F484771
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 888 | 593 | 646 | 316 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0033613|Ga0495672_0033613_915_1955 |
| Length | 346 |
| Sequence | MRNCASGNLGIPGSMLRIAPEWREERHLMSVTTMSSRGVVNRQPGWLARLFDYKPFLIVACLTPAIGLLAVFLTYPLGLGIWLAFTDTTIGRRGVFVGFENFQYLLSDPLWWGAVFYSVFYTAIATFGKFALGFWLALLLNNHFPFKSLLRAIVLLPWIVPTVLSALAFWWIYDPQFSIISYLLVDVLHIRTTNIDFLGTPWPARFSLIAANIWRGIPFVAISLLAGLQTISPSLYEAAMLDGATAWQRFRYITFPMMMPILAIVMTFSIIFTFTDFQLVYAITRGGPVNSTHLLATLAFQRGIAGGELGEGAAIAVSMIPFLVFATLFSYFGLARRKWQQGESND |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 10 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 11 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 12 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 13 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 14 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 21 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 22 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 23 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 24 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 25 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 26 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 27 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 28 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 29 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 30 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 31 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 32 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 33 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 34 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 35 | 2791355199 | |||
| 36 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 37 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 38 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 39 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 40 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 41 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 42 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 43 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 44 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 45 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 46 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 47 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 48 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 49 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 50 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 51 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 52 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 53 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 54 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 55 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 56 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 57 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 58 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 59 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 60 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 61 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 62 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 63 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 64 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 65 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 66 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 67 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 68 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 69 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 70 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 71 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 72 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 73 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 74 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 75 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 76 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 77 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 78 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 79 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 80 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 81 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 82 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 83 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 84 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 85 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 86 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 87 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 88 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 89 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 90 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 91 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 92 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 93 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 94 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 95 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 96 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 97 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 98 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 99 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 100 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 101 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 102 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 103 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 104 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 105 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 106 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 107 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 108 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 109 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 110 | 2904699407 | |||
| 111 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 112 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 113 | 2906610324 | |||
| 114 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 115 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 116 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 117 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 118 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 119 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 120 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 121 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 122 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 123 | 2922368715 | |||
| 124 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 125 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 126 | 2922425934 | |||
| 127 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 128 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 129 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 130 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 131 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 132 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 133 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 134 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 135 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 136 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 137 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 138 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 139 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 140 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 141 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 142 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 143 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 144 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 145 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 146 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 147 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 148 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 149 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 150 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 151 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 152 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 153 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 154 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 155 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 156 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 157 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 158 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 159 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 160 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 161 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 162 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 163 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 164 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 165 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 166 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 167 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 168 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 169 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 170 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 171 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 172 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 173 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 174 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 175 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 176 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 177 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 178 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 179 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 180 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 181 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 182 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 183 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 184 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 185 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 186 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 187 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 188 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 189 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 190 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 191 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 192 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 193 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 194 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 195 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 196 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 197 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 198 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 199 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 200 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 201 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 202 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 203 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 204 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 205 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 206 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 207 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 208 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 209 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 210 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 211 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 213 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 215 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 216 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 217 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 219 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 223 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 225 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 226 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 227 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 232 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 233 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 234 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 235 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 236 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 237 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 239 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 240 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 242 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 243 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 244 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 245 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 246 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 247 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 248 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 249 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 250 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 251 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 252 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 253 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 254 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 255 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 256 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 257 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 258 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 259 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 260 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 261 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 262 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 263 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 264 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 265 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 266 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 267 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 269 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 270 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 271 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 277 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 278 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 279 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 280 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 281 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 282 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 283 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 284 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 287 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 288 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 289 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 290 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 291 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 292 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 293 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 294 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 295 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 296 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 297 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 298 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 299 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 300 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 301 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 302 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 303 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 304 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 305 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 307 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 308 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 309 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 310 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 311 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 312 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 356 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 357 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 358 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 359 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 361 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 364 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 365 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 366 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 367 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 368 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 369 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 370 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 371 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 372 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 373 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 374 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 375 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 376 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 377 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 378 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 379 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 380 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 381 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 382 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 383 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 384 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 385 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 386 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 387 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 388 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 389 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 390 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 391 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 392 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 393 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 394 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 395 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 396 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 397 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 398 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 399 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 400 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 401 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 402 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 403 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 404 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 405 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 406 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 407 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 408 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 409 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 410 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 411 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 473 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 474 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 475 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 476 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 477 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 478 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 479 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 480 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 481 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 482 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 483 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 484 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 485 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 486 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 487 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 488 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 489 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 490 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 491 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 492 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 493 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 494 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 495 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 496 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 497 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 508 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 509 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 510 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 511 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 512 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 513 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 514 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 515 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 516 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 517 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 518 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 519 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 520 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 521 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 522 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 523 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 524 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 525 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 526 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 527 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 528 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 529 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 530 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 531 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 532 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 533 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 534 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 535 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 536 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 537 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 538 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 539 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 540 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 541 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 542 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 543 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 544 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 545 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 546 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 547 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 548 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 549 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 550 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 551 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 553 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 554 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 555 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 556 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 557 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 558 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 559 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 560 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 561 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 562 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 563 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 564 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 565 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 566 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 567 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 568 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 569 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 570 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 571 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 572 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 573 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 574 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 575 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 576 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 577 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 578 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 579 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 580 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 581 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 582 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 583 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 584 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 585 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 586 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 587 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 588 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 589 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 590 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 591 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 592 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 593 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.05 |
| Metatranscriptomes | 0.11 |
| Isolates | 26.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.3 |
| Nodule | 20.95 |
| Rhizoplane | 4.39 |
| Rhizosphere | 46.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1005938 | 3300002987 | Bacteria | 3746 |
| 2 | JGI25151J46595_10000052 | 3300003187 | Bacteria | 159471 |
| 3 | JGI25406J46586_10000032 | 3300003203 | Bacteria | 67745 |
| 4 | JGI25406J46586_10000433 | 3300003203 | Bacteria | 19355 |
| 5 | JGI25153J46596_10021591 | 3300003215 | Bacteria | 2395 |
| 6 | JGI25153J46596_10042041 | 3300003215 | Bacteria | 1399 |
| 7 | JGI25160J50197_1007298 | 3300003354 | Bacteria | 4345 |
| 8 | JGI25404J52841_10008508 | 3300003659 | Bacteria | 2187 |
| 9 | Ga0055542_1002606 | 3300003762 | Bacteria | 5696 |
| 10 | Ga0055526_1000017 | 3300003771 | Bacteria | 210613 |
| 11 | Ga0055526_1002207 | 3300003771 | Bacteria | 13341 |
| 12 | Ga0055524_1000014 | 3300003775 | Bacteria | 259417 |
| 13 | Ga0055524_1010792 | 3300003775 | Bacteria | 3614 |
| 14 | Ga0055531_10005960 | 3300003794 | Bacteria | 7003 |
| 15 | Ga0055543_1008492 | 3300004625 | Bacteria | 2271 |
| 16 | Ga0065165_1000313 | 3300005262 | Bacteria | 79494 |
| 17 | Ga0065165_1001376 | 3300005262 | Bacteria | 26733 |
| 18 | Ga0065165_1002335 | 3300005262 | Bacteria | 16541 |
| 19 | Ga0065165_1006843 | 3300005262 | Bacteria | 5804 |
| 20 | Ga0070658_10157912 | 3300005327 | Bacteria | 1901 |
| 21 | Ga0070683_100077150 | 3300005329 | Bacteria | 3115 |
| 22 | Ga0070683_100141173 | 3300005329 | Bacteria | 2282 |
| 23 | Ga0070670_100186591 | 3300005331 | Bacteria | 1800 |
| 24 | Ga0070680_100083267 | 3300005336 | Bacteria | 2642 |
| 25 | Ga0070682_100046835 | 3300005337 | Bacteria | 2685 |
| 26 | Ga0068868_100011310 | 3300005338 | Bacteria | 6497 |
| 27 | Ga0070660_100295789 | 3300005339 | Bacteria | 1326 |
| 28 | Ga0070691_10003977 | 3300005341 | Bacteria | 6687 |
| 29 | Ga0070668_100104940 | 3300005347 | Bacteria | 2243 |
| 30 | Ga0070668_100271542 | 3300005347 | Bacteria | 1413 |
| 31 | Ga0070668_100382221 | 3300005347 | Bacteria | 1198 |
| 32 | Ga0070669_100083475 | 3300005353 | Bacteria | 2382 |
| 33 | Ga0070673_100120662 | 3300005364 | Bacteria | 2187 |
| 34 | Ga0070673_100234202 | 3300005364 | Bacteria | 1594 |
| 35 | Ga0070709_10040228 | 3300005434 | Bacteria | 2873 |
| 36 | Ga0070709_10050791 | 3300005434 | Bacteria | 2599 |
| 37 | Ga0070714_100084443 | 3300005435 | Bacteria | 2771 |
| 38 | Ga0070714_100312896 | 3300005435 | Bacteria | 1467 |
| 39 | Ga0070713_100057350 | 3300005436 | Bacteria | 3243 |
| 40 | Ga0070713_100160398 | 3300005436 | Bacteria | 2007 |
| 41 | Ga0070710_10145871 | 3300005437 | Bacteria | 1455 |
| 42 | Ga0070701_10188722 | 3300005438 | Bacteria | 1211 |
| 43 | Ga0070711_100006483 | 3300005439 | Bacteria | 7056 |
| 44 | Ga0070663_100003863 | 3300005455 | Bacteria | 8728 |
| 45 | Ga0070663_100007767 | 3300005455 | Bacteria | 6551 |
| 46 | Ga0070663_100079113 | 3300005455 | Bacteria | 2411 |
| 47 | Ga0070663_100098615 | 3300005455 | Bacteria | 2177 |
| 48 | Ga0070678_100064819 | 3300005456 | Bacteria | 2709 |
| 49 | Ga0070678_100070667 | 3300005456 | Bacteria | 2611 |
| 50 | Ga0070678_100103857 | 3300005456 | Bacteria | 2209 |
| 51 | Ga0070678_100157444 | 3300005456 | Bacteria | 1836 |
| 52 | Ga0070662_100073817 | 3300005457 | Bacteria | 2521 |
| 53 | Ga0070662_100078804 | 3300005457 | Bacteria | 2448 |
| 54 | Ga0070706_100063277 | 3300005467 | Bacteria | 3419 |
| 55 | Ga0070707_100104189 | 3300005468 | Bacteria | 2750 |
| 56 | Ga0070698_100250591 | 3300005471 | Bacteria | 1703 |
| 57 | Ga0070679_100075900 | 3300005530 | Bacteria | 3351 |
| 58 | Ga0070684_100085029 | 3300005535 | Bacteria | 2805 |
| 59 | Ga0070684_100304214 | 3300005535 | Bacteria | 1463 |
| 60 | Ga0068853_100192064 | 3300005539 | Bacteria | 1856 |
| 61 | Ga0068853_100340430 | 3300005539 | Bacteria | 1393 |
| 62 | Ga0070665_100017918 | 3300005548 | Bacteria | 7111 |
| 63 | Ga0070665_100050535 | 3300005548 | Bacteria | 4172 |
| 64 | Ga0070665_100188677 | 3300005548 | Bacteria | 2062 |
| 65 | Ga0070665_100193682 | 3300005548 | Bacteria | 2033 |
| 66 | Ga0070704_100003315 | 3300005549 | Bacteria | 9212 |
| 67 | Ga0068855_100092061 | 3300005563 | Bacteria | 3496 |
| 68 | Ga0068855_100133728 | 3300005563 | Bacteria | 2830 |
| 69 | Ga0068855_100180701 | 3300005563 | Bacteria | 2385 |
| 70 | Ga0070664_100061891 | 3300005564 | Bacteria | 3190 |
| 71 | Ga0068857_100013484 | 3300005577 | Bacteria | 7120 |
| 72 | Ga0068856_100002849 | 3300005614 | Bacteria | 17692 |
| 73 | Ga0068856_100017546 | 3300005614 | Bacteria | 6936 |
| 74 | Ga0068856_100072955 | 3300005614 | Bacteria | 3398 |
| 75 | Ga0068856_100236398 | 3300005614 | Bacteria | 1842 |
| 76 | Ga0068856_100502207 | 3300005614 | Bacteria | 1234 |
| 77 | Ga0068852_100034684 | 3300005616 | Bacteria | 4201 |
| 78 | Ga0068852_100153881 | 3300005616 | Bacteria | 2141 |
| 79 | Ga0068859_100106673 | 3300005617 | Bacteria | 2860 |
| 80 | Ga0068864_100098797 | 3300005618 | Bacteria | 2586 |
| 81 | Ga0068861_100017897 | 3300005719 | Bacteria | 5037 |
| 82 | Ga0068861_100026690 | 3300005719 | Bacteria | 4201 |
| 83 | Ga0068858_100019766 | 3300005842 | Bacteria | 6296 |
| 84 | Ga0068860_100095846 | 3300005843 | Bacteria | 2828 |
| 85 | Ga0081455_10014280 | 3300005937 | Bacteria | 7794 |
| 86 | Ga0081455_10026724 | 3300005937 | Bacteria | 5300 |
| 87 | Ga0081455_10050536 | 3300005937 | Bacteria | 3575 |
| 88 | Ga0081455_10100081 | 3300005937 | Bacteria | 2330 |
| 89 | Ga0081538_10058444 | 3300005981 | Bacteria | 2236 |
| 90 | Ga0081540_1000338 | 3300005983 | Bacteria | 48150 |
| 91 | Ga0081540_1000876 | 3300005983 | Bacteria | 27180 |
| 92 | Ga0081540_1003442 | 3300005983 | Bacteria | 12498 |
| 93 | Ga0081540_1005310 | 3300005983 | Bacteria | 9639 |
| 94 | Ga0081540_1014249 | 3300005983 | Bacteria | 5106 |
| 95 | Ga0081540_1016517 | 3300005983 | Bacteria | 4614 |
| 96 | Ga0081540_1026537 | 3300005983 | Bacteria | 3304 |
| 97 | Ga0081540_1090239 | 3300005983 | Bacteria | 1350 |
| 98 | Ga0081539_10000129 | 3300005985 | Bacteria | 178675 |
| 99 | Ga0081539_10000549 | 3300005985 | Bacteria | 77428 |
| 100 | Ga0075365_10013919 | 3300006038 | Bacteria | 4827 |
| 101 | Ga0075365_10027326 | 3300006038 | Bacteria | 3630 |
| 102 | Ga0075365_10041585 | 3300006038 | Bacteria | 3003 |
| 103 | Ga0075365_10075885 | 3300006038 | Bacteria | 2269 |
| 104 | Ga0075365_10119058 | 3300006038 | Bacteria | 1820 |
| 105 | Ga0075368_10010701 | 3300006042 | Bacteria | 3322 |
| 106 | Ga0075368_10098583 | 3300006042 | Bacteria | 1198 |
| 107 | Ga0075363_100002563 | 3300006048 | Bacteria | 7472 |
| 108 | Ga0075363_100018134 | 3300006048 | Bacteria | 3501 |
| 109 | Ga0075363_100020378 | 3300006048 | Bacteria | 3325 |
| 110 | Ga0075363_100247188 | 3300006048 | Bacteria | 1027 |
| 111 | Ga0075364_10026756 | 3300006051 | Bacteria | 3682 |
| 112 | Ga0070712_100194163 | 3300006175 | Bacteria | 1590 |
| 113 | Ga0075362_10018021 | 3300006177 | Bacteria | 2917 |
| 114 | Ga0075362_10026316 | 3300006177 | Bacteria | 2484 |
| 115 | Ga0075362_10049775 | 3300006177 | Bacteria | 1872 |
| 116 | Ga0075367_10002436 | 3300006178 | Bacteria | 8500 |
| 117 | Ga0075367_10008820 | 3300006178 | Bacteria | 5245 |
| 118 | Ga0075367_10037362 | 3300006178 | Bacteria | 2821 |
| 119 | Ga0075367_10045189 | 3300006178 | Bacteria | 2584 |
| 120 | Ga0075367_10060940 | 3300006178 | Bacteria | 2251 |
| 121 | Ga0075367_10101703 | 3300006178 | Bacteria | 1757 |
| 122 | Ga0075369_10031201 | 3300006186 | Bacteria | 2247 |
| 123 | Ga0075369_10069969 | 3300006186 | Bacteria | 1543 |
| 124 | Ga0075366_10025251 | 3300006195 | Bacteria | 3469 |
| 125 | Ga0075366_10096587 | 3300006195 | Bacteria | 1771 |
| 126 | Ga0075370_10024705 | 3300006353 | Bacteria | 3321 |
| 127 | Ga0075428_100019515 | 3300006844 | Bacteria | 7503 |
| 128 | Ga0075428_100092179 | 3300006844 | Bacteria | 3303 |
| 129 | Ga0075428_100097827 | 3300006844 | Bacteria | 3200 |
| 130 | Ga0075428_100179315 | 3300006844 | Bacteria | 2293 |
| 131 | Ga0075430_100036628 | 3300006846 | Bacteria | 4160 |
| 132 | Ga0075430_100111696 | 3300006846 | Bacteria | 2279 |
| 133 | Ga0075431_100000986 | 3300006847 | Bacteria | 25337 |
| 134 | Ga0075431_100004249 | 3300006847 | Bacteria | 14032 |
| 135 | Ga0075429_100013820 | 3300006880 | Bacteria | 7001 |
| 136 | Ga0075429_100073335 | 3300006880 | Bacteria | 2982 |
| 137 | Ga0097620_100106674 | 3300006931 | Bacteria | 2860 |
| 138 | Ga0099824_1008180 | 3300006942 | Bacteria | 13469 |
| 139 | Ga0099824_1012471 | 3300006942 | Bacteria | 9249 |
| 140 | Ga0099822_1007748 | 3300006943 | Bacteria | 13828 |
| 141 | Ga0075435_100482419 | 3300007076 | Bacteria | 1071 |
| 142 | Ga0105240_10002375 | 3300009093 | Bacteria | 30348 |
| 143 | Ga0105240_10317934 | 3300009093 | Bacteria | 1775 |
| 144 | Ga0111539_10004845 | 3300009094 | Bacteria | 17538 |
| 145 | Ga0105245_10063949 | 3300009098 | Bacteria | 3325 |
| 146 | Ga0114129_10004791 | 3300009147 | Bacteria | 19126 |
| 147 | Ga0114129_10581912 | 3300009147 | Bacteria | 1452 |
| 148 | Ga0114129_10606425 | 3300009147 | Bacteria | 1418 |
| 149 | Ga0105243_10066447 | 3300009148 | Bacteria | 2900 |
| 150 | Ga0105243_10368374 | 3300009148 | Bacteria | 1325 |
| 151 | Ga0105241_10067653 | 3300009174 | Bacteria | 2765 |
| 152 | Ga0105242_10345458 | 3300009176 | Bacteria | 1373 |
| 153 | Ga0105248_10207825 | 3300009177 | Bacteria | 2206 |
| 154 | Ga0105248_10409107 | 3300009177 | Bacteria | 1527 |
| 155 | Ga0105237_10163828 | 3300009545 | Bacteria | 2222 |
| 156 | Ga0105238_10074040 | 3300009551 | Bacteria | 3399 |
| 157 | Ga0105238_10177560 | 3300009551 | Bacteria | 2106 |
| 158 | Ga0105249_10068969 | 3300009553 | Bacteria | 3263 |
| 159 | Ga0105239_10075123 | 3300010375 | Bacteria | 3715 |
| 160 | Ga0105239_10089511 | 3300010375 | Bacteria | 3394 |
| 161 | Ga0105239_10214163 | 3300010375 | Bacteria | 2159 |
| 162 | Ga0105239_10290755 | 3300010375 | Bacteria | 1840 |
| 163 | Ga0105239_10365033 | 3300010375 | Bacteria | 1631 |
| 164 | Ga0105246_10032074 | 3300011119 | Bacteria | 3481 |
| 165 | Ga0157370_10023801 | 3300013104 | Bacteria | 6076 |
| 166 | Ga0157370_10059485 | 3300013104 | Bacteria | 3631 |
| 167 | Ga0157369_10198380 | 3300013105 | Bacteria | 2107 |
| 168 | Ga0171462_1012 | 3300013250 | Bacteria | 208216 |
| 169 | Ga0157374_10495097 | 3300013296 | Bacteria | 1226 |
| 170 | Ga0157375_10073454 | 3300013308 | Bacteria | 3439 |
| 171 | Ga0157375_10097352 | 3300013308 | Bacteria | 3017 |
| 172 | Ga0163163_10101915 | 3300014325 | Bacteria | 2893 |
| 173 | Ga0163163_10153044 | 3300014325 | Bacteria | 2349 |
| 174 | Ga0163163_10322886 | 3300014325 | Bacteria | 1597 |
| 175 | Ga0157380_10159845 | 3300014326 | Bacteria | 1957 |
| 176 | Ga0157377_10017758 | 3300014745 | Bacteria | 3686 |
| 177 | Ga0157379_10296581 | 3300014968 | Bacteria | 1473 |
| 178 | Ga0157379_10474188 | 3300014968 | Bacteria | 1158 |
| 179 | Ga0157376_10155978 | 3300014969 | Bacteria | 2064 |
| 180 | Ga0214544_1000005 | 3300021320 | Bacteria | 387675 |
| 181 | Ga0214542_1000004 | 3300021321 | Bacteria | 415597 |
| 182 | Ga0214545_1000005 | 3300021324 | Bacteria | 415590 |
| 183 | Ga0214543_1000564 | 3300021327 | Bacteria | 63531 |
| 184 | Ga0213873_10006356 | 3300021358 | Bacteria | 2321 |
| 185 | Ga0213874_10003165 | 3300021377 | Bacteria | 3626 |
| 186 | Ga0213876_10009074 | 3300021384 | Bacteria | 5355 |
| 187 | Ga0213876_10064040 | 3300021384 | Bacteria | 1941 |
| 188 | Ga0213875_10001033 | 3300021388 | Bacteria | 19652 |
| 189 | Ga0213875_10003029 | 3300021388 | Bacteria | 9747 |
| 190 | Ga0213875_10004683 | 3300021388 | Bacteria | 7452 |
| 191 | Ga0213875_10006053 | 3300021388 | Bacteria | 6406 |
| 192 | Ga0213875_10007237 | 3300021388 | Bacteria | 5755 |
| 193 | Ga0209677_101562 | 3300025253 | Bacteria | 9737 |
| 194 | Ga0209148_1000367 | 3300025254 | Bacteria | 55809 |
| 195 | Ga0209673_1015067 | 3300025273 | Bacteria | 2957 |
| 196 | Ga0209130_1000209 | 3300025284 | Bacteria | 78300 |
| 197 | Ga0209025_1000017 | 3300025294 | Bacteria | 768983 |
| 198 | Ga0209025_1003934 | 3300025294 | Bacteria | 13351 |
| 199 | Ga0209025_1030103 | 3300025294 | Bacteria | 2607 |
| 200 | Ga0209564_1000031 | 3300025295 | Bacteria | 494703 |
| 201 | Ga0209564_1002546 | 3300025295 | Bacteria | 14040 |
| 202 | Ga0209758_1000102 | 3300025297 | Bacteria | 224851 |
| 203 | Ga0209758_1000732 | 3300025297 | Bacteria | 48005 |
| 204 | Ga0209758_1004116 | 3300025297 | Bacteria | 12460 |
| 205 | Ga0209758_1006909 | 3300025297 | Bacteria | 7927 |
| 206 | Ga0209758_1007061 | 3300025297 | Bacteria | 7787 |
| 207 | Ga0209758_1021066 | 3300025297 | Bacteria | 3054 |
| 208 | Ga0209758_1022195 | 3300025297 | Bacteria | 2923 |
| 209 | Ga0209256_1000033 | 3300025299 | Bacteria | 393924 |
| 210 | Ga0209256_1000181 | 3300025299 | Bacteria | 123624 |
| 211 | Ga0209256_1002569 | 3300025299 | Bacteria | 14499 |
| 212 | Ga0209256_1023170 | 3300025299 | Bacteria | 1859 |
| 213 | Ga0207426_1000354 | 3300025302 | Bacteria | 83734 |
| 214 | Ga0207426_1000521 | 3300025302 | Bacteria | 55976 |
| 215 | Ga0207426_1019010 | 3300025302 | Bacteria | 2410 |
| 216 | Ga0209257_1001340 | 3300025304 | Bacteria | 29845 |
| 217 | Ga0207692_10067322 | 3300025898 | Bacteria | 1874 |
| 218 | Ga0207710_10086764 | 3300025900 | Bacteria | 1459 |
| 219 | Ga0207688_10110378 | 3300025901 | Bacteria | 1596 |
| 220 | Ga0207688_10110951 | 3300025901 | Bacteria | 1592 |
| 221 | Ga0207685_10019898 | 3300025905 | Bacteria | 2220 |
| 222 | Ga0207699_10022267 | 3300025906 | Bacteria | 3431 |
| 223 | Ga0207699_10036133 | 3300025906 | Bacteria | 2814 |
| 224 | Ga0207643_10039276 | 3300025908 | Bacteria | 2662 |
| 225 | Ga0207684_10137561 | 3300025910 | Bacteria | 2098 |
| 226 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 227 | Ga0207695_10279906 | 3300025913 | Bacteria | 1562 |
| 228 | Ga0207671_10014045 | 3300025914 | Bacteria | 6350 |
| 229 | Ga0207693_10010582 | 3300025915 | Bacteria | 7485 |
| 230 | Ga0207693_10131009 | 3300025915 | Bacteria | 1971 |
| 231 | Ga0207693_10135623 | 3300025915 | Bacteria | 1935 |
| 232 | Ga0207663_10105062 | 3300025916 | Bacteria | 1905 |
| 233 | Ga0207657_10022030 | 3300025919 | Bacteria | 5983 |
| 234 | Ga0207657_10060743 | 3300025919 | Bacteria | 3243 |
| 235 | Ga0207657_10165466 | 3300025919 | Bacteria | 1794 |
| 236 | Ga0207657_10314873 | 3300025919 | Bacteria | 1238 |
| 237 | Ga0207649_10085137 | 3300025920 | Bacteria | 2057 |
| 238 | Ga0207652_10025038 | 3300025921 | Bacteria | 4958 |
| 239 | Ga0207652_10075415 | 3300025921 | Bacteria | 2939 |
| 240 | Ga0207646_10148962 | 3300025922 | Bacteria | 2110 |
| 241 | Ga0207694_10133485 | 3300025924 | Bacteria | 1991 |
| 242 | Ga0207694_10314015 | 3300025924 | Bacteria | 1292 |
| 243 | Ga0207687_10035517 | 3300025927 | Bacteria | 3390 |
| 244 | Ga0207687_10071054 | 3300025927 | Bacteria | 2486 |
| 245 | Ga0207700_10010378 | 3300025928 | Bacteria | 5873 |
| 246 | Ga0207700_10415950 | 3300025928 | Bacteria | 1180 |
| 247 | Ga0207664_10075358 | 3300025929 | Bacteria | 2728 |
| 248 | Ga0207706_10091630 | 3300025933 | Bacteria | 2672 |
| 249 | Ga0207709_10103518 | 3300025935 | Bacteria | 1887 |
| 250 | Ga0207669_10107806 | 3300025937 | Bacteria | 1859 |
| 251 | Ga0207704_10236102 | 3300025938 | Bacteria | 1363 |
| 252 | Ga0207704_10268073 | 3300025938 | Bacteria | 1291 |
| 253 | Ga0207665_10117331 | 3300025939 | Bacteria | 1877 |
| 254 | Ga0207691_10271155 | 3300025940 | Bacteria | 1461 |
| 255 | Ga0207691_10332186 | 3300025940 | Bacteria | 1302 |
| 256 | Ga0207711_10092919 | 3300025941 | Bacteria | 2656 |
| 257 | Ga0207661_10001876 | 3300025944 | Bacteria | 14409 |
| 258 | Ga0207661_10125207 | 3300025944 | Bacteria | 2194 |
| 259 | Ga0207679_10018807 | 3300025945 | Bacteria | 4635 |
| 260 | Ga0207679_10104507 | 3300025945 | Bacteria | 2222 |
| 261 | Ga0207667_10151422 | 3300025949 | Bacteria | 2387 |
| 262 | Ga0207667_10315544 | 3300025949 | Bacteria | 1597 |
| 263 | Ga0207667_10530269 | 3300025949 | Bacteria | 1192 |
| 264 | Ga0207651_10086245 | 3300025960 | Bacteria | 2281 |
| 265 | Ga0207712_10103795 | 3300025961 | Bacteria | 2118 |
| 266 | Ga0207668_10288281 | 3300025972 | Bacteria | 1349 |
| 267 | Ga0207640_10078190 | 3300025981 | Bacteria | 2251 |
| 268 | Ga0207640_10091170 | 3300025981 | Bacteria | 2111 |
| 269 | Ga0207677_10012388 | 3300026023 | Bacteria | 4900 |
| 270 | Ga0207703_10028003 | 3300026035 | Bacteria | 4437 |
| 271 | Ga0207703_10258870 | 3300026035 | Bacteria | 1572 |
| 272 | Ga0207703_10345365 | 3300026035 | Bacteria | 1369 |
| 273 | Ga0207639_10179965 | 3300026041 | Bacteria | 1798 |
| 274 | Ga0207678_10016363 | 3300026067 | Bacteria | 6512 |
| 275 | Ga0207678_10032802 | 3300026067 | Bacteria | 4526 |
| 276 | Ga0207678_10059021 | 3300026067 | Bacteria | 3301 |
| 277 | Ga0207678_10127113 | 3300026067 | Bacteria | 2174 |
| 278 | Ga0207702_10000325 | 3300026078 | Bacteria | 54690 |
| 279 | Ga0207702_10030533 | 3300026078 | Bacteria | 4491 |
| 280 | Ga0207702_10155367 | 3300026078 | Bacteria | 2085 |
| 281 | Ga0207702_10313442 | 3300026078 | Bacteria | 1492 |
| 282 | Ga0207641_10166993 | 3300026088 | Bacteria | 2005 |
| 283 | Ga0207648_10393146 | 3300026089 | Bacteria | 1255 |
| 284 | Ga0207674_10110649 | 3300026116 | Bacteria | 2722 |
| 285 | Ga0207683_10042482 | 3300026121 | Bacteria | 3971 |
| 286 | Ga0207683_10052354 | 3300026121 | Bacteria | 3576 |
| 287 | Ga0207683_10099071 | 3300026121 | Bacteria | 2601 |
| 288 | Ga0207698_10005512 | 3300026142 | Bacteria | 7828 |
| 289 | Ga0207698_10033601 | 3300026142 | Bacteria | 3729 |
| 290 | Ga0209389_1000021 | 3300027296 | Bacteria | 169506 |
| 291 | Ga0209389_1000086 | 3300027296 | Bacteria | 84925 |
| 292 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 293 | Ga0209589_1000027 | 3300027357 | Bacteria | 155295 |
| 294 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 295 | Ga0209489_100313 | 3300027361 | Bacteria | 85507 |
| 296 | Ga0209489_105143 | 3300027361 | Bacteria | 23183 |
| 297 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 298 | Ga0209700_100483 | 3300027363 | Bacteria | 74857 |
| 299 | Ga0209588_1016301 | 3300027671 | Bacteria | 2293 |
| 300 | Ga0207428_10121684 | 3300027907 | Bacteria | 2001 |
| 301 | Ga0207428_10122668 | 3300027907 | Bacteria | 1992 |
| 302 | Ga0268266_10015155 | 3300028379 | Bacteria | 6618 |
| 303 | Ga0268266_10018333 | 3300028379 | Bacteria | 5966 |
| 304 | Ga0268266_10026503 | 3300028379 | Bacteria | 4932 |
| 305 | Ga0268266_10128844 | 3300028379 | Bacteria | 2261 |
| 306 | Ga0268266_10143467 | 3300028379 | Bacteria | 2145 |
| 307 | Ga0268264_10113998 | 3300028381 | Bacteria | 2372 |
| 308 | Ga0268264_10180154 | 3300028381 | Bacteria | 1918 |
| 309 | Ga0307515_10021681 | 3300028794 | Bacteria | 11371 |
| 310 | Ga0307513_10320295 | 3300031456 | Bacteria | 1309 |
| 311 | Ga0307509_10145855 | 3300031507 | Bacteria | 2293 |
| 312 | Ga0307408_100046459 | 3300031548 | Bacteria | 3106 |
| 313 | Ga0307516_10016844 | 3300031730 | Bacteria | 7630 |
| 314 | Ga0307516_10023182 | 3300031730 | Bacteria | 6367 |
| 315 | Ga0307412_10122930 | 3300031911 | Bacteria | 1872 |
| 316 | Ga0307409_100293167 | 3300031995 | Bacteria | 1509 |
| 317 | Ga0307510_10035866 | 3300033180 | Bacteria | 5530 |
| 318 | Ga0307510_10067387 | 3300033180 | Bacteria | 3604 |
| 319 | Ga0315911_1000040 | 3300033442 | Bacteria | 50766 |
| 320 | Ga0373926_0015173 | 3300035083 | Bacteria | 2625 |
| 321 | Ga0373923_0012011 | 3300035111 | Bacteria | 3191 |
| 322 | Ga0373923_0018161 | 3300035111 | Bacteria | 2702 |
| 323 | Ga0373936_0005491 | 3300035113 | Bacteria | 4783 |
| 324 | Ga0373936_0163871 | 3300035113 | Bacteria | 969 |
| 325 | Ga0373954_0020662 | 3300035118 | Bacteria | 2980 |
| 326 | Ga0373943_0019790 | 3300035170 | Bacteria | 3099 |
| 327 | Ga0373955_0051944 | 3300035172 | Bacteria | 2234 |
| 328 | Ga0373935_0108905 | 3300035692 | Bacteria | 1836 |
| 329 | Ga0373935_0127238 | 3300035692 | Bacteria | 1708 |
| 330 | Ga0373927_0002111 | 3300035695 | Bacteria | 14657 |
| 331 | Ga0373927_0095269 | 3300035695 | Bacteria | 1934 |
| 332 | Ga0373927_0111572 | 3300035695 | Bacteria | 1782 |
| 333 | Ga0373933_0067749 | 3300035724 | Bacteria | 2166 |
| 334 | Ga0373947_0057121 | 3300035725 | Bacteria | 2360 |
| 335 | Ga0373937_0191104 | 3300036401 | Bacteria | 1924 |
| 336 | Ga0373925_0119797 | 3300037068 | Bacteria | 2042 |
| 337 | Ga0395900_0003232 | 3300037418 | Bacteria | 17642 |
| 338 | Ga0395900_0008561 | 3300037418 | Bacteria | 10519 |
| 339 | Ga0395900_0029800 | 3300037418 | Bacteria | 5601 |
| 340 | Ga0395900_0121556 | 3300037418 | Bacteria | 2679 |
| 341 | Ga0395898_0007511 | 3300037466 | Bacteria | 11584 |
| 342 | Ga0395898_0009099 | 3300037466 | Bacteria | 10459 |
| 343 | Ga0395898_0147177 | 3300037466 | Bacteria | 2254 |
| 344 | Ga0395905_0002158 | 3300037471 | Bacteria | 22308 |
| 345 | Ga0436364_0063930 | 3300037853 | Bacteria | 4672 |
| 346 | Ga0436364_0103156 | 3300037853 | Bacteria | 17490 |
| 347 | Ga0436364_0533917 | 3300037853 | Bacteria | 9986 |
| 348 | Ga0436364_0601659 | 3300037853 | Bacteria | 2760 |
| 349 | Ga0436364_0623979 | 3300037853 | Bacteria | 1827 |
| 350 | Ga0436364_0642169 | 3300037853 | Bacteria | 25731 |
| 351 | Ga0436364_0659865 | 3300037853 | Bacteria | 47070 |
| 352 | Ga0436364_0674187 | 3300037853 | Bacteria | 9456 |
| 353 | Ga0436364_0831688 | 3300037853 | Bacteria | 1784 |
| 354 | Ga0436364_1379234 | 3300037853 | Bacteria | 5061 |
| 355 | Ga0436364_1558822 | 3300037853 | Bacteria | 1898 |
| 356 | Ga0395901_0011181 | 3300038443 | Bacteria | 9096 |
| 357 | Ga0395901_0012192 | 3300038443 | Bacteria | 8723 |
| 358 | Ga0395901_0044480 | 3300038443 | Bacteria | 4606 |
| 359 | Ga0395901_0358781 | 3300038443 | Bacteria | 1503 |
| 360 | Ga0395901_0444016 | 3300038443 | Bacteria | 1327 |
| 361 | Ga0436365_0138565 | 3300039437 | Bacteria | 8501 |
| 362 | Ga0436365_0481731 | 3300039437 | Bacteria | 2890 |
| 363 | Ga0436365_0879300 | 3300039437 | Bacteria | 3197 |
| 364 | Ga0436365_1246836 | 3300039437 | Bacteria | 2599 |
| 365 | Ga0436365_1339798 | 3300039437 | Bacteria | 2368 |
| 366 | Ga0436365_1453543 | 3300039437 | Bacteria | 3621 |
| 367 | Ga0436365_1535876 | 3300039437 | Bacteria | 20439 |
| 368 | Ga0436365_1736919 | 3300039437 | Bacteria | 6655 |
| 369 | Ga0436360_0178193 | 3300039438 | Bacteria | 6576 |
| 370 | Ga0436361_0606306 | 3300039447 | Bacteria | 2508 |
| 371 | Ga0436363_0282535 | 3300039450 | Bacteria | 16541 |
| 372 | Ga0436363_0472610 | 3300039450 | Bacteria | 6308 |
| 373 | Ga0436363_0839057 | 3300039450 | Bacteria | 2212 |
| 374 | Ga0436363_1333206 | 3300039450 | Bacteria | 1028 |
| 375 | Ga0436363_1477180 | 3300039450 | Bacteria | 2712 |
| 376 | Ga0436362_0822437 | 3300039453 | Bacteria | 5872 |
| 377 | Ga0439461_0033868 | 3300041410 | Bacteria | 1077 |
| 378 | Ga0439465_0053312 | 3300041413 | Bacteria | 1328 |
| 379 | Ga0451807_0299519 | 3300041486 | Bacteria | 1391 |
| 380 | Ga0466969_0039103 | 3300044656 | Bacteria | 2384 |
| 381 | Ga0466972_0000266 | 3300044658 | Bacteria | 33408 |
| 382 | Ga0466972_0002615 | 3300044658 | Bacteria | 8923 |
| 383 | Ga0466965_0031828 | 3300044683 | Bacteria | 2574 |
| 384 | Ga0466966_0013523 | 3300044684 | Bacteria | 5403 |
| 385 | Ga0466961_0000172 | 3300044693 | Bacteria | 44200 |
| 386 | Ga0466963_0005504 | 3300044694 | Bacteria | 7413 |
| 387 | Ga0466963_0005645 | 3300044694 | Bacteria | 7346 |
| 388 | Ga0466963_0035553 | 3300044694 | Bacteria | 3246 |
| 389 | Ga0466964_0041684 | 3300044706 | Bacteria | 1858 |
| 390 | Ga0466968_0021379 | 3300044735 | Bacteria | 2620 |
| 391 | Ga0466957_0006661 | 3300044842 | Bacteria | 6532 |
| 392 | Ga0466957_0105284 | 3300044842 | Bacteria | 1783 |
| 393 | Ga0466960_0031566 | 3300044901 | Bacteria | 2446 |
| 394 | Ga0466959_0004055 | 3300045049 | Bacteria | 9744 |
| 395 | Ga0451576_0000231 | 3300045051 | Bacteria | 136040 |
| 396 | Ga0451576_0400232 | 3300045051 | Bacteria | 1440 |
| 397 | Ga0466958_0160827 | 3300045836 | Bacteria | 1419 |
| 398 | Ga0466967_0008224 | 3300045976 | Bacteria | 7620 |
| 399 | Ga0466967_0013600 | 3300045976 | Bacteria | 6297 |
| 400 | Ga0466967_0498387 | 3300045976 | Bacteria | 1195 |
| 401 | Ga0495592_0099056 | 3300046454 | Bacteria | 2080 |
| 402 | Ga0495603_0001315 | 3300046455 | Bacteria | 14430 |
| 403 | Ga0495603_0045157 | 3300046455 | Bacteria | 2628 |
| 404 | Ga0495629_0017140 | 3300046459 | Bacteria | 5196 |
| 405 | Ga0495638_0004161 | 3300046460 | Bacteria | 11032 |
| 406 | Ga0495638_0040440 | 3300046460 | Bacteria | 2955 |
| 407 | Ga0495638_0117956 | 3300046460 | Bacteria | 1570 |
| 408 | Ga0495651_0017859 | 3300046462 | Bacteria | 5492 |
| 409 | Ga0495651_0019144 | 3300046462 | Bacteria | 5304 |
| 410 | Ga0495580_0000514 | 3300046472 | Bacteria | 32568 |
| 411 | Ga0495580_0113791 | 3300046472 | Bacteria | 1879 |
| 412 | Ga0495582_0003610 | 3300046473 | Bacteria | 8716 |
| 413 | Ga0495582_0105771 | 3300046473 | Bacteria | 1578 |
| 414 | Ga0495639_0000101 | 3300046475 | Bacteria | 42348 |
| 415 | Ga0495662_0000117 | 3300046476 | Bacteria | 29710 |
| 416 | Ga0495664_0006748 | 3300046477 | Bacteria | 6348 |
| 417 | Ga0495664_0014068 | 3300046477 | Bacteria | 4533 |
| 418 | Ga0495664_0058826 | 3300046477 | Bacteria | 2287 |
| 419 | Ga0495584_0075183 | 3300046491 | Bacteria | 1698 |
| 420 | Ga0495585_0116629 | 3300046492 | Bacteria | 1416 |
| 421 | Ga0495594_0000083 | 3300046499 | Bacteria | 42703 |
| 422 | Ga0495594_0232242 | 3300046499 | Bacteria | 1051 |
| 423 | Ga0495607_0081770 | 3300046501 | Bacteria | 1774 |
| 424 | Ga0495583_0110714 | 3300046506 | Bacteria | 1164 |
| 425 | Ga0495606_0004349 | 3300046507 | Bacteria | 14214 |
| 426 | Ga0495606_0060549 | 3300046507 | Bacteria | 2424 |
| 427 | Ga0495606_0088765 | 3300046507 | Bacteria | 1905 |
| 428 | Ga0495608_0003835 | 3300046511 | Bacteria | 10806 |
| 429 | Ga0495610_0051064 | 3300046512 | Bacteria | 2015 |
| 430 | Ga0495618_0059561 | 3300046514 | Bacteria | 2420 |
| 431 | Ga0495628_0012656 | 3300046516 | Bacteria | 7108 |
| 432 | Ga0495630_0001944 | 3300046517 | Bacteria | 14381 |
| 433 | Ga0495632_0107665 | 3300046519 | Bacteria | 1310 |
| 434 | Ga0495632_0112071 | 3300046519 | Bacteria | 1280 |
| 435 | Ga0495643_0029682 | 3300046522 | Bacteria | 3058 |
| 436 | Ga0495648_0158237 | 3300046524 | Bacteria | 1174 |
| 437 | Ga0495666_0060141 | 3300046526 | Bacteria | 1816 |
| 438 | Ga0495652_0015106 | 3300046529 | Bacteria | 6917 |
| 439 | Ga0495652_0029484 | 3300046529 | Bacteria | 4820 |
| 440 | Ga0495665_0000055 | 3300046531 | Bacteria | 45208 |
| 441 | Ga0495640_0002279 | 3300046533 | Bacteria | 15390 |
| 442 | Ga0495586_0150763 | 3300046535 | Bacteria | 1308 |
| 443 | Ga0495609_0065035 | 3300046538 | Bacteria | 1608 |
| 444 | Ga0495621_0028933 | 3300046539 | Bacteria | 1886 |
| 445 | Ga0495645_0027914 | 3300046543 | Bacteria | 4100 |
| 446 | Ga0495645_0035625 | 3300046543 | Bacteria | 3627 |
| 447 | Ga0495645_0198010 | 3300046543 | Bacteria | 1365 |
| 448 | Ga0495622_0011851 | 3300046557 | Bacteria | 4031 |
| 449 | Ga0495622_0123777 | 3300046557 | Bacteria | 1180 |
| 450 | Ga0495633_0092098 | 3300046558 | Bacteria | 1409 |
| 451 | Ga0495667_0003327 | 3300046559 | Bacteria | 10762 |
| 452 | Ga0495656_0022359 | 3300046615 | Bacteria | 2475 |
| 453 | Ga0495668_0243084 | 3300046616 | Bacteria | 985 |
| 454 | Ga0495634_0000720 | 3300046642 | Bacteria | 32017 |
| 455 | Ga0495634_0013784 | 3300046642 | Bacteria | 5838 |
| 456 | Ga0495611_0060615 | 3300046648 | Bacteria | 1719 |
| 457 | Ga0495625_0074182 | 3300046660 | Bacteria | 2383 |
| 458 | Ga0495625_0220134 | 3300046660 | Bacteria | 1244 |
| 459 | Ga0495635_0004704 | 3300046663 | Bacteria | 9483 |
| 460 | Ga0495635_0042909 | 3300046663 | Bacteria | 3122 |
| 461 | Ga0495635_0045446 | 3300046663 | Bacteria | 3030 |
| 462 | Ga0495659_0028941 | 3300046664 | Bacteria | 1920 |
| 463 | Ga0495588_0004531 | 3300046674 | Bacteria | 6144 |
| 464 | Ga0495588_0024877 | 3300046674 | Bacteria | 2978 |
| 465 | Ga0495588_0039281 | 3300046674 | Bacteria | 2410 |
| 466 | Ga0495599_0008275 | 3300046678 | Bacteria | 6323 |
| 467 | Ga0495599_0029287 | 3300046678 | Bacteria | 3451 |
| 468 | Ga0495599_0173750 | 3300046678 | Bacteria | 1329 |
| 469 | Ga0495646_0009997 | 3300046680 | Bacteria | 6032 |
| 470 | Ga0495647_0010156 | 3300046681 | Bacteria | 3201 |
| 471 | Ga0495647_0072458 | 3300046681 | Bacteria | 1382 |
| 472 | Ga0495658_0001206 | 3300046683 | Bacteria | 13594 |
| 473 | Ga0495613_0128172 | 3300046689 | Bacteria | 1818 |
| 474 | Ga0495624_0001822 | 3300046690 | Bacteria | 16263 |
| 475 | Ga0495671_0052978 | 3300046692 | Bacteria | 2015 |
| 476 | Ga0495600_0033814 | 3300046809 | Bacteria | 3319 |
| 477 | Ga0495600_0120154 | 3300046809 | Bacteria | 1709 |
| 478 | Ga0495600_0154096 | 3300046809 | Bacteria | 1487 |
| 479 | Ga0495581_0000041 | 3300047315 | Bacteria | 46518 |
| 480 | Ga0495581_0020587 | 3300047315 | Bacteria | 3827 |
| 481 | Ga0495581_0027606 | 3300047315 | Bacteria | 3292 |
| 482 | Ga0495581_0112206 | 3300047315 | Bacteria | 1585 |
| 483 | Ga0495604_0009181 | 3300047317 | Bacteria | 7826 |
| 484 | Ga0495674_0007683 | 3300047319 | Bacteria | 10298 |
| 485 | Ga0495674_0024255 | 3300047319 | Bacteria | 5575 |
| 486 | Ga0495674_0030974 | 3300047319 | Bacteria | 4861 |
| 487 | Ga0495674_0101026 | 3300047319 | Bacteria | 2454 |
| 488 | Ga0495672_0007300 | 3300047320 | Bacteria | 8336 |
| 489 | Ga0495672_0011899 | 3300047320 | Bacteria | 6105 |
| 490 | Ga0495672_0033613 | 3300047320 | Bacteria | 3176 |
| 491 | Ga0495687_012044 | 3300047443 | Bacteria | 4598 |
| 492 | Ga0495675_0006818 | 3300047444 | Bacteria | 7006 |
| 493 | Ga0495673_0033572 | 3300047469 | Bacteria | 2380 |
| 494 | Ga0495684_0007286 | 3300047471 | Bacteria | 8572 |
| 495 | Ga0495684_0014082 | 3300047471 | Bacteria | 6151 |
| 496 | Ga0495684_0051088 | 3300047471 | Bacteria | 3156 |
| 497 | Ga0495684_0142581 | 3300047471 | Bacteria | 1796 |
| 498 | Ga0495593_0000024 | 3300047673 | Bacteria | 65718 |
| 499 | Ga0495602_0196729 | 3300048088 | Bacteria | 1541 |
| 500 | Ga0496100_0020009 | 3300048903 | Bacteria | 4006 |
| 501 | Ga0496101_0030168 | 3300048904 | Bacteria | 3799 |
| 502 | Ga0496101_0268151 | 3300048904 | Bacteria | 1332 |
| 503 | Ga0496102_0068588 | 3300048905 | Bacteria | 3254 |
| 504 | Ga0496102_0076537 | 3300048905 | Bacteria | 3078 |
| 505 | Ga0496102_0173241 | 3300048905 | Bacteria | 2031 |
| 506 | Ga0496104_0005208 | 3300048907 | Bacteria | 11372 |
| 507 | Ga0496104_0007795 | 3300048907 | Bacteria | 9490 |
| 508 | Ga0496104_0058381 | 3300048907 | Bacteria | 3652 |
| 509 | Ga0496104_0082985 | 3300048907 | Bacteria | 3056 |
| 510 | Ga0496105_0028872 | 3300048908 | Bacteria | 4538 |
| 511 | Ga0496105_0080570 | 3300048908 | Bacteria | 2689 |
| 512 | Ga0496106_0076391 | 3300048909 | Bacteria | 2567 |
| 513 | Ga0496106_0162042 | 3300048909 | Bacteria | 1769 |
| 514 | Ga0496107_0015042 | 3300048910 | Bacteria | 5421 |
| 515 | Ga0496107_0265811 | 3300048910 | Bacteria | 1276 |
| 516 | Ga0496108_0007612 | 3300048911 | Bacteria | 8769 |
| 517 | Ga0496108_0051120 | 3300048911 | Bacteria | 3462 |
| 518 | Ga0496108_0069747 | 3300048911 | Bacteria | 2966 |
| 519 | Ga0496108_0087600 | 3300048911 | Bacteria | 2644 |
| 520 | Ga0496109_0021076 | 3300048912 | Bacteria | 5763 |
| 521 | Ga0496109_0087818 | 3300048912 | Bacteria | 2872 |
| 522 | Ga0496109_0214121 | 3300048912 | Bacteria | 1812 |
| 523 | Ga0496110_0205528 | 3300048913 | Bacteria | 1790 |
| 524 | Ga0496110_0269712 | 3300048913 | Bacteria | 1549 |
| 525 | Ga0496111_0032362 | 3300048914 | Bacteria | 3728 |
| 526 | Ga0496112_0000015 | 3300048915 | Bacteria | 206423 |
| 527 | Ga0496112_0012721 | 3300048915 | Bacteria | 7738 |
| 528 | Ga0496112_0089225 | 3300048915 | Bacteria | 3051 |
| 529 | Ga0496113_0055604 | 3300048916 | Bacteria | 2967 |
| 530 | Ga0496113_0058727 | 3300048916 | Bacteria | 2895 |
| 531 | Ga0496113_0334073 | 3300048916 | Bacteria | 1215 |
| 532 | Ga0496114_0019685 | 3300048917 | Bacteria | 5470 |
| 533 | Ga0496115_0002706 | 3300048918 | Bacteria | 12727 |
| 534 | Ga0496115_0088858 | 3300048918 | Bacteria | 2523 |
| 535 | Ga0496115_0186680 | 3300048918 | Bacteria | 1713 |
| 536 | Ga0496115_0348319 | 3300048918 | Bacteria | 1208 |
| 537 | Ga0496116_0071172 | 3300048919 | Bacteria | 2203 |
| 538 | Ga0496117_0199209 | 3300048920 | Bacteria | 1133 |
| 539 | Ga0496119_0012116 | 3300048922 | Bacteria | 7041 |
| 540 | Ga0496120_0086090 | 3300048923 | Bacteria | 1690 |
| 541 | Ga0496121_0000406 | 3300048924 | Bacteria | 85761 |
| 542 | Ga0496121_0066126 | 3300048924 | Bacteria | 2937 |
| 543 | Ga0496121_0071470 | 3300048924 | Bacteria | 2790 |
| 544 | Ga0496121_0151132 | 3300048924 | Bacteria | 1708 |
| 545 | Ga0496122_0065829 | 3300048925 | Bacteria | 2624 |
| 546 | Ga0496122_0104543 | 3300048925 | Bacteria | 1881 |
| 547 | Ga0496123_0088520 | 3300048926 | Bacteria | 1848 |
| 548 | Ga0496123_0111861 | 3300048926 | Bacteria | 1559 |
| 549 | Ga0496124_0118113 | 3300048927 | Bacteria | 2123 |
| 550 | Ga0496125_0093408 | 3300048928 | Bacteria | 2245 |
| 551 | Ga0496126_0021020 | 3300048929 | Bacteria | 6387 |
| 552 | Ga0496126_0024395 | 3300048929 | Bacteria | 5840 |
| 553 | Ga0496126_0046669 | 3300048929 | Bacteria | 3970 |
| 554 | Ga0496126_0061739 | 3300048929 | Bacteria | 3365 |
| 555 | Ga0496126_0085214 | 3300048929 | Bacteria | 2786 |
| 556 | Ga0501034_0022087 | 3300049571 | Bacteria | 6482 |
| 557 | Ga0501043_0067753 | 3300049579 | Bacteria | 2803 |
| 558 | Ga0501046_0019753 | 3300049580 | Bacteria | 5583 |
| 559 | Ga0501047_0032125 | 3300049581 | Bacteria | 5066 |
| 560 | Ga0501047_0203035 | 3300049581 | Bacteria | 1842 |
| 561 | Ga0501068_0008897 | 3300049584 | Bacteria | 5602 |
| 562 | Ga0501070_0117503 | 3300049586 | Bacteria | 2197 |
| 563 | Ga0501071_0030318 | 3300049587 | Bacteria | 3825 |
| 564 | Ga0501075_0209857 | 3300049591 | Bacteria | 1486 |
| 565 | Ga0501080_0014452 | 3300049742 | Bacteria | 7272 |
| 566 | Ga0501044_0018528 | 3300049823 | Bacteria | 7459 |
| 567 | Ga0501044_0029495 | 3300049823 | Bacteria | 5784 |
| 568 | Ga0501044_0072326 | 3300049823 | Bacteria | 3506 |
| 569 | Ga0501044_0107423 | 3300049823 | Bacteria | 2802 |
| 570 | nmdc:mga03683_19961_c1 | 3300050489 | Bacteria | 2565 |
| 571 | nmdc:mga03683_21707_c1 | 3300050489 | Bacteria | 2480 |
| 572 | nmdc:mga03n38_1055_c1 | 3300050490 | Bacteria | 7595 |
| 573 | nmdc:mga03n38_10745_c1 | 3300050490 | Bacteria | 3383 |
| 574 | nmdc:mga03n38_28573_c1 | 3300050490 | Bacteria | 2326 |
| 575 | nmdc:mga03n38_51920_c1 | 3300050490 | Bacteria | 1833 |
| 576 | nmdc:mga00v17_107902_c1 | 3300050491 | Bacteria | 1764 |
| 577 | nmdc:mga00v17_31246_c1 | 3300050491 | Bacteria | 3139 |
| 578 | nmdc:mga0yw44_14491_c1 | 3300050492 | Bacteria | 3843 |
| 579 | nmdc:mga0yw44_24043_c1 | 3300050492 | Bacteria | 3442 |
| 580 | nmdc:mga0yw44_24162_c1 | 3300050492 | Bacteria | 3435 |
| 581 | nmdc:mga0yw44_26989_c1 | 3300050492 | Bacteria | 3285 |
| 582 | nmdc:mga0yw44_316655_c1 | 3300050492 | Bacteria | 1047 |
| 583 | nmdc:mga0yw44_62806_c1 | 3300050492 | Bacteria | 2282 |
| 584 | nmdc:mga0yw44_7443_c1 | 3300050492 | Bacteria | 5387 |
| 585 | nmdc:mga06z11_11047_c1 | 3300050494 | Bacteria | 3876 |
| 586 | nmdc:mga06z11_6877_c1 | 3300050494 | Bacteria | 4652 |
| 587 | nmdc:mga06z11_69332_c1 | 3300050494 | Bacteria | 1861 |
| 588 | nmdc:mga04h51_31567_c1 | 3300050495 | Bacteria | 1675 |
| 589 | nmdc:mga07m45_169755_c1 | 3300050496 | Bacteria | 1268 |
| 590 | nmdc:mga07m45_5698_c1 | 3300050496 | Bacteria | 6228 |
| 591 | nmdc:mga05p37_106889_c1 | 3300050507 | Bacteria | 3443 |
| 592 | nmdc:mga05p37_3181_c1 | 3300050507 | Bacteria | 19102 |
| 593 | nmdc:mga05p37_410753_c1 | 3300050507 | Bacteria | 1270 |
| 594 | nmdc:mga09592_45885_c1 | 3300050508 | Bacteria | 3680 |
| 595 | nmdc:mga09592_53176_c1 | 3300050508 | Bacteria | 2063 |
| 596 | nmdc:mga09592_8656_c1 | 3300050508 | Bacteria | 8280 |
| 597 | nmdc:mga0qj67_101195_c1 | 3300050509 | Bacteria | 2323 |
| 598 | nmdc:mga0qj67_185567_c1 | 3300050509 | Bacteria | 1689 |
| 599 | nmdc:mga0qj67_5521_c1 | 3300050509 | Bacteria | 9244 |
| 600 | nmdc:mga06r32_12511_c1 | 3300050510 | Bacteria | 7658 |
| 601 | nmdc:mga06r32_3795_c1 | 3300050510 | Bacteria | 13525 |
| 602 | nmdc:mga06r32_4390_c1 | 3300050510 | Bacteria | 12611 |
| 603 | nmdc:mga08y16_149632_c1 | 3300050511 | Bacteria | 2427 |
| 604 | nmdc:mga08y16_204_c3 | 3300050511 | Bacteria | 8325 |
| 605 | nmdc:mga0rr50_502528_c1 | 3300050513 | Bacteria | 1031 |
| 606 | Ga0500635_0002338 | 3300053080 | Bacteria | 4684 |
| 607 | Ga0500578_0220828 | 3300053086 | Bacteria | 1152 |
| 608 | Ga0500643_000016 | 3300053087 | Bacteria | 309502 |
| 609 | Ga0500644_0121407 | 3300053088 | Bacteria | 1019 |
| 610 | Ga0500647_0022319 | 3300053091 | Bacteria | 2960 |
| 611 | Ga0500651_0011118 | 3300053093 | Bacteria | 5417 |
| 612 | Ga0500651_0141756 | 3300053093 | Bacteria | 1448 |
| 613 | Ga0500640_088921 | 3300053095 | Bacteria | 1297 |
| 614 | Ga0500641_0018213 | 3300053096 | Bacteria | 2638 |
| 615 | Ga0500554_001920 | 3300053102 | Bacteria | 4023 |
| 616 | Ga0500556_0005530 | 3300053104 | Bacteria | 3567 |
| 617 | Ga0500557_000058 | 3300053105 | Bacteria | 45990 |
| 618 | Ga0500569_006597 | 3300053109 | Bacteria | 2557 |
| 619 | Ga0500592_009756 | 3300053116 | Bacteria | 1527 |
| 620 | Ga0500595_001183 | 3300053119 | Bacteria | 14392 |
| 621 | Ga0500595_002181 | 3300053119 | Bacteria | 9945 |
| 622 | Ga0500595_002664 | 3300053119 | Bacteria | 8681 |
| 623 | Ga0500595_030904 | 3300053119 | Bacteria | 1800 |
| 624 | Ga0500642_0000151 | 3300053130 | Bacteria | 29364 |
| 625 | Ga0500642_0045614 | 3300053130 | Bacteria | 1913 |
| 626 | Ga0500658_0071732 | 3300053134 | Bacteria | 1463 |
| 627 | Ga0500568_0016475 | 3300053139 | Bacteria | 3285 |
| 628 | Ga0500589_058019 | 3300053147 | Bacteria | 1781 |
| 629 | Ga0500603_001115 | 3300053150 | Bacteria | 6276 |
| 630 | Ga0500616_0026790 | 3300053153 | Bacteria | 3187 |
| 631 | Ga0500616_0026922 | 3300053153 | Bacteria | 3178 |
| 632 | Ga0500620_065597 | 3300053155 | Bacteria | 1242 |
| 633 | Ga0500622_0044158 | 3300053156 | Bacteria | 2309 |
| 634 | Ga0500622_0076701 | 3300053156 | Bacteria | 1680 |
| 635 | Ga0500627_0117080 | 3300053158 | Bacteria | 1201 |
| 636 | Ga0500634_0202198 | 3300053161 | Bacteria | 871 |
| 637 | Ga0500638_009653 | 3300053162 | Bacteria | 4187 |
| 638 | Ga0500636_0000146 | 3300053177 | Bacteria | 37168 |
| 639 | Ga0500636_0001753 | 3300053177 | Bacteria | 11889 |
| 640 | Ga0500637_0000138 | 3300053178 | Bacteria | 26740 |
| 641 | Ga0500637_0002536 | 3300053178 | Bacteria | 8148 |
| 642 | Ga0500625_054324 | 3300053729 | Bacteria | 1840 |
| 643 | Ga0500645_018897 | 3300053730 | Bacteria | 2147 |
| 644 | Ga0500601_000523 | 3300053737 | Bacteria | 5788 |
| 645 | Ga0500661_000130 | 3300055283 | Bacteria | 12645 |
| 646 | Ga0587075_003396 | 3300059644 | Bacteria | 1773 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053161 | Ga0500634_0202198 | Ga0500634_0202198_23_859 | 278 |
| 2 | iso_pu_bacteria | 8019547302 | 8019551264 | 278 |
| 3 | iso_pu_bacteria | 2879110137 | 2879113819 | 284 |
| 4 | iso_pu_bacteria | 8006984368 | 8006991277 | 284 |
| 5 | iso_pu_bacteria | 8016530956 | 8016538082 | 284 |
| 6 | iso_pu_bacteria | 8016613128 | 8016620023 | 284 |
| 7 | iso_pu_bacteria | 8019668869 | 8019674980 | 284 |
| 8 | 3300050508 | nmdc:mga09592_53176_c1 | nmdc:mga09592_53176_c1_98_955 | 285 |
| 9 | 3300046558 | Ga0495633_0092098 | Ga0495633_0092098_533_1396 | 287 |
| 10 | 3300050496 | nmdc:mga07m45_169755_c1 | nmdc:mga07m45_169755_c1_389_1252 | 287 |
| 11 | 3300053088 | Ga0500644_0121407 | Ga0500644_0121407_139_1005 | 288 |
| 12 | 3300009148 | Ga0105243_10368374 | Ga0105243_103683742 | 296 |
| 13 | 3300053729 | Ga0500625_054324 | Ga0500625_054324_41_940 | 299 |
| 14 | 3300031456 | Ga0307513_10320295 | Ga0307513_103202952 | 300 |
| 15 | 3300048922 | Ga0496119_0012116 | Ga0496119_0012116_5701_6660 | 304 |
| 16 | 3300048925 | Ga0496122_0065829 | Ga0496122_0065829_171_1091 | 306 |
| 17 | 3300009093 | Ga0105240_10317934 | Ga0105240_103179342 | 307 |
| 18 | 3300009177 | Ga0105248_10207825 | Ga0105248_102078252 | 307 |
| 19 | 3300010375 | Ga0105239_10214163 | Ga0105239_102141632 | 307 |
| 20 | 3300041486 | Ga0451807_0299519 | Ga0451807_0299519_51_977 | 307 |
| 21 | 3300048907 | Ga0496104_0005208 | Ga0496104_0005208_10167_11090 | 307 |
| 22 | 3300048911 | Ga0496108_0087600 | Ga0496108_0087600_1635_2558 | 307 |
| 23 | 3300048913 | Ga0496110_0269712 | Ga0496110_0269712_145_1068 | 307 |
| 24 | 3300048916 | Ga0496113_0055604 | Ga0496113_0055604_1968_2891 | 307 |
| 25 | 3300050492 | nmdc:mga0yw44_316655_c1 | nmdc:mga0yw44_316655_c1_47_970 | 307 |
| 26 | 3300050494 | nmdc:mga06z11_69332_c1 | nmdc:mga06z11_69332_c1_853_1776 | 307 |
| 27 | 3300005937 | Ga0081455_10100081 | Ga0081455_101000811 | 308 |
| 28 | 3300005983 | Ga0081540_1003442 | Ga0081540_10034422 | 308 |
| 29 | 3300009147 | Ga0114129_10581912 | Ga0114129_105819122 | 308 |
| 30 | 3300011119 | Ga0105246_10032074 | Ga0105246_100320742 | 308 |
| 31 | 3300013308 | Ga0157375_10073454 | Ga0157375_100734541 | 308 |
| 32 | 3300037853 | Ga0436364_0623979 | Ga0436364_0623979_57_1013 | 308 |
| 33 | 3300046460 | Ga0495638_0040440 | Ga0495638_0040440_1688_2614 | 308 |
| 34 | 3300046460 | Ga0495638_0117956 | Ga0495638_0117956_202_1128 | 308 |
| 35 | 3300046491 | Ga0495584_0075183 | Ga0495584_0075183_482_1408 | 308 |
| 36 | 3300046519 | Ga0495632_0107665 | Ga0495632_0107665_279_1205 | 308 |
| 37 | 3300046519 | Ga0495632_0112071 | Ga0495632_0112071_18_944 | 308 |
| 38 | 3300046524 | Ga0495648_0158237 | Ga0495648_0158237_107_1033 | 308 |
| 39 | 3300046535 | Ga0495586_0150763 | Ga0495586_0150763_248_1174 | 308 |
| 40 | 3300046538 | Ga0495609_0065035 | Ga0495609_0065035_148_1074 | 308 |
| 41 | 3300046539 | Ga0495621_0028933 | Ga0495621_0028933_332_1258 | 308 |
| 42 | 3300046557 | Ga0495622_0123777 | Ga0495622_0123777_178_1104 | 308 |
| 43 | 3300046616 | Ga0495668_0243084 | Ga0495668_0243084_43_969 | 308 |
| 44 | 3300046648 | Ga0495611_0060615 | Ga0495611_0060615_56_982 | 308 |
| 45 | 3300046660 | Ga0495625_0074182 | Ga0495625_0074182_176_1102 | 308 |
| 46 | 3300046660 | Ga0495625_0220134 | Ga0495625_0220134_244_1170 | 308 |
| 47 | 3300046664 | Ga0495659_0028941 | Ga0495659_0028941_512_1438 | 308 |
| 48 | 3300046674 | Ga0495588_0039281 | Ga0495588_0039281_795_1721 | 308 |
| 49 | 3300046681 | Ga0495647_0072458 | Ga0495647_0072458_327_1253 | 308 |
| 50 | 3300046692 | Ga0495671_0052978 | Ga0495671_0052978_509_1435 | 308 |
| 51 | 3300047320 | Ga0495672_0007300 | Ga0495672_0007300_6889_7815 | 308 |
| 52 | 3300048088 | Ga0495602_0196729 | Ga0495602_0196729_73_999 | 308 |
| 53 | 3300048903 | Ga0496100_0020009 | Ga0496100_0020009_1753_2679 | 308 |
| 54 | 3300048904 | Ga0496101_0030168 | Ga0496101_0030168_2233_3159 | 308 |
| 55 | 3300048905 | Ga0496102_0068588 | Ga0496102_0068588_272_1198 | 308 |
| 56 | 3300048907 | Ga0496104_0082985 | Ga0496104_0082985_144_1070 | 308 |
| 57 | 3300048908 | Ga0496105_0028872 | Ga0496105_0028872_141_1067 | 308 |
| 58 | 3300048909 | Ga0496106_0076391 | Ga0496106_0076391_128_1054 | 308 |
| 59 | 3300048910 | Ga0496107_0015042 | Ga0496107_0015042_283_1209 | 308 |
| 60 | 3300048911 | Ga0496108_0069747 | Ga0496108_0069747_133_1059 | 308 |
| 61 | 3300048912 | Ga0496109_0087818 | Ga0496109_0087818_1626_2552 | 308 |
| 62 | 3300048914 | Ga0496111_0032362 | Ga0496111_0032362_756_1682 | 308 |
| 63 | 3300048918 | Ga0496115_0002706 | Ga0496115_0002706_6632_7558 | 308 |
| 64 | 3300048924 | Ga0496121_0000406 | Ga0496121_0000406_19635_20561 | 308 |
| 65 | 3300048924 | Ga0496121_0071470 | Ga0496121_0071470_53_979 | 308 |
| 66 | 3300048927 | Ga0496124_0118113 | Ga0496124_0118113_725_1651 | 308 |
| 67 | 3300048929 | Ga0496126_0061739 | Ga0496126_0061739_1694_2620 | 308 |
| 68 | 3300050489 | nmdc:mga03683_19961_c1 | nmdc:mga03683_19961_c1_483_1409 | 308 |
| 69 | 3300053096 | Ga0500641_0018213 | Ga0500641_0018213_534_1460 | 308 |
| 70 | 3300053116 | Ga0500592_009756 | Ga0500592_009756_553_1479 | 308 |
| 71 | 3300053119 | Ga0500595_002664 | Ga0500595_002664_6468_7394 | 308 |
| 72 | 3300053147 | Ga0500589_058019 | Ga0500589_058019_168_1094 | 308 |
| 73 | 3300053158 | Ga0500627_0117080 | Ga0500627_0117080_131_1057 | 308 |
| 74 | 3300053730 | Ga0500645_018897 | Ga0500645_018897_1131_2057 | 308 |
| 75 | 3300021388 | Ga0213875_10004683 | Ga0213875_100046837 | 313 |
| 76 | 3300021388 | Ga0213875_10007237 | Ga0213875_100072374 | 313 |
| 77 | 3300035083 | Ga0373926_0015173 | Ga0373926_0015173_998_1939 | 313 |
| 78 | 3300035111 | Ga0373923_0018161 | Ga0373923_0018161_126_1067 | 313 |
| 79 | 3300035113 | Ga0373936_0163871 | Ga0373936_0163871_10_951 | 313 |
| 80 | 3300035118 | Ga0373954_0020662 | Ga0373954_0020662_1976_2917 | 313 |
| 81 | 3300035170 | Ga0373943_0019790 | Ga0373943_0019790_363_1304 | 313 |
| 82 | 3300035172 | Ga0373955_0051944 | Ga0373955_0051944_822_1763 | 313 |
| 83 | 3300035692 | Ga0373935_0108905 | Ga0373935_0108905_43_1017 | 313 |
| 84 | 3300035695 | Ga0373927_0095269 | Ga0373927_0095269_174_1115 | 313 |
| 85 | 3300035695 | Ga0373927_0111572 | Ga0373927_0111572_626_1567 | 313 |
| 86 | 3300035724 | Ga0373933_0067749 | Ga0373933_0067749_69_1010 | 313 |
| 87 | 3300035725 | Ga0373947_0057121 | Ga0373947_0057121_184_1125 | 313 |
| 88 | 3300037853 | Ga0436364_0533917 | Ga0436364_0533917_7681_8634 | 313 |
| 89 | 3300037853 | Ga0436364_0642169 | Ga0436364_0642169_16081_17052 | 313 |
| 90 | 3300045051 | Ga0451576_0400232 | Ga0451576_0400232_64_1017 | 313 |
| 91 | 3300046459 | Ga0495629_0017140 | Ga0495629_0017140_47_988 | 313 |
| 92 | 3300046472 | Ga0495580_0113791 | Ga0495580_0113791_80_1021 | 313 |
| 93 | 3300046477 | Ga0495664_0014068 | Ga0495664_0014068_3531_4472 | 313 |
| 94 | 3300046514 | Ga0495618_0059561 | Ga0495618_0059561_1458_2399 | 313 |
| 95 | 3300046526 | Ga0495666_0060141 | Ga0495666_0060141_757_1698 | 313 |
| 96 | 3300046543 | Ga0495645_0198010 | Ga0495645_0198010_245_1186 | 313 |
| 97 | 3300046642 | Ga0495634_0013784 | Ga0495634_0013784_2066_3007 | 313 |
| 98 | 3300046678 | Ga0495599_0173750 | Ga0495599_0173750_320_1261 | 313 |
| 99 | 3300046689 | Ga0495613_0128172 | Ga0495613_0128172_103_1044 | 313 |
| 100 | 3300047315 | Ga0495581_0020587 | Ga0495581_0020587_2165_3106 | 313 |
| 101 | 3300047319 | Ga0495674_0024255 | Ga0495674_0024255_4334_5275 | 313 |
| 102 | 3300047471 | Ga0495684_0014082 | Ga0495684_0014082_68_1009 | 313 |
| 103 | 3300049580 | Ga0501046_0019753 | Ga0501046_0019753_899_1840 | 313 |
| 104 | 3300049581 | Ga0501047_0032125 | Ga0501047_0032125_3214_4155 | 313 |
| 105 | 3300049586 | Ga0501070_0117503 | Ga0501070_0117503_1240_2181 | 313 |
| 106 | 3300049742 | Ga0501080_0014452 | Ga0501080_0014452_3712_4653 | 313 |
| 107 | 3300049823 | Ga0501044_0029495 | Ga0501044_0029495_3604_4545 | 313 |
| 108 | 3300050511 | nmdc:mga08y16_149632_c1 | nmdc:mga08y16_149632_c1_1119_2060 | 313 |
| 109 | iso_pu_bacteria | 2643221736 | 2644746171 | 313 |
| 110 | iso_pu_bacteria | 2841760612 | 2841766119 | 313 |
| 111 | iso_pu_bacteria | 2842775625 | 2842777251 | 313 |
| 112 | iso_pu_bacteria | 2844104063 | 2844105885 | 313 |
| 113 | iso_pu_bacteria | 2851182111 | 2851186383 | 313 |
| 114 | iso_pu_bacteria | 2851246043 | 2851246241 | 313 |
| 115 | iso_pu_bacteria | 2894772417 | 2894776639 | 313 |
| 116 | iso_pu_bacteria | 8057529695 | 8057531533 | 313 |
| 117 | 3300006846 | Ga0075430_100111696 | Ga0075430_1001116962 | 314 |
| 118 | 3300021388 | Ga0213875_10001033 | Ga0213875_1000103313 | 314 |
| 119 | 3300037853 | Ga0436364_0659865 | Ga0436364_0659865_18260_19216 | 314 |
| 120 | 3300039437 | Ga0436365_1453543 | Ga0436365_1453543_1882_2862 | 314 |
| 121 | 3300049823 | Ga0501044_0072326 | Ga0501044_0072326_373_1326 | 314 |
| 122 | 3300050509 | nmdc:mga0qj67_101195_c1 | nmdc:mga0qj67_101195_c1_840_1793 | 314 |
| 123 | iso_pu_bacteria | 2507262055 | 2507511394 | 314 |
| 124 | iso_pu_bacteria | 2508501009 | 2508545192 | 314 |
| 125 | iso_pu_bacteria | 2508501042 | 2508694028 | 314 |
| 126 | iso_pu_bacteria | 2511231028 | 2511398282 | 314 |
| 127 | iso_pu_bacteria | 2513237092 | 2513624129 | 314 |
| 128 | iso_pu_bacteria | 2513237094 | 2513641092 | 314 |
| 129 | iso_pu_bacteria | 2513237095 | 2513648516 | 314 |
| 130 | iso_pu_bacteria | 2513237096 | 2513656113 | 314 |
| 131 | iso_pu_bacteria | 2513237098 | 2513673469 | 314 |
| 132 | iso_pu_bacteria | 2513237101 | 2513696342 | 314 |
| 133 | iso_pu_bacteria | 2513237102 | 2513702640 | 314 |
| 134 | iso_pu_bacteria | 2513237104 | 2513717813 | 314 |
| 135 | iso_pu_bacteria | 2513237137 | 2513859009 | 314 |
| 136 | iso_pu_bacteria | 2513237139 | 2513874978 | 314 |
| 137 | iso_pu_bacteria | 2513237145 | 2513920878 | 314 |
| 138 | iso_pu_bacteria | 2513237161 | 2514013954 | 314 |
| 139 | iso_pu_bacteria | 2515154112 | 2515625026 | 314 |
| 140 | iso_pu_bacteria | 2517093001 | 2517101131 | 314 |
| 141 | iso_pu_bacteria | 2517572143 | 2517895934 | 314 |
| 142 | iso_pu_bacteria | 2524023205 | 2524439924 | 314 |
| 143 | iso_pu_bacteria | 2524023210 | 2524467491 | 314 |
| 144 | iso_pu_bacteria | 2524023228 | 2524534803 | 314 |
| 145 | iso_pu_bacteria | 2528768022 | 2528854012 | 314 |
| 146 | iso_pu_bacteria | 2617270735 | 2617348458 | 314 |
| 147 | iso_pu_bacteria | 2617270741 | 2617375002 | 314 |
| 148 | iso_pu_bacteria | 2643221733 | 2644730068 | 314 |
| 149 | iso_pu_bacteria | 2643221734 | 2644737380 | 314 |
| 150 | iso_pu_bacteria | 2667528175 | 2671122725 | 314 |
| 151 | iso_pu_bacteria | 2721755755 | 2723842841 | 314 |
| 152 | iso_pu_bacteria | 2728368998 | 2728752371 | 314 |
| 153 | iso_pu_bacteria | 2744054633 | 2745075794 | 314 |
| 154 | iso_pu_bacteria | 2791355196 | 2793061647 | 314 |
| 155 | iso_pu_bacteria | 2791355197 | 2793069640 | 314 |
| 156 | iso_pu_bacteria | 2791355199 | 2793080263 | 314 |
| 157 | iso_pu_bacteria | 2802429603 | 2805916434 | 314 |
| 158 | iso_pu_bacteria | 2816332527 | 2818240099 | 314 |
| 159 | iso_pu_bacteria | 2818991467 | 2819720106 | 314 |
| 160 | iso_pu_bacteria | 2824600985 | 2824608120 | 314 |
| 161 | iso_pu_bacteria | 2824609381 | 2824615712 | 314 |
| 162 | iso_pu_bacteria | 2824617872 | 2824625822 | 314 |
| 163 | iso_pu_bacteria | 2824626560 | 2824634616 | 314 |
| 164 | iso_pu_bacteria | 2824635225 | 2824642266 | 314 |
| 165 | iso_pu_bacteria | 2824644064 | 2824651495 | 314 |
| 166 | iso_pu_bacteria | 2824653114 | 2824660553 | 314 |
| 167 | iso_pu_bacteria | 2824661429 | 2824665451 | 314 |
| 168 | iso_pu_bacteria | 2824671348 | 2824678412 | 314 |
| 169 | iso_pu_bacteria | 2824679649 | 2824686225 | 314 |
| 170 | iso_pu_bacteria | 2824687955 | 2824694856 | 314 |
| 171 | iso_pu_bacteria | 2824696289 | 2824702798 | 314 |
| 172 | iso_pu_bacteria | 2824704595 | 2824709851 | 314 |
| 173 | iso_pu_bacteria | 2824714736 | 2824719561 | 314 |
| 174 | iso_pu_bacteria | 2824723954 | 2824731470 | 314 |
| 175 | iso_pu_bacteria | 2824732956 | 2824738916 | 314 |
| 176 | iso_pu_bacteria | 2824746037 | 2824752962 | 314 |
| 177 | iso_pu_bacteria | 2824753945 | 2824759982 | 314 |
| 178 | iso_pu_bacteria | 2824763712 | 2824769386 | 314 |
| 179 | iso_pu_bacteria | 2824773399 | 2824778992 | 314 |
| 180 | iso_pu_bacteria | 2838122688 | 2838129897 | 314 |
| 181 | iso_pu_bacteria | 2841941048 | 2841946937 | 314 |
| 182 | iso_pu_bacteria | 2841949485 | 2841955132 | 314 |
| 183 | iso_pu_bacteria | 2841957949 | 2841961548 | 314 |
| 184 | iso_pu_bacteria | 2841966195 | 2841970089 | 314 |
| 185 | iso_pu_bacteria | 2841974524 | 2841977267 | 314 |
| 186 | iso_pu_bacteria | 2841983080 | 2841990319 | 314 |
| 187 | iso_pu_bacteria | 2842038055 | 2842042317 | 314 |
| 188 | iso_pu_bacteria | 2842045827 | 2842050360 | 314 |
| 189 | iso_pu_bacteria | 2844315083 | 2844316520 | 314 |
| 190 | iso_pu_bacteria | 2847930680 | 2847939171 | 314 |
| 191 | iso_pu_bacteria | 2847939898 | 2847943880 | 314 |
| 192 | iso_pu_bacteria | 2849076700 | 2849081894 | 314 |
| 193 | iso_pu_bacteria | 2857509624 | 2857513618 | 314 |
| 194 | iso_pu_bacteria | 2874590934 | 2874594613 | 314 |
| 195 | iso_pu_bacteria | 2874604998 | 2874606490 | 314 |
| 196 | iso_pu_bacteria | 2874612657 | 2874615347 | 314 |
| 197 | iso_pu_bacteria | 2874620515 | 2874620646 | 314 |
| 198 | iso_pu_bacteria | 2874628541 | 2874633698 | 314 |
| 199 | iso_pu_bacteria | 2874645413 | 2874649658 | 314 |
| 200 | iso_pu_bacteria | 2876761206 | 2876766306 | 314 |
| 201 | iso_pu_bacteria | 2876771140 | 2876773745 | 314 |
| 202 | iso_pu_bacteria | 2876818435 | 2876820736 | 314 |
| 203 | iso_pu_bacteria | 2879074833 | 2879076938 | 314 |
| 204 | iso_pu_bacteria | 2879083081 | 2879090312 | 314 |
| 205 | iso_pu_bacteria | 2879099564 | 2879100837 | 314 |
| 206 | iso_pu_bacteria | 2879110137 | 2879113746 | 314 |
| 207 | iso_pu_bacteria | 2879127579 | 2879130274 | 314 |
| 208 | iso_pu_bacteria | 2879142872 | 2879146790 | 314 |
| 209 | iso_pu_bacteria | 2881364244 | 2881367303 | 314 |
| 210 | iso_pu_bacteria | 2881665667 | 2881668692 | 314 |
| 211 | iso_pu_bacteria | 2883577096 | 2883577391 | 314 |
| 212 | iso_pu_bacteria | 2885366525 | 2885373745 | 314 |
| 213 | iso_pu_bacteria | 2885374607 | 2885382968 | 314 |
| 214 | iso_pu_bacteria | 2885383462 | 2885390990 | 314 |
| 215 | iso_pu_bacteria | 2885409591 | 2885412247 | 314 |
| 216 | iso_pu_bacteria | 2888378607 | 2888386949 | 314 |
| 217 | iso_pu_bacteria | 2888388044 | 2888389643 | 314 |
| 218 | iso_pu_bacteria | 2888419890 | 2888421449 | 314 |
| 219 | iso_pu_bacteria | 2889033259 | 2889033831 | 314 |
| 220 | iso_pu_bacteria | 2903727486 | 2903732399 | 314 |
| 221 | iso_pu_bacteria | 2903748898 | 2903750380 | 314 |
| 222 | iso_pu_bacteria | 2903768456 | 2903773247 | 314 |
| 223 | iso_pu_bacteria | 2904666416 | 2904666570 | 314 |
| 224 | iso_pu_bacteria | 2904690495 | 2904699082 | 314 |
| 225 | iso_pu_bacteria | 2904699407 | 2904707073 | 314 |
| 226 | iso_pu_bacteria | 2904711408 | 2904719537 | 314 |
| 227 | iso_pu_bacteria | 2906602504 | 2906606286 | 314 |
| 228 | iso_pu_bacteria | 2906610324 | 2906615601 | 314 |
| 229 | iso_pu_bacteria | 2906626472 | 2906626744 | 314 |
| 230 | iso_pu_bacteria | 2906635258 | 2906636487 | 314 |
| 231 | iso_pu_bacteria | 2906643746 | 2906647841 | 314 |
| 232 | iso_pu_bacteria | 2906660503 | 2906665033 | 314 |
| 233 | iso_pu_bacteria | 2908739725 | 2908745580 | 314 |
| 234 | iso_pu_bacteria | 2908756301 | 2908763566 | 314 |
| 235 | iso_pu_bacteria | 2908775508 | 2908777484 | 314 |
| 236 | iso_pu_bacteria | 2917699015 | 2917703898 | 314 |
| 237 | iso_pu_bacteria | 2922361189 | 2922367254 | 314 |
| 238 | iso_pu_bacteria | 2922368715 | 2922377078 | 314 |
| 239 | iso_pu_bacteria | 2922386360 | 2922390041 | 314 |
| 240 | iso_pu_bacteria | 2922393267 | 2922398230 | 314 |
| 241 | iso_pu_bacteria | 2922425934 | 2922432406 | 314 |
| 242 | iso_pu_bacteria | 2929199973 | 2929202997 | 314 |
| 243 | iso_pu_bacteria | 2929615660 | 2929619091 | 314 |
| 244 | iso_pu_bacteria | 2929624759 | 2929628414 | 314 |
| 245 | iso_pu_bacteria | 2932784394 | 2932791334 | 314 |
| 246 | iso_pu_bacteria | 2932794094 | 2932795760 | 314 |
| 247 | iso_pu_bacteria | 2932801729 | 2932801998 | 314 |
| 248 | iso_pu_bacteria | 2932809354 | 2932814808 | 314 |
| 249 | iso_pu_bacteria | 2932818245 | 2932823665 | 314 |
| 250 | iso_pu_bacteria | 2932828146 | 2932833097 | 314 |
| 251 | iso_pu_bacteria | 2933577622 | 2933581013 | 314 |
| 252 | iso_pu_bacteria | 2935608549 | 2935612282 | 314 |
| 253 | iso_pu_bacteria | 2935616580 | 2935623826 | 314 |
| 254 | iso_pu_bacteria | 2935630451 | 2935630769 | 314 |
| 255 | iso_pu_bacteria | 2935638405 | 2935639601 | 314 |
| 256 | iso_pu_bacteria | 2935648319 | 2935650122 | 314 |
| 257 | iso_pu_bacteria | 2935656913 | 2935658269 | 314 |
| 258 | iso_pu_bacteria | 2935665750 | 2935670544 | 314 |
| 259 | iso_pu_bacteria | 2935675223 | 2935682877 | 314 |
| 260 | iso_pu_bacteria | 2935684952 | 2935687540 | 314 |
| 261 | iso_pu_bacteria | 2935694250 | 2935696488 | 314 |
| 262 | iso_pu_bacteria | 2935703347 | 2935705301 | 314 |
| 263 | iso_pu_bacteria | 2935713505 | 2935719000 | 314 |
| 264 | iso_pu_bacteria | 2935722832 | 2935728652 | 314 |
| 265 | iso_pu_bacteria | 2935732158 | 2935736752 | 314 |
| 266 | iso_pu_bacteria | 2935741537 | 2935746246 | 314 |
| 267 | iso_pu_bacteria | 2935750917 | 2935753506 | 314 |
| 268 | iso_pu_bacteria | 2935760218 | 2935767703 | 314 |
| 269 | iso_pu_bacteria | 2935769743 | 2935770465 | 314 |
| 270 | iso_pu_bacteria | 2935777560 | 2935782508 | 314 |
| 271 | iso_pu_bacteria | 2935785616 | 2935786482 | 314 |
| 272 | iso_pu_bacteria | 2935793552 | 2935794537 | 314 |
| 273 | iso_pu_bacteria | 2935801545 | 2935807046 | 314 |
| 274 | iso_pu_bacteria | 2935810662 | 2935814039 | 314 |
| 275 | iso_pu_bacteria | 2935819856 | 2935823771 | 314 |
| 276 | iso_pu_bacteria | 2935827899 | 2935829083 | 314 |
| 277 | iso_pu_bacteria | 2935837841 | 2935845382 | 314 |
| 278 | iso_pu_bacteria | 2935847175 | 2935854409 | 314 |
| 279 | iso_pu_bacteria | 2935855204 | 2935861949 | 314 |
| 280 | iso_pu_bacteria | 2935864058 | 2935872801 | 314 |
| 281 | iso_pu_bacteria | 2935873716 | 2935880376 | 314 |
| 282 | iso_pu_bacteria | 2935883170 | 2935886186 | 314 |
| 283 | iso_pu_bacteria | 2935908558 | 2935913497 | 314 |
| 284 | iso_pu_bacteria | 2935916978 | 2935923394 | 314 |
| 285 | iso_pu_bacteria | 2935926038 | 2935931186 | 314 |
| 286 | iso_pu_bacteria | 2935934488 | 2935935468 | 314 |
| 287 | iso_pu_bacteria | 2935942939 | 2935947034 | 314 |
| 288 | iso_pu_bacteria | 2935951376 | 2935953871 | 314 |
| 289 | iso_pu_bacteria | 2935959822 | 2935961490 | 314 |
| 290 | iso_pu_bacteria | 2935967501 | 2935968897 | 314 |
| 291 | iso_pu_bacteria | 2935975950 | 2935982433 | 314 |
| 292 | iso_pu_bacteria | 2935984226 | 2935985901 | 314 |
| 293 | iso_pu_bacteria | 2935992306 | 2935994986 | 314 |
| 294 | iso_pu_bacteria | 2936002035 | 2936006079 | 314 |
| 295 | iso_pu_bacteria | 2936011229 | 2936013319 | 314 |
| 296 | iso_pu_bacteria | 2936019824 | 2936021594 | 314 |
| 297 | iso_pu_bacteria | 2936028420 | 2936030612 | 314 |
| 298 | iso_pu_bacteria | 2936037263 | 2936039594 | 314 |
| 299 | iso_pu_bacteria | 2936046547 | 2936047788 | 314 |
| 300 | iso_pu_bacteria | 2936055302 | 2936057790 | 314 |
| 301 | iso_pu_bacteria | 2940556831 | 2940559419 | 314 |
| 302 | iso_pu_bacteria | 2941507105 | 2941507421 | 314 |
| 303 | iso_pu_bacteria | 2941515067 | 2941515848 | 314 |
| 304 | iso_pu_bacteria | 2941523033 | 2941523444 | 314 |
| 305 | iso_pu_bacteria | 2941531003 | 2941536986 | 314 |
| 306 | iso_pu_bacteria | 2941538514 | 2941545647 | 314 |
| 307 | iso_pu_bacteria | 3005474847 | 3005476633 | 314 |
| 308 | iso_pu_bacteria | 3005483717 | 3005487673 | 314 |
| 309 | iso_pu_bacteria | 3005506211 | 3005511176 | 314 |
| 310 | iso_pu_bacteria | 3005587118 | 3005592027 | 314 |
| 311 | iso_pu_bacteria | 3005594810 | 3005596144 | 314 |
| 312 | iso_pu_bacteria | 3005710791 | 3005712093 | 314 |
| 313 | iso_pu_bacteria | 3005718088 | 3005719327 | 314 |
| 314 | iso_pu_bacteria | 8006926726 | 8006929448 | 314 |
| 315 | iso_pu_bacteria | 8006933436 | 8006934848 | 314 |
| 316 | iso_pu_bacteria | 8006964411 | 8006966156 | 314 |
| 317 | iso_pu_bacteria | 8006973647 | 8006974816 | 314 |
| 318 | iso_pu_bacteria | 8006984368 | 8006989668 | 314 |
| 319 | iso_pu_bacteria | 8006994254 | 8006998068 | 314 |
| 320 | iso_pu_bacteria | 8016511872 | 8016516943 | 314 |
| 321 | iso_pu_bacteria | 8016539877 | 8016542359 | 314 |
| 322 | iso_pu_bacteria | 8016557553 | 8016559330 | 314 |
| 323 | iso_pu_bacteria | 8016566248 | 8016567746 | 314 |
| 324 | iso_pu_bacteria | 8016575299 | 8016580439 | 314 |
| 325 | iso_pu_bacteria | 8016583857 | 8016588609 | 314 |
| 326 | iso_pu_bacteria | 8016595262 | 8016597273 | 314 |
| 327 | iso_pu_bacteria | 8016603502 | 8016604987 | 314 |
| 328 | iso_pu_bacteria | 8016622563 | 8016624244 | 314 |
| 329 | iso_pu_bacteria | 8016630954 | 8016637650 | 314 |
| 330 | iso_pu_bacteria | 8017057580 | 8017059628 | 314 |
| 331 | iso_pu_bacteria | 8019530166 | 8019537751 | 314 |
| 332 | iso_pu_bacteria | 8019538911 | 8019539381 | 314 |
| 333 | iso_pu_bacteria | 8019576017 | 8019579101 | 314 |
| 334 | iso_pu_bacteria | 8019586578 | 8019597155 | 314 |
| 335 | iso_pu_bacteria | 8019608314 | 8019613995 | 314 |
| 336 | iso_pu_bacteria | 8019619141 | 8019624538 | 314 |
| 337 | iso_pu_bacteria | 8019629233 | 8019637502 | 314 |
| 338 | iso_pu_bacteria | 8019638758 | 8019642107 | 314 |
| 339 | iso_pu_bacteria | 8019648815 | 8019650415 | 314 |
| 340 | iso_pu_bacteria | 8019659431 | 8019665435 | 314 |
| 341 | iso_pu_bacteria | 8019678201 | 8019681114 | 314 |
| 342 | iso_pu_bacteria | 8019687851 | 8019694582 | 314 |
| 343 | iso_pu_bacteria | 8055742211 | 8055749651 | 314 |
| 344 | iso_pu_bacteria | 8055909800 | 8055916095 | 314 |
| 345 | iso_pu_bacteria | 8056673599 | 8056675093 | 314 |
| 346 | iso_pu_bacteria | 8056681323 | 8056684644 | 314 |
| 347 | iso_pu_bacteria | 8056689827 | 8056696229 | 314 |
| 348 | iso_pu_bacteria | 8056967851 | 8056973868 | 314 |
| 349 | 3300005468 | Ga0070707_100104189 | Ga0070707_1001041892 | 315 |
| 350 | 3300005471 | Ga0070698_100250591 | Ga0070698_1002505912 | 315 |
| 351 | 3300006038 | Ga0075365_10027326 | Ga0075365_100273264 | 315 |
| 352 | 3300006177 | Ga0075362_10026316 | Ga0075362_100263162 | 315 |
| 353 | 3300006178 | Ga0075367_10060940 | Ga0075367_100609402 | 315 |
| 354 | 3300013104 | Ga0157370_10059485 | Ga0157370_100594852 | 315 |
| 355 | 3300025922 | Ga0207646_10148962 | Ga0207646_101489622 | 315 |
| 356 | 3300025981 | Ga0207640_10091170 | Ga0207640_100911702 | 315 |
| 357 | 3300037853 | Ga0436364_0601659 | Ga0436364_0601659_1423_2376 | 315 |
| 358 | 3300039437 | Ga0436365_1736919 | Ga0436365_1736919_2655_3608 | 315 |
| 359 | 3300046663 | Ga0495635_0042909 | Ga0495635_0042909_164_1114 | 315 |
| 360 | 3300050489 | nmdc:mga03683_21707_c1 | nmdc:mga03683_21707_c1_401_1357 | 315 |
| 361 | 3300050492 | nmdc:mga0yw44_7443_c1 | nmdc:mga0yw44_7443_c1_1959_2915 | 315 |
| 362 | 3300003203 | JGI25406J46586_10000032 | JGI25406J46586_1000003240 | 316 |
| 363 | 3300003203 | JGI25406J46586_10000433 | JGI25406J46586_1000043312 | 316 |
| 364 | 3300005337 | Ga0070682_100046835 | Ga0070682_1000468352 | 316 |
| 365 | 3300005338 | Ga0068868_100011310 | Ga0068868_1000113105 | 316 |
| 366 | 3300005434 | Ga0070709_10050791 | Ga0070709_100507912 | 316 |
| 367 | 3300005435 | Ga0070714_100084443 | Ga0070714_1000844432 | 316 |
| 368 | 3300005436 | Ga0070713_100057350 | Ga0070713_1000573503 | 316 |
| 369 | 3300005455 | Ga0070663_100007767 | Ga0070663_1000077674 | 316 |
| 370 | 3300005456 | Ga0070678_100064819 | Ga0070678_1000648192 | 316 |
| 371 | 3300005456 | Ga0070678_100103857 | Ga0070678_1001038572 | 316 |
| 372 | 3300005563 | Ga0068855_100180701 | Ga0068855_1001807011 | 316 |
| 373 | 3300005614 | Ga0068856_100002849 | Ga0068856_10000284913 | 316 |
| 374 | 3300005616 | Ga0068852_100153881 | Ga0068852_1001538812 | 316 |
| 375 | 3300005618 | Ga0068864_100098797 | Ga0068864_1000987972 | 316 |
| 376 | 3300005981 | Ga0081538_10058444 | Ga0081538_100584442 | 316 |
| 377 | 3300005983 | Ga0081540_1014249 | Ga0081540_10142492 | 316 |
| 378 | 3300005985 | Ga0081539_10000129 | Ga0081539_10000129160 | 316 |
| 379 | 3300005985 | Ga0081539_10000549 | Ga0081539_1000054929 | 316 |
| 380 | 3300006844 | Ga0075428_100019515 | Ga0075428_1000195153 | 316 |
| 381 | 3300006846 | Ga0075430_100036628 | Ga0075430_1000366283 | 316 |
| 382 | 3300006847 | Ga0075431_100000986 | Ga0075431_10000098611 | 316 |
| 383 | 3300006880 | Ga0075429_100013820 | Ga0075429_1000138205 | 316 |
| 384 | 3300007076 | Ga0075435_100482419 | Ga0075435_1004824192 | 316 |
| 385 | 3300009094 | Ga0111539_10004845 | Ga0111539_100048455 | 316 |
| 386 | 3300009147 | Ga0114129_10004791 | Ga0114129_1000479117 | 316 |
| 387 | 3300021377 | Ga0213874_10003165 | Ga0213874_100031652 | 316 |
| 388 | 3300021384 | Ga0213876_10009074 | Ga0213876_100090743 | 316 |
| 389 | 3300021388 | Ga0213875_10003029 | Ga0213875_100030292 | 316 |
| 390 | 3300021388 | Ga0213875_10006053 | Ga0213875_100060536 | 316 |
| 391 | 3300025901 | Ga0207688_10110951 | Ga0207688_101109512 | 316 |
| 392 | 3300025905 | Ga0207685_10019898 | Ga0207685_100198982 | 316 |
| 393 | 3300025906 | Ga0207699_10036133 | Ga0207699_100361333 | 316 |
| 394 | 3300025908 | Ga0207643_10039276 | Ga0207643_100392761 | 316 |
| 395 | 3300025913 | Ga0207695_10279906 | Ga0207695_102799062 | 316 |
| 396 | 3300025915 | Ga0207693_10010582 | Ga0207693_100105827 | 316 |
| 397 | 3300025915 | Ga0207693_10135623 | Ga0207693_101356232 | 316 |
| 398 | 3300025916 | Ga0207663_10105062 | Ga0207663_101050622 | 316 |
| 399 | 3300025921 | Ga0207652_10075415 | Ga0207652_100754152 | 316 |
| 400 | 3300025927 | Ga0207687_10071054 | Ga0207687_100710541 | 316 |
| 401 | 3300025928 | Ga0207700_10415950 | Ga0207700_104159502 | 316 |
| 402 | 3300025929 | Ga0207664_10075358 | Ga0207664_100753582 | 316 |
| 403 | 3300025937 | Ga0207669_10107806 | Ga0207669_101078062 | 316 |
| 404 | 3300025938 | Ga0207704_10236102 | Ga0207704_102361022 | 316 |
| 405 | 3300025939 | Ga0207665_10117331 | Ga0207665_101173311 | 316 |
| 406 | 3300025944 | Ga0207661_10125207 | Ga0207661_101252072 | 316 |
| 407 | 3300025949 | Ga0207667_10530269 | Ga0207667_105302691 | 316 |
| 408 | 3300026023 | Ga0207677_10012388 | Ga0207677_100123882 | 316 |
| 409 | 3300026035 | Ga0207703_10258870 | Ga0207703_102588702 | 316 |
| 410 | 3300026067 | Ga0207678_10032802 | Ga0207678_100328024 | 316 |
| 411 | 3300026078 | Ga0207702_10000325 | Ga0207702_1000032558 | 316 |
| 412 | 3300026121 | Ga0207683_10042482 | Ga0207683_100424824 | 316 |
| 413 | 3300026121 | Ga0207683_10052354 | Ga0207683_100523543 | 316 |
| 414 | 3300027671 | Ga0209588_1016301 | Ga0209588_10163011 | 316 |
| 415 | 3300031730 | Ga0307516_10016844 | Ga0307516_100168443 | 316 |
| 416 | 3300031730 | Ga0307516_10023182 | Ga0307516_100231822 | 316 |
| 417 | 3300035111 | Ga0373923_0012011 | Ga0373923_0012011_1618_2574 | 316 |
| 418 | 3300035113 | Ga0373936_0005491 | Ga0373936_0005491_3691_4647 | 316 |
| 419 | 3300035692 | Ga0373935_0127238 | Ga0373935_0127238_505_1470 | 316 |
| 420 | 3300035695 | Ga0373927_0002111 | Ga0373927_0002111_2282_3238 | 316 |
| 421 | 3300036401 | Ga0373937_0191104 | Ga0373937_0191104_862_1827 | 316 |
| 422 | 3300037068 | Ga0373925_0119797 | Ga0373925_0119797_829_1794 | 316 |
| 423 | 3300037853 | Ga0436364_0103156 | Ga0436364_0103156_13895_14851 | 316 |
| 424 | 3300037853 | Ga0436364_0831688 | Ga0436364_0831688_587_1543 | 316 |
| 425 | 3300037853 | Ga0436364_1379234 | Ga0436364_1379234_524_1486 | 316 |
| 426 | 3300037853 | Ga0436364_1558822 | Ga0436364_1558822_171_1133 | 316 |
| 427 | 3300039437 | Ga0436365_0138565 | Ga0436365_0138565_6579_7541 | 316 |
| 428 | 3300039437 | Ga0436365_0879300 | Ga0436365_0879300_1120_2076 | 316 |
| 429 | 3300039437 | Ga0436365_1535876 | Ga0436365_1535876_7445_8407 | 316 |
| 430 | 3300039450 | Ga0436363_0282535 | Ga0436363_0282535_9433_10395 | 316 |
| 431 | 3300039450 | Ga0436363_0472610 | Ga0436363_0472610_1120_2082 | 316 |
| 432 | 3300039453 | Ga0436362_0822437 | Ga0436362_0822437_3610_4572 | 316 |
| 433 | 3300045836 | Ga0466958_0160827 | Ga0466958_0160827_203_1159 | 316 |
| 434 | 3300046454 | Ga0495592_0099056 | Ga0495592_0099056_32_997 | 316 |
| 435 | 3300046455 | Ga0495603_0001315 | Ga0495603_0001315_1946_2902 | 316 |
| 436 | 3300046455 | Ga0495603_0045157 | Ga0495603_0045157_1187_2143 | 316 |
| 437 | 3300046462 | Ga0495651_0017859 | Ga0495651_0017859_4082_5047 | 316 |
| 438 | 3300046472 | Ga0495580_0000514 | Ga0495580_0000514_31577_32533 | 316 |
| 439 | 3300046473 | Ga0495582_0003610 | Ga0495582_0003610_7421_8377 | 316 |
| 440 | 3300046475 | Ga0495639_0000101 | Ga0495639_0000101_32238_33194 | 316 |
| 441 | 3300046476 | Ga0495662_0000117 | Ga0495662_0000117_3558_4514 | 316 |
| 442 | 3300046477 | Ga0495664_0006748 | Ga0495664_0006748_4702_5658 | 316 |
| 443 | 3300046499 | Ga0495594_0000083 | Ga0495594_0000083_16987_17943 | 316 |
| 444 | 3300046507 | Ga0495606_0004349 | Ga0495606_0004349_12425_13381 | 316 |
| 445 | 3300046512 | Ga0495610_0051064 | Ga0495610_0051064_335_1288 | 316 |
| 446 | 3300046517 | Ga0495630_0001944 | Ga0495630_0001944_227_1183 | 316 |
| 447 | 3300046531 | Ga0495665_0000055 | Ga0495665_0000055_11738_12694 | 316 |
| 448 | 3300046533 | Ga0495640_0002279 | Ga0495640_0002279_11662_12618 | 316 |
| 449 | 3300046543 | Ga0495645_0035625 | Ga0495645_0035625_2280_3236 | 316 |
| 450 | 3300046557 | Ga0495622_0011851 | Ga0495622_0011851_2880_3836 | 316 |
| 451 | 3300046642 | Ga0495634_0000720 | Ga0495634_0000720_14844_15800 | 316 |
| 452 | 3300046663 | Ga0495635_0004704 | Ga0495635_0004704_4750_5706 | 316 |
| 453 | 3300046674 | Ga0495588_0004531 | Ga0495588_0004531_5026_5982 | 316 |
| 454 | 3300046678 | Ga0495599_0029287 | Ga0495599_0029287_1890_2855 | 316 |
| 455 | 3300046680 | Ga0495646_0009997 | Ga0495646_0009997_3699_4655 | 316 |
| 456 | 3300046681 | Ga0495647_0010156 | Ga0495647_0010156_539_1495 | 316 |
| 457 | 3300046683 | Ga0495658_0001206 | Ga0495658_0001206_5292_6248 | 316 |
| 458 | 3300046690 | Ga0495624_0001822 | Ga0495624_0001822_209_1165 | 316 |
| 459 | 3300046809 | Ga0495600_0033814 | Ga0495600_0033814_1928_2884 | 316 |
| 460 | 3300047315 | Ga0495581_0000041 | Ga0495581_0000041_36280_37236 | 316 |
| 461 | 3300047319 | Ga0495674_0007683 | Ga0495674_0007683_2443_3399 | 316 |
| 462 | 3300047319 | Ga0495674_0101026 | Ga0495674_0101026_1310_2275 | 316 |
| 463 | 3300047320 | Ga0495672_0033613 | Ga0495672_0033613_915_1955 | 316 |
| 464 | 3300047469 | Ga0495673_0033572 | Ga0495673_0033572_891_1856 | 316 |
| 465 | 3300047471 | Ga0495684_0007286 | Ga0495684_0007286_7153_8109 | 316 |
| 466 | 3300047471 | Ga0495684_0051088 | Ga0495684_0051088_2168_3133 | 316 |
| 467 | 3300047673 | Ga0495593_0000024 | Ga0495593_0000024_6549_7505 | 316 |
| 468 | 3300048915 | Ga0496112_0000015 | Ga0496112_0000015_83536_84492 | 316 |
| 469 | 3300048917 | Ga0496114_0019685 | Ga0496114_0019685_141_1097 | 316 |
| 470 | 3300048918 | Ga0496115_0186680 | Ga0496115_0186680_576_1532 | 316 |
| 471 | 3300048929 | Ga0496126_0021020 | Ga0496126_0021020_442_1398 | 316 |
| 472 | 3300049591 | Ga0501075_0209857 | Ga0501075_0209857_442_1398 | 316 |
| 473 | 3300050507 | nmdc:mga05p37_3181_c1 | nmdc:mga05p37_3181_c1_4874_5833 | 316 |
| 474 | 3300050508 | nmdc:mga09592_8656_c1 | nmdc:mga09592_8656_c1_4960_5919 | 316 |
| 475 | 3300050509 | nmdc:mga0qj67_5521_c1 | nmdc:mga0qj67_5521_c1_1784_2743 | 316 |
| 476 | 3300050510 | nmdc:mga06r32_3795_c1 | nmdc:mga06r32_3795_c1_11097_12056 | 316 |
| 477 | 3300050511 | nmdc:mga08y16_204_c3 | nmdc:mga08y16_204_c3_4196_5155 | 316 |
| 478 | 3300050513 | nmdc:mga0rr50_502528_c1 | nmdc:mga0rr50_502528_c1_44_1000 | 316 |
| 479 | 3300053080 | Ga0500635_0002338 | Ga0500635_0002338_1862_2818 | 316 |
| 480 | 3300053093 | Ga0500651_0011118 | Ga0500651_0011118_1461_2435 | 316 |
| 481 | 3300053102 | Ga0500554_001920 | Ga0500554_001920_25_981 | 316 |
| 482 | 3300053119 | Ga0500595_002181 | Ga0500595_002181_3228_4184 | 316 |
| 483 | 3300053150 | Ga0500603_001115 | Ga0500603_001115_3464_4420 | 316 |
| 484 | 3300053153 | Ga0500616_0026922 | Ga0500616_0026922_1752_2705 | 316 |
| 485 | 3300053156 | Ga0500622_0076701 | Ga0500622_0076701_440_1414 | 316 |
| 486 | 3300053177 | Ga0500636_0001753 | Ga0500636_0001753_1469_2422 | 316 |
| 487 | 3300053178 | Ga0500637_0002536 | Ga0500637_0002536_5336_6292 | 316 |
| 488 | 3300002987 | JGI25159J45721_1005938 | JGI25159J45721_10059383 | 317 |
| 489 | 3300003187 | JGI25151J46595_10000052 | JGI25151J46595_10000052102 | 317 |
| 490 | 3300003215 | JGI25153J46596_10021591 | JGI25153J46596_100215912 | 317 |
| 491 | 3300003215 | JGI25153J46596_10042041 | JGI25153J46596_100420411 | 317 |
| 492 | 3300003354 | JGI25160J50197_1007298 | JGI25160J50197_10072982 | 317 |
| 493 | 3300003659 | JGI25404J52841_10008508 | JGI25404J52841_100085081 | 317 |
| 494 | 3300003762 | Ga0055542_1002606 | Ga0055542_10026062 | 317 |
| 495 | 3300003771 | Ga0055526_1000017 | Ga0055526_1000017112 | 317 |
| 496 | 3300003771 | Ga0055526_1002207 | Ga0055526_10022075 | 317 |
| 497 | 3300003775 | Ga0055524_1000014 | Ga0055524_100001458 | 317 |
| 498 | 3300003775 | Ga0055524_1010792 | Ga0055524_10107923 | 317 |
| 499 | 3300003794 | Ga0055531_10005960 | Ga0055531_100059605 | 317 |
| 500 | 3300004625 | Ga0055543_1008492 | Ga0055543_10084922 | 317 |
| 501 | 3300005262 | Ga0065165_1000313 | Ga0065165_100031356 | 317 |
| 502 | 3300005262 | Ga0065165_1001376 | Ga0065165_10013762 | 317 |
| 503 | 3300005262 | Ga0065165_1002335 | Ga0065165_100233514 | 317 |
| 504 | 3300005262 | Ga0065165_1006843 | Ga0065165_10068433 | 317 |
| 505 | 3300005327 | Ga0070658_10157912 | Ga0070658_101579121 | 317 |
| 506 | 3300005329 | Ga0070683_100077150 | Ga0070683_1000771502 | 317 |
| 507 | 3300005329 | Ga0070683_100141173 | Ga0070683_1001411732 | 317 |
| 508 | 3300005331 | Ga0070670_100186591 | Ga0070670_1001865912 | 317 |
| 509 | 3300005336 | Ga0070680_100083267 | Ga0070680_1000832672 | 317 |
| 510 | 3300005339 | Ga0070660_100295789 | Ga0070660_1002957891 | 317 |
| 511 | 3300005341 | Ga0070691_10003977 | Ga0070691_100039772 | 317 |
| 512 | 3300005347 | Ga0070668_100104940 | Ga0070668_1001049402 | 317 |
| 513 | 3300005347 | Ga0070668_100271542 | Ga0070668_1002715421 | 317 |
| 514 | 3300005347 | Ga0070668_100382221 | Ga0070668_1003822211 | 317 |
| 515 | 3300005353 | Ga0070669_100083475 | Ga0070669_1000834753 | 317 |
| 516 | 3300005364 | Ga0070673_100120662 | Ga0070673_1001206622 | 317 |
| 517 | 3300005364 | Ga0070673_100234202 | Ga0070673_1002342022 | 317 |
| 518 | 3300005434 | Ga0070709_10040228 | Ga0070709_100402282 | 317 |
| 519 | 3300005435 | Ga0070714_100312896 | Ga0070714_1003128961 | 317 |
| 520 | 3300005436 | Ga0070713_100160398 | Ga0070713_1001603982 | 317 |
| 521 | 3300005437 | Ga0070710_10145871 | Ga0070710_101458711 | 317 |
| 522 | 3300005438 | Ga0070701_10188722 | Ga0070701_101887221 | 317 |
| 523 | 3300005439 | Ga0070711_100006483 | Ga0070711_1000064833 | 317 |
| 524 | 3300005455 | Ga0070663_100003863 | Ga0070663_1000038634 | 317 |
| 525 | 3300005455 | Ga0070663_100079113 | Ga0070663_1000791132 | 317 |
| 526 | 3300005455 | Ga0070663_100098615 | Ga0070663_1000986152 | 317 |
| 527 | 3300005456 | Ga0070678_100070667 | Ga0070678_1000706672 | 317 |
| 528 | 3300005456 | Ga0070678_100157444 | Ga0070678_1001574441 | 317 |
| 529 | 3300005457 | Ga0070662_100073817 | Ga0070662_1000738172 | 317 |
| 530 | 3300005457 | Ga0070662_100078804 | Ga0070662_1000788042 | 317 |
| 531 | 3300005467 | Ga0070706_100063277 | Ga0070706_1000632772 | 317 |
| 532 | 3300005530 | Ga0070679_100075900 | Ga0070679_1000759002 | 317 |
| 533 | 3300005535 | Ga0070684_100085029 | Ga0070684_1000850292 | 317 |
| 534 | 3300005535 | Ga0070684_100304214 | Ga0070684_1003042142 | 317 |
| 535 | 3300005539 | Ga0068853_100192064 | Ga0068853_1001920642 | 317 |
| 536 | 3300005539 | Ga0068853_100340430 | Ga0068853_1003404301 | 317 |
| 537 | 3300005548 | Ga0070665_100017918 | Ga0070665_1000179186 | 317 |
| 538 | 3300005548 | Ga0070665_100050535 | Ga0070665_1000505352 | 317 |
| 539 | 3300005548 | Ga0070665_100188677 | Ga0070665_1001886773 | 317 |
| 540 | 3300005548 | Ga0070665_100193682 | Ga0070665_1001936822 | 317 |
| 541 | 3300005549 | Ga0070704_100003315 | Ga0070704_1000033152 | 317 |
| 542 | 3300005563 | Ga0068855_100092061 | Ga0068855_1000920612 | 317 |
| 543 | 3300005563 | Ga0068855_100133728 | Ga0068855_1001337282 | 317 |
| 544 | 3300005564 | Ga0070664_100061891 | Ga0070664_1000618912 | 317 |
| 545 | 3300005577 | Ga0068857_100013484 | Ga0068857_1000134844 | 317 |
| 546 | 3300005614 | Ga0068856_100017546 | Ga0068856_1000175466 | 317 |
| 547 | 3300005614 | Ga0068856_100072955 | Ga0068856_1000729552 | 317 |
| 548 | 3300005614 | Ga0068856_100236398 | Ga0068856_1002363981 | 317 |
| 549 | 3300005614 | Ga0068856_100502207 | Ga0068856_1005022072 | 317 |
| 550 | 3300005616 | Ga0068852_100034684 | Ga0068852_1000346842 | 317 |
| 551 | 3300005617 | Ga0068859_100106673 | Ga0068859_1001066732 | 317 |
| 552 | 3300005719 | Ga0068861_100017897 | Ga0068861_1000178973 | 317 |
| 553 | 3300005719 | Ga0068861_100026690 | Ga0068861_1000266903 | 317 |
| 554 | 3300005842 | Ga0068858_100019766 | Ga0068858_1000197666 | 317 |
| 555 | 3300005843 | Ga0068860_100095846 | Ga0068860_1000958462 | 317 |
| 556 | 3300005937 | Ga0081455_10014280 | Ga0081455_100142804 | 317 |
| 557 | 3300005937 | Ga0081455_10026724 | Ga0081455_100267243 | 317 |
| 558 | 3300005937 | Ga0081455_10050536 | Ga0081455_100505362 | 317 |
| 559 | 3300005983 | Ga0081540_1000338 | Ga0081540_100033840 | 317 |
| 560 | 3300005983 | Ga0081540_1000876 | Ga0081540_100087627 | 317 |
| 561 | 3300005983 | Ga0081540_1005310 | Ga0081540_10053104 | 317 |
| 562 | 3300005983 | Ga0081540_1016517 | Ga0081540_10165174 | 317 |
| 563 | 3300005983 | Ga0081540_1026537 | Ga0081540_10265372 | 317 |
| 564 | 3300005983 | Ga0081540_1090239 | Ga0081540_10902392 | 317 |
| 565 | 3300006038 | Ga0075365_10013919 | Ga0075365_100139193 | 317 |
| 566 | 3300006038 | Ga0075365_10041585 | Ga0075365_100415854 | 317 |
| 567 | 3300006038 | Ga0075365_10075885 | Ga0075365_100758852 | 317 |
| 568 | 3300006038 | Ga0075365_10119058 | Ga0075365_101190582 | 317 |
| 569 | 3300006042 | Ga0075368_10010701 | Ga0075368_100107012 | 317 |
| 570 | 3300006042 | Ga0075368_10098583 | Ga0075368_100985831 | 317 |
| 571 | 3300006048 | Ga0075363_100002563 | Ga0075363_1000025633 | 317 |
| 572 | 3300006048 | Ga0075363_100018134 | Ga0075363_1000181343 | 317 |
| 573 | 3300006048 | Ga0075363_100020378 | Ga0075363_1000203782 | 317 |
| 574 | 3300006048 | Ga0075363_100247188 | Ga0075363_1002471881 | 317 |
| 575 | 3300006051 | Ga0075364_10026756 | Ga0075364_100267562 | 317 |
| 576 | 3300006175 | Ga0070712_100194163 | Ga0070712_1001941632 | 317 |
| 577 | 3300006177 | Ga0075362_10018021 | Ga0075362_100180212 | 317 |
| 578 | 3300006177 | Ga0075362_10049775 | Ga0075362_100497752 | 317 |
| 579 | 3300006178 | Ga0075367_10002436 | Ga0075367_100024366 | 317 |
| 580 | 3300006178 | Ga0075367_10008820 | Ga0075367_100088202 | 317 |
| 581 | 3300006178 | Ga0075367_10037362 | Ga0075367_100373622 | 317 |
| 582 | 3300006178 | Ga0075367_10045189 | Ga0075367_100451892 | 317 |
| 583 | 3300006178 | Ga0075367_10101703 | Ga0075367_101017032 | 317 |
| 584 | 3300006186 | Ga0075369_10031201 | Ga0075369_100312012 | 317 |
| 585 | 3300006186 | Ga0075369_10069969 | Ga0075369_100699692 | 317 |
| 586 | 3300006195 | Ga0075366_10025251 | Ga0075366_100252513 | 317 |
| 587 | 3300006195 | Ga0075366_10096587 | Ga0075366_100965871 | 317 |
| 588 | 3300006353 | Ga0075370_10024705 | Ga0075370_100247052 | 317 |
| 589 | 3300006844 | Ga0075428_100092179 | Ga0075428_1000921793 | 317 |
| 590 | 3300006844 | Ga0075428_100097827 | Ga0075428_1000978273 | 317 |
| 591 | 3300006844 | Ga0075428_100179315 | Ga0075428_1001793152 | 317 |
| 592 | 3300006847 | Ga0075431_100004249 | Ga0075431_10000424911 | 317 |
| 593 | 3300006880 | Ga0075429_100073335 | Ga0075429_1000733354 | 317 |
| 594 | 3300006931 | Ga0097620_100106674 | Ga0097620_1001066742 | 317 |
| 595 | 3300006942 | Ga0099824_1008180 | Ga0099824_10081805 | 317 |
| 596 | 3300006942 | Ga0099824_1012471 | Ga0099824_10124714 | 317 |
| 597 | 3300006943 | Ga0099822_1007748 | Ga0099822_10077486 | 317 |
| 598 | 3300009093 | Ga0105240_10002375 | Ga0105240_100023758 | 317 |
| 599 | 3300009098 | Ga0105245_10063949 | Ga0105245_100639493 | 317 |
| 600 | 3300009147 | Ga0114129_10606425 | Ga0114129_106064251 | 317 |
| 601 | 3300009148 | Ga0105243_10066447 | Ga0105243_100664472 | 317 |
| 602 | 3300009174 | Ga0105241_10067653 | Ga0105241_100676532 | 317 |
| 603 | 3300009176 | Ga0105242_10345458 | Ga0105242_103454581 | 317 |
| 604 | 3300009177 | Ga0105248_10409107 | Ga0105248_104091072 | 317 |
| 605 | 3300009545 | Ga0105237_10163828 | Ga0105237_101638282 | 317 |
| 606 | 3300009551 | Ga0105238_10074040 | Ga0105238_100740402 | 317 |
| 607 | 3300009551 | Ga0105238_10177560 | Ga0105238_101775602 | 317 |
| 608 | 3300009553 | Ga0105249_10068969 | Ga0105249_100689693 | 317 |
| 609 | 3300010375 | Ga0105239_10075123 | Ga0105239_100751233 | 317 |
| 610 | 3300010375 | Ga0105239_10089511 | Ga0105239_100895112 | 317 |
| 611 | 3300010375 | Ga0105239_10290755 | Ga0105239_102907552 | 317 |
| 612 | 3300010375 | Ga0105239_10365033 | Ga0105239_103650332 | 317 |
| 613 | 3300013104 | Ga0157370_10023801 | Ga0157370_100238013 | 317 |
| 614 | 3300013105 | Ga0157369_10198380 | Ga0157369_101983802 | 317 |
| 615 | 3300013250 | Ga0171462_1012 | Ga0171462_1012157 | 317 |
| 616 | 3300013296 | Ga0157374_10495097 | Ga0157374_104950971 | 317 |
| 617 | 3300013308 | Ga0157375_10097352 | Ga0157375_100973522 | 317 |
| 618 | 3300014325 | Ga0163163_10101915 | Ga0163163_101019153 | 317 |
| 619 | 3300014325 | Ga0163163_10153044 | Ga0163163_101530442 | 317 |
| 620 | 3300014325 | Ga0163163_10322886 | Ga0163163_103228862 | 317 |
| 621 | 3300014326 | Ga0157380_10159845 | Ga0157380_101598451 | 317 |
| 622 | 3300014745 | Ga0157377_10017758 | Ga0157377_100177583 | 317 |
| 623 | 3300014968 | Ga0157379_10296581 | Ga0157379_102965811 | 317 |
| 624 | 3300014968 | Ga0157379_10474188 | Ga0157379_104741881 | 317 |
| 625 | 3300014969 | Ga0157376_10155978 | Ga0157376_101559782 | 317 |
| 626 | 3300021320 | Ga0214544_1000005 | Ga0214544_1000005151 | 317 |
| 627 | 3300021321 | Ga0214542_1000004 | Ga0214542_1000004155 | 317 |
| 628 | 3300021324 | Ga0214545_1000005 | Ga0214545_1000005242 | 317 |
| 629 | 3300021327 | Ga0214543_1000564 | Ga0214543_100056440 | 317 |
| 630 | 3300021358 | Ga0213873_10006356 | Ga0213873_100063562 | 317 |
| 631 | 3300021384 | Ga0213876_10064040 | Ga0213876_100640402 | 317 |
| 632 | 3300025253 | Ga0209677_101562 | Ga0209677_1015627 | 317 |
| 633 | 3300025254 | Ga0209148_1000367 | Ga0209148_10003676 | 317 |
| 634 | 3300025273 | Ga0209673_1015067 | Ga0209673_10150672 | 317 |
| 635 | 3300025284 | Ga0209130_1000209 | Ga0209130_100020917 | 317 |
| 636 | 3300025294 | Ga0209025_1000017 | Ga0209025_100001769 | 317 |
| 637 | 3300025294 | Ga0209025_1003934 | Ga0209025_100393414 | 317 |
| 638 | 3300025294 | Ga0209025_1030103 | Ga0209025_10301032 | 317 |
| 639 | 3300025295 | Ga0209564_1000031 | Ga0209564_100003195 | 317 |
| 640 | 3300025295 | Ga0209564_1002546 | Ga0209564_100254613 | 317 |
| 641 | 3300025297 | Ga0209758_1000102 | Ga0209758_100010268 | 317 |
| 642 | 3300025297 | Ga0209758_1000732 | Ga0209758_100073232 | 317 |
| 643 | 3300025297 | Ga0209758_1004116 | Ga0209758_10041167 | 317 |
| 644 | 3300025297 | Ga0209758_1006909 | Ga0209758_10069094 | 317 |
| 645 | 3300025297 | Ga0209758_1007061 | Ga0209758_10070613 | 317 |
| 646 | 3300025297 | Ga0209758_1021066 | Ga0209758_10210662 | 317 |
| 647 | 3300025297 | Ga0209758_1022195 | Ga0209758_10221952 | 317 |
| 648 | 3300025299 | Ga0209256_1000033 | Ga0209256_1000033290 | 317 |
| 649 | 3300025299 | Ga0209256_1000181 | Ga0209256_100018174 | 317 |
| 650 | 3300025299 | Ga0209256_1002569 | Ga0209256_10025697 | 317 |
| 651 | 3300025299 | Ga0209256_1023170 | Ga0209256_10231702 | 317 |
| 652 | 3300025302 | Ga0207426_1000354 | Ga0207426_100035419 | 317 |
| 653 | 3300025302 | Ga0207426_1000521 | Ga0207426_10005219 | 317 |
| 654 | 3300025302 | Ga0207426_1019010 | Ga0207426_10190102 | 317 |
| 655 | 3300025304 | Ga0209257_1001340 | Ga0209257_100134016 | 317 |
| 656 | 3300025898 | Ga0207692_10067322 | Ga0207692_100673221 | 317 |
| 657 | 3300025900 | Ga0207710_10086764 | Ga0207710_100867642 | 317 |
| 658 | 3300025901 | Ga0207688_10110378 | Ga0207688_101103781 | 317 |
| 659 | 3300025906 | Ga0207699_10022267 | Ga0207699_100222671 | 317 |
| 660 | 3300025910 | Ga0207684_10137561 | Ga0207684_101375612 | 317 |
| 661 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006844 | 317 |
| 662 | 3300025914 | Ga0207671_10014045 | Ga0207671_100140453 | 317 |
| 663 | 3300025915 | Ga0207693_10131009 | Ga0207693_101310092 | 317 |
| 664 | 3300025919 | Ga0207657_10022030 | Ga0207657_100220302 | 317 |
| 665 | 3300025919 | Ga0207657_10060743 | Ga0207657_100607432 | 317 |
| 666 | 3300025919 | Ga0207657_10165466 | Ga0207657_101654662 | 317 |
| 667 | 3300025919 | Ga0207657_10314873 | Ga0207657_103148732 | 317 |
| 668 | 3300025920 | Ga0207649_10085137 | Ga0207649_100851372 | 317 |
| 669 | 3300025921 | Ga0207652_10025038 | Ga0207652_100250382 | 317 |
| 670 | 3300025924 | Ga0207694_10133485 | Ga0207694_101334852 | 317 |
| 671 | 3300025924 | Ga0207694_10314015 | Ga0207694_103140152 | 317 |
| 672 | 3300025927 | Ga0207687_10035517 | Ga0207687_100355172 | 317 |
| 673 | 3300025928 | Ga0207700_10010378 | Ga0207700_100103784 | 317 |
| 674 | 3300025933 | Ga0207706_10091630 | Ga0207706_100916301 | 317 |
| 675 | 3300025935 | Ga0207709_10103518 | Ga0207709_101035182 | 317 |
| 676 | 3300025938 | Ga0207704_10268073 | Ga0207704_102680732 | 317 |
| 677 | 3300025940 | Ga0207691_10271155 | Ga0207691_102711552 | 317 |
| 678 | 3300025940 | Ga0207691_10332186 | Ga0207691_103321862 | 317 |
| 679 | 3300025941 | Ga0207711_10092919 | Ga0207711_100929192 | 317 |
| 680 | 3300025944 | Ga0207661_10001876 | Ga0207661_100018764 | 317 |
| 681 | 3300025945 | Ga0207679_10018807 | Ga0207679_100188072 | 317 |
| 682 | 3300025945 | Ga0207679_10104507 | Ga0207679_101045072 | 317 |
| 683 | 3300025949 | Ga0207667_10151422 | Ga0207667_101514223 | 317 |
| 684 | 3300025949 | Ga0207667_10315544 | Ga0207667_103155441 | 317 |
| 685 | 3300025960 | Ga0207651_10086245 | Ga0207651_100862451 | 317 |
| 686 | 3300025961 | Ga0207712_10103795 | Ga0207712_101037952 | 317 |
| 687 | 3300025972 | Ga0207668_10288281 | Ga0207668_102882812 | 317 |
| 688 | 3300025981 | Ga0207640_10078190 | Ga0207640_100781902 | 317 |
| 689 | 3300026035 | Ga0207703_10028003 | Ga0207703_100280034 | 317 |
| 690 | 3300026035 | Ga0207703_10345365 | Ga0207703_103453652 | 317 |
| 691 | 3300026041 | Ga0207639_10179965 | Ga0207639_101799652 | 317 |
| 692 | 3300026067 | Ga0207678_10016363 | Ga0207678_100163637 | 317 |
| 693 | 3300026067 | Ga0207678_10059021 | Ga0207678_100590212 | 317 |
| 694 | 3300026067 | Ga0207678_10127113 | Ga0207678_101271132 | 317 |
| 695 | 3300026078 | Ga0207702_10030533 | Ga0207702_100305334 | 317 |
| 696 | 3300026078 | Ga0207702_10155367 | Ga0207702_101553672 | 317 |
| 697 | 3300026078 | Ga0207702_10313442 | Ga0207702_103134422 | 317 |
| 698 | 3300026088 | Ga0207641_10166993 | Ga0207641_101669932 | 317 |
| 699 | 3300026089 | Ga0207648_10393146 | Ga0207648_103931461 | 317 |
| 700 | 3300026116 | Ga0207674_10110649 | Ga0207674_101106492 | 317 |
| 701 | 3300026121 | Ga0207683_10099071 | Ga0207683_100990712 | 317 |
| 702 | 3300026142 | Ga0207698_10005512 | Ga0207698_100055126 | 317 |
| 703 | 3300026142 | Ga0207698_10033601 | Ga0207698_100336012 | 317 |
| 704 | 3300027296 | Ga0209389_1000021 | Ga0209389_100002136 | 317 |
| 705 | 3300027296 | Ga0209389_1000086 | Ga0209389_100008653 | 317 |
| 706 | 3300027357 | Ga0209589_1000005 | Ga0209589_1000005173 | 317 |
| 707 | 3300027357 | Ga0209589_1000027 | Ga0209589_100002732 | 317 |
| 708 | 3300027361 | Ga0209489_100005 | Ga0209489_100005173 | 317 |
| 709 | 3300027361 | Ga0209489_100313 | Ga0209489_10031353 | 317 |
| 710 | 3300027361 | Ga0209489_105143 | Ga0209489_1051433 | 317 |
| 711 | 3300027363 | Ga0209700_100006 | Ga0209700_100006173 | 317 |
| 712 | 3300027363 | Ga0209700_100483 | Ga0209700_1004834 | 317 |
| 713 | 3300027907 | Ga0207428_10121684 | Ga0207428_101216842 | 317 |
| 714 | 3300027907 | Ga0207428_10122668 | Ga0207428_101226682 | 317 |
| 715 | 3300028379 | Ga0268266_10015155 | Ga0268266_100151552 | 317 |
| 716 | 3300028379 | Ga0268266_10018333 | Ga0268266_100183334 | 317 |
| 717 | 3300028379 | Ga0268266_10026503 | Ga0268266_100265035 | 317 |
| 718 | 3300028379 | Ga0268266_10128844 | Ga0268266_101288442 | 317 |
| 719 | 3300028379 | Ga0268266_10143467 | Ga0268266_101434672 | 317 |
| 720 | 3300028381 | Ga0268264_10113998 | Ga0268264_101139981 | 317 |
| 721 | 3300028381 | Ga0268264_10180154 | Ga0268264_101801542 | 317 |
| 722 | 3300028794 | Ga0307515_10021681 | Ga0307515_100216819 | 317 |
| 723 | 3300031507 | Ga0307509_10145855 | Ga0307509_101458552 | 317 |
| 724 | 3300031548 | Ga0307408_100046459 | Ga0307408_1000464592 | 317 |
| 725 | 3300031911 | Ga0307412_10122930 | Ga0307412_101229302 | 317 |
| 726 | 3300031995 | Ga0307409_100293167 | Ga0307409_1002931672 | 317 |
| 727 | 3300033180 | Ga0307510_10035866 | Ga0307510_100358663 | 317 |
| 728 | 3300033180 | Ga0307510_10067387 | Ga0307510_100673872 | 317 |
| 729 | 3300033442 | Ga0315911_1000040 | Ga0315911_100004037 | 317 |
| 730 | 3300037418 | Ga0395900_0003232 | Ga0395900_0003232_541_1497 | 317 |
| 731 | 3300037418 | Ga0395900_0008561 | Ga0395900_0008561_3440_4396 | 317 |
| 732 | 3300037418 | Ga0395900_0029800 | Ga0395900_0029800_1049_2005 | 317 |
| 733 | 3300037418 | Ga0395900_0121556 | Ga0395900_0121556_1161_2117 | 317 |
| 734 | 3300037466 | Ga0395898_0007511 | Ga0395898_0007511_7968_8924 | 317 |
| 735 | 3300037466 | Ga0395898_0009099 | Ga0395898_0009099_9311_10267 | 317 |
| 736 | 3300037466 | Ga0395898_0147177 | Ga0395898_0147177_1248_2204 | 317 |
| 737 | 3300037471 | Ga0395905_0002158 | Ga0395905_0002158_8359_9315 | 317 |
| 738 | 3300037853 | Ga0436364_0063930 | Ga0436364_0063930_1945_2904 | 317 |
| 739 | 3300037853 | Ga0436364_0674187 | Ga0436364_0674187_3153_4121 | 317 |
| 740 | 3300038443 | Ga0395901_0011181 | Ga0395901_0011181_2064_3020 | 317 |
| 741 | 3300038443 | Ga0395901_0012192 | Ga0395901_0012192_362_1318 | 317 |
| 742 | 3300038443 | Ga0395901_0044480 | Ga0395901_0044480_3575_4531 | 317 |
| 743 | 3300038443 | Ga0395901_0358781 | Ga0395901_0358781_83_1039 | 317 |
| 744 | 3300038443 | Ga0395901_0444016 | Ga0395901_0444016_38_994 | 317 |
| 745 | 3300039437 | Ga0436365_0481731 | Ga0436365_0481731_889_1848 | 317 |
| 746 | 3300039437 | Ga0436365_1246836 | Ga0436365_1246836_46_1017 | 317 |
| 747 | 3300039437 | Ga0436365_1339798 | Ga0436365_1339798_1048_2004 | 317 |
| 748 | 3300039438 | Ga0436360_0178193 | Ga0436360_0178193_3377_4336 | 317 |
| 749 | 3300039447 | Ga0436361_0606306 | Ga0436361_0606306_480_1451 | 317 |
| 750 | 3300039450 | Ga0436363_0839057 | Ga0436363_0839057_856_1815 | 317 |
| 751 | 3300039450 | Ga0436363_1333206 | Ga0436363_1333206_30_986 | 317 |
| 752 | 3300039450 | Ga0436363_1477180 | Ga0436363_1477180_1271_2227 | 317 |
| 753 | 3300041410 | Ga0439461_0033868 | Ga0439461_0033868_63_1019 | 317 |
| 754 | 3300041413 | Ga0439465_0053312 | Ga0439465_0053312_90_1043 | 317 |
| 755 | 3300044656 | Ga0466969_0039103 | Ga0466969_0039103_773_1729 | 317 |
| 756 | 3300044658 | Ga0466972_0000266 | Ga0466972_0000266_19821_20777 | 317 |
| 757 | 3300044658 | Ga0466972_0002615 | Ga0466972_0002615_7620_8576 | 317 |
| 758 | 3300044683 | Ga0466965_0031828 | Ga0466965_0031828_1269_2225 | 317 |
| 759 | 3300044684 | Ga0466966_0013523 | Ga0466966_0013523_578_1534 | 317 |
| 760 | 3300044693 | Ga0466961_0000172 | Ga0466961_0000172_22589_23545 | 317 |
| 761 | 3300044694 | Ga0466963_0005504 | Ga0466963_0005504_124_1080 | 317 |
| 762 | 3300044694 | Ga0466963_0005645 | Ga0466963_0005645_4054_5010 | 317 |
| 763 | 3300044694 | Ga0466963_0035553 | Ga0466963_0035553_2209_3165 | 317 |
| 764 | 3300044706 | Ga0466964_0041684 | Ga0466964_0041684_659_1615 | 317 |
| 765 | 3300044735 | Ga0466968_0021379 | Ga0466968_0021379_866_1822 | 317 |
| 766 | 3300044842 | Ga0466957_0006661 | Ga0466957_0006661_598_1554 | 317 |
| 767 | 3300044842 | Ga0466957_0105284 | Ga0466957_0105284_421_1377 | 317 |
| 768 | 3300044901 | Ga0466960_0031566 | Ga0466960_0031566_580_1536 | 317 |
| 769 | 3300045049 | Ga0466959_0004055 | Ga0466959_0004055_7202_8158 | 317 |
| 770 | 3300045051 | Ga0451576_0000231 | Ga0451576_0000231_90271_91230 | 317 |
| 771 | 3300045976 | Ga0466967_0008224 | Ga0466967_0008224_2404_3360 | 317 |
| 772 | 3300045976 | Ga0466967_0013600 | Ga0466967_0013600_1260_2216 | 317 |
| 773 | 3300045976 | Ga0466967_0498387 | Ga0466967_0498387_150_1106 | 317 |
| 774 | 3300046460 | Ga0495638_0004161 | Ga0495638_0004161_6241_7197 | 317 |
| 775 | 3300046462 | Ga0495651_0019144 | Ga0495651_0019144_572_1528 | 317 |
| 776 | 3300046473 | Ga0495582_0105771 | Ga0495582_0105771_461_1423 | 317 |
| 777 | 3300046477 | Ga0495664_0058826 | Ga0495664_0058826_1296_2252 | 317 |
| 778 | 3300046492 | Ga0495585_0116629 | Ga0495585_0116629_160_1116 | 317 |
| 779 | 3300046499 | Ga0495594_0232242 | Ga0495594_0232242_52_1014 | 317 |
| 780 | 3300046501 | Ga0495607_0081770 | Ga0495607_0081770_109_1068 | 317 |
| 781 | 3300046506 | Ga0495583_0110714 | Ga0495583_0110714_178_1140 | 317 |
| 782 | 3300046507 | Ga0495606_0060549 | Ga0495606_0060549_853_1809 | 317 |
| 783 | 3300046507 | Ga0495606_0088765 | Ga0495606_0088765_581_1537 | 317 |
| 784 | 3300046511 | Ga0495608_0003835 | Ga0495608_0003835_7154_8110 | 317 |
| 785 | 3300046516 | Ga0495628_0012656 | Ga0495628_0012656_1026_1982 | 317 |
| 786 | 3300046522 | Ga0495643_0029682 | Ga0495643_0029682_849_1805 | 317 |
| 787 | 3300046529 | Ga0495652_0015106 | Ga0495652_0015106_4673_5629 | 317 |
| 788 | 3300046529 | Ga0495652_0029484 | Ga0495652_0029484_3287_4243 | 317 |
| 789 | 3300046543 | Ga0495645_0027914 | Ga0495645_0027914_263_1219 | 317 |
| 790 | 3300046559 | Ga0495667_0003327 | Ga0495667_0003327_1673_2629 | 317 |
| 791 | 3300046615 | Ga0495656_0022359 | Ga0495656_0022359_813_1772 | 317 |
| 792 | 3300046663 | Ga0495635_0045446 | Ga0495635_0045446_1894_2850 | 317 |
| 793 | 3300046674 | Ga0495588_0024877 | Ga0495588_0024877_335_1291 | 317 |
| 794 | 3300046678 | Ga0495599_0008275 | Ga0495599_0008275_5103_6059 | 317 |
| 795 | 3300046809 | Ga0495600_0120154 | Ga0495600_0120154_317_1273 | 317 |
| 796 | 3300046809 | Ga0495600_0154096 | Ga0495600_0154096_220_1182 | 317 |
| 797 | 3300047315 | Ga0495581_0027606 | Ga0495581_0027606_614_1570 | 317 |
| 798 | 3300047315 | Ga0495581_0112206 | Ga0495581_0112206_241_1203 | 317 |
| 799 | 3300047317 | Ga0495604_0009181 | Ga0495604_0009181_1308_2264 | 317 |
| 800 | 3300047319 | Ga0495674_0030974 | Ga0495674_0030974_3777_4733 | 317 |
| 801 | 3300047320 | Ga0495672_0011899 | Ga0495672_0011899_4154_5113 | 317 |
| 802 | 3300047443 | Ga0495687_012044 | Ga0495687_012044_212_1168 | 317 |
| 803 | 3300047444 | Ga0495675_0006818 | Ga0495675_0006818_491_1447 | 317 |
| 804 | 3300047471 | Ga0495684_0142581 | Ga0495684_0142581_171_1127 | 317 |
| 805 | 3300048904 | Ga0496101_0268151 | Ga0496101_0268151_335_1291 | 317 |
| 806 | 3300048905 | Ga0496102_0076537 | Ga0496102_0076537_1970_2926 | 317 |
| 807 | 3300048905 | Ga0496102_0173241 | Ga0496102_0173241_65_1021 | 317 |
| 808 | 3300048907 | Ga0496104_0007795 | Ga0496104_0007795_2609_3565 | 317 |
| 809 | 3300048907 | Ga0496104_0058381 | Ga0496104_0058381_1792_2748 | 317 |
| 810 | 3300048908 | Ga0496105_0080570 | Ga0496105_0080570_733_1689 | 317 |
| 811 | 3300048909 | Ga0496106_0162042 | Ga0496106_0162042_773_1729 | 317 |
| 812 | 3300048910 | Ga0496107_0265811 | Ga0496107_0265811_224_1180 | 317 |
| 813 | 3300048911 | Ga0496108_0007612 | Ga0496108_0007612_1889_2845 | 317 |
| 814 | 3300048911 | Ga0496108_0051120 | Ga0496108_0051120_602_1558 | 317 |
| 815 | 3300048912 | Ga0496109_0021076 | Ga0496109_0021076_3038_3994 | 317 |
| 816 | 3300048912 | Ga0496109_0214121 | Ga0496109_0214121_64_1020 | 317 |
| 817 | 3300048913 | Ga0496110_0205528 | Ga0496110_0205528_513_1469 | 317 |
| 818 | 3300048915 | Ga0496112_0012721 | Ga0496112_0012721_2237_3193 | 317 |
| 819 | 3300048915 | Ga0496112_0089225 | Ga0496112_0089225_2045_3001 | 317 |
| 820 | 3300048916 | Ga0496113_0058727 | Ga0496113_0058727_1854_2810 | 317 |
| 821 | 3300048916 | Ga0496113_0334073 | Ga0496113_0334073_142_1098 | 317 |
| 822 | 3300048918 | Ga0496115_0088858 | Ga0496115_0088858_735_1691 | 317 |
| 823 | 3300048918 | Ga0496115_0348319 | Ga0496115_0348319_26_982 | 317 |
| 824 | 3300048919 | Ga0496116_0071172 | Ga0496116_0071172_1086_2042 | 317 |
| 825 | 3300048920 | Ga0496117_0199209 | Ga0496117_0199209_158_1114 | 317 |
| 826 | 3300048923 | Ga0496120_0086090 | Ga0496120_0086090_485_1441 | 317 |
| 827 | 3300048924 | Ga0496121_0066126 | Ga0496121_0066126_35_991 | 317 |
| 828 | 3300048924 | Ga0496121_0151132 | Ga0496121_0151132_395_1351 | 317 |
| 829 | 3300048925 | Ga0496122_0104543 | Ga0496122_0104543_119_1075 | 317 |
| 830 | 3300048926 | Ga0496123_0088520 | Ga0496123_0088520_314_1270 | 317 |
| 831 | 3300048926 | Ga0496123_0111861 | Ga0496123_0111861_354_1310 | 317 |
| 832 | 3300048928 | Ga0496125_0093408 | Ga0496125_0093408_1085_2041 | 317 |
| 833 | 3300048929 | Ga0496126_0024395 | Ga0496126_0024395_4581_5537 | 317 |
| 834 | 3300048929 | Ga0496126_0046669 | Ga0496126_0046669_2282_3238 | 317 |
| 835 | 3300048929 | Ga0496126_0085214 | Ga0496126_0085214_106_1062 | 317 |
| 836 | 3300049571 | Ga0501034_0022087 | Ga0501034_0022087_1355_2311 | 317 |
| 837 | 3300049579 | Ga0501043_0067753 | Ga0501043_0067753_1069_2025 | 317 |
| 838 | 3300049581 | Ga0501047_0203035 | Ga0501047_0203035_853_1809 | 317 |
| 839 | 3300049584 | Ga0501068_0008897 | Ga0501068_0008897_4092_5048 | 317 |
| 840 | 3300049587 | Ga0501071_0030318 | Ga0501071_0030318_2715_3671 | 317 |
| 841 | 3300049823 | Ga0501044_0018528 | Ga0501044_0018528_547_1503 | 317 |
| 842 | 3300049823 | Ga0501044_0107423 | Ga0501044_0107423_403_1359 | 317 |
| 843 | 3300050490 | nmdc:mga03n38_1055_c1 | nmdc:mga03n38_1055_c1_5971_6927 | 317 |
| 844 | 3300050490 | nmdc:mga03n38_10745_c1 | nmdc:mga03n38_10745_c1_1428_2390 | 317 |
| 845 | 3300050490 | nmdc:mga03n38_28573_c1 | nmdc:mga03n38_28573_c1_586_1548 | 317 |
| 846 | 3300050490 | nmdc:mga03n38_51920_c1 | nmdc:mga03n38_51920_c1_562_1518 | 317 |
| 847 | 3300050491 | nmdc:mga00v17_107902_c1 | nmdc:mga00v17_107902_c1_573_1529 | 317 |
| 848 | 3300050491 | nmdc:mga00v17_31246_c1 | nmdc:mga00v17_31246_c1_255_1211 | 317 |
| 849 | 3300050492 | nmdc:mga0yw44_14491_c1 | nmdc:mga0yw44_14491_c1_1423_2379 | 317 |
| 850 | 3300050492 | nmdc:mga0yw44_24043_c1 | nmdc:mga0yw44_24043_c1_2010_2969 | 317 |
| 851 | 3300050492 | nmdc:mga0yw44_24162_c1 | nmdc:mga0yw44_24162_c1_677_1633 | 317 |
| 852 | 3300050492 | nmdc:mga0yw44_26989_c1 | nmdc:mga0yw44_26989_c1_682_1638 | 317 |
| 853 | 3300050492 | nmdc:mga0yw44_62806_c1 | nmdc:mga0yw44_62806_c1_568_1530 | 317 |
| 854 | 3300050494 | nmdc:mga06z11_11047_c1 | nmdc:mga06z11_11047_c1_1668_2630 | 317 |
| 855 | 3300050494 | nmdc:mga06z11_6877_c1 | nmdc:mga06z11_6877_c1_1364_2320 | 317 |
| 856 | 3300050495 | nmdc:mga04h51_31567_c1 | nmdc:mga04h51_31567_c1_186_1142 | 317 |
| 857 | 3300050496 | nmdc:mga07m45_5698_c1 | nmdc:mga07m45_5698_c1_4863_5825 | 317 |
| 858 | 3300050507 | nmdc:mga05p37_106889_c1 | nmdc:mga05p37_106889_c1_482_1438 | 317 |
| 859 | 3300050507 | nmdc:mga05p37_410753_c1 | nmdc:mga05p37_410753_c1_273_1259 | 317 |
| 860 | 3300050508 | nmdc:mga09592_45885_c1 | nmdc:mga09592_45885_c1_2143_3108 | 317 |
| 861 | 3300050509 | nmdc:mga0qj67_185567_c1 | nmdc:mga0qj67_185567_c1_542_1501 | 317 |
| 862 | 3300050510 | nmdc:mga06r32_12511_c1 | nmdc:mga06r32_12511_c1_3092_4078 | 317 |
| 863 | 3300050510 | nmdc:mga06r32_4390_c1 | nmdc:mga06r32_4390_c1_7355_8320 | 317 |
| 864 | 3300053086 | Ga0500578_0220828 | Ga0500578_0220828_29_985 | 317 |
| 865 | 3300053087 | Ga0500643_000016 | Ga0500643_000016_146306_147262 | 317 |
| 866 | 3300053091 | Ga0500647_0022319 | Ga0500647_0022319_161_1117 | 317 |
| 867 | 3300053093 | Ga0500651_0141756 | Ga0500651_0141756_345_1301 | 317 |
| 868 | 3300053095 | Ga0500640_088921 | Ga0500640_088921_237_1193 | 317 |
| 869 | 3300053104 | Ga0500556_0005530 | Ga0500556_0005530_906_1862 | 317 |
| 870 | 3300053105 | Ga0500557_000058 | Ga0500557_000058_16198_17154 | 317 |
| 871 | 3300053109 | Ga0500569_006597 | Ga0500569_006597_827_1783 | 317 |
| 872 | 3300053119 | Ga0500595_001183 | Ga0500595_001183_9584_10543 | 317 |
| 873 | 3300053119 | Ga0500595_030904 | Ga0500595_030904_600_1556 | 317 |
| 874 | 3300053130 | Ga0500642_0000151 | Ga0500642_0000151_1737_2693 | 317 |
| 875 | 3300053130 | Ga0500642_0045614 | Ga0500642_0045614_407_1363 | 317 |
| 876 | 3300053134 | Ga0500658_0071732 | Ga0500658_0071732_141_1097 | 317 |
| 877 | 3300053139 | Ga0500568_0016475 | Ga0500568_0016475_66_1022 | 317 |
| 878 | 3300053153 | Ga0500616_0026790 | Ga0500616_0026790_114_1070 | 317 |
| 879 | 3300053155 | Ga0500620_065597 | Ga0500620_065597_200_1156 | 317 |
| 880 | 3300053156 | Ga0500622_0044158 | Ga0500622_0044158_128_1084 | 317 |
| 881 | 3300053162 | Ga0500638_009653 | Ga0500638_009653_1221_2180 | 317 |
| 882 | 3300053177 | Ga0500636_0000146 | Ga0500636_0000146_15190_16146 | 317 |
| 883 | 3300053178 | Ga0500637_0000138 | Ga0500637_0000138_21735_22694 | 317 |
| 884 | 3300053737 | Ga0500601_000523 | Ga0500601_000523_3261_4217 | 317 |
| 885 | 3300055283 | Ga0500661_000130 | Ga0500661_000130_2341_3300 | 317 |
| 886 | 3300059644 | Ga0587075_003396 | Ga0587075_003396_355_1323 | 317 |
| 887 | iso_pu_bacteria | 8019555841 | 8019563807 | 317 |
| 888 | iso_pu_bacteria | 8019565922 | 8019573873 | 317 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
129
340
0.88
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar