F484771

General Info

Members Datasets Scaffolds Average Seq Length
888 593 646 316

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0033613|Ga0495672_0033613_915_1955
Length 346
Sequence MRNCASGNLGIPGSMLRIAPEWREERHLMSVTTMSSRGVVNRQPGWLARLFDYKPFLIVACLTPAIGLLAVFLTYPLGLGIWLAFTDTTIGRRGVFVGFENFQYLLSDPLWWGAVFYSVFYTAIATFGKFALGFWLALLLNNHFPFKSLLRAIVLLPWIVPTVLSALAFWWIYDPQFSIISYLLVDVLHIRTTNIDFLGTPWPARFSLIAANIWRGIPFVAISLLAGLQTISPSLYEAAMLDGATAWQRFRYITFPMMMPILAIVMTFSIIFTFTDFQLVYAITRGGPVNSTHLLATLAFQRGIAGGELGEGAAIAVSMIPFLVFATLFSYFGLARRKWQQGESND

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
14 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
23 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
24 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
25 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
26 2643221733 Bosea sp. Root381 Isolate Unclassified
27 2643221734 Bosea sp. Root670 Isolate Unclassified
28 2643221736 Bosea sp. Root483D1 Isolate Unclassified
29 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
30 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
31 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
32 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
33 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
34 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
35 2791355199
36 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
37 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
38 2818991467 Bosea vestrisii 3192 Isolate Unclassified
39 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
40 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
41 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
42 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
43 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
44 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
45 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
46 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
47 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
48 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
49 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
50 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
51 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
52 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
53 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
54 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
55 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
56 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
57 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
58 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
59 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
60 2841760612 Bosea sp. Tri-49 Isolate Nodule
61 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
62 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
63 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
64 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
65 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
66 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
67 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
68 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
69 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
70 2844104063 Bosea sp. Tri-39 Isolate Nodule
71 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
72 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
73 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
74 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
75 2851182111 Bosea sp. Tri-44 Isolate Nodule
76 2851246043 Bosea sp. Tri-54 Isolate Nodule
77 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
78 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
79 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
80 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
81 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
82 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
83 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
84 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
85 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
86 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
87 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
88 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
89 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
90 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
91 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
92 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
93 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
94 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
95 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
96 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
97 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
98 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
99 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
100 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
101 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
102 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
103 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
104 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
105 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
106 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
107 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
108 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
109 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
110 2904699407
111 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
112 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
113 2906610324
114 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
115 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
116 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
117 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
118 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
119 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
120 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
121 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
122 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
123 2922368715
124 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
125 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
126 2922425934
127 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
128 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
129 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
130 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
131 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
132 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
133 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
134 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
135 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
136 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
137 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
138 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
139 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
140 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
141 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
142 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
143 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
144 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
145 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
146 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
147 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
148 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
149 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
150 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
151 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
152 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
153 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
154 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
155 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
156 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
157 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
158 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
159 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
160 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
161 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
162 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
163 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
164 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
165 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
166 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
167 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
168 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
169 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
170 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
171 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
172 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
173 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
174 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
175 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
176 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
177 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
178 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
179 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
180 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
181 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
182 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
183 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
184 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
185 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
186 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
187 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
188 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
189 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
190 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
191 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
192 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
193 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
194 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
195 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
196 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
197 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
198 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
199 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
200 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
201 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
202 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
203 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
204 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
205 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
206 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
207 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
208 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
209 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
210 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
211 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
212 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
213 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
214 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
215 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
216 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
217 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
218 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
219 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
220 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
221 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
222 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
223 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
224 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
225 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
226 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
227 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
228 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
229 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
230 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
231 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
232 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
233 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
234 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
235 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
236 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
237 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
238 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
239 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
240 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
241 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
242 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
243 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
244 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
245 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
246 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
247 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
248 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
249 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
250 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
251 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
252 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
253 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
254 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
255 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
256 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
257 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
258 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
259 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
260 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
261 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
262 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
263 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
264 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
265 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
266 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
267 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
268 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
269 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
270 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
271 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
272 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
273 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
274 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
275 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
276 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
277 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
278 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
279 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
280 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
281 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
282 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
283 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
284 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
285 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
286 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
287 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
288 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
289 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
290 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
291 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
292 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
293 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
294 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
295 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
296 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
297 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
298 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
299 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
300 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
301 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
302 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
305 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
306 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
307 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
308 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
309 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
310 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
311 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
312 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
356 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
357 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
358 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
359 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
361 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
364 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
365 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
366 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
367 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
368 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
369 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
370 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
371 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
372 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
373 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
374 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
375 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
376 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
377 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
378 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
379 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
380 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
381 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
382 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
383 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
384 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
385 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
386 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
387 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
388 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
389 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
390 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
391 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
392 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
393 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
394 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
395 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
396 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
397 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
398 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
399 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
400 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
401 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
402 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
403 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
404 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
405 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
406 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
407 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
408 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
409 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
410 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
411 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
412 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
413 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
414 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
415 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
416 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
417 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
418 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
419 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
420 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
421 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
422 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
423 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
424 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
425 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
426 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
427 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
428 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
429 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
430 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
431 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
432 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
433 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
434 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
435 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
436 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
437 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
438 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
439 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
440 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
441 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
442 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
443 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
444 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
445 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
446 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
447 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
448 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
449 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
450 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
451 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
452 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
453 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
454 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
455 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
456 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
457 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
458 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
459 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
460 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
461 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
462 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
463 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
464 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
465 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
466 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
467 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
468 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
469 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
470 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
471 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
472 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
473 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
474 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
475 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
476 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
477 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
478 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
479 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
480 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
481 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
482 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
483 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
484 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
485 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
486 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
487 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
488 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
489 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
490 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
491 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
492 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
493 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
494 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
495 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
496 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
497 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
498 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
499 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
500 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
501 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
502 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
503 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
504 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
505 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
506 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
507 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
508 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
509 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
510 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
511 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
512 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
513 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
514 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
515 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
516 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
517 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
518 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
519 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
520 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
521 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
522 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
523 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
524 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
525 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
526 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
527 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
528 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
529 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
530 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
531 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
532 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
533 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
534 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
535 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
536 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
537 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
538 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
539 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
540 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
541 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
542 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
543 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
544 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
545 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
546 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
547 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
548 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
549 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
550 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
551 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
553 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
554 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
555 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
556 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
557 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
558 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
559 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
560 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
561 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
562 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
563 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
564 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
565 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
566 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
567 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
568 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
569 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
570 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
571 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
572 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
573 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
574 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
575 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
576 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
577 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
578 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
579 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
580 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
581 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
582 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
583 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
584 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
585 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
586 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
587 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
588 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
589 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
590 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
591 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
592 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
593 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.05
Metatranscriptomes 0.11
Isolates 26.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.3
Nodule 20.95
Rhizoplane 4.39
Rhizosphere 46.17
Stem 0
Stem Tuber 0
Unclassified 14.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1005938 3300002987 Bacteria 3746
2 JGI25151J46595_10000052 3300003187 Bacteria 159471
3 JGI25406J46586_10000032 3300003203 Bacteria 67745
4 JGI25406J46586_10000433 3300003203 Bacteria 19355
5 JGI25153J46596_10021591 3300003215 Bacteria 2395
6 JGI25153J46596_10042041 3300003215 Bacteria 1399
7 JGI25160J50197_1007298 3300003354 Bacteria 4345
8 JGI25404J52841_10008508 3300003659 Bacteria 2187
9 Ga0055542_1002606 3300003762 Bacteria 5696
10 Ga0055526_1000017 3300003771 Bacteria 210613
11 Ga0055526_1002207 3300003771 Bacteria 13341
12 Ga0055524_1000014 3300003775 Bacteria 259417
13 Ga0055524_1010792 3300003775 Bacteria 3614
14 Ga0055531_10005960 3300003794 Bacteria 7003
15 Ga0055543_1008492 3300004625 Bacteria 2271
16 Ga0065165_1000313 3300005262 Bacteria 79494
17 Ga0065165_1001376 3300005262 Bacteria 26733
18 Ga0065165_1002335 3300005262 Bacteria 16541
19 Ga0065165_1006843 3300005262 Bacteria 5804
20 Ga0070658_10157912 3300005327 Bacteria 1901
21 Ga0070683_100077150 3300005329 Bacteria 3115
22 Ga0070683_100141173 3300005329 Bacteria 2282
23 Ga0070670_100186591 3300005331 Bacteria 1800
24 Ga0070680_100083267 3300005336 Bacteria 2642
25 Ga0070682_100046835 3300005337 Bacteria 2685
26 Ga0068868_100011310 3300005338 Bacteria 6497
27 Ga0070660_100295789 3300005339 Bacteria 1326
28 Ga0070691_10003977 3300005341 Bacteria 6687
29 Ga0070668_100104940 3300005347 Bacteria 2243
30 Ga0070668_100271542 3300005347 Bacteria 1413
31 Ga0070668_100382221 3300005347 Bacteria 1198
32 Ga0070669_100083475 3300005353 Bacteria 2382
33 Ga0070673_100120662 3300005364 Bacteria 2187
34 Ga0070673_100234202 3300005364 Bacteria 1594
35 Ga0070709_10040228 3300005434 Bacteria 2873
36 Ga0070709_10050791 3300005434 Bacteria 2599
37 Ga0070714_100084443 3300005435 Bacteria 2771
38 Ga0070714_100312896 3300005435 Bacteria 1467
39 Ga0070713_100057350 3300005436 Bacteria 3243
40 Ga0070713_100160398 3300005436 Bacteria 2007
41 Ga0070710_10145871 3300005437 Bacteria 1455
42 Ga0070701_10188722 3300005438 Bacteria 1211
43 Ga0070711_100006483 3300005439 Bacteria 7056
44 Ga0070663_100003863 3300005455 Bacteria 8728
45 Ga0070663_100007767 3300005455 Bacteria 6551
46 Ga0070663_100079113 3300005455 Bacteria 2411
47 Ga0070663_100098615 3300005455 Bacteria 2177
48 Ga0070678_100064819 3300005456 Bacteria 2709
49 Ga0070678_100070667 3300005456 Bacteria 2611
50 Ga0070678_100103857 3300005456 Bacteria 2209
51 Ga0070678_100157444 3300005456 Bacteria 1836
52 Ga0070662_100073817 3300005457 Bacteria 2521
53 Ga0070662_100078804 3300005457 Bacteria 2448
54 Ga0070706_100063277 3300005467 Bacteria 3419
55 Ga0070707_100104189 3300005468 Bacteria 2750
56 Ga0070698_100250591 3300005471 Bacteria 1703
57 Ga0070679_100075900 3300005530 Bacteria 3351
58 Ga0070684_100085029 3300005535 Bacteria 2805
59 Ga0070684_100304214 3300005535 Bacteria 1463
60 Ga0068853_100192064 3300005539 Bacteria 1856
61 Ga0068853_100340430 3300005539 Bacteria 1393
62 Ga0070665_100017918 3300005548 Bacteria 7111
63 Ga0070665_100050535 3300005548 Bacteria 4172
64 Ga0070665_100188677 3300005548 Bacteria 2062
65 Ga0070665_100193682 3300005548 Bacteria 2033
66 Ga0070704_100003315 3300005549 Bacteria 9212
67 Ga0068855_100092061 3300005563 Bacteria 3496
68 Ga0068855_100133728 3300005563 Bacteria 2830
69 Ga0068855_100180701 3300005563 Bacteria 2385
70 Ga0070664_100061891 3300005564 Bacteria 3190
71 Ga0068857_100013484 3300005577 Bacteria 7120
72 Ga0068856_100002849 3300005614 Bacteria 17692
73 Ga0068856_100017546 3300005614 Bacteria 6936
74 Ga0068856_100072955 3300005614 Bacteria 3398
75 Ga0068856_100236398 3300005614 Bacteria 1842
76 Ga0068856_100502207 3300005614 Bacteria 1234
77 Ga0068852_100034684 3300005616 Bacteria 4201
78 Ga0068852_100153881 3300005616 Bacteria 2141
79 Ga0068859_100106673 3300005617 Bacteria 2860
80 Ga0068864_100098797 3300005618 Bacteria 2586
81 Ga0068861_100017897 3300005719 Bacteria 5037
82 Ga0068861_100026690 3300005719 Bacteria 4201
83 Ga0068858_100019766 3300005842 Bacteria 6296
84 Ga0068860_100095846 3300005843 Bacteria 2828
85 Ga0081455_10014280 3300005937 Bacteria 7794
86 Ga0081455_10026724 3300005937 Bacteria 5300
87 Ga0081455_10050536 3300005937 Bacteria 3575
88 Ga0081455_10100081 3300005937 Bacteria 2330
89 Ga0081538_10058444 3300005981 Bacteria 2236
90 Ga0081540_1000338 3300005983 Bacteria 48150
91 Ga0081540_1000876 3300005983 Bacteria 27180
92 Ga0081540_1003442 3300005983 Bacteria 12498
93 Ga0081540_1005310 3300005983 Bacteria 9639
94 Ga0081540_1014249 3300005983 Bacteria 5106
95 Ga0081540_1016517 3300005983 Bacteria 4614
96 Ga0081540_1026537 3300005983 Bacteria 3304
97 Ga0081540_1090239 3300005983 Bacteria 1350
98 Ga0081539_10000129 3300005985 Bacteria 178675
99 Ga0081539_10000549 3300005985 Bacteria 77428
100 Ga0075365_10013919 3300006038 Bacteria 4827
101 Ga0075365_10027326 3300006038 Bacteria 3630
102 Ga0075365_10041585 3300006038 Bacteria 3003
103 Ga0075365_10075885 3300006038 Bacteria 2269
104 Ga0075365_10119058 3300006038 Bacteria 1820
105 Ga0075368_10010701 3300006042 Bacteria 3322
106 Ga0075368_10098583 3300006042 Bacteria 1198
107 Ga0075363_100002563 3300006048 Bacteria 7472
108 Ga0075363_100018134 3300006048 Bacteria 3501
109 Ga0075363_100020378 3300006048 Bacteria 3325
110 Ga0075363_100247188 3300006048 Bacteria 1027
111 Ga0075364_10026756 3300006051 Bacteria 3682
112 Ga0070712_100194163 3300006175 Bacteria 1590
113 Ga0075362_10018021 3300006177 Bacteria 2917
114 Ga0075362_10026316 3300006177 Bacteria 2484
115 Ga0075362_10049775 3300006177 Bacteria 1872
116 Ga0075367_10002436 3300006178 Bacteria 8500
117 Ga0075367_10008820 3300006178 Bacteria 5245
118 Ga0075367_10037362 3300006178 Bacteria 2821
119 Ga0075367_10045189 3300006178 Bacteria 2584
120 Ga0075367_10060940 3300006178 Bacteria 2251
121 Ga0075367_10101703 3300006178 Bacteria 1757
122 Ga0075369_10031201 3300006186 Bacteria 2247
123 Ga0075369_10069969 3300006186 Bacteria 1543
124 Ga0075366_10025251 3300006195 Bacteria 3469
125 Ga0075366_10096587 3300006195 Bacteria 1771
126 Ga0075370_10024705 3300006353 Bacteria 3321
127 Ga0075428_100019515 3300006844 Bacteria 7503
128 Ga0075428_100092179 3300006844 Bacteria 3303
129 Ga0075428_100097827 3300006844 Bacteria 3200
130 Ga0075428_100179315 3300006844 Bacteria 2293
131 Ga0075430_100036628 3300006846 Bacteria 4160
132 Ga0075430_100111696 3300006846 Bacteria 2279
133 Ga0075431_100000986 3300006847 Bacteria 25337
134 Ga0075431_100004249 3300006847 Bacteria 14032
135 Ga0075429_100013820 3300006880 Bacteria 7001
136 Ga0075429_100073335 3300006880 Bacteria 2982
137 Ga0097620_100106674 3300006931 Bacteria 2860
138 Ga0099824_1008180 3300006942 Bacteria 13469
139 Ga0099824_1012471 3300006942 Bacteria 9249
140 Ga0099822_1007748 3300006943 Bacteria 13828
141 Ga0075435_100482419 3300007076 Bacteria 1071
142 Ga0105240_10002375 3300009093 Bacteria 30348
143 Ga0105240_10317934 3300009093 Bacteria 1775
144 Ga0111539_10004845 3300009094 Bacteria 17538
145 Ga0105245_10063949 3300009098 Bacteria 3325
146 Ga0114129_10004791 3300009147 Bacteria 19126
147 Ga0114129_10581912 3300009147 Bacteria 1452
148 Ga0114129_10606425 3300009147 Bacteria 1418
149 Ga0105243_10066447 3300009148 Bacteria 2900
150 Ga0105243_10368374 3300009148 Bacteria 1325
151 Ga0105241_10067653 3300009174 Bacteria 2765
152 Ga0105242_10345458 3300009176 Bacteria 1373
153 Ga0105248_10207825 3300009177 Bacteria 2206
154 Ga0105248_10409107 3300009177 Bacteria 1527
155 Ga0105237_10163828 3300009545 Bacteria 2222
156 Ga0105238_10074040 3300009551 Bacteria 3399
157 Ga0105238_10177560 3300009551 Bacteria 2106
158 Ga0105249_10068969 3300009553 Bacteria 3263
159 Ga0105239_10075123 3300010375 Bacteria 3715
160 Ga0105239_10089511 3300010375 Bacteria 3394
161 Ga0105239_10214163 3300010375 Bacteria 2159
162 Ga0105239_10290755 3300010375 Bacteria 1840
163 Ga0105239_10365033 3300010375 Bacteria 1631
164 Ga0105246_10032074 3300011119 Bacteria 3481
165 Ga0157370_10023801 3300013104 Bacteria 6076
166 Ga0157370_10059485 3300013104 Bacteria 3631
167 Ga0157369_10198380 3300013105 Bacteria 2107
168 Ga0171462_1012 3300013250 Bacteria 208216
169 Ga0157374_10495097 3300013296 Bacteria 1226
170 Ga0157375_10073454 3300013308 Bacteria 3439
171 Ga0157375_10097352 3300013308 Bacteria 3017
172 Ga0163163_10101915 3300014325 Bacteria 2893
173 Ga0163163_10153044 3300014325 Bacteria 2349
174 Ga0163163_10322886 3300014325 Bacteria 1597
175 Ga0157380_10159845 3300014326 Bacteria 1957
176 Ga0157377_10017758 3300014745 Bacteria 3686
177 Ga0157379_10296581 3300014968 Bacteria 1473
178 Ga0157379_10474188 3300014968 Bacteria 1158
179 Ga0157376_10155978 3300014969 Bacteria 2064
180 Ga0214544_1000005 3300021320 Bacteria 387675
181 Ga0214542_1000004 3300021321 Bacteria 415597
182 Ga0214545_1000005 3300021324 Bacteria 415590
183 Ga0214543_1000564 3300021327 Bacteria 63531
184 Ga0213873_10006356 3300021358 Bacteria 2321
185 Ga0213874_10003165 3300021377 Bacteria 3626
186 Ga0213876_10009074 3300021384 Bacteria 5355
187 Ga0213876_10064040 3300021384 Bacteria 1941
188 Ga0213875_10001033 3300021388 Bacteria 19652
189 Ga0213875_10003029 3300021388 Bacteria 9747
190 Ga0213875_10004683 3300021388 Bacteria 7452
191 Ga0213875_10006053 3300021388 Bacteria 6406
192 Ga0213875_10007237 3300021388 Bacteria 5755
193 Ga0209677_101562 3300025253 Bacteria 9737
194 Ga0209148_1000367 3300025254 Bacteria 55809
195 Ga0209673_1015067 3300025273 Bacteria 2957
196 Ga0209130_1000209 3300025284 Bacteria 78300
197 Ga0209025_1000017 3300025294 Bacteria 768983
198 Ga0209025_1003934 3300025294 Bacteria 13351
199 Ga0209025_1030103 3300025294 Bacteria 2607
200 Ga0209564_1000031 3300025295 Bacteria 494703
201 Ga0209564_1002546 3300025295 Bacteria 14040
202 Ga0209758_1000102 3300025297 Bacteria 224851
203 Ga0209758_1000732 3300025297 Bacteria 48005
204 Ga0209758_1004116 3300025297 Bacteria 12460
205 Ga0209758_1006909 3300025297 Bacteria 7927
206 Ga0209758_1007061 3300025297 Bacteria 7787
207 Ga0209758_1021066 3300025297 Bacteria 3054
208 Ga0209758_1022195 3300025297 Bacteria 2923
209 Ga0209256_1000033 3300025299 Bacteria 393924
210 Ga0209256_1000181 3300025299 Bacteria 123624
211 Ga0209256_1002569 3300025299 Bacteria 14499
212 Ga0209256_1023170 3300025299 Bacteria 1859
213 Ga0207426_1000354 3300025302 Bacteria 83734
214 Ga0207426_1000521 3300025302 Bacteria 55976
215 Ga0207426_1019010 3300025302 Bacteria 2410
216 Ga0209257_1001340 3300025304 Bacteria 29845
217 Ga0207692_10067322 3300025898 Bacteria 1874
218 Ga0207710_10086764 3300025900 Bacteria 1459
219 Ga0207688_10110378 3300025901 Bacteria 1596
220 Ga0207688_10110951 3300025901 Bacteria 1592
221 Ga0207685_10019898 3300025905 Bacteria 2220
222 Ga0207699_10022267 3300025906 Bacteria 3431
223 Ga0207699_10036133 3300025906 Bacteria 2814
224 Ga0207643_10039276 3300025908 Bacteria 2662
225 Ga0207684_10137561 3300025910 Bacteria 2098
226 Ga0207695_10000006 3300025913 Bacteria 1135309
227 Ga0207695_10279906 3300025913 Bacteria 1562
228 Ga0207671_10014045 3300025914 Bacteria 6350
229 Ga0207693_10010582 3300025915 Bacteria 7485
230 Ga0207693_10131009 3300025915 Bacteria 1971
231 Ga0207693_10135623 3300025915 Bacteria 1935
232 Ga0207663_10105062 3300025916 Bacteria 1905
233 Ga0207657_10022030 3300025919 Bacteria 5983
234 Ga0207657_10060743 3300025919 Bacteria 3243
235 Ga0207657_10165466 3300025919 Bacteria 1794
236 Ga0207657_10314873 3300025919 Bacteria 1238
237 Ga0207649_10085137 3300025920 Bacteria 2057
238 Ga0207652_10025038 3300025921 Bacteria 4958
239 Ga0207652_10075415 3300025921 Bacteria 2939
240 Ga0207646_10148962 3300025922 Bacteria 2110
241 Ga0207694_10133485 3300025924 Bacteria 1991
242 Ga0207694_10314015 3300025924 Bacteria 1292
243 Ga0207687_10035517 3300025927 Bacteria 3390
244 Ga0207687_10071054 3300025927 Bacteria 2486
245 Ga0207700_10010378 3300025928 Bacteria 5873
246 Ga0207700_10415950 3300025928 Bacteria 1180
247 Ga0207664_10075358 3300025929 Bacteria 2728
248 Ga0207706_10091630 3300025933 Bacteria 2672
249 Ga0207709_10103518 3300025935 Bacteria 1887
250 Ga0207669_10107806 3300025937 Bacteria 1859
251 Ga0207704_10236102 3300025938 Bacteria 1363
252 Ga0207704_10268073 3300025938 Bacteria 1291
253 Ga0207665_10117331 3300025939 Bacteria 1877
254 Ga0207691_10271155 3300025940 Bacteria 1461
255 Ga0207691_10332186 3300025940 Bacteria 1302
256 Ga0207711_10092919 3300025941 Bacteria 2656
257 Ga0207661_10001876 3300025944 Bacteria 14409
258 Ga0207661_10125207 3300025944 Bacteria 2194
259 Ga0207679_10018807 3300025945 Bacteria 4635
260 Ga0207679_10104507 3300025945 Bacteria 2222
261 Ga0207667_10151422 3300025949 Bacteria 2387
262 Ga0207667_10315544 3300025949 Bacteria 1597
263 Ga0207667_10530269 3300025949 Bacteria 1192
264 Ga0207651_10086245 3300025960 Bacteria 2281
265 Ga0207712_10103795 3300025961 Bacteria 2118
266 Ga0207668_10288281 3300025972 Bacteria 1349
267 Ga0207640_10078190 3300025981 Bacteria 2251
268 Ga0207640_10091170 3300025981 Bacteria 2111
269 Ga0207677_10012388 3300026023 Bacteria 4900
270 Ga0207703_10028003 3300026035 Bacteria 4437
271 Ga0207703_10258870 3300026035 Bacteria 1572
272 Ga0207703_10345365 3300026035 Bacteria 1369
273 Ga0207639_10179965 3300026041 Bacteria 1798
274 Ga0207678_10016363 3300026067 Bacteria 6512
275 Ga0207678_10032802 3300026067 Bacteria 4526
276 Ga0207678_10059021 3300026067 Bacteria 3301
277 Ga0207678_10127113 3300026067 Bacteria 2174
278 Ga0207702_10000325 3300026078 Bacteria 54690
279 Ga0207702_10030533 3300026078 Bacteria 4491
280 Ga0207702_10155367 3300026078 Bacteria 2085
281 Ga0207702_10313442 3300026078 Bacteria 1492
282 Ga0207641_10166993 3300026088 Bacteria 2005
283 Ga0207648_10393146 3300026089 Bacteria 1255
284 Ga0207674_10110649 3300026116 Bacteria 2722
285 Ga0207683_10042482 3300026121 Bacteria 3971
286 Ga0207683_10052354 3300026121 Bacteria 3576
287 Ga0207683_10099071 3300026121 Bacteria 2601
288 Ga0207698_10005512 3300026142 Bacteria 7828
289 Ga0207698_10033601 3300026142 Bacteria 3729
290 Ga0209389_1000021 3300027296 Bacteria 169506
291 Ga0209389_1000086 3300027296 Bacteria 84925
292 Ga0209589_1000005 3300027357 Bacteria 530958
293 Ga0209589_1000027 3300027357 Bacteria 155295
294 Ga0209489_100005 3300027361 Bacteria 530958
295 Ga0209489_100313 3300027361 Bacteria 85507
296 Ga0209489_105143 3300027361 Bacteria 23183
297 Ga0209700_100006 3300027363 Bacteria 530958
298 Ga0209700_100483 3300027363 Bacteria 74857
299 Ga0209588_1016301 3300027671 Bacteria 2293
300 Ga0207428_10121684 3300027907 Bacteria 2001
301 Ga0207428_10122668 3300027907 Bacteria 1992
302 Ga0268266_10015155 3300028379 Bacteria 6618
303 Ga0268266_10018333 3300028379 Bacteria 5966
304 Ga0268266_10026503 3300028379 Bacteria 4932
305 Ga0268266_10128844 3300028379 Bacteria 2261
306 Ga0268266_10143467 3300028379 Bacteria 2145
307 Ga0268264_10113998 3300028381 Bacteria 2372
308 Ga0268264_10180154 3300028381 Bacteria 1918
309 Ga0307515_10021681 3300028794 Bacteria 11371
310 Ga0307513_10320295 3300031456 Bacteria 1309
311 Ga0307509_10145855 3300031507 Bacteria 2293
312 Ga0307408_100046459 3300031548 Bacteria 3106
313 Ga0307516_10016844 3300031730 Bacteria 7630
314 Ga0307516_10023182 3300031730 Bacteria 6367
315 Ga0307412_10122930 3300031911 Bacteria 1872
316 Ga0307409_100293167 3300031995 Bacteria 1509
317 Ga0307510_10035866 3300033180 Bacteria 5530
318 Ga0307510_10067387 3300033180 Bacteria 3604
319 Ga0315911_1000040 3300033442 Bacteria 50766
320 Ga0373926_0015173 3300035083 Bacteria 2625
321 Ga0373923_0012011 3300035111 Bacteria 3191
322 Ga0373923_0018161 3300035111 Bacteria 2702
323 Ga0373936_0005491 3300035113 Bacteria 4783
324 Ga0373936_0163871 3300035113 Bacteria 969
325 Ga0373954_0020662 3300035118 Bacteria 2980
326 Ga0373943_0019790 3300035170 Bacteria 3099
327 Ga0373955_0051944 3300035172 Bacteria 2234
328 Ga0373935_0108905 3300035692 Bacteria 1836
329 Ga0373935_0127238 3300035692 Bacteria 1708
330 Ga0373927_0002111 3300035695 Bacteria 14657
331 Ga0373927_0095269 3300035695 Bacteria 1934
332 Ga0373927_0111572 3300035695 Bacteria 1782
333 Ga0373933_0067749 3300035724 Bacteria 2166
334 Ga0373947_0057121 3300035725 Bacteria 2360
335 Ga0373937_0191104 3300036401 Bacteria 1924
336 Ga0373925_0119797 3300037068 Bacteria 2042
337 Ga0395900_0003232 3300037418 Bacteria 17642
338 Ga0395900_0008561 3300037418 Bacteria 10519
339 Ga0395900_0029800 3300037418 Bacteria 5601
340 Ga0395900_0121556 3300037418 Bacteria 2679
341 Ga0395898_0007511 3300037466 Bacteria 11584
342 Ga0395898_0009099 3300037466 Bacteria 10459
343 Ga0395898_0147177 3300037466 Bacteria 2254
344 Ga0395905_0002158 3300037471 Bacteria 22308
345 Ga0436364_0063930 3300037853 Bacteria 4672
346 Ga0436364_0103156 3300037853 Bacteria 17490
347 Ga0436364_0533917 3300037853 Bacteria 9986
348 Ga0436364_0601659 3300037853 Bacteria 2760
349 Ga0436364_0623979 3300037853 Bacteria 1827
350 Ga0436364_0642169 3300037853 Bacteria 25731
351 Ga0436364_0659865 3300037853 Bacteria 47070
352 Ga0436364_0674187 3300037853 Bacteria 9456
353 Ga0436364_0831688 3300037853 Bacteria 1784
354 Ga0436364_1379234 3300037853 Bacteria 5061
355 Ga0436364_1558822 3300037853 Bacteria 1898
356 Ga0395901_0011181 3300038443 Bacteria 9096
357 Ga0395901_0012192 3300038443 Bacteria 8723
358 Ga0395901_0044480 3300038443 Bacteria 4606
359 Ga0395901_0358781 3300038443 Bacteria 1503
360 Ga0395901_0444016 3300038443 Bacteria 1327
361 Ga0436365_0138565 3300039437 Bacteria 8501
362 Ga0436365_0481731 3300039437 Bacteria 2890
363 Ga0436365_0879300 3300039437 Bacteria 3197
364 Ga0436365_1246836 3300039437 Bacteria 2599
365 Ga0436365_1339798 3300039437 Bacteria 2368
366 Ga0436365_1453543 3300039437 Bacteria 3621
367 Ga0436365_1535876 3300039437 Bacteria 20439
368 Ga0436365_1736919 3300039437 Bacteria 6655
369 Ga0436360_0178193 3300039438 Bacteria 6576
370 Ga0436361_0606306 3300039447 Bacteria 2508
371 Ga0436363_0282535 3300039450 Bacteria 16541
372 Ga0436363_0472610 3300039450 Bacteria 6308
373 Ga0436363_0839057 3300039450 Bacteria 2212
374 Ga0436363_1333206 3300039450 Bacteria 1028
375 Ga0436363_1477180 3300039450 Bacteria 2712
376 Ga0436362_0822437 3300039453 Bacteria 5872
377 Ga0439461_0033868 3300041410 Bacteria 1077
378 Ga0439465_0053312 3300041413 Bacteria 1328
379 Ga0451807_0299519 3300041486 Bacteria 1391
380 Ga0466969_0039103 3300044656 Bacteria 2384
381 Ga0466972_0000266 3300044658 Bacteria 33408
382 Ga0466972_0002615 3300044658 Bacteria 8923
383 Ga0466965_0031828 3300044683 Bacteria 2574
384 Ga0466966_0013523 3300044684 Bacteria 5403
385 Ga0466961_0000172 3300044693 Bacteria 44200
386 Ga0466963_0005504 3300044694 Bacteria 7413
387 Ga0466963_0005645 3300044694 Bacteria 7346
388 Ga0466963_0035553 3300044694 Bacteria 3246
389 Ga0466964_0041684 3300044706 Bacteria 1858
390 Ga0466968_0021379 3300044735 Bacteria 2620
391 Ga0466957_0006661 3300044842 Bacteria 6532
392 Ga0466957_0105284 3300044842 Bacteria 1783
393 Ga0466960_0031566 3300044901 Bacteria 2446
394 Ga0466959_0004055 3300045049 Bacteria 9744
395 Ga0451576_0000231 3300045051 Bacteria 136040
396 Ga0451576_0400232 3300045051 Bacteria 1440
397 Ga0466958_0160827 3300045836 Bacteria 1419
398 Ga0466967_0008224 3300045976 Bacteria 7620
399 Ga0466967_0013600 3300045976 Bacteria 6297
400 Ga0466967_0498387 3300045976 Bacteria 1195
401 Ga0495592_0099056 3300046454 Bacteria 2080
402 Ga0495603_0001315 3300046455 Bacteria 14430
403 Ga0495603_0045157 3300046455 Bacteria 2628
404 Ga0495629_0017140 3300046459 Bacteria 5196
405 Ga0495638_0004161 3300046460 Bacteria 11032
406 Ga0495638_0040440 3300046460 Bacteria 2955
407 Ga0495638_0117956 3300046460 Bacteria 1570
408 Ga0495651_0017859 3300046462 Bacteria 5492
409 Ga0495651_0019144 3300046462 Bacteria 5304
410 Ga0495580_0000514 3300046472 Bacteria 32568
411 Ga0495580_0113791 3300046472 Bacteria 1879
412 Ga0495582_0003610 3300046473 Bacteria 8716
413 Ga0495582_0105771 3300046473 Bacteria 1578
414 Ga0495639_0000101 3300046475 Bacteria 42348
415 Ga0495662_0000117 3300046476 Bacteria 29710
416 Ga0495664_0006748 3300046477 Bacteria 6348
417 Ga0495664_0014068 3300046477 Bacteria 4533
418 Ga0495664_0058826 3300046477 Bacteria 2287
419 Ga0495584_0075183 3300046491 Bacteria 1698
420 Ga0495585_0116629 3300046492 Bacteria 1416
421 Ga0495594_0000083 3300046499 Bacteria 42703
422 Ga0495594_0232242 3300046499 Bacteria 1051
423 Ga0495607_0081770 3300046501 Bacteria 1774
424 Ga0495583_0110714 3300046506 Bacteria 1164
425 Ga0495606_0004349 3300046507 Bacteria 14214
426 Ga0495606_0060549 3300046507 Bacteria 2424
427 Ga0495606_0088765 3300046507 Bacteria 1905
428 Ga0495608_0003835 3300046511 Bacteria 10806
429 Ga0495610_0051064 3300046512 Bacteria 2015
430 Ga0495618_0059561 3300046514 Bacteria 2420
431 Ga0495628_0012656 3300046516 Bacteria 7108
432 Ga0495630_0001944 3300046517 Bacteria 14381
433 Ga0495632_0107665 3300046519 Bacteria 1310
434 Ga0495632_0112071 3300046519 Bacteria 1280
435 Ga0495643_0029682 3300046522 Bacteria 3058
436 Ga0495648_0158237 3300046524 Bacteria 1174
437 Ga0495666_0060141 3300046526 Bacteria 1816
438 Ga0495652_0015106 3300046529 Bacteria 6917
439 Ga0495652_0029484 3300046529 Bacteria 4820
440 Ga0495665_0000055 3300046531 Bacteria 45208
441 Ga0495640_0002279 3300046533 Bacteria 15390
442 Ga0495586_0150763 3300046535 Bacteria 1308
443 Ga0495609_0065035 3300046538 Bacteria 1608
444 Ga0495621_0028933 3300046539 Bacteria 1886
445 Ga0495645_0027914 3300046543 Bacteria 4100
446 Ga0495645_0035625 3300046543 Bacteria 3627
447 Ga0495645_0198010 3300046543 Bacteria 1365
448 Ga0495622_0011851 3300046557 Bacteria 4031
449 Ga0495622_0123777 3300046557 Bacteria 1180
450 Ga0495633_0092098 3300046558 Bacteria 1409
451 Ga0495667_0003327 3300046559 Bacteria 10762
452 Ga0495656_0022359 3300046615 Bacteria 2475
453 Ga0495668_0243084 3300046616 Bacteria 985
454 Ga0495634_0000720 3300046642 Bacteria 32017
455 Ga0495634_0013784 3300046642 Bacteria 5838
456 Ga0495611_0060615 3300046648 Bacteria 1719
457 Ga0495625_0074182 3300046660 Bacteria 2383
458 Ga0495625_0220134 3300046660 Bacteria 1244
459 Ga0495635_0004704 3300046663 Bacteria 9483
460 Ga0495635_0042909 3300046663 Bacteria 3122
461 Ga0495635_0045446 3300046663 Bacteria 3030
462 Ga0495659_0028941 3300046664 Bacteria 1920
463 Ga0495588_0004531 3300046674 Bacteria 6144
464 Ga0495588_0024877 3300046674 Bacteria 2978
465 Ga0495588_0039281 3300046674 Bacteria 2410
466 Ga0495599_0008275 3300046678 Bacteria 6323
467 Ga0495599_0029287 3300046678 Bacteria 3451
468 Ga0495599_0173750 3300046678 Bacteria 1329
469 Ga0495646_0009997 3300046680 Bacteria 6032
470 Ga0495647_0010156 3300046681 Bacteria 3201
471 Ga0495647_0072458 3300046681 Bacteria 1382
472 Ga0495658_0001206 3300046683 Bacteria 13594
473 Ga0495613_0128172 3300046689 Bacteria 1818
474 Ga0495624_0001822 3300046690 Bacteria 16263
475 Ga0495671_0052978 3300046692 Bacteria 2015
476 Ga0495600_0033814 3300046809 Bacteria 3319
477 Ga0495600_0120154 3300046809 Bacteria 1709
478 Ga0495600_0154096 3300046809 Bacteria 1487
479 Ga0495581_0000041 3300047315 Bacteria 46518
480 Ga0495581_0020587 3300047315 Bacteria 3827
481 Ga0495581_0027606 3300047315 Bacteria 3292
482 Ga0495581_0112206 3300047315 Bacteria 1585
483 Ga0495604_0009181 3300047317 Bacteria 7826
484 Ga0495674_0007683 3300047319 Bacteria 10298
485 Ga0495674_0024255 3300047319 Bacteria 5575
486 Ga0495674_0030974 3300047319 Bacteria 4861
487 Ga0495674_0101026 3300047319 Bacteria 2454
488 Ga0495672_0007300 3300047320 Bacteria 8336
489 Ga0495672_0011899 3300047320 Bacteria 6105
490 Ga0495672_0033613 3300047320 Bacteria 3176
491 Ga0495687_012044 3300047443 Bacteria 4598
492 Ga0495675_0006818 3300047444 Bacteria 7006
493 Ga0495673_0033572 3300047469 Bacteria 2380
494 Ga0495684_0007286 3300047471 Bacteria 8572
495 Ga0495684_0014082 3300047471 Bacteria 6151
496 Ga0495684_0051088 3300047471 Bacteria 3156
497 Ga0495684_0142581 3300047471 Bacteria 1796
498 Ga0495593_0000024 3300047673 Bacteria 65718
499 Ga0495602_0196729 3300048088 Bacteria 1541
500 Ga0496100_0020009 3300048903 Bacteria 4006
501 Ga0496101_0030168 3300048904 Bacteria 3799
502 Ga0496101_0268151 3300048904 Bacteria 1332
503 Ga0496102_0068588 3300048905 Bacteria 3254
504 Ga0496102_0076537 3300048905 Bacteria 3078
505 Ga0496102_0173241 3300048905 Bacteria 2031
506 Ga0496104_0005208 3300048907 Bacteria 11372
507 Ga0496104_0007795 3300048907 Bacteria 9490
508 Ga0496104_0058381 3300048907 Bacteria 3652
509 Ga0496104_0082985 3300048907 Bacteria 3056
510 Ga0496105_0028872 3300048908 Bacteria 4538
511 Ga0496105_0080570 3300048908 Bacteria 2689
512 Ga0496106_0076391 3300048909 Bacteria 2567
513 Ga0496106_0162042 3300048909 Bacteria 1769
514 Ga0496107_0015042 3300048910 Bacteria 5421
515 Ga0496107_0265811 3300048910 Bacteria 1276
516 Ga0496108_0007612 3300048911 Bacteria 8769
517 Ga0496108_0051120 3300048911 Bacteria 3462
518 Ga0496108_0069747 3300048911 Bacteria 2966
519 Ga0496108_0087600 3300048911 Bacteria 2644
520 Ga0496109_0021076 3300048912 Bacteria 5763
521 Ga0496109_0087818 3300048912 Bacteria 2872
522 Ga0496109_0214121 3300048912 Bacteria 1812
523 Ga0496110_0205528 3300048913 Bacteria 1790
524 Ga0496110_0269712 3300048913 Bacteria 1549
525 Ga0496111_0032362 3300048914 Bacteria 3728
526 Ga0496112_0000015 3300048915 Bacteria 206423
527 Ga0496112_0012721 3300048915 Bacteria 7738
528 Ga0496112_0089225 3300048915 Bacteria 3051
529 Ga0496113_0055604 3300048916 Bacteria 2967
530 Ga0496113_0058727 3300048916 Bacteria 2895
531 Ga0496113_0334073 3300048916 Bacteria 1215
532 Ga0496114_0019685 3300048917 Bacteria 5470
533 Ga0496115_0002706 3300048918 Bacteria 12727
534 Ga0496115_0088858 3300048918 Bacteria 2523
535 Ga0496115_0186680 3300048918 Bacteria 1713
536 Ga0496115_0348319 3300048918 Bacteria 1208
537 Ga0496116_0071172 3300048919 Bacteria 2203
538 Ga0496117_0199209 3300048920 Bacteria 1133
539 Ga0496119_0012116 3300048922 Bacteria 7041
540 Ga0496120_0086090 3300048923 Bacteria 1690
541 Ga0496121_0000406 3300048924 Bacteria 85761
542 Ga0496121_0066126 3300048924 Bacteria 2937
543 Ga0496121_0071470 3300048924 Bacteria 2790
544 Ga0496121_0151132 3300048924 Bacteria 1708
545 Ga0496122_0065829 3300048925 Bacteria 2624
546 Ga0496122_0104543 3300048925 Bacteria 1881
547 Ga0496123_0088520 3300048926 Bacteria 1848
548 Ga0496123_0111861 3300048926 Bacteria 1559
549 Ga0496124_0118113 3300048927 Bacteria 2123
550 Ga0496125_0093408 3300048928 Bacteria 2245
551 Ga0496126_0021020 3300048929 Bacteria 6387
552 Ga0496126_0024395 3300048929 Bacteria 5840
553 Ga0496126_0046669 3300048929 Bacteria 3970
554 Ga0496126_0061739 3300048929 Bacteria 3365
555 Ga0496126_0085214 3300048929 Bacteria 2786
556 Ga0501034_0022087 3300049571 Bacteria 6482
557 Ga0501043_0067753 3300049579 Bacteria 2803
558 Ga0501046_0019753 3300049580 Bacteria 5583
559 Ga0501047_0032125 3300049581 Bacteria 5066
560 Ga0501047_0203035 3300049581 Bacteria 1842
561 Ga0501068_0008897 3300049584 Bacteria 5602
562 Ga0501070_0117503 3300049586 Bacteria 2197
563 Ga0501071_0030318 3300049587 Bacteria 3825
564 Ga0501075_0209857 3300049591 Bacteria 1486
565 Ga0501080_0014452 3300049742 Bacteria 7272
566 Ga0501044_0018528 3300049823 Bacteria 7459
567 Ga0501044_0029495 3300049823 Bacteria 5784
568 Ga0501044_0072326 3300049823 Bacteria 3506
569 Ga0501044_0107423 3300049823 Bacteria 2802
570 nmdc:mga03683_19961_c1 3300050489 Bacteria 2565
571 nmdc:mga03683_21707_c1 3300050489 Bacteria 2480
572 nmdc:mga03n38_1055_c1 3300050490 Bacteria 7595
573 nmdc:mga03n38_10745_c1 3300050490 Bacteria 3383
574 nmdc:mga03n38_28573_c1 3300050490 Bacteria 2326
575 nmdc:mga03n38_51920_c1 3300050490 Bacteria 1833
576 nmdc:mga00v17_107902_c1 3300050491 Bacteria 1764
577 nmdc:mga00v17_31246_c1 3300050491 Bacteria 3139
578 nmdc:mga0yw44_14491_c1 3300050492 Bacteria 3843
579 nmdc:mga0yw44_24043_c1 3300050492 Bacteria 3442
580 nmdc:mga0yw44_24162_c1 3300050492 Bacteria 3435
581 nmdc:mga0yw44_26989_c1 3300050492 Bacteria 3285
582 nmdc:mga0yw44_316655_c1 3300050492 Bacteria 1047
583 nmdc:mga0yw44_62806_c1 3300050492 Bacteria 2282
584 nmdc:mga0yw44_7443_c1 3300050492 Bacteria 5387
585 nmdc:mga06z11_11047_c1 3300050494 Bacteria 3876
586 nmdc:mga06z11_6877_c1 3300050494 Bacteria 4652
587 nmdc:mga06z11_69332_c1 3300050494 Bacteria 1861
588 nmdc:mga04h51_31567_c1 3300050495 Bacteria 1675
589 nmdc:mga07m45_169755_c1 3300050496 Bacteria 1268
590 nmdc:mga07m45_5698_c1 3300050496 Bacteria 6228
591 nmdc:mga05p37_106889_c1 3300050507 Bacteria 3443
592 nmdc:mga05p37_3181_c1 3300050507 Bacteria 19102
593 nmdc:mga05p37_410753_c1 3300050507 Bacteria 1270
594 nmdc:mga09592_45885_c1 3300050508 Bacteria 3680
595 nmdc:mga09592_53176_c1 3300050508 Bacteria 2063
596 nmdc:mga09592_8656_c1 3300050508 Bacteria 8280
597 nmdc:mga0qj67_101195_c1 3300050509 Bacteria 2323
598 nmdc:mga0qj67_185567_c1 3300050509 Bacteria 1689
599 nmdc:mga0qj67_5521_c1 3300050509 Bacteria 9244
600 nmdc:mga06r32_12511_c1 3300050510 Bacteria 7658
601 nmdc:mga06r32_3795_c1 3300050510 Bacteria 13525
602 nmdc:mga06r32_4390_c1 3300050510 Bacteria 12611
603 nmdc:mga08y16_149632_c1 3300050511 Bacteria 2427
604 nmdc:mga08y16_204_c3 3300050511 Bacteria 8325
605 nmdc:mga0rr50_502528_c1 3300050513 Bacteria 1031
606 Ga0500635_0002338 3300053080 Bacteria 4684
607 Ga0500578_0220828 3300053086 Bacteria 1152
608 Ga0500643_000016 3300053087 Bacteria 309502
609 Ga0500644_0121407 3300053088 Bacteria 1019
610 Ga0500647_0022319 3300053091 Bacteria 2960
611 Ga0500651_0011118 3300053093 Bacteria 5417
612 Ga0500651_0141756 3300053093 Bacteria 1448
613 Ga0500640_088921 3300053095 Bacteria 1297
614 Ga0500641_0018213 3300053096 Bacteria 2638
615 Ga0500554_001920 3300053102 Bacteria 4023
616 Ga0500556_0005530 3300053104 Bacteria 3567
617 Ga0500557_000058 3300053105 Bacteria 45990
618 Ga0500569_006597 3300053109 Bacteria 2557
619 Ga0500592_009756 3300053116 Bacteria 1527
620 Ga0500595_001183 3300053119 Bacteria 14392
621 Ga0500595_002181 3300053119 Bacteria 9945
622 Ga0500595_002664 3300053119 Bacteria 8681
623 Ga0500595_030904 3300053119 Bacteria 1800
624 Ga0500642_0000151 3300053130 Bacteria 29364
625 Ga0500642_0045614 3300053130 Bacteria 1913
626 Ga0500658_0071732 3300053134 Bacteria 1463
627 Ga0500568_0016475 3300053139 Bacteria 3285
628 Ga0500589_058019 3300053147 Bacteria 1781
629 Ga0500603_001115 3300053150 Bacteria 6276
630 Ga0500616_0026790 3300053153 Bacteria 3187
631 Ga0500616_0026922 3300053153 Bacteria 3178
632 Ga0500620_065597 3300053155 Bacteria 1242
633 Ga0500622_0044158 3300053156 Bacteria 2309
634 Ga0500622_0076701 3300053156 Bacteria 1680
635 Ga0500627_0117080 3300053158 Bacteria 1201
636 Ga0500634_0202198 3300053161 Bacteria 871
637 Ga0500638_009653 3300053162 Bacteria 4187
638 Ga0500636_0000146 3300053177 Bacteria 37168
639 Ga0500636_0001753 3300053177 Bacteria 11889
640 Ga0500637_0000138 3300053178 Bacteria 26740
641 Ga0500637_0002536 3300053178 Bacteria 8148
642 Ga0500625_054324 3300053729 Bacteria 1840
643 Ga0500645_018897 3300053730 Bacteria 2147
644 Ga0500601_000523 3300053737 Bacteria 5788
645 Ga0500661_000130 3300055283 Bacteria 12645
646 Ga0587075_003396 3300059644 Bacteria 1773

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053161 Ga0500634_0202198 Ga0500634_0202198_23_859 278
2 iso_pu_bacteria 8019547302 8019551264 278
3 iso_pu_bacteria 2879110137 2879113819 284
4 iso_pu_bacteria 8006984368 8006991277 284
5 iso_pu_bacteria 8016530956 8016538082 284
6 iso_pu_bacteria 8016613128 8016620023 284
7 iso_pu_bacteria 8019668869 8019674980 284
8 3300050508 nmdc:mga09592_53176_c1 nmdc:mga09592_53176_c1_98_955 285
9 3300046558 Ga0495633_0092098 Ga0495633_0092098_533_1396 287
10 3300050496 nmdc:mga07m45_169755_c1 nmdc:mga07m45_169755_c1_389_1252 287
11 3300053088 Ga0500644_0121407 Ga0500644_0121407_139_1005 288
12 3300009148 Ga0105243_10368374 Ga0105243_103683742 296
13 3300053729 Ga0500625_054324 Ga0500625_054324_41_940 299
14 3300031456 Ga0307513_10320295 Ga0307513_103202952 300
15 3300048922 Ga0496119_0012116 Ga0496119_0012116_5701_6660 304
16 3300048925 Ga0496122_0065829 Ga0496122_0065829_171_1091 306
17 3300009093 Ga0105240_10317934 Ga0105240_103179342 307
18 3300009177 Ga0105248_10207825 Ga0105248_102078252 307
19 3300010375 Ga0105239_10214163 Ga0105239_102141632 307
20 3300041486 Ga0451807_0299519 Ga0451807_0299519_51_977 307
21 3300048907 Ga0496104_0005208 Ga0496104_0005208_10167_11090 307
22 3300048911 Ga0496108_0087600 Ga0496108_0087600_1635_2558 307
23 3300048913 Ga0496110_0269712 Ga0496110_0269712_145_1068 307
24 3300048916 Ga0496113_0055604 Ga0496113_0055604_1968_2891 307
25 3300050492 nmdc:mga0yw44_316655_c1 nmdc:mga0yw44_316655_c1_47_970 307
26 3300050494 nmdc:mga06z11_69332_c1 nmdc:mga06z11_69332_c1_853_1776 307
27 3300005937 Ga0081455_10100081 Ga0081455_101000811 308
28 3300005983 Ga0081540_1003442 Ga0081540_10034422 308
29 3300009147 Ga0114129_10581912 Ga0114129_105819122 308
30 3300011119 Ga0105246_10032074 Ga0105246_100320742 308
31 3300013308 Ga0157375_10073454 Ga0157375_100734541 308
32 3300037853 Ga0436364_0623979 Ga0436364_0623979_57_1013 308
33 3300046460 Ga0495638_0040440 Ga0495638_0040440_1688_2614 308
34 3300046460 Ga0495638_0117956 Ga0495638_0117956_202_1128 308
35 3300046491 Ga0495584_0075183 Ga0495584_0075183_482_1408 308
36 3300046519 Ga0495632_0107665 Ga0495632_0107665_279_1205 308
37 3300046519 Ga0495632_0112071 Ga0495632_0112071_18_944 308
38 3300046524 Ga0495648_0158237 Ga0495648_0158237_107_1033 308
39 3300046535 Ga0495586_0150763 Ga0495586_0150763_248_1174 308
40 3300046538 Ga0495609_0065035 Ga0495609_0065035_148_1074 308
41 3300046539 Ga0495621_0028933 Ga0495621_0028933_332_1258 308
42 3300046557 Ga0495622_0123777 Ga0495622_0123777_178_1104 308
43 3300046616 Ga0495668_0243084 Ga0495668_0243084_43_969 308
44 3300046648 Ga0495611_0060615 Ga0495611_0060615_56_982 308
45 3300046660 Ga0495625_0074182 Ga0495625_0074182_176_1102 308
46 3300046660 Ga0495625_0220134 Ga0495625_0220134_244_1170 308
47 3300046664 Ga0495659_0028941 Ga0495659_0028941_512_1438 308
48 3300046674 Ga0495588_0039281 Ga0495588_0039281_795_1721 308
49 3300046681 Ga0495647_0072458 Ga0495647_0072458_327_1253 308
50 3300046692 Ga0495671_0052978 Ga0495671_0052978_509_1435 308
51 3300047320 Ga0495672_0007300 Ga0495672_0007300_6889_7815 308
52 3300048088 Ga0495602_0196729 Ga0495602_0196729_73_999 308
53 3300048903 Ga0496100_0020009 Ga0496100_0020009_1753_2679 308
54 3300048904 Ga0496101_0030168 Ga0496101_0030168_2233_3159 308
55 3300048905 Ga0496102_0068588 Ga0496102_0068588_272_1198 308
56 3300048907 Ga0496104_0082985 Ga0496104_0082985_144_1070 308
57 3300048908 Ga0496105_0028872 Ga0496105_0028872_141_1067 308
58 3300048909 Ga0496106_0076391 Ga0496106_0076391_128_1054 308
59 3300048910 Ga0496107_0015042 Ga0496107_0015042_283_1209 308
60 3300048911 Ga0496108_0069747 Ga0496108_0069747_133_1059 308
61 3300048912 Ga0496109_0087818 Ga0496109_0087818_1626_2552 308
62 3300048914 Ga0496111_0032362 Ga0496111_0032362_756_1682 308
63 3300048918 Ga0496115_0002706 Ga0496115_0002706_6632_7558 308
64 3300048924 Ga0496121_0000406 Ga0496121_0000406_19635_20561 308
65 3300048924 Ga0496121_0071470 Ga0496121_0071470_53_979 308
66 3300048927 Ga0496124_0118113 Ga0496124_0118113_725_1651 308
67 3300048929 Ga0496126_0061739 Ga0496126_0061739_1694_2620 308
68 3300050489 nmdc:mga03683_19961_c1 nmdc:mga03683_19961_c1_483_1409 308
69 3300053096 Ga0500641_0018213 Ga0500641_0018213_534_1460 308
70 3300053116 Ga0500592_009756 Ga0500592_009756_553_1479 308
71 3300053119 Ga0500595_002664 Ga0500595_002664_6468_7394 308
72 3300053147 Ga0500589_058019 Ga0500589_058019_168_1094 308
73 3300053158 Ga0500627_0117080 Ga0500627_0117080_131_1057 308
74 3300053730 Ga0500645_018897 Ga0500645_018897_1131_2057 308
75 3300021388 Ga0213875_10004683 Ga0213875_100046837 313
76 3300021388 Ga0213875_10007237 Ga0213875_100072374 313
77 3300035083 Ga0373926_0015173 Ga0373926_0015173_998_1939 313
78 3300035111 Ga0373923_0018161 Ga0373923_0018161_126_1067 313
79 3300035113 Ga0373936_0163871 Ga0373936_0163871_10_951 313
80 3300035118 Ga0373954_0020662 Ga0373954_0020662_1976_2917 313
81 3300035170 Ga0373943_0019790 Ga0373943_0019790_363_1304 313
82 3300035172 Ga0373955_0051944 Ga0373955_0051944_822_1763 313
83 3300035692 Ga0373935_0108905 Ga0373935_0108905_43_1017 313
84 3300035695 Ga0373927_0095269 Ga0373927_0095269_174_1115 313
85 3300035695 Ga0373927_0111572 Ga0373927_0111572_626_1567 313
86 3300035724 Ga0373933_0067749 Ga0373933_0067749_69_1010 313
87 3300035725 Ga0373947_0057121 Ga0373947_0057121_184_1125 313
88 3300037853 Ga0436364_0533917 Ga0436364_0533917_7681_8634 313
89 3300037853 Ga0436364_0642169 Ga0436364_0642169_16081_17052 313
90 3300045051 Ga0451576_0400232 Ga0451576_0400232_64_1017 313
91 3300046459 Ga0495629_0017140 Ga0495629_0017140_47_988 313
92 3300046472 Ga0495580_0113791 Ga0495580_0113791_80_1021 313
93 3300046477 Ga0495664_0014068 Ga0495664_0014068_3531_4472 313
94 3300046514 Ga0495618_0059561 Ga0495618_0059561_1458_2399 313
95 3300046526 Ga0495666_0060141 Ga0495666_0060141_757_1698 313
96 3300046543 Ga0495645_0198010 Ga0495645_0198010_245_1186 313
97 3300046642 Ga0495634_0013784 Ga0495634_0013784_2066_3007 313
98 3300046678 Ga0495599_0173750 Ga0495599_0173750_320_1261 313
99 3300046689 Ga0495613_0128172 Ga0495613_0128172_103_1044 313
100 3300047315 Ga0495581_0020587 Ga0495581_0020587_2165_3106 313
101 3300047319 Ga0495674_0024255 Ga0495674_0024255_4334_5275 313
102 3300047471 Ga0495684_0014082 Ga0495684_0014082_68_1009 313
103 3300049580 Ga0501046_0019753 Ga0501046_0019753_899_1840 313
104 3300049581 Ga0501047_0032125 Ga0501047_0032125_3214_4155 313
105 3300049586 Ga0501070_0117503 Ga0501070_0117503_1240_2181 313
106 3300049742 Ga0501080_0014452 Ga0501080_0014452_3712_4653 313
107 3300049823 Ga0501044_0029495 Ga0501044_0029495_3604_4545 313
108 3300050511 nmdc:mga08y16_149632_c1 nmdc:mga08y16_149632_c1_1119_2060 313
109 iso_pu_bacteria 2643221736 2644746171 313
110 iso_pu_bacteria 2841760612 2841766119 313
111 iso_pu_bacteria 2842775625 2842777251 313
112 iso_pu_bacteria 2844104063 2844105885 313
113 iso_pu_bacteria 2851182111 2851186383 313
114 iso_pu_bacteria 2851246043 2851246241 313
115 iso_pu_bacteria 2894772417 2894776639 313
116 iso_pu_bacteria 8057529695 8057531533 313
117 3300006846 Ga0075430_100111696 Ga0075430_1001116962 314
118 3300021388 Ga0213875_10001033 Ga0213875_1000103313 314
119 3300037853 Ga0436364_0659865 Ga0436364_0659865_18260_19216 314
120 3300039437 Ga0436365_1453543 Ga0436365_1453543_1882_2862 314
121 3300049823 Ga0501044_0072326 Ga0501044_0072326_373_1326 314
122 3300050509 nmdc:mga0qj67_101195_c1 nmdc:mga0qj67_101195_c1_840_1793 314
123 iso_pu_bacteria 2507262055 2507511394 314
124 iso_pu_bacteria 2508501009 2508545192 314
125 iso_pu_bacteria 2508501042 2508694028 314
126 iso_pu_bacteria 2511231028 2511398282 314
127 iso_pu_bacteria 2513237092 2513624129 314
128 iso_pu_bacteria 2513237094 2513641092 314
129 iso_pu_bacteria 2513237095 2513648516 314
130 iso_pu_bacteria 2513237096 2513656113 314
131 iso_pu_bacteria 2513237098 2513673469 314
132 iso_pu_bacteria 2513237101 2513696342 314
133 iso_pu_bacteria 2513237102 2513702640 314
134 iso_pu_bacteria 2513237104 2513717813 314
135 iso_pu_bacteria 2513237137 2513859009 314
136 iso_pu_bacteria 2513237139 2513874978 314
137 iso_pu_bacteria 2513237145 2513920878 314
138 iso_pu_bacteria 2513237161 2514013954 314
139 iso_pu_bacteria 2515154112 2515625026 314
140 iso_pu_bacteria 2517093001 2517101131 314
141 iso_pu_bacteria 2517572143 2517895934 314
142 iso_pu_bacteria 2524023205 2524439924 314
143 iso_pu_bacteria 2524023210 2524467491 314
144 iso_pu_bacteria 2524023228 2524534803 314
145 iso_pu_bacteria 2528768022 2528854012 314
146 iso_pu_bacteria 2617270735 2617348458 314
147 iso_pu_bacteria 2617270741 2617375002 314
148 iso_pu_bacteria 2643221733 2644730068 314
149 iso_pu_bacteria 2643221734 2644737380 314
150 iso_pu_bacteria 2667528175 2671122725 314
151 iso_pu_bacteria 2721755755 2723842841 314
152 iso_pu_bacteria 2728368998 2728752371 314
153 iso_pu_bacteria 2744054633 2745075794 314
154 iso_pu_bacteria 2791355196 2793061647 314
155 iso_pu_bacteria 2791355197 2793069640 314
156 iso_pu_bacteria 2791355199 2793080263 314
157 iso_pu_bacteria 2802429603 2805916434 314
158 iso_pu_bacteria 2816332527 2818240099 314
159 iso_pu_bacteria 2818991467 2819720106 314
160 iso_pu_bacteria 2824600985 2824608120 314
161 iso_pu_bacteria 2824609381 2824615712 314
162 iso_pu_bacteria 2824617872 2824625822 314
163 iso_pu_bacteria 2824626560 2824634616 314
164 iso_pu_bacteria 2824635225 2824642266 314
165 iso_pu_bacteria 2824644064 2824651495 314
166 iso_pu_bacteria 2824653114 2824660553 314
167 iso_pu_bacteria 2824661429 2824665451 314
168 iso_pu_bacteria 2824671348 2824678412 314
169 iso_pu_bacteria 2824679649 2824686225 314
170 iso_pu_bacteria 2824687955 2824694856 314
171 iso_pu_bacteria 2824696289 2824702798 314
172 iso_pu_bacteria 2824704595 2824709851 314
173 iso_pu_bacteria 2824714736 2824719561 314
174 iso_pu_bacteria 2824723954 2824731470 314
175 iso_pu_bacteria 2824732956 2824738916 314
176 iso_pu_bacteria 2824746037 2824752962 314
177 iso_pu_bacteria 2824753945 2824759982 314
178 iso_pu_bacteria 2824763712 2824769386 314
179 iso_pu_bacteria 2824773399 2824778992 314
180 iso_pu_bacteria 2838122688 2838129897 314
181 iso_pu_bacteria 2841941048 2841946937 314
182 iso_pu_bacteria 2841949485 2841955132 314
183 iso_pu_bacteria 2841957949 2841961548 314
184 iso_pu_bacteria 2841966195 2841970089 314
185 iso_pu_bacteria 2841974524 2841977267 314
186 iso_pu_bacteria 2841983080 2841990319 314
187 iso_pu_bacteria 2842038055 2842042317 314
188 iso_pu_bacteria 2842045827 2842050360 314
189 iso_pu_bacteria 2844315083 2844316520 314
190 iso_pu_bacteria 2847930680 2847939171 314
191 iso_pu_bacteria 2847939898 2847943880 314
192 iso_pu_bacteria 2849076700 2849081894 314
193 iso_pu_bacteria 2857509624 2857513618 314
194 iso_pu_bacteria 2874590934 2874594613 314
195 iso_pu_bacteria 2874604998 2874606490 314
196 iso_pu_bacteria 2874612657 2874615347 314
197 iso_pu_bacteria 2874620515 2874620646 314
198 iso_pu_bacteria 2874628541 2874633698 314
199 iso_pu_bacteria 2874645413 2874649658 314
200 iso_pu_bacteria 2876761206 2876766306 314
201 iso_pu_bacteria 2876771140 2876773745 314
202 iso_pu_bacteria 2876818435 2876820736 314
203 iso_pu_bacteria 2879074833 2879076938 314
204 iso_pu_bacteria 2879083081 2879090312 314
205 iso_pu_bacteria 2879099564 2879100837 314
206 iso_pu_bacteria 2879110137 2879113746 314
207 iso_pu_bacteria 2879127579 2879130274 314
208 iso_pu_bacteria 2879142872 2879146790 314
209 iso_pu_bacteria 2881364244 2881367303 314
210 iso_pu_bacteria 2881665667 2881668692 314
211 iso_pu_bacteria 2883577096 2883577391 314
212 iso_pu_bacteria 2885366525 2885373745 314
213 iso_pu_bacteria 2885374607 2885382968 314
214 iso_pu_bacteria 2885383462 2885390990 314
215 iso_pu_bacteria 2885409591 2885412247 314
216 iso_pu_bacteria 2888378607 2888386949 314
217 iso_pu_bacteria 2888388044 2888389643 314
218 iso_pu_bacteria 2888419890 2888421449 314
219 iso_pu_bacteria 2889033259 2889033831 314
220 iso_pu_bacteria 2903727486 2903732399 314
221 iso_pu_bacteria 2903748898 2903750380 314
222 iso_pu_bacteria 2903768456 2903773247 314
223 iso_pu_bacteria 2904666416 2904666570 314
224 iso_pu_bacteria 2904690495 2904699082 314
225 iso_pu_bacteria 2904699407 2904707073 314
226 iso_pu_bacteria 2904711408 2904719537 314
227 iso_pu_bacteria 2906602504 2906606286 314
228 iso_pu_bacteria 2906610324 2906615601 314
229 iso_pu_bacteria 2906626472 2906626744 314
230 iso_pu_bacteria 2906635258 2906636487 314
231 iso_pu_bacteria 2906643746 2906647841 314
232 iso_pu_bacteria 2906660503 2906665033 314
233 iso_pu_bacteria 2908739725 2908745580 314
234 iso_pu_bacteria 2908756301 2908763566 314
235 iso_pu_bacteria 2908775508 2908777484 314
236 iso_pu_bacteria 2917699015 2917703898 314
237 iso_pu_bacteria 2922361189 2922367254 314
238 iso_pu_bacteria 2922368715 2922377078 314
239 iso_pu_bacteria 2922386360 2922390041 314
240 iso_pu_bacteria 2922393267 2922398230 314
241 iso_pu_bacteria 2922425934 2922432406 314
242 iso_pu_bacteria 2929199973 2929202997 314
243 iso_pu_bacteria 2929615660 2929619091 314
244 iso_pu_bacteria 2929624759 2929628414 314
245 iso_pu_bacteria 2932784394 2932791334 314
246 iso_pu_bacteria 2932794094 2932795760 314
247 iso_pu_bacteria 2932801729 2932801998 314
248 iso_pu_bacteria 2932809354 2932814808 314
249 iso_pu_bacteria 2932818245 2932823665 314
250 iso_pu_bacteria 2932828146 2932833097 314
251 iso_pu_bacteria 2933577622 2933581013 314
252 iso_pu_bacteria 2935608549 2935612282 314
253 iso_pu_bacteria 2935616580 2935623826 314
254 iso_pu_bacteria 2935630451 2935630769 314
255 iso_pu_bacteria 2935638405 2935639601 314
256 iso_pu_bacteria 2935648319 2935650122 314
257 iso_pu_bacteria 2935656913 2935658269 314
258 iso_pu_bacteria 2935665750 2935670544 314
259 iso_pu_bacteria 2935675223 2935682877 314
260 iso_pu_bacteria 2935684952 2935687540 314
261 iso_pu_bacteria 2935694250 2935696488 314
262 iso_pu_bacteria 2935703347 2935705301 314
263 iso_pu_bacteria 2935713505 2935719000 314
264 iso_pu_bacteria 2935722832 2935728652 314
265 iso_pu_bacteria 2935732158 2935736752 314
266 iso_pu_bacteria 2935741537 2935746246 314
267 iso_pu_bacteria 2935750917 2935753506 314
268 iso_pu_bacteria 2935760218 2935767703 314
269 iso_pu_bacteria 2935769743 2935770465 314
270 iso_pu_bacteria 2935777560 2935782508 314
271 iso_pu_bacteria 2935785616 2935786482 314
272 iso_pu_bacteria 2935793552 2935794537 314
273 iso_pu_bacteria 2935801545 2935807046 314
274 iso_pu_bacteria 2935810662 2935814039 314
275 iso_pu_bacteria 2935819856 2935823771 314
276 iso_pu_bacteria 2935827899 2935829083 314
277 iso_pu_bacteria 2935837841 2935845382 314
278 iso_pu_bacteria 2935847175 2935854409 314
279 iso_pu_bacteria 2935855204 2935861949 314
280 iso_pu_bacteria 2935864058 2935872801 314
281 iso_pu_bacteria 2935873716 2935880376 314
282 iso_pu_bacteria 2935883170 2935886186 314
283 iso_pu_bacteria 2935908558 2935913497 314
284 iso_pu_bacteria 2935916978 2935923394 314
285 iso_pu_bacteria 2935926038 2935931186 314
286 iso_pu_bacteria 2935934488 2935935468 314
287 iso_pu_bacteria 2935942939 2935947034 314
288 iso_pu_bacteria 2935951376 2935953871 314
289 iso_pu_bacteria 2935959822 2935961490 314
290 iso_pu_bacteria 2935967501 2935968897 314
291 iso_pu_bacteria 2935975950 2935982433 314
292 iso_pu_bacteria 2935984226 2935985901 314
293 iso_pu_bacteria 2935992306 2935994986 314
294 iso_pu_bacteria 2936002035 2936006079 314
295 iso_pu_bacteria 2936011229 2936013319 314
296 iso_pu_bacteria 2936019824 2936021594 314
297 iso_pu_bacteria 2936028420 2936030612 314
298 iso_pu_bacteria 2936037263 2936039594 314
299 iso_pu_bacteria 2936046547 2936047788 314
300 iso_pu_bacteria 2936055302 2936057790 314
301 iso_pu_bacteria 2940556831 2940559419 314
302 iso_pu_bacteria 2941507105 2941507421 314
303 iso_pu_bacteria 2941515067 2941515848 314
304 iso_pu_bacteria 2941523033 2941523444 314
305 iso_pu_bacteria 2941531003 2941536986 314
306 iso_pu_bacteria 2941538514 2941545647 314
307 iso_pu_bacteria 3005474847 3005476633 314
308 iso_pu_bacteria 3005483717 3005487673 314
309 iso_pu_bacteria 3005506211 3005511176 314
310 iso_pu_bacteria 3005587118 3005592027 314
311 iso_pu_bacteria 3005594810 3005596144 314
312 iso_pu_bacteria 3005710791 3005712093 314
313 iso_pu_bacteria 3005718088 3005719327 314
314 iso_pu_bacteria 8006926726 8006929448 314
315 iso_pu_bacteria 8006933436 8006934848 314
316 iso_pu_bacteria 8006964411 8006966156 314
317 iso_pu_bacteria 8006973647 8006974816 314
318 iso_pu_bacteria 8006984368 8006989668 314
319 iso_pu_bacteria 8006994254 8006998068 314
320 iso_pu_bacteria 8016511872 8016516943 314
321 iso_pu_bacteria 8016539877 8016542359 314
322 iso_pu_bacteria 8016557553 8016559330 314
323 iso_pu_bacteria 8016566248 8016567746 314
324 iso_pu_bacteria 8016575299 8016580439 314
325 iso_pu_bacteria 8016583857 8016588609 314
326 iso_pu_bacteria 8016595262 8016597273 314
327 iso_pu_bacteria 8016603502 8016604987 314
328 iso_pu_bacteria 8016622563 8016624244 314
329 iso_pu_bacteria 8016630954 8016637650 314
330 iso_pu_bacteria 8017057580 8017059628 314
331 iso_pu_bacteria 8019530166 8019537751 314
332 iso_pu_bacteria 8019538911 8019539381 314
333 iso_pu_bacteria 8019576017 8019579101 314
334 iso_pu_bacteria 8019586578 8019597155 314
335 iso_pu_bacteria 8019608314 8019613995 314
336 iso_pu_bacteria 8019619141 8019624538 314
337 iso_pu_bacteria 8019629233 8019637502 314
338 iso_pu_bacteria 8019638758 8019642107 314
339 iso_pu_bacteria 8019648815 8019650415 314
340 iso_pu_bacteria 8019659431 8019665435 314
341 iso_pu_bacteria 8019678201 8019681114 314
342 iso_pu_bacteria 8019687851 8019694582 314
343 iso_pu_bacteria 8055742211 8055749651 314
344 iso_pu_bacteria 8055909800 8055916095 314
345 iso_pu_bacteria 8056673599 8056675093 314
346 iso_pu_bacteria 8056681323 8056684644 314
347 iso_pu_bacteria 8056689827 8056696229 314
348 iso_pu_bacteria 8056967851 8056973868 314
349 3300005468 Ga0070707_100104189 Ga0070707_1001041892 315
350 3300005471 Ga0070698_100250591 Ga0070698_1002505912 315
351 3300006038 Ga0075365_10027326 Ga0075365_100273264 315
352 3300006177 Ga0075362_10026316 Ga0075362_100263162 315
353 3300006178 Ga0075367_10060940 Ga0075367_100609402 315
354 3300013104 Ga0157370_10059485 Ga0157370_100594852 315
355 3300025922 Ga0207646_10148962 Ga0207646_101489622 315
356 3300025981 Ga0207640_10091170 Ga0207640_100911702 315
357 3300037853 Ga0436364_0601659 Ga0436364_0601659_1423_2376 315
358 3300039437 Ga0436365_1736919 Ga0436365_1736919_2655_3608 315
359 3300046663 Ga0495635_0042909 Ga0495635_0042909_164_1114 315
360 3300050489 nmdc:mga03683_21707_c1 nmdc:mga03683_21707_c1_401_1357 315
361 3300050492 nmdc:mga0yw44_7443_c1 nmdc:mga0yw44_7443_c1_1959_2915 315
362 3300003203 JGI25406J46586_10000032 JGI25406J46586_1000003240 316
363 3300003203 JGI25406J46586_10000433 JGI25406J46586_1000043312 316
364 3300005337 Ga0070682_100046835 Ga0070682_1000468352 316
365 3300005338 Ga0068868_100011310 Ga0068868_1000113105 316
366 3300005434 Ga0070709_10050791 Ga0070709_100507912 316
367 3300005435 Ga0070714_100084443 Ga0070714_1000844432 316
368 3300005436 Ga0070713_100057350 Ga0070713_1000573503 316
369 3300005455 Ga0070663_100007767 Ga0070663_1000077674 316
370 3300005456 Ga0070678_100064819 Ga0070678_1000648192 316
371 3300005456 Ga0070678_100103857 Ga0070678_1001038572 316
372 3300005563 Ga0068855_100180701 Ga0068855_1001807011 316
373 3300005614 Ga0068856_100002849 Ga0068856_10000284913 316
374 3300005616 Ga0068852_100153881 Ga0068852_1001538812 316
375 3300005618 Ga0068864_100098797 Ga0068864_1000987972 316
376 3300005981 Ga0081538_10058444 Ga0081538_100584442 316
377 3300005983 Ga0081540_1014249 Ga0081540_10142492 316
378 3300005985 Ga0081539_10000129 Ga0081539_10000129160 316
379 3300005985 Ga0081539_10000549 Ga0081539_1000054929 316
380 3300006844 Ga0075428_100019515 Ga0075428_1000195153 316
381 3300006846 Ga0075430_100036628 Ga0075430_1000366283 316
382 3300006847 Ga0075431_100000986 Ga0075431_10000098611 316
383 3300006880 Ga0075429_100013820 Ga0075429_1000138205 316
384 3300007076 Ga0075435_100482419 Ga0075435_1004824192 316
385 3300009094 Ga0111539_10004845 Ga0111539_100048455 316
386 3300009147 Ga0114129_10004791 Ga0114129_1000479117 316
387 3300021377 Ga0213874_10003165 Ga0213874_100031652 316
388 3300021384 Ga0213876_10009074 Ga0213876_100090743 316
389 3300021388 Ga0213875_10003029 Ga0213875_100030292 316
390 3300021388 Ga0213875_10006053 Ga0213875_100060536 316
391 3300025901 Ga0207688_10110951 Ga0207688_101109512 316
392 3300025905 Ga0207685_10019898 Ga0207685_100198982 316
393 3300025906 Ga0207699_10036133 Ga0207699_100361333 316
394 3300025908 Ga0207643_10039276 Ga0207643_100392761 316
395 3300025913 Ga0207695_10279906 Ga0207695_102799062 316
396 3300025915 Ga0207693_10010582 Ga0207693_100105827 316
397 3300025915 Ga0207693_10135623 Ga0207693_101356232 316
398 3300025916 Ga0207663_10105062 Ga0207663_101050622 316
399 3300025921 Ga0207652_10075415 Ga0207652_100754152 316
400 3300025927 Ga0207687_10071054 Ga0207687_100710541 316
401 3300025928 Ga0207700_10415950 Ga0207700_104159502 316
402 3300025929 Ga0207664_10075358 Ga0207664_100753582 316
403 3300025937 Ga0207669_10107806 Ga0207669_101078062 316
404 3300025938 Ga0207704_10236102 Ga0207704_102361022 316
405 3300025939 Ga0207665_10117331 Ga0207665_101173311 316
406 3300025944 Ga0207661_10125207 Ga0207661_101252072 316
407 3300025949 Ga0207667_10530269 Ga0207667_105302691 316
408 3300026023 Ga0207677_10012388 Ga0207677_100123882 316
409 3300026035 Ga0207703_10258870 Ga0207703_102588702 316
410 3300026067 Ga0207678_10032802 Ga0207678_100328024 316
411 3300026078 Ga0207702_10000325 Ga0207702_1000032558 316
412 3300026121 Ga0207683_10042482 Ga0207683_100424824 316
413 3300026121 Ga0207683_10052354 Ga0207683_100523543 316
414 3300027671 Ga0209588_1016301 Ga0209588_10163011 316
415 3300031730 Ga0307516_10016844 Ga0307516_100168443 316
416 3300031730 Ga0307516_10023182 Ga0307516_100231822 316
417 3300035111 Ga0373923_0012011 Ga0373923_0012011_1618_2574 316
418 3300035113 Ga0373936_0005491 Ga0373936_0005491_3691_4647 316
419 3300035692 Ga0373935_0127238 Ga0373935_0127238_505_1470 316
420 3300035695 Ga0373927_0002111 Ga0373927_0002111_2282_3238 316
421 3300036401 Ga0373937_0191104 Ga0373937_0191104_862_1827 316
422 3300037068 Ga0373925_0119797 Ga0373925_0119797_829_1794 316
423 3300037853 Ga0436364_0103156 Ga0436364_0103156_13895_14851 316
424 3300037853 Ga0436364_0831688 Ga0436364_0831688_587_1543 316
425 3300037853 Ga0436364_1379234 Ga0436364_1379234_524_1486 316
426 3300037853 Ga0436364_1558822 Ga0436364_1558822_171_1133 316
427 3300039437 Ga0436365_0138565 Ga0436365_0138565_6579_7541 316
428 3300039437 Ga0436365_0879300 Ga0436365_0879300_1120_2076 316
429 3300039437 Ga0436365_1535876 Ga0436365_1535876_7445_8407 316
430 3300039450 Ga0436363_0282535 Ga0436363_0282535_9433_10395 316
431 3300039450 Ga0436363_0472610 Ga0436363_0472610_1120_2082 316
432 3300039453 Ga0436362_0822437 Ga0436362_0822437_3610_4572 316
433 3300045836 Ga0466958_0160827 Ga0466958_0160827_203_1159 316
434 3300046454 Ga0495592_0099056 Ga0495592_0099056_32_997 316
435 3300046455 Ga0495603_0001315 Ga0495603_0001315_1946_2902 316
436 3300046455 Ga0495603_0045157 Ga0495603_0045157_1187_2143 316
437 3300046462 Ga0495651_0017859 Ga0495651_0017859_4082_5047 316
438 3300046472 Ga0495580_0000514 Ga0495580_0000514_31577_32533 316
439 3300046473 Ga0495582_0003610 Ga0495582_0003610_7421_8377 316
440 3300046475 Ga0495639_0000101 Ga0495639_0000101_32238_33194 316
441 3300046476 Ga0495662_0000117 Ga0495662_0000117_3558_4514 316
442 3300046477 Ga0495664_0006748 Ga0495664_0006748_4702_5658 316
443 3300046499 Ga0495594_0000083 Ga0495594_0000083_16987_17943 316
444 3300046507 Ga0495606_0004349 Ga0495606_0004349_12425_13381 316
445 3300046512 Ga0495610_0051064 Ga0495610_0051064_335_1288 316
446 3300046517 Ga0495630_0001944 Ga0495630_0001944_227_1183 316
447 3300046531 Ga0495665_0000055 Ga0495665_0000055_11738_12694 316
448 3300046533 Ga0495640_0002279 Ga0495640_0002279_11662_12618 316
449 3300046543 Ga0495645_0035625 Ga0495645_0035625_2280_3236 316
450 3300046557 Ga0495622_0011851 Ga0495622_0011851_2880_3836 316
451 3300046642 Ga0495634_0000720 Ga0495634_0000720_14844_15800 316
452 3300046663 Ga0495635_0004704 Ga0495635_0004704_4750_5706 316
453 3300046674 Ga0495588_0004531 Ga0495588_0004531_5026_5982 316
454 3300046678 Ga0495599_0029287 Ga0495599_0029287_1890_2855 316
455 3300046680 Ga0495646_0009997 Ga0495646_0009997_3699_4655 316
456 3300046681 Ga0495647_0010156 Ga0495647_0010156_539_1495 316
457 3300046683 Ga0495658_0001206 Ga0495658_0001206_5292_6248 316
458 3300046690 Ga0495624_0001822 Ga0495624_0001822_209_1165 316
459 3300046809 Ga0495600_0033814 Ga0495600_0033814_1928_2884 316
460 3300047315 Ga0495581_0000041 Ga0495581_0000041_36280_37236 316
461 3300047319 Ga0495674_0007683 Ga0495674_0007683_2443_3399 316
462 3300047319 Ga0495674_0101026 Ga0495674_0101026_1310_2275 316
463 3300047320 Ga0495672_0033613 Ga0495672_0033613_915_1955 316
464 3300047469 Ga0495673_0033572 Ga0495673_0033572_891_1856 316
465 3300047471 Ga0495684_0007286 Ga0495684_0007286_7153_8109 316
466 3300047471 Ga0495684_0051088 Ga0495684_0051088_2168_3133 316
467 3300047673 Ga0495593_0000024 Ga0495593_0000024_6549_7505 316
468 3300048915 Ga0496112_0000015 Ga0496112_0000015_83536_84492 316
469 3300048917 Ga0496114_0019685 Ga0496114_0019685_141_1097 316
470 3300048918 Ga0496115_0186680 Ga0496115_0186680_576_1532 316
471 3300048929 Ga0496126_0021020 Ga0496126_0021020_442_1398 316
472 3300049591 Ga0501075_0209857 Ga0501075_0209857_442_1398 316
473 3300050507 nmdc:mga05p37_3181_c1 nmdc:mga05p37_3181_c1_4874_5833 316
474 3300050508 nmdc:mga09592_8656_c1 nmdc:mga09592_8656_c1_4960_5919 316
475 3300050509 nmdc:mga0qj67_5521_c1 nmdc:mga0qj67_5521_c1_1784_2743 316
476 3300050510 nmdc:mga06r32_3795_c1 nmdc:mga06r32_3795_c1_11097_12056 316
477 3300050511 nmdc:mga08y16_204_c3 nmdc:mga08y16_204_c3_4196_5155 316
478 3300050513 nmdc:mga0rr50_502528_c1 nmdc:mga0rr50_502528_c1_44_1000 316
479 3300053080 Ga0500635_0002338 Ga0500635_0002338_1862_2818 316
480 3300053093 Ga0500651_0011118 Ga0500651_0011118_1461_2435 316
481 3300053102 Ga0500554_001920 Ga0500554_001920_25_981 316
482 3300053119 Ga0500595_002181 Ga0500595_002181_3228_4184 316
483 3300053150 Ga0500603_001115 Ga0500603_001115_3464_4420 316
484 3300053153 Ga0500616_0026922 Ga0500616_0026922_1752_2705 316
485 3300053156 Ga0500622_0076701 Ga0500622_0076701_440_1414 316
486 3300053177 Ga0500636_0001753 Ga0500636_0001753_1469_2422 316
487 3300053178 Ga0500637_0002536 Ga0500637_0002536_5336_6292 316
488 3300002987 JGI25159J45721_1005938 JGI25159J45721_10059383 317
489 3300003187 JGI25151J46595_10000052 JGI25151J46595_10000052102 317
490 3300003215 JGI25153J46596_10021591 JGI25153J46596_100215912 317
491 3300003215 JGI25153J46596_10042041 JGI25153J46596_100420411 317
492 3300003354 JGI25160J50197_1007298 JGI25160J50197_10072982 317
493 3300003659 JGI25404J52841_10008508 JGI25404J52841_100085081 317
494 3300003762 Ga0055542_1002606 Ga0055542_10026062 317
495 3300003771 Ga0055526_1000017 Ga0055526_1000017112 317
496 3300003771 Ga0055526_1002207 Ga0055526_10022075 317
497 3300003775 Ga0055524_1000014 Ga0055524_100001458 317
498 3300003775 Ga0055524_1010792 Ga0055524_10107923 317
499 3300003794 Ga0055531_10005960 Ga0055531_100059605 317
500 3300004625 Ga0055543_1008492 Ga0055543_10084922 317
501 3300005262 Ga0065165_1000313 Ga0065165_100031356 317
502 3300005262 Ga0065165_1001376 Ga0065165_10013762 317
503 3300005262 Ga0065165_1002335 Ga0065165_100233514 317
504 3300005262 Ga0065165_1006843 Ga0065165_10068433 317
505 3300005327 Ga0070658_10157912 Ga0070658_101579121 317
506 3300005329 Ga0070683_100077150 Ga0070683_1000771502 317
507 3300005329 Ga0070683_100141173 Ga0070683_1001411732 317
508 3300005331 Ga0070670_100186591 Ga0070670_1001865912 317
509 3300005336 Ga0070680_100083267 Ga0070680_1000832672 317
510 3300005339 Ga0070660_100295789 Ga0070660_1002957891 317
511 3300005341 Ga0070691_10003977 Ga0070691_100039772 317
512 3300005347 Ga0070668_100104940 Ga0070668_1001049402 317
513 3300005347 Ga0070668_100271542 Ga0070668_1002715421 317
514 3300005347 Ga0070668_100382221 Ga0070668_1003822211 317
515 3300005353 Ga0070669_100083475 Ga0070669_1000834753 317
516 3300005364 Ga0070673_100120662 Ga0070673_1001206622 317
517 3300005364 Ga0070673_100234202 Ga0070673_1002342022 317
518 3300005434 Ga0070709_10040228 Ga0070709_100402282 317
519 3300005435 Ga0070714_100312896 Ga0070714_1003128961 317
520 3300005436 Ga0070713_100160398 Ga0070713_1001603982 317
521 3300005437 Ga0070710_10145871 Ga0070710_101458711 317
522 3300005438 Ga0070701_10188722 Ga0070701_101887221 317
523 3300005439 Ga0070711_100006483 Ga0070711_1000064833 317
524 3300005455 Ga0070663_100003863 Ga0070663_1000038634 317
525 3300005455 Ga0070663_100079113 Ga0070663_1000791132 317
526 3300005455 Ga0070663_100098615 Ga0070663_1000986152 317
527 3300005456 Ga0070678_100070667 Ga0070678_1000706672 317
528 3300005456 Ga0070678_100157444 Ga0070678_1001574441 317
529 3300005457 Ga0070662_100073817 Ga0070662_1000738172 317
530 3300005457 Ga0070662_100078804 Ga0070662_1000788042 317
531 3300005467 Ga0070706_100063277 Ga0070706_1000632772 317
532 3300005530 Ga0070679_100075900 Ga0070679_1000759002 317
533 3300005535 Ga0070684_100085029 Ga0070684_1000850292 317
534 3300005535 Ga0070684_100304214 Ga0070684_1003042142 317
535 3300005539 Ga0068853_100192064 Ga0068853_1001920642 317
536 3300005539 Ga0068853_100340430 Ga0068853_1003404301 317
537 3300005548 Ga0070665_100017918 Ga0070665_1000179186 317
538 3300005548 Ga0070665_100050535 Ga0070665_1000505352 317
539 3300005548 Ga0070665_100188677 Ga0070665_1001886773 317
540 3300005548 Ga0070665_100193682 Ga0070665_1001936822 317
541 3300005549 Ga0070704_100003315 Ga0070704_1000033152 317
542 3300005563 Ga0068855_100092061 Ga0068855_1000920612 317
543 3300005563 Ga0068855_100133728 Ga0068855_1001337282 317
544 3300005564 Ga0070664_100061891 Ga0070664_1000618912 317
545 3300005577 Ga0068857_100013484 Ga0068857_1000134844 317
546 3300005614 Ga0068856_100017546 Ga0068856_1000175466 317
547 3300005614 Ga0068856_100072955 Ga0068856_1000729552 317
548 3300005614 Ga0068856_100236398 Ga0068856_1002363981 317
549 3300005614 Ga0068856_100502207 Ga0068856_1005022072 317
550 3300005616 Ga0068852_100034684 Ga0068852_1000346842 317
551 3300005617 Ga0068859_100106673 Ga0068859_1001066732 317
552 3300005719 Ga0068861_100017897 Ga0068861_1000178973 317
553 3300005719 Ga0068861_100026690 Ga0068861_1000266903 317
554 3300005842 Ga0068858_100019766 Ga0068858_1000197666 317
555 3300005843 Ga0068860_100095846 Ga0068860_1000958462 317
556 3300005937 Ga0081455_10014280 Ga0081455_100142804 317
557 3300005937 Ga0081455_10026724 Ga0081455_100267243 317
558 3300005937 Ga0081455_10050536 Ga0081455_100505362 317
559 3300005983 Ga0081540_1000338 Ga0081540_100033840 317
560 3300005983 Ga0081540_1000876 Ga0081540_100087627 317
561 3300005983 Ga0081540_1005310 Ga0081540_10053104 317
562 3300005983 Ga0081540_1016517 Ga0081540_10165174 317
563 3300005983 Ga0081540_1026537 Ga0081540_10265372 317
564 3300005983 Ga0081540_1090239 Ga0081540_10902392 317
565 3300006038 Ga0075365_10013919 Ga0075365_100139193 317
566 3300006038 Ga0075365_10041585 Ga0075365_100415854 317
567 3300006038 Ga0075365_10075885 Ga0075365_100758852 317
568 3300006038 Ga0075365_10119058 Ga0075365_101190582 317
569 3300006042 Ga0075368_10010701 Ga0075368_100107012 317
570 3300006042 Ga0075368_10098583 Ga0075368_100985831 317
571 3300006048 Ga0075363_100002563 Ga0075363_1000025633 317
572 3300006048 Ga0075363_100018134 Ga0075363_1000181343 317
573 3300006048 Ga0075363_100020378 Ga0075363_1000203782 317
574 3300006048 Ga0075363_100247188 Ga0075363_1002471881 317
575 3300006051 Ga0075364_10026756 Ga0075364_100267562 317
576 3300006175 Ga0070712_100194163 Ga0070712_1001941632 317
577 3300006177 Ga0075362_10018021 Ga0075362_100180212 317
578 3300006177 Ga0075362_10049775 Ga0075362_100497752 317
579 3300006178 Ga0075367_10002436 Ga0075367_100024366 317
580 3300006178 Ga0075367_10008820 Ga0075367_100088202 317
581 3300006178 Ga0075367_10037362 Ga0075367_100373622 317
582 3300006178 Ga0075367_10045189 Ga0075367_100451892 317
583 3300006178 Ga0075367_10101703 Ga0075367_101017032 317
584 3300006186 Ga0075369_10031201 Ga0075369_100312012 317
585 3300006186 Ga0075369_10069969 Ga0075369_100699692 317
586 3300006195 Ga0075366_10025251 Ga0075366_100252513 317
587 3300006195 Ga0075366_10096587 Ga0075366_100965871 317
588 3300006353 Ga0075370_10024705 Ga0075370_100247052 317
589 3300006844 Ga0075428_100092179 Ga0075428_1000921793 317
590 3300006844 Ga0075428_100097827 Ga0075428_1000978273 317
591 3300006844 Ga0075428_100179315 Ga0075428_1001793152 317
592 3300006847 Ga0075431_100004249 Ga0075431_10000424911 317
593 3300006880 Ga0075429_100073335 Ga0075429_1000733354 317
594 3300006931 Ga0097620_100106674 Ga0097620_1001066742 317
595 3300006942 Ga0099824_1008180 Ga0099824_10081805 317
596 3300006942 Ga0099824_1012471 Ga0099824_10124714 317
597 3300006943 Ga0099822_1007748 Ga0099822_10077486 317
598 3300009093 Ga0105240_10002375 Ga0105240_100023758 317
599 3300009098 Ga0105245_10063949 Ga0105245_100639493 317
600 3300009147 Ga0114129_10606425 Ga0114129_106064251 317
601 3300009148 Ga0105243_10066447 Ga0105243_100664472 317
602 3300009174 Ga0105241_10067653 Ga0105241_100676532 317
603 3300009176 Ga0105242_10345458 Ga0105242_103454581 317
604 3300009177 Ga0105248_10409107 Ga0105248_104091072 317
605 3300009545 Ga0105237_10163828 Ga0105237_101638282 317
606 3300009551 Ga0105238_10074040 Ga0105238_100740402 317
607 3300009551 Ga0105238_10177560 Ga0105238_101775602 317
608 3300009553 Ga0105249_10068969 Ga0105249_100689693 317
609 3300010375 Ga0105239_10075123 Ga0105239_100751233 317
610 3300010375 Ga0105239_10089511 Ga0105239_100895112 317
611 3300010375 Ga0105239_10290755 Ga0105239_102907552 317
612 3300010375 Ga0105239_10365033 Ga0105239_103650332 317
613 3300013104 Ga0157370_10023801 Ga0157370_100238013 317
614 3300013105 Ga0157369_10198380 Ga0157369_101983802 317
615 3300013250 Ga0171462_1012 Ga0171462_1012157 317
616 3300013296 Ga0157374_10495097 Ga0157374_104950971 317
617 3300013308 Ga0157375_10097352 Ga0157375_100973522 317
618 3300014325 Ga0163163_10101915 Ga0163163_101019153 317
619 3300014325 Ga0163163_10153044 Ga0163163_101530442 317
620 3300014325 Ga0163163_10322886 Ga0163163_103228862 317
621 3300014326 Ga0157380_10159845 Ga0157380_101598451 317
622 3300014745 Ga0157377_10017758 Ga0157377_100177583 317
623 3300014968 Ga0157379_10296581 Ga0157379_102965811 317
624 3300014968 Ga0157379_10474188 Ga0157379_104741881 317
625 3300014969 Ga0157376_10155978 Ga0157376_101559782 317
626 3300021320 Ga0214544_1000005 Ga0214544_1000005151 317
627 3300021321 Ga0214542_1000004 Ga0214542_1000004155 317
628 3300021324 Ga0214545_1000005 Ga0214545_1000005242 317
629 3300021327 Ga0214543_1000564 Ga0214543_100056440 317
630 3300021358 Ga0213873_10006356 Ga0213873_100063562 317
631 3300021384 Ga0213876_10064040 Ga0213876_100640402 317
632 3300025253 Ga0209677_101562 Ga0209677_1015627 317
633 3300025254 Ga0209148_1000367 Ga0209148_10003676 317
634 3300025273 Ga0209673_1015067 Ga0209673_10150672 317
635 3300025284 Ga0209130_1000209 Ga0209130_100020917 317
636 3300025294 Ga0209025_1000017 Ga0209025_100001769 317
637 3300025294 Ga0209025_1003934 Ga0209025_100393414 317
638 3300025294 Ga0209025_1030103 Ga0209025_10301032 317
639 3300025295 Ga0209564_1000031 Ga0209564_100003195 317
640 3300025295 Ga0209564_1002546 Ga0209564_100254613 317
641 3300025297 Ga0209758_1000102 Ga0209758_100010268 317
642 3300025297 Ga0209758_1000732 Ga0209758_100073232 317
643 3300025297 Ga0209758_1004116 Ga0209758_10041167 317
644 3300025297 Ga0209758_1006909 Ga0209758_10069094 317
645 3300025297 Ga0209758_1007061 Ga0209758_10070613 317
646 3300025297 Ga0209758_1021066 Ga0209758_10210662 317
647 3300025297 Ga0209758_1022195 Ga0209758_10221952 317
648 3300025299 Ga0209256_1000033 Ga0209256_1000033290 317
649 3300025299 Ga0209256_1000181 Ga0209256_100018174 317
650 3300025299 Ga0209256_1002569 Ga0209256_10025697 317
651 3300025299 Ga0209256_1023170 Ga0209256_10231702 317
652 3300025302 Ga0207426_1000354 Ga0207426_100035419 317
653 3300025302 Ga0207426_1000521 Ga0207426_10005219 317
654 3300025302 Ga0207426_1019010 Ga0207426_10190102 317
655 3300025304 Ga0209257_1001340 Ga0209257_100134016 317
656 3300025898 Ga0207692_10067322 Ga0207692_100673221 317
657 3300025900 Ga0207710_10086764 Ga0207710_100867642 317
658 3300025901 Ga0207688_10110378 Ga0207688_101103781 317
659 3300025906 Ga0207699_10022267 Ga0207699_100222671 317
660 3300025910 Ga0207684_10137561 Ga0207684_101375612 317
661 3300025913 Ga0207695_10000006 Ga0207695_10000006844 317
662 3300025914 Ga0207671_10014045 Ga0207671_100140453 317
663 3300025915 Ga0207693_10131009 Ga0207693_101310092 317
664 3300025919 Ga0207657_10022030 Ga0207657_100220302 317
665 3300025919 Ga0207657_10060743 Ga0207657_100607432 317
666 3300025919 Ga0207657_10165466 Ga0207657_101654662 317
667 3300025919 Ga0207657_10314873 Ga0207657_103148732 317
668 3300025920 Ga0207649_10085137 Ga0207649_100851372 317
669 3300025921 Ga0207652_10025038 Ga0207652_100250382 317
670 3300025924 Ga0207694_10133485 Ga0207694_101334852 317
671 3300025924 Ga0207694_10314015 Ga0207694_103140152 317
672 3300025927 Ga0207687_10035517 Ga0207687_100355172 317
673 3300025928 Ga0207700_10010378 Ga0207700_100103784 317
674 3300025933 Ga0207706_10091630 Ga0207706_100916301 317
675 3300025935 Ga0207709_10103518 Ga0207709_101035182 317
676 3300025938 Ga0207704_10268073 Ga0207704_102680732 317
677 3300025940 Ga0207691_10271155 Ga0207691_102711552 317
678 3300025940 Ga0207691_10332186 Ga0207691_103321862 317
679 3300025941 Ga0207711_10092919 Ga0207711_100929192 317
680 3300025944 Ga0207661_10001876 Ga0207661_100018764 317
681 3300025945 Ga0207679_10018807 Ga0207679_100188072 317
682 3300025945 Ga0207679_10104507 Ga0207679_101045072 317
683 3300025949 Ga0207667_10151422 Ga0207667_101514223 317
684 3300025949 Ga0207667_10315544 Ga0207667_103155441 317
685 3300025960 Ga0207651_10086245 Ga0207651_100862451 317
686 3300025961 Ga0207712_10103795 Ga0207712_101037952 317
687 3300025972 Ga0207668_10288281 Ga0207668_102882812 317
688 3300025981 Ga0207640_10078190 Ga0207640_100781902 317
689 3300026035 Ga0207703_10028003 Ga0207703_100280034 317
690 3300026035 Ga0207703_10345365 Ga0207703_103453652 317
691 3300026041 Ga0207639_10179965 Ga0207639_101799652 317
692 3300026067 Ga0207678_10016363 Ga0207678_100163637 317
693 3300026067 Ga0207678_10059021 Ga0207678_100590212 317
694 3300026067 Ga0207678_10127113 Ga0207678_101271132 317
695 3300026078 Ga0207702_10030533 Ga0207702_100305334 317
696 3300026078 Ga0207702_10155367 Ga0207702_101553672 317
697 3300026078 Ga0207702_10313442 Ga0207702_103134422 317
698 3300026088 Ga0207641_10166993 Ga0207641_101669932 317
699 3300026089 Ga0207648_10393146 Ga0207648_103931461 317
700 3300026116 Ga0207674_10110649 Ga0207674_101106492 317
701 3300026121 Ga0207683_10099071 Ga0207683_100990712 317
702 3300026142 Ga0207698_10005512 Ga0207698_100055126 317
703 3300026142 Ga0207698_10033601 Ga0207698_100336012 317
704 3300027296 Ga0209389_1000021 Ga0209389_100002136 317
705 3300027296 Ga0209389_1000086 Ga0209389_100008653 317
706 3300027357 Ga0209589_1000005 Ga0209589_1000005173 317
707 3300027357 Ga0209589_1000027 Ga0209589_100002732 317
708 3300027361 Ga0209489_100005 Ga0209489_100005173 317
709 3300027361 Ga0209489_100313 Ga0209489_10031353 317
710 3300027361 Ga0209489_105143 Ga0209489_1051433 317
711 3300027363 Ga0209700_100006 Ga0209700_100006173 317
712 3300027363 Ga0209700_100483 Ga0209700_1004834 317
713 3300027907 Ga0207428_10121684 Ga0207428_101216842 317
714 3300027907 Ga0207428_10122668 Ga0207428_101226682 317
715 3300028379 Ga0268266_10015155 Ga0268266_100151552 317
716 3300028379 Ga0268266_10018333 Ga0268266_100183334 317
717 3300028379 Ga0268266_10026503 Ga0268266_100265035 317
718 3300028379 Ga0268266_10128844 Ga0268266_101288442 317
719 3300028379 Ga0268266_10143467 Ga0268266_101434672 317
720 3300028381 Ga0268264_10113998 Ga0268264_101139981 317
721 3300028381 Ga0268264_10180154 Ga0268264_101801542 317
722 3300028794 Ga0307515_10021681 Ga0307515_100216819 317
723 3300031507 Ga0307509_10145855 Ga0307509_101458552 317
724 3300031548 Ga0307408_100046459 Ga0307408_1000464592 317
725 3300031911 Ga0307412_10122930 Ga0307412_101229302 317
726 3300031995 Ga0307409_100293167 Ga0307409_1002931672 317
727 3300033180 Ga0307510_10035866 Ga0307510_100358663 317
728 3300033180 Ga0307510_10067387 Ga0307510_100673872 317
729 3300033442 Ga0315911_1000040 Ga0315911_100004037 317
730 3300037418 Ga0395900_0003232 Ga0395900_0003232_541_1497 317
731 3300037418 Ga0395900_0008561 Ga0395900_0008561_3440_4396 317
732 3300037418 Ga0395900_0029800 Ga0395900_0029800_1049_2005 317
733 3300037418 Ga0395900_0121556 Ga0395900_0121556_1161_2117 317
734 3300037466 Ga0395898_0007511 Ga0395898_0007511_7968_8924 317
735 3300037466 Ga0395898_0009099 Ga0395898_0009099_9311_10267 317
736 3300037466 Ga0395898_0147177 Ga0395898_0147177_1248_2204 317
737 3300037471 Ga0395905_0002158 Ga0395905_0002158_8359_9315 317
738 3300037853 Ga0436364_0063930 Ga0436364_0063930_1945_2904 317
739 3300037853 Ga0436364_0674187 Ga0436364_0674187_3153_4121 317
740 3300038443 Ga0395901_0011181 Ga0395901_0011181_2064_3020 317
741 3300038443 Ga0395901_0012192 Ga0395901_0012192_362_1318 317
742 3300038443 Ga0395901_0044480 Ga0395901_0044480_3575_4531 317
743 3300038443 Ga0395901_0358781 Ga0395901_0358781_83_1039 317
744 3300038443 Ga0395901_0444016 Ga0395901_0444016_38_994 317
745 3300039437 Ga0436365_0481731 Ga0436365_0481731_889_1848 317
746 3300039437 Ga0436365_1246836 Ga0436365_1246836_46_1017 317
747 3300039437 Ga0436365_1339798 Ga0436365_1339798_1048_2004 317
748 3300039438 Ga0436360_0178193 Ga0436360_0178193_3377_4336 317
749 3300039447 Ga0436361_0606306 Ga0436361_0606306_480_1451 317
750 3300039450 Ga0436363_0839057 Ga0436363_0839057_856_1815 317
751 3300039450 Ga0436363_1333206 Ga0436363_1333206_30_986 317
752 3300039450 Ga0436363_1477180 Ga0436363_1477180_1271_2227 317
753 3300041410 Ga0439461_0033868 Ga0439461_0033868_63_1019 317
754 3300041413 Ga0439465_0053312 Ga0439465_0053312_90_1043 317
755 3300044656 Ga0466969_0039103 Ga0466969_0039103_773_1729 317
756 3300044658 Ga0466972_0000266 Ga0466972_0000266_19821_20777 317
757 3300044658 Ga0466972_0002615 Ga0466972_0002615_7620_8576 317
758 3300044683 Ga0466965_0031828 Ga0466965_0031828_1269_2225 317
759 3300044684 Ga0466966_0013523 Ga0466966_0013523_578_1534 317
760 3300044693 Ga0466961_0000172 Ga0466961_0000172_22589_23545 317
761 3300044694 Ga0466963_0005504 Ga0466963_0005504_124_1080 317
762 3300044694 Ga0466963_0005645 Ga0466963_0005645_4054_5010 317
763 3300044694 Ga0466963_0035553 Ga0466963_0035553_2209_3165 317
764 3300044706 Ga0466964_0041684 Ga0466964_0041684_659_1615 317
765 3300044735 Ga0466968_0021379 Ga0466968_0021379_866_1822 317
766 3300044842 Ga0466957_0006661 Ga0466957_0006661_598_1554 317
767 3300044842 Ga0466957_0105284 Ga0466957_0105284_421_1377 317
768 3300044901 Ga0466960_0031566 Ga0466960_0031566_580_1536 317
769 3300045049 Ga0466959_0004055 Ga0466959_0004055_7202_8158 317
770 3300045051 Ga0451576_0000231 Ga0451576_0000231_90271_91230 317
771 3300045976 Ga0466967_0008224 Ga0466967_0008224_2404_3360 317
772 3300045976 Ga0466967_0013600 Ga0466967_0013600_1260_2216 317
773 3300045976 Ga0466967_0498387 Ga0466967_0498387_150_1106 317
774 3300046460 Ga0495638_0004161 Ga0495638_0004161_6241_7197 317
775 3300046462 Ga0495651_0019144 Ga0495651_0019144_572_1528 317
776 3300046473 Ga0495582_0105771 Ga0495582_0105771_461_1423 317
777 3300046477 Ga0495664_0058826 Ga0495664_0058826_1296_2252 317
778 3300046492 Ga0495585_0116629 Ga0495585_0116629_160_1116 317
779 3300046499 Ga0495594_0232242 Ga0495594_0232242_52_1014 317
780 3300046501 Ga0495607_0081770 Ga0495607_0081770_109_1068 317
781 3300046506 Ga0495583_0110714 Ga0495583_0110714_178_1140 317
782 3300046507 Ga0495606_0060549 Ga0495606_0060549_853_1809 317
783 3300046507 Ga0495606_0088765 Ga0495606_0088765_581_1537 317
784 3300046511 Ga0495608_0003835 Ga0495608_0003835_7154_8110 317
785 3300046516 Ga0495628_0012656 Ga0495628_0012656_1026_1982 317
786 3300046522 Ga0495643_0029682 Ga0495643_0029682_849_1805 317
787 3300046529 Ga0495652_0015106 Ga0495652_0015106_4673_5629 317
788 3300046529 Ga0495652_0029484 Ga0495652_0029484_3287_4243 317
789 3300046543 Ga0495645_0027914 Ga0495645_0027914_263_1219 317
790 3300046559 Ga0495667_0003327 Ga0495667_0003327_1673_2629 317
791 3300046615 Ga0495656_0022359 Ga0495656_0022359_813_1772 317
792 3300046663 Ga0495635_0045446 Ga0495635_0045446_1894_2850 317
793 3300046674 Ga0495588_0024877 Ga0495588_0024877_335_1291 317
794 3300046678 Ga0495599_0008275 Ga0495599_0008275_5103_6059 317
795 3300046809 Ga0495600_0120154 Ga0495600_0120154_317_1273 317
796 3300046809 Ga0495600_0154096 Ga0495600_0154096_220_1182 317
797 3300047315 Ga0495581_0027606 Ga0495581_0027606_614_1570 317
798 3300047315 Ga0495581_0112206 Ga0495581_0112206_241_1203 317
799 3300047317 Ga0495604_0009181 Ga0495604_0009181_1308_2264 317
800 3300047319 Ga0495674_0030974 Ga0495674_0030974_3777_4733 317
801 3300047320 Ga0495672_0011899 Ga0495672_0011899_4154_5113 317
802 3300047443 Ga0495687_012044 Ga0495687_012044_212_1168 317
803 3300047444 Ga0495675_0006818 Ga0495675_0006818_491_1447 317
804 3300047471 Ga0495684_0142581 Ga0495684_0142581_171_1127 317
805 3300048904 Ga0496101_0268151 Ga0496101_0268151_335_1291 317
806 3300048905 Ga0496102_0076537 Ga0496102_0076537_1970_2926 317
807 3300048905 Ga0496102_0173241 Ga0496102_0173241_65_1021 317
808 3300048907 Ga0496104_0007795 Ga0496104_0007795_2609_3565 317
809 3300048907 Ga0496104_0058381 Ga0496104_0058381_1792_2748 317
810 3300048908 Ga0496105_0080570 Ga0496105_0080570_733_1689 317
811 3300048909 Ga0496106_0162042 Ga0496106_0162042_773_1729 317
812 3300048910 Ga0496107_0265811 Ga0496107_0265811_224_1180 317
813 3300048911 Ga0496108_0007612 Ga0496108_0007612_1889_2845 317
814 3300048911 Ga0496108_0051120 Ga0496108_0051120_602_1558 317
815 3300048912 Ga0496109_0021076 Ga0496109_0021076_3038_3994 317
816 3300048912 Ga0496109_0214121 Ga0496109_0214121_64_1020 317
817 3300048913 Ga0496110_0205528 Ga0496110_0205528_513_1469 317
818 3300048915 Ga0496112_0012721 Ga0496112_0012721_2237_3193 317
819 3300048915 Ga0496112_0089225 Ga0496112_0089225_2045_3001 317
820 3300048916 Ga0496113_0058727 Ga0496113_0058727_1854_2810 317
821 3300048916 Ga0496113_0334073 Ga0496113_0334073_142_1098 317
822 3300048918 Ga0496115_0088858 Ga0496115_0088858_735_1691 317
823 3300048918 Ga0496115_0348319 Ga0496115_0348319_26_982 317
824 3300048919 Ga0496116_0071172 Ga0496116_0071172_1086_2042 317
825 3300048920 Ga0496117_0199209 Ga0496117_0199209_158_1114 317
826 3300048923 Ga0496120_0086090 Ga0496120_0086090_485_1441 317
827 3300048924 Ga0496121_0066126 Ga0496121_0066126_35_991 317
828 3300048924 Ga0496121_0151132 Ga0496121_0151132_395_1351 317
829 3300048925 Ga0496122_0104543 Ga0496122_0104543_119_1075 317
830 3300048926 Ga0496123_0088520 Ga0496123_0088520_314_1270 317
831 3300048926 Ga0496123_0111861 Ga0496123_0111861_354_1310 317
832 3300048928 Ga0496125_0093408 Ga0496125_0093408_1085_2041 317
833 3300048929 Ga0496126_0024395 Ga0496126_0024395_4581_5537 317
834 3300048929 Ga0496126_0046669 Ga0496126_0046669_2282_3238 317
835 3300048929 Ga0496126_0085214 Ga0496126_0085214_106_1062 317
836 3300049571 Ga0501034_0022087 Ga0501034_0022087_1355_2311 317
837 3300049579 Ga0501043_0067753 Ga0501043_0067753_1069_2025 317
838 3300049581 Ga0501047_0203035 Ga0501047_0203035_853_1809 317
839 3300049584 Ga0501068_0008897 Ga0501068_0008897_4092_5048 317
840 3300049587 Ga0501071_0030318 Ga0501071_0030318_2715_3671 317
841 3300049823 Ga0501044_0018528 Ga0501044_0018528_547_1503 317
842 3300049823 Ga0501044_0107423 Ga0501044_0107423_403_1359 317
843 3300050490 nmdc:mga03n38_1055_c1 nmdc:mga03n38_1055_c1_5971_6927 317
844 3300050490 nmdc:mga03n38_10745_c1 nmdc:mga03n38_10745_c1_1428_2390 317
845 3300050490 nmdc:mga03n38_28573_c1 nmdc:mga03n38_28573_c1_586_1548 317
846 3300050490 nmdc:mga03n38_51920_c1 nmdc:mga03n38_51920_c1_562_1518 317
847 3300050491 nmdc:mga00v17_107902_c1 nmdc:mga00v17_107902_c1_573_1529 317
848 3300050491 nmdc:mga00v17_31246_c1 nmdc:mga00v17_31246_c1_255_1211 317
849 3300050492 nmdc:mga0yw44_14491_c1 nmdc:mga0yw44_14491_c1_1423_2379 317
850 3300050492 nmdc:mga0yw44_24043_c1 nmdc:mga0yw44_24043_c1_2010_2969 317
851 3300050492 nmdc:mga0yw44_24162_c1 nmdc:mga0yw44_24162_c1_677_1633 317
852 3300050492 nmdc:mga0yw44_26989_c1 nmdc:mga0yw44_26989_c1_682_1638 317
853 3300050492 nmdc:mga0yw44_62806_c1 nmdc:mga0yw44_62806_c1_568_1530 317
854 3300050494 nmdc:mga06z11_11047_c1 nmdc:mga06z11_11047_c1_1668_2630 317
855 3300050494 nmdc:mga06z11_6877_c1 nmdc:mga06z11_6877_c1_1364_2320 317
856 3300050495 nmdc:mga04h51_31567_c1 nmdc:mga04h51_31567_c1_186_1142 317
857 3300050496 nmdc:mga07m45_5698_c1 nmdc:mga07m45_5698_c1_4863_5825 317
858 3300050507 nmdc:mga05p37_106889_c1 nmdc:mga05p37_106889_c1_482_1438 317
859 3300050507 nmdc:mga05p37_410753_c1 nmdc:mga05p37_410753_c1_273_1259 317
860 3300050508 nmdc:mga09592_45885_c1 nmdc:mga09592_45885_c1_2143_3108 317
861 3300050509 nmdc:mga0qj67_185567_c1 nmdc:mga0qj67_185567_c1_542_1501 317
862 3300050510 nmdc:mga06r32_12511_c1 nmdc:mga06r32_12511_c1_3092_4078 317
863 3300050510 nmdc:mga06r32_4390_c1 nmdc:mga06r32_4390_c1_7355_8320 317
864 3300053086 Ga0500578_0220828 Ga0500578_0220828_29_985 317
865 3300053087 Ga0500643_000016 Ga0500643_000016_146306_147262 317
866 3300053091 Ga0500647_0022319 Ga0500647_0022319_161_1117 317
867 3300053093 Ga0500651_0141756 Ga0500651_0141756_345_1301 317
868 3300053095 Ga0500640_088921 Ga0500640_088921_237_1193 317
869 3300053104 Ga0500556_0005530 Ga0500556_0005530_906_1862 317
870 3300053105 Ga0500557_000058 Ga0500557_000058_16198_17154 317
871 3300053109 Ga0500569_006597 Ga0500569_006597_827_1783 317
872 3300053119 Ga0500595_001183 Ga0500595_001183_9584_10543 317
873 3300053119 Ga0500595_030904 Ga0500595_030904_600_1556 317
874 3300053130 Ga0500642_0000151 Ga0500642_0000151_1737_2693 317
875 3300053130 Ga0500642_0045614 Ga0500642_0045614_407_1363 317
876 3300053134 Ga0500658_0071732 Ga0500658_0071732_141_1097 317
877 3300053139 Ga0500568_0016475 Ga0500568_0016475_66_1022 317
878 3300053153 Ga0500616_0026790 Ga0500616_0026790_114_1070 317
879 3300053155 Ga0500620_065597 Ga0500620_065597_200_1156 317
880 3300053156 Ga0500622_0044158 Ga0500622_0044158_128_1084 317
881 3300053162 Ga0500638_009653 Ga0500638_009653_1221_2180 317
882 3300053177 Ga0500636_0000146 Ga0500636_0000146_15190_16146 317
883 3300053178 Ga0500637_0000138 Ga0500637_0000138_21735_22694 317
884 3300053737 Ga0500601_000523 Ga0500601_000523_3261_4217 317
885 3300055283 Ga0500661_000130 Ga0500661_000130_2341_3300 317
886 3300059644 Ga0587075_003396 Ga0587075_003396_355_1323 317
887 iso_pu_bacteria 8019555841 8019563807 317
888 iso_pu_bacteria 8019565922 8019573873 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

129

340

0.88

Feature Viewer

pLDDT pTM Quality
60.08 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map