936046547 2936054858 286
526 iso_pu_bacteria 2936055302 2936061445 286
527 iso_pu_bacteria 2940556831 2940560116 286
528 iso_pu_bacteria 2941531003 2941533984 286
529 iso_pu_bacteria 2941538514 2941546913 286
530 iso_pu_bacteria 3005483717 3005490069 286
531 iso_pu_bacteria 3005506211 3005511723 286
532 iso_pu_bacteria 3005587118 3005590849 286
533 iso_pu_bacteria 3005594810 3005598296 286
534 iso_pu_bacteria 3005710791 3005714010 286
535 iso_pu_bacteria 3005718088 3005721462 286
536 iso_pu_bacteria 8006926726 8006930356 286
537 iso_pu_bacteria 8006994254 8006996315 286
538 iso_pu_bacteria 8016511872 8016514448 286
539 iso_pu_bacteria 8016522445 8016530550 286
540 iso_pu_bacteria 8016530956 8016535828 286
541 iso_pu_bacteria 8016548790 8016553124 286
542 iso_pu_bacteria 8016557553 8016561505 286
543 iso_pu_bacteria 8016575299 8016578277 286
544 iso_pu_bacteria 8016595262 8016599350 286
545 iso_pu_bacteria 8016603502 8016611686 286
546 iso_pu_bacteria 8016613128 8016622112 286
547 iso_pu_bacteria 8016622563 8016627738 286
548 iso_pu_bacteria 8017057580 8017061976 286
549 iso_pu_bacteria 8019530166 8019535555 286
550 iso_pu_bacteria 8019538911 8019543926 286
551 iso_pu_bacteria 8019547302 8019554841 286
552 iso_pu_bacteria 8019576017 8019581515 286
553 iso_pu_bacteria 8019597564 8019602088 286
554 iso_pu_bacteria 8019608314 8019616465 286
555 iso_pu_bacteria 8019619141 8019627135 286
556 iso_pu_bacteria 8019629233 8019635411 286
557 iso_pu_bacteria 8019648815 8019657354 286
558 iso_pu_bacteria 8019659431 8019663224 286
559 iso_pu_bacteria 8019668869 8019672834 286
560 iso_pu_bacteria 8019678201 8019683306 286
561 iso_pu_bacteria 8019687851 8019689016 286
562 iso_pu_bacteria 8055742211 8055747331 286
563 iso_pu_bacteria 8056673599 8056678109 286
564 iso_pu_bacteria 8056967851 8056972583 286
565 3300005262 Ga0065165_1004938 Ga0065165_10049389 287
566 3300005330 Ga0070690_100103363 Ga0070690_1001033632 287
567 3300005338 Ga0068868_100325214 Ga0068868_1003252142 287
568 3300005436 Ga0070713_100001790 Ga0070713_1000017905 287
569 3300005455 Ga0070663_100024377 Ga0070663_1000243773 287
570 3300005535 Ga0070684_100253982 Ga0070684_1002539822 287
571 3300005616 Ga0068852_100622108 Ga0068852_1006221082 287
572 3300005618 Ga0068864_100026137 Ga0068864_1000261376 287
573 3300005842 Ga0068858_100039814 Ga0068858_1000398142 287
574 3300005985 Ga0081539_10020813 Ga0081539_100208133 287
575 3300006042 Ga0075368_10091450 Ga0075368_100914502 287
576 3300006186 Ga0075369_10044359 Ga0075369_100443591 287
577 3300009148 Ga0105243_10384529 Ga0105243_103845292 287
578 3300009174 Ga0105241_10004891 Ga0105241_100048918 287
579 3300011119 Ga0105246_10033871 Ga0105246_100338715 287
580 3300013296 Ga0157374_10285172 Ga0157374_102851722 287
581 3300013306 Ga0163162_10656546 Ga0163162_106565462 287
582 3300014325 Ga0163163_10013349 Ga0163163_1001334910 287
583 3300025261 Ga0209233_1001149 Ga0209233_10011498 287
584 3300025302 Ga0207426_1000596 Ga0207426_10005964 287
585 3300025907 Ga0207645_10076652 Ga0207645_100766523 287
586 3300025908 Ga0207643_10027921 Ga0207643_100279211 287
587 3300025911 Ga0207654_10005089 Ga0207654_100050898 287
588 3300025918 Ga0207662_10037429 Ga0207662_100374293 287
589 3300025924 Ga0207694_10151031 Ga0207694_101510311 287
590 3300025928 Ga0207700_10001654 Ga0207700_100016549 287
591 3300025941 Ga0207711_10059809 Ga0207711_100598093 287
592 3300025942 Ga0207689_10006687 Ga0207689_100066873 287
593 3300026041 Ga0207639_10008087 Ga0207639_100080873 287
594 3300026095 Ga0207676_10177602 Ga0207676_101776021 287
595 3300028379 Ga0268266_10004661 Ga0268266_1000466114 287
596 3300031616 Ga0307508_10036379 Ga0307508_100363793 287
597 3300046492 Ga0495585_0030399 Ga0495585_0030399_561_1484 287
598 3300046539 Ga0495621_0022733 Ga0495621_0022733_1122_2045 287
599 3300046558 Ga0495633_0058152 Ga0495633_0058152_549_1472 287
600 3300047318 Ga0495636_0024541 Ga0495636_0024541_54_977 287
601 3300048904 Ga0496101_0042282 Ga0496101_0042282_1995_2924 287
602 3300048905 Ga0496102_0075575 Ga0496102_0075575_1532_2461 287
603 3300048911 Ga0496108_0173514 Ga0496108_0173514_124_1053 287
604 3300048913 Ga0496110_0155376 Ga0496110_0155376_426_1355 287
605 3300050514 nmdc:mga08x19_214517_c1 nmdc:mga08x19_214517_c1_17_946 287
606 iso_pu_bacteria 2513237096 2513656493 287
607 iso_pu_bacteria 2513237137 2513859622 287
608 iso_pu_bacteria 2513237145 2513917678 287
609 iso_pu_bacteria 2517572143 2517893249 287
610 iso_pu_bacteria 2524023228 2524537176 287
611 iso_pu_bacteria 2667528175 2671117890 287
612 iso_pu_bacteria 2728368998 2728754513 287
613 iso_pu_bacteria 2791355197 2793069880 287
614 iso_pu_bacteria 2885374607 2885374841 287
615 iso_pu_bacteria 2904690495 2904696707 287
616 iso_pu_bacteria 2906610324 2906617543 287
617 iso_pu_bacteria 2906635258 2906642250 287
618 iso_pu_bacteria 2906660503 2906667953 287
619 iso_pu_bacteria 2908739725 2908743645 287
620 iso_pu_bacteria 2908756301 2908761327 287
621 iso_pu_bacteria 2922425934 2922429228 287
622 iso_pu_bacteria 2935630451 2935634182 287
623 iso_pu_bacteria 2941507105 2941511072 287
624 iso_pu_bacteria 2941515067 2941518456 287
625 iso_pu_bacteria 2941523033 2941527281 287
626 iso_pu_bacteria 3005474847 3005479394 287
627 iso_pu_bacteria 8019555841 8019557661 287
628 iso_pu_bacteria 8019565922 8019567638 287
629 iso_pu_bacteria 8056689827 8056695795 287
630 3300005983 Ga0081540_1010080 Ga0081540_10100804 288
631 3300025297 Ga0209758_1017288 Ga0209758_10172884 288
632 3300025940 Ga0207691_10267718 Ga0207691_102677181 288
633 iso_pu_bacteria 2513237101 2513691664 288
634 iso_pu_bacteria 2524023205 2524439724 288
635 iso_pu_bacteria 2528768022 2528853523 288
636 iso_pu_bacteria 2824661429 2824668771 288
637 iso_pu_bacteria 2922361189 2922367870 288
638 iso_pu_bacteria 2922386360 2922392240 288
639 iso_pu_bacteria 2935959822 2935964474 288
640 iso_pu_bacteria 8006964411 8006968701 288
641 3300005458 Ga0070681_10053524 Ga0070681_100535246 289
642 3300005548 Ga0070665_100201354 Ga0070665_1002013542 289
643 3300028379 Ga0268266_10162189 Ga0268266_101621891 289
644 3300046460 Ga0495638_0014228 Ga0495638_0014228_275_1198 289
645 3300046462 Ga0495651_0002653 Ga0495651_0002653_11031_11954 289
646 3300046463 Ga0495653_0125391 Ga0495653_0125391_354_1277 289
647 3300046477 Ga0495664_0020156 Ga0495664_0020156_2903_3826 289
648 3300046506 Ga0495583_0106175 Ga0495583_0106175_217_1140 289
649 3300046507 Ga0495606_0158486 Ga0495606_0158486_186_1109 289
650 3300046511 Ga0495608_0006579 Ga0495608_0006579_5805_6728 289
651 3300046516 Ga0495628_0010035 Ga0495628_0010035_2379_3302 289
652 3300046529 Ga0495652_0019244 Ga0495652_0019244_4386_5309 289
653 3300046533 Ga0495640_0054645 Ga0495640_0054645_69_992 289
654 3300046536 Ga0495587_0033782 Ga0495587_0033782_1128_2051 289
655 3300046537 Ga0495598_0002292 Ga0495598_0002292_52_981 289
656 3300046543 Ga0495645_0041833 Ga0495645_0041833_1696_2619 289
657 3300046557 Ga0495622_0062758 Ga0495622_0062758_34_957 289
658 3300046559 Ga0495667_0023767 Ga0495667_0023767_11_934 289
659 3300046642 Ga0495634_0101163 Ga0495634_0101163_492_1415 289
660 3300046675 Ga0495657_0006529 Ga0495657_0006529_3361_4284 289
661 3300046679 Ga0495623_0006459 Ga0495623_0006459_6146_7069 289
662 3300046809 Ga0495600_0038968 Ga0495600_0038968_417_1340 289
663 3300047317 Ga0495604_0002893 Ga0495604_0002893_10926_11849 289
664 3300047319 Ga0495674_0017963 Ga0495674_0017963_1581_2504 289
665 3300047322 Ga0495680_0000866 Ga0495680_0000866_11203_12126 289
666 3300047444 Ga0495675_0006944 Ga0495675_0006944_3053_3976 289
667 3300048088 Ga0495602_0023599 Ga0495602_0023599_3801_4724 289
668 3300048909 Ga0496106_0001713 Ga0496106_0001713_8766_9710 289
669 3300048928 Ga0496125_0000125 Ga0496125_0000125_12722_13648 289
670 3300048928 Ga0496125_0209451 Ga0496125_0209451_54_977 289
671 3300053080 Ga0500635_0033076 Ga0500635_0033076_683_1606 289
672 3300053085 Ga0495619_0114767 Ga0495619_0114767_447_1370 289
673 3300053094 Ga0500566_0008165 Ga0500566_0008165_4816_5745 289
674 3300053102 Ga0500554_009991 Ga0500554_009991_1052_1981 289
675 3300053104 Ga0500556_0038278 Ga0500556_0038278_662_1585 289
676 3300053109 Ga0500569_034818 Ga0500569_034818_466_1389 289
677 3300053119 Ga0500595_000159 Ga0500595_000159_18136_19065 289
678 3300053146 Ga0500588_0011377 Ga0500588_0011377_1144_2067 289
679 3300053160 Ga0500633_0058264 Ga0500633_0058264_148_1071 289
680 3300053178 Ga0500637_0000349 Ga0500637_0000349_13194_14123 289
681 3300053736 Ga0500599_002700 Ga0500599_002700_1079_2002 289
682 3300053737 Ga0500601_000594 Ga0500601_000594_1617_2540 289
683 3300055283 Ga0500661_000182 Ga0500661_000182_8489_9418 289
684 iso_pu_bacteria 2508501009 2508543555 289
685 iso_pu_bacteria 2511231028 2511395544 289
686 iso_pu_bacteria 2513237098 2513676826 289
687 iso_pu_bacteria 2844315083 2844318229 289
688 iso_pu_bacteria 2876761206 2876770906 289
689 iso_pu_bacteria 2885383462 2885386642 289
690 iso_pu_bacteria 2903727486 2903729176 289
691 iso_pu_bacteria 2903748898 2903755716 289
692 iso_pu_bacteria 2903768456 2903774605 289
693 iso_pu_bacteria 2906602504 2906605122 289
694 iso_pu_bacteria 2932794094 2932796344 289
695 iso_pu_bacteria 2932801729 2932804350 289
696 iso_pu_bacteria 8006984368 8006990558 289
697 iso_pu_bacteria 8056681323 8056684091 289
698 3300003215 JGI25153J46596_10002725 JGI25153J46596_100027257 290
699 3300003215 JGI25153J46596_10004784 JGI25153J46596_100047846 290
700 3300003323 rootH1_10136472 rootH1_101364721 290
701 3300003354 JGI25160J50197_1000742 JGI25160J50197_10007424 290
702 3300003794 Ga0055531_10011993 Ga0055531_100119932 290
703 3300005262 Ga0065165_1005861 Ga0065165_10058617 290
704 3300005327 Ga0070658_10071789 Ga0070658_100717893 290
705 3300005347 Ga0070668_100116047 Ga0070668_1001160472 290
706 3300005355 Ga0070671_100491050 Ga0070671_1004910501 290
707 3300005434 Ga0070709_10000536 Ga0070709_100005368 290
708 3300005435 Ga0070714_100017643 Ga0070714_1000176431 290
709 3300005436 Ga0070713_100060245 Ga0070713_1000602452 290
710 3300005437 Ga0070710_10001025 Ga0070710_100010256 290
711 3300005439 Ga0070711_100006213 Ga0070711_1000062133 290
712 3300005466 Ga0070685_10159390 Ga0070685_101593902 290
713 3300005844 Ga0068862_100218316 Ga0068862_1002183161 290
714 3300005937 Ga0081455_10002500 Ga0081455_1000250020 290
715 3300005983 Ga0081540_1000916 Ga0081540_100091625 290
716 3300006028 Ga0070717_10023702 Ga0070717_100237022 290
717 3300006042 Ga0075368_10009922 Ga0075368_100099223 290
718 3300006048 Ga0075363_100038559 Ga0075363_1000385593 290
719 3300006051 Ga0075364_10140022 Ga0075364_101400223 290
720 3300006173 Ga0070716_100004262 Ga0070716_1000042626 290
721 3300006175 Ga0070712_100009193 Ga0070712_1000091933 290
722 3300006178 Ga0075367_10187734 Ga0075367_101877342 290
723 3300006195 Ga0075366_10086566 Ga0075366_100865663 290
724 3300006353 Ga0075370_10080790 Ga0075370_100807902 290
725 3300009093 Ga0105240_10007081 Ga0105240_1000708117 290
726 3300009177 Ga0105248_10126043 Ga0105248_101260432 290
727 3300009545 Ga0105237_10034229 Ga0105237_100342294 290
728 3300009545 Ga0105237_10140474 Ga0105237_101404743 290
729 3300013102 Ga0157371_10202148 Ga0157371_102021482 290
730 3300013104 Ga0157370_10197526 Ga0157370_101975262 290
731 3300013307 Ga0157372_10042485 Ga0157372_100424856 290
732 3300014325 Ga0163163_10075810 Ga0163163_100758103 290
733 3300014325 Ga0163163_10745325 Ga0163163_107453251 290
734 3300021320 Ga0214544_1000009 Ga0214544_100000939 290
735 3300021321 Ga0214542_1000002 Ga0214542_1000002481 290
736 3300021324 Ga0214545_1000002 Ga0214545_1000002239 290
737 3300021327 Ga0214543_1000013 Ga0214543_100001383 290
738 3300021384 Ga0213876_10002492 Ga0213876_100024929 290
739 3300025254 Ga0209148_1001101 Ga0209148_10011014 290
740 3300025261 Ga0209233_1015182 Ga0209233_10151823 290
741 3300025261 Ga0209233_1024850 Ga0209233_10248502 290
742 3300025272 Ga0209455_1010970 Ga0209455_10109701 290
743 3300025272 Ga0209455_1016968 Ga0209455_10169681 290
744 3300025295 Ga0209564_1014408 Ga0209564_10144082 290
745 3300025297 Ga0209758_1000100 Ga0209758_1000100139 290
746 3300025297 Ga0209758_1001030 Ga0209758_100103020 290
747 3300025297 Ga0209758_1004329 Ga0209758_10043295 290
748 3300025297 Ga0209758_1004805 Ga0209758_10048056 290
749 3300025297 Ga0209758_1029357 Ga0209758_10293572 290
750 3300025299 Ga0209256_1003774 Ga0209256_10037745 290
751 3300025302 Ga0207426_1000382 Ga0207426_100038262 290
752 3300025302 Ga0207426_1014329 Ga0207426_10143293 290
753 3300025302 Ga0207426_1031161 Ga0207426_10311612 290
754 3300025304 Ga0209257_1004538 Ga0209257_100453813 290
755 3300025304 Ga0209257_1028192 Ga0209257_10281922 290
756 3300025898 Ga0207692_10001144 Ga0207692_100011443 290
757 3300025903 Ga0207680_10244039 Ga0207680_102440391 290
758 3300025906 Ga0207699_10079455 Ga0207699_100794552 290
759 3300025911 Ga0207654_10019143 Ga0207654_100191432 290
760 3300025913 Ga0207695_10001107 Ga0207695_100011073 290
761 3300025915 Ga0207693_10015526 Ga0207693_100155267 290
762 3300025916 Ga0207663_10003002 Ga0207663_100030023 290
763 3300025928 Ga0207700_10056950 Ga0207700_100569502 290
764 3300025929 Ga0207664_10032535 Ga0207664_100325353 290
765 3300025939 Ga0207665_10008309 Ga0207665_100083097 290
766 3300025940 Ga0207691_10236720 Ga0207691_102367202 290
767 3300025941 Ga0207711_10255289 Ga0207711_102552892 290
768 3300026089 Ga0207648_10218622 Ga0207648_102186222 290
769 3300027866 Ga0209813_10029960 Ga0209813_100299602 290
770 3300031911 Ga0307412_10270297 Ga0307412_102702972 290
771 3300033180 Ga0307510_10000998 Ga0307510_1000099817 290
772 3300033180 Ga0307510_10002011 Ga0307510_1000201117 290
773 3300034820 Ga0373959_0036988 Ga0373959_0036988_28_951 290
774 3300035695 Ga0373927_0070930 Ga0373927_0070930_193_1116 290
775 3300039437 Ga0436365_0727123 Ga0436365_0727123_6702_7625 290
776 3300039453 Ga0436362_0977195 Ga0436362_0977195_660_1583 290
777 3300044684 Ga0466966_0001718 Ga0466966_0001718_11071_11994 290
778 3300044693 Ga0466961_0000506 Ga0466961_0000506_13345_14268 290
779 3300044901 Ga0466960_0084695 Ga0466960_0084695_659_1582 290
780 3300045049 Ga0466959_0003908 Ga0466959_0003908_2481_3404 290
781 3300046454 Ga0495592_0055217 Ga0495592_0055217_1744_2667 290
782 3300046522 Ga0495643_0016764 Ga0495643_0016764_2944_3867 290
783 3300046530 Ga0495654_0045108 Ga0495654_0045108_740_1666 290
784 3300047321 Ga0495676_0214214 Ga0495676_0214214_294_1217 290
785 3300047443 Ga0495687_008422 Ga0495687_008422_4202_5125 290
786 3300048905 Ga0496102_0181473 Ga0496102_0181473_103_1026 290
787 3300048906 Ga0496103_0007222 Ga0496103_0007222_413_1336 290
788 3300048906 Ga0496103_0096745 Ga0496103_0096745_343_1266 290
789 3300048912 Ga0496109_0438483 Ga0496109_0438483_179_1102 290
790 3300048924 Ga0496121_0030405 Ga0496121_0030405_2199_3122 290
791 3300048924 Ga0496121_0152392 Ga0496121_0152392_354_1277 290
792 3300048924 Ga0496121_0187067 Ga0496121_0187067_212_1135 290
793 3300048925 Ga0496122_0025525 Ga0496122_0025525_3141_4067 290
794 3300048926 Ga0496123_0026472 Ga0496123_0026472_2638_3564 290
795 3300048927 Ga0496124_0127277 Ga0496124_0127277_193_1116 290
796 3300048928 Ga0496125_0018720 Ga0496125_0018720_569_1495 290
797 3300048928 Ga0496125_0041087 Ga0496125_0041087_100_1023 290
798 3300048929 Ga0496126_0225845 Ga0496126_0225845_600_1526 290
799 3300049569 Ga0501032_0002066 Ga0501032_0002066_2232_3158 290
800 3300049570 Ga0501033_0000241 Ga0501033_0000241_1522_2448 290
801 3300049571 Ga0501034_0000021 Ga0501034_0000021_134712_135638 290
802 3300049572 Ga0501036_0000055 Ga0501036_0000055_25453_26379 290
803 3300049573 Ga0501037_0010878 Ga0501037_0010878_203_1129 290
804 3300049574 Ga0501038_0002132 Ga0501038_0002132_14882_15808 290
805 3300049575 Ga0501039_0000293 Ga0501039_0000293_15922_16848 290
806 3300049578 Ga0501042_0041869 Ga0501042_0041869_557_1483 290
807 3300049579 Ga0501043_0000033 Ga0501043_0000033_53835_54761 290
808 3300049580 Ga0501046_0000452 Ga0501046_0000452_37089_38015 290
809 3300049581 Ga0501047_0001106 Ga0501047_0001106_1494_2420 290
810 3300049582 Ga0501048_0000261 Ga0501048_0000261_27907_28833 290
811 3300049583 Ga0501067_0000045 Ga0501067_0000045_8048_8974 290
812 3300049584 Ga0501068_0000661 Ga0501068_0000661_11551_12477 290
813 3300049585 Ga0501069_0005255 Ga0501069_0005255_1501_2427 290
814 3300049586 Ga0501070_0002298 Ga0501070_0002298_2679_3605 290
815 3300049586 Ga0501070_0218030 Ga0501070_0218030_547_1473 290
816 3300049589 Ga0501073_0000064 Ga0501073_0000064_48017_48943 290
817 3300049590 Ga0501074_0000044 Ga0501074_0000044_48986_49912 290
818 3300049592 Ga0501076_0106065 Ga0501076_0106065_195_1121 290
819 3300049741 Ga0501079_0003287 Ga0501079_0003287_2766_3692 290
820 3300049742 Ga0501080_0000072 Ga0501080_0000072_10625_11551 290
821 3300049744 Ga0501083_0000182 Ga0501083_0000182_19363_20289 290
822 3300049822 Ga0501035_0000241 Ga0501035_0000241_40363_41289 290
823 3300049823 Ga0501044_0000640 Ga0501044_0000640_37759_38685 290
824 3300049824 Ga0501045_0020657 Ga0501045_0020657_3727_4653 290
825 3300050495 nmdc:mga04h51_35861_c1 nmdc:mga04h51_35861_c1_548_1471 290
826 3300050496 nmdc:mga07m45_108977_c1 nmdc:mga07m45_108977_c1_259_1182 290
827 3300050496 nmdc:mga07m45_146664_c1 nmdc:mga07m45_146664_c1_422_1345 290
828 3300050496 nmdc:mga07m45_54096_c1 nmdc:mga07m45_54096_c1_426_1349 290
829 3300053087 Ga0500643_000025 Ga0500643_000025_71155_72078 290
830 3300053090 Ga0500646_0020288 Ga0500646_0020288_638_1564 290
831 3300053092 Ga0500583_0100050 Ga0500583_0100050_352_1275 290
832 3300053094 Ga0500566_0000357 Ga0500566_0000357_3891_4814 290
833 3300053096 Ga0500641_0030588 Ga0500641_0030588_871_1794 290
834 3300053096 Ga0500641_0091407 Ga0500641_0091407_220_1143 290
835 3300053103 Ga0500555_001092 Ga0500555_001092_2432_3355 290
836 3300053118 Ga0500594_0038047 Ga0500594_0038047_241_1167 290
837 3300053118 Ga0500594_0047142 Ga0500594_0047142_157_1080 290
838 3300053119 Ga0500595_001073 Ga0500595_001073_9510_10436 290
839 3300053119 Ga0500595_001169 Ga0500595_001169_10200_11123 290
840 3300053130 Ga0500642_0031446 Ga0500642_0031446_691_1614 290
841 3300053131 Ga0500652_000170 Ga0500652_000170_15791_16717 290
842 3300053177 Ga0500636_0000518 Ga0500636_0000518_13377_14300 290
843 3300053177 Ga0500636_0027080 Ga0500636_0027080_1780_2709 290
844 3300060353 Ga0501082_0007533 Ga0501082_0007533_573_1499 290
845 3300006195 Ga0075366_10112501 Ga0075366_101125012 291
846 3300053730 Ga0500645_043502 Ga0500645_043502_355_1284 291
847 3300003659 JGI25404J52841_10003218 JGI25404J52841_100032183 292
848 3300005455 Ga0070663_100030738 Ga0070663_1000307383 292
849 3300005937 Ga0081455_10004176 Ga0081455_100041764 292
850 3300006177 Ga0075362_10031729 Ga0075362_100317293 292
851 3300007788 Ga0099795_10016442 Ga0099795_100164423 292
852 3300013297 Ga0157378_10017474 Ga0157378_100174744 292
853 3300026041 Ga0207639_10091645 Ga0207639_100916451 292
854 3300026067 Ga0207678_10124810 Ga0207678_101248101 292
855 3300026142 Ga0207698_10311976 Ga0207698_103119762 292
856 3300037471 Ga0395905_0051575 Ga0395905_0051575_1862_2791 292
857 3300038443 Ga0395901_0058835 Ga0395901_0058835_2298_3227 292
858 3300046475 Ga0495639_0082452 Ga0495639_0082452_529_1458 292
859 3300048920 Ga0496117_0101357 Ga0496117_0101357_311_1255 292
860 3300048922 Ga0496119_0130634 Ga0496119_0130634_133_1077 292
861 3300048924 Ga0496121_0000398 Ga0496121_0000398_15264_16208 292
862 3300048927 Ga0496124_0001166 Ga0496124_0001166_6381_7325 292
863 3300048928 Ga0496125_0009648 Ga0496125_0009648_4262_5206 292
864 3300048929 Ga0496126_0010434 Ga0496126_0010434_4141_5085 292
865 3300050492 nmdc:mga0yw44_18638_c1 nmdc:mga0yw44_18638_c1_734_1663 292
866 3300050492 nmdc:mga0yw44_2168_c1 nmdc:mga0yw44_2168_c1_930_1859 292
867 3300050511 nmdc:mga08y16_284683_c1 nmdc:mga08y16_284683_c1_148_1077 292
868 3300003203 JGI25406J46586_10000853 JGI25406J46586_1000085311 293
869 3300003215 JGI25153J46596_10000726 JGI25153J46596_1000072619 293
870 3300005262 Ga0065165_1025486 Ga0065165_10254862 293
871 3300005435 Ga0070714_100320729 Ga0070714_1003207292 293
872 3300005937 Ga0081455_10030188 Ga0081455_100301884 293
873 3300005985 Ga0081539_10000231 Ga0081539_10000231104 293
874 3300006048 Ga0075363_100004318 Ga0075363_1000043185 293
875 3300006178 Ga0075367_10004932 Ga0075367_100049325 293
876 3300025295 Ga0209564_1006526 Ga0209564_10065266 293
877 3300025297 Ga0209758_1003897 Ga0209758_10038976 293
878 3300025297 Ga0209758_1026291 Ga0209758_10262912 293
879 3300028379 Ga0268266_10002460 Ga0268266_1000246017 293
880 3300028794 Ga0307515_10218882 Ga0307515_102188822 293
881 3300033180 Ga0307510_10096190 Ga0307510_100961902 293
882 3300046492 Ga0495585_0031512 Ga0495585_0031512_1411_2343 293
883 3300046518 Ga0495631_0138436 Ga0495631_0138436_44_976 293
884 3300046692 Ga0495671_0100980 Ga0495671_0100980_463_1395 293
885 3300047445 Ga0495677_0030579 Ga0495677_0030579_979_1911 293
886 3300048918 Ga0496115_0256525 Ga0496115_0256525_434_1366 293
887 3300048925 Ga0496122_0082300 Ga0496122_0082300_805_1746 293
888 3300050490 nmdc:mga03n38_4403_c1 nmdc:mga03n38_4403_c1_3224_4156 293
889 3300050496 nmdc:mga07m45_18542_c1 nmdc:mga07m45_18542_c1_1287_2219 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01758

SBF

Sodium Bile acid symporter family

203

310

0.91

PF03547

Mem_trans

Membrane transport protein

3

303

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qpc-assembly1.cif.gz_A inward-facing npa bound form of auxin transporter pin8 0.7811 2 288
7wks-assembly1.cif.gz_A apo state of atpin3 0.772 2 290
7qpc-assembly1.cif.gz_A inward-facing npa bound form of auxin transporter pin8 0.7648 2 288
7wks-assembly1.cif.gz_A apo state of atpin3 0.7607 2 290
7y9t-assembly1.cif.gz_B structure of the auxin exporter pin1 in arabidopsis thaliana in the apo state 0.7564 2 290
ID Description Score Start End Superfamily
af_Q9LFP6_9_362_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8457 4 285 1.20.1530.20
af_Q9C9K5_10_382_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8221 6 285 1.20.1530.20
af_Q9LFP6_9_362_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8142 4 285 1.20.1530.20
af_I1MAE5_9_526_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7942 4 285 1.20.1530.20
af_I1MI30_9_487_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7928 4 285 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A1U7JDN0-F1-model_v4 Membrane transport protein 0.9035 1 289 GO:0005886
GO:0055085
AF-A0A2M8H787-F1-model_v4 Transporter 0.9032 2 291 GO:0005886
GO:0055085
AF-A0A349GPM1-F1-model_v4 AEC family transporter 0.9017 1 291 GO:0005886
GO:0055085
AF-A0A651FEH3-F1-model_v4 deleted 0.9005 1 290
AF-A0A0K6III1-F1-model_v4 Predicted permease 0.9002 1 291 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
84.19 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map