F484751

General Info

Members Datasets Scaffolds Average Seq Length
888 339 875 193

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100665284|Ga0068862_1006652841
Length 209
Sequence MAEPSPCPAGGWAPSLRGEYPQLVVGLGNPGPQYATTRHNLGFLIADILSDRIGSGFKVHKKSGAEVATGRLGGRSVVLAKPRCYMNESGRQVGPLAKFYSVPPADIVVIHDELDIDFGRIRLKFGGGVAGHNGLRSVGSSLGTNDFQRVRIGIGRPPGRMEGAAFVLSNFTNTEWREVPTICEQAADATELLVADGLEPAQNTVHAWG

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
5 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
6 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
7 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
8 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
9 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
10 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
11 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
12 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
13 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
14 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
17 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
200 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
201 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
213 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
214 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
215 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
216 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
217 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
220 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
221 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
222 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
223 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
224 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
225 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
226 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
227 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
228 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
229 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
232 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
233 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
234 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
235 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
236 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
237 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
238 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
243 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
248 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
249 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
250 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
264 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
265 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
290 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
312 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
320 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
321 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
324 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
328 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
329 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
330 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
331 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
332 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
333 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
334 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
335 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
338 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
339 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 0
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.77
Nodule 0.11
Rhizoplane 8.45
Rhizosphere 77.93
Stem 0
Stem Tuber 0
Unclassified 5.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1008944 3300001977 Bacteria 1504
2 JGI24739J22299_10083003 3300001989 Bacteria 982
3 JGI24743J22301_10013189 3300001991 Bacteria 1512
4 JGI24745J21846_1003814 3300002073 Bacteria 1591
5 JGI24745J21846_1016360 3300002073 Bacteria 860
6 JGI24749J21850_1007767 3300002076 Bacteria 1495
7 Ga0055540_1000043 3300003792 Bacteria 155228
8 Ga0055540_1007851 3300003792 Bacteria 3947
9 Ga0070676_10045179 3300005328 Bacteria 2565
10 Ga0070676_10124387 3300005328 Bacteria 1623
11 Ga0070690_100143971 3300005330 Bacteria 1620
12 Ga0070690_100155322 3300005330 Bacteria 1564
13 Ga0070670_100071249 3300005331 Bacteria 2984
14 Ga0070670_100199219 3300005331 Bacteria 1739
15 Ga0070670_100212651 3300005331 Bacteria 1681
16 Ga0070677_10004991 3300005333 Bacteria 4358
17 Ga0068869_100019489 3300005334 Bacteria 4637
18 Ga0068869_100055923 3300005334 Bacteria 2877
19 Ga0068869_100129571 3300005334 Bacteria 1938
20 Ga0068869_101056266 3300005334 Bacteria 709
21 Ga0070666_10080831 3300005335 Bacteria 2221
22 Ga0068868_100001163 3300005338 Bacteria 18048
23 Ga0068868_100681562 3300005338 Bacteria 918
24 Ga0070660_100155321 3300005339 Bacteria 1841
25 Ga0070689_100026826 3300005340 Bacteria 4339
26 Ga0070689_100094272 3300005340 Bacteria 2363
27 Ga0070689_100155719 3300005340 Bacteria 1845
28 Ga0070689_100969405 3300005340 Bacteria 755
29 Ga0070691_10010543 3300005341 Bacteria 4219
30 Ga0070661_100160224 3300005344 Bacteria 1704
31 Ga0070692_10069345 3300005345 Bacteria 1876
32 Ga0070668_100001540 3300005347 Bacteria 16632
33 Ga0070668_100153909 3300005347 Bacteria 1862
34 Ga0070668_100156989 3300005347 Bacteria 1843
35 Ga0070669_100007711 3300005353 Bacteria 7695
36 Ga0070669_100135310 3300005353 Bacteria 1895
37 Ga0070669_100300805 3300005353 Bacteria 1290
38 Ga0070669_100649322 3300005353 Bacteria 887
39 Ga0070675_100161598 3300005354 Bacteria 1926
40 Ga0070675_100222581 3300005354 Bacteria 1644
41 Ga0070671_100043005 3300005355 Bacteria 3756
42 Ga0070671_100085812 3300005355 Bacteria 2634
43 Ga0070671_100086014 3300005355 Bacteria 2630
44 Ga0070671_100169639 3300005355 Bacteria 1845
45 Ga0070674_100089173 3300005356 Bacteria 2221
46 Ga0070674_100229082 3300005356 Bacteria 1449
47 Ga0070674_100309703 3300005356 Bacteria 1262
48 Ga0070673_100005957 3300005364 Bacteria 7881
49 Ga0070673_100188383 3300005364 Bacteria 1770
50 Ga0070673_100203191 3300005364 Bacteria 1707
51 Ga0070688_100257131 3300005365 Bacteria 1246
52 Ga0070688_100720532 3300005365 Bacteria 774
53 Ga0070659_100053946 3300005366 Bacteria 3165
54 Ga0070659_100068613 3300005366 Bacteria 2813
55 Ga0070659_100318681 3300005366 Bacteria 1299
56 Ga0070659_100967381 3300005366 Bacteria 746
57 Ga0070667_100000791 3300005367 Bacteria 29649
58 Ga0070667_100013973 3300005367 Bacteria 6635
59 Ga0070667_100029854 3300005367 Bacteria 4545
60 Ga0070667_100897239 3300005367 Bacteria 825
61 Ga0070703_10308729 3300005406 Bacteria 662
62 Ga0070709_10055686 3300005434 Bacteria 2498
63 Ga0070709_10077029 3300005434 Bacteria 2167
64 Ga0070714_100128686 3300005435 Bacteria 2261
65 Ga0070713_100095738 3300005436 Bacteria 2562
66 Ga0070710_10000690 3300005437 Bacteria 16057
67 Ga0070710_10003060 3300005437 Bacteria 7951
68 Ga0070710_10033713 3300005437 Bacteria 2782
69 Ga0070701_10001806 3300005438 Bacteria 8078
70 Ga0070701_10091749 3300005438 Bacteria 1665
71 Ga0070711_100000160 3300005439 Bacteria 36517
72 Ga0070711_100007595 3300005439 Bacteria 6597
73 Ga0070705_100032461 3300005440 Bacteria 2901
74 Ga0070705_100113172 3300005440 Bacteria 1738
75 Ga0070705_100236165 3300005440 Bacteria 1275
76 Ga0070700_100041374 3300005441 Bacteria 2825
77 Ga0070700_100190486 3300005441 Bacteria 1433
78 Ga0070694_100048520 3300005444 Bacteria 2857
79 Ga0070663_100167351 3300005455 Bacteria 1697
80 Ga0070663_100204504 3300005455 Bacteria 1543
81 Ga0070678_100000117 3300005456 Bacteria 31126
82 Ga0070678_100137249 3300005456 Bacteria 1952
83 Ga0070678_100153911 3300005456 Bacteria 1855
84 Ga0070662_100014176 3300005457 Bacteria 5319
85 Ga0070662_100467765 3300005457 Bacteria 1048
86 Ga0068867_100004067 3300005459 Bacteria 10296
87 Ga0068867_100010852 3300005459 Bacteria 6425
88 Ga0068867_100028527 3300005459 Bacteria 4020
89 Ga0068867_100173347 3300005459 Bacteria 1710
90 Ga0068867_100579427 3300005459 Bacteria 976
91 Ga0070685_10032722 3300005466 Bacteria 2914
92 Ga0070684_101506148 3300005535 Bacteria 634
93 Ga0068853_100023310 3300005539 Bacteria 5180
94 Ga0068853_100079103 3300005539 Bacteria 2874
95 Ga0068853_100124253 3300005539 Bacteria 2304
96 Ga0068853_100147840 3300005539 Bacteria 2113
97 Ga0070672_100067944 3300005543 Bacteria 2825
98 Ga0070686_100081996 3300005544 Bacteria 2138
99 Ga0070686_100148982 3300005544 Bacteria 1637
100 Ga0070695_100487647 3300005545 Bacteria 951
101 Ga0070696_100010017 3300005546 Bacteria 6339
102 Ga0070696_100171824 3300005546 Bacteria 1603
103 Ga0070693_100455667 3300005547 Bacteria 898
104 Ga0070665_100005216 3300005548 Bacteria 13444
105 Ga0070665_100006373 3300005548 Bacteria 12030
106 Ga0070665_100009409 3300005548 Bacteria 9888
107 Ga0070665_100029759 3300005548 Bacteria 5495
108 Ga0070665_100432064 3300005548 Bacteria 1326
109 Ga0070665_101237347 3300005548 Bacteria 757
110 Ga0070704_100041327 3300005549 Bacteria 3181
111 Ga0068855_101237862 3300005563 Bacteria 775
112 Ga0070664_100061616 3300005564 Bacteria 3198
113 Ga0070664_100764736 3300005564 Bacteria 902
114 Ga0068857_100794198 3300005577 Bacteria 904
115 Ga0068854_100009069 3300005578 Bacteria 6411
116 Ga0068854_100127101 3300005578 Bacteria 1942
117 Ga0068854_100286875 3300005578 Bacteria 1327
118 Ga0068854_100931624 3300005578 Bacteria 765
119 Ga0068856_100220476 3300005614 Bacteria 1912
120 Ga0070702_100000873 3300005615 Bacteria 11690
121 Ga0070702_100044762 3300005615 Bacteria 2500
122 Ga0068852_100103135 3300005616 Bacteria 2579
123 Ga0068852_100287681 3300005616 Bacteria 1586
124 Ga0068852_100593908 3300005616 Bacteria 1111
125 Ga0068859_100001042 3300005617 Bacteria 28409
126 Ga0068859_100116679 3300005617 Bacteria 2734
127 Ga0068859_100261551 3300005617 Bacteria 1822
128 Ga0068859_100577187 3300005617 Bacteria 1218
129 Ga0068864_100008552 3300005618 Bacteria 8447
130 Ga0068864_100040080 3300005618 Bacteria 4006
131 Ga0068864_100235403 3300005618 Bacteria 1695
132 Ga0068864_101469661 3300005618 Bacteria 684
133 Ga0068866_10000441 3300005718 Bacteria 19171
134 Ga0068866_10027916 3300005718 Bacteria 2684
135 Ga0068861_100003820 3300005719 Bacteria 10055
136 Ga0068861_100218434 3300005719 Bacteria 1610
137 Ga0068861_100902249 3300005719 Bacteria 837
138 Ga0068870_10496446 3300005840 Bacteria 813
139 Ga0068863_100001025 3300005841 Bacteria 27909
140 Ga0068863_100012259 3300005841 Bacteria 8277
141 Ga0068863_100027751 3300005841 Bacteria 5403
142 Ga0068863_100029840 3300005841 Bacteria 5208
143 Ga0068863_100089781 3300005841 Bacteria 2914
144 Ga0068863_100499357 3300005841 Bacteria 1198
145 Ga0068863_101003205 3300005841 Bacteria 837
146 Ga0068858_100004832 3300005842 Bacteria 13203
147 Ga0068858_100016818 3300005842 Bacteria 6869
148 Ga0068858_100074042 3300005842 Bacteria 3162
149 Ga0068858_100123671 3300005842 Bacteria 2421
150 Ga0068858_101552539 3300005842 Bacteria 653
151 Ga0068860_100000087 3300005843 Bacteria 158242
152 Ga0068860_100008728 3300005843 Bacteria 10094
153 Ga0068860_100049084 3300005843 Bacteria 4022
154 Ga0068860_100184027 3300005843 Bacteria 2020
155 Ga0068860_100283471 3300005843 Bacteria 1620
156 Ga0068860_100582440 3300005843 Bacteria 1123
157 Ga0068862_100000077 3300005844 Bacteria 116781
158 Ga0068862_100008978 3300005844 Bacteria 8277
159 Ga0068862_100045978 3300005844 Bacteria 3726
160 Ga0068862_100081482 3300005844 Bacteria 2808
161 Ga0068862_100083623 3300005844 Bacteria 2772
162 Ga0068862_100298420 3300005844 Bacteria 1481
163 Ga0068862_100621002 3300005844 Bacteria 1040
164 Ga0068862_100665284 3300005844 Bacteria 1006
165 Ga0081455_10253084 3300005937 Bacteria 1287
166 Ga0081538_10067540 3300005981 Bacteria 1995
167 Ga0070717_10489261 3300006028 Bacteria 1111
168 Ga0075365_10408359 3300006038 Bacteria 958
169 Ga0075365_10410611 3300006038 Bacteria 956
170 Ga0075368_10008666 3300006042 Bacteria 3632
171 Ga0075363_100008437 3300006048 Bacteria 4796
172 Ga0075363_100018254 3300006048 Bacteria 3491
173 Ga0075363_100038889 3300006048 Bacteria 2502
174 Ga0075363_100070873 3300006048 Bacteria 1893
175 Ga0075363_100119312 3300006048 Bacteria 1472
176 Ga0075363_100182829 3300006048 Bacteria 1193
177 Ga0075364_10063286 3300006051 Bacteria 2429
178 Ga0070715_10024074 3300006163 Bacteria 2393
179 Ga0070715_10322756 3300006163 Bacteria 834
180 Ga0070716_100009944 3300006173 Bacteria 4757
181 Ga0070716_100034686 3300006173 Bacteria 2768
182 Ga0070716_100284764 3300006173 Bacteria 1142
183 Ga0070712_100000846 3300006175 Bacteria 18192
184 Ga0070712_100002348 3300006175 Bacteria 11656
185 Ga0070712_100216142 3300006175 Bacteria 1514
186 Ga0070712_100787855 3300006175 Bacteria 815
187 Ga0070712_100891951 3300006175 Bacteria 766
188 Ga0075362_10032507 3300006177 Bacteria 2264
189 Ga0075367_10039786 3300006178 Bacteria 2743
190 Ga0075369_10004544 3300006186 Bacteria 5137
191 Ga0075369_10012989 3300006186 Bacteria 3295
192 Ga0075369_10085533 3300006186 Bacteria 1402
193 Ga0097621_100014593 3300006237 Bacteria 5886
194 Ga0075370_10027074 3300006353 Bacteria 3179
195 Ga0075370_10095310 3300006353 Bacteria 1719
196 Ga0075370_10140851 3300006353 Bacteria 1410
197 Ga0075370_10405957 3300006353 Bacteria 817
198 Ga0068871_100003130 3300006358 Bacteria 11355
199 Ga0068871_100007688 3300006358 Bacteria 7711
200 Ga0068871_100048970 3300006358 Bacteria 3414
201 Ga0075428_100071233 3300006844 Bacteria 3799
202 Ga0075428_100101443 3300006844 Bacteria 3137
203 Ga0075428_100138818 3300006844 Bacteria 2643
204 Ga0075430_100099602 3300006846 Bacteria 2427
205 Ga0075430_100123661 3300006846 Bacteria 2156
206 Ga0075431_100111441 3300006847 Bacteria 2824
207 Ga0068865_100010990 3300006881 Bacteria 5650
208 Ga0068865_100063301 3300006881 Bacteria 2599
209 Ga0068865_100144687 3300006881 Bacteria 1796
210 Ga0068865_100512164 3300006881 Bacteria 1002
211 Ga0097620_100001042 3300006931 Bacteria 28409
212 Ga0097620_100116667 3300006931 Bacteria 2734
213 Ga0097620_100261540 3300006931 Bacteria 1822
214 Ga0097620_100577195 3300006931 Bacteria 1218
215 Ga0099795_10039323 3300007788 Bacteria 1674
216 Ga0105250_10194592 3300009092 Bacteria 854
217 Ga0105250_10197597 3300009092 Bacteria 848
218 Ga0105240_10500877 3300009093 Bacteria 1350
219 Ga0105245_10008338 3300009098 Bacteria 9053
220 Ga0105245_10059620 3300009098 Bacteria 3437
221 Ga0105245_10178791 3300009098 Bacteria 2025
222 Ga0105245_10281693 3300009098 Bacteria 1625
223 Ga0105247_10000060 3300009101 Bacteria 127879
224 Ga0105247_10000298 3300009101 Bacteria 44765
225 Ga0105247_10183557 3300009101 Bacteria 1397
226 Ga0105243_10000700 3300009148 Bacteria 32410
227 Ga0105243_10035567 3300009148 Bacteria 3862
228 Ga0105243_10045903 3300009148 Bacteria 3435
229 Ga0105241_10399990 3300009174 Bacteria 1204
230 Ga0105241_11289172 3300009174 Bacteria 695
231 Ga0105242_10001954 3300009176 Bacteria 16221
232 Ga0105248_10000050 3300009177 Bacteria 152667
233 Ga0105248_10003516 3300009177 Bacteria 17379
234 Ga0105248_10056751 3300009177 Bacteria 4393
235 Ga0105248_10271166 3300009177 Bacteria 1911
236 Ga0105237_10006011 3300009545 Bacteria 13581
237 Ga0105237_10011826 3300009545 Bacteria 9231
238 Ga0105237_10027144 3300009545 Bacteria 5848
239 Ga0105237_10336453 3300009545 Bacteria 1514
240 Ga0105237_10942392 3300009545 Bacteria 870
241 Ga0105238_10022028 3300009551 Bacteria 6494
242 Ga0105249_10000042 3300009553 Bacteria 195242
243 Ga0105249_10000470 3300009553 Bacteria 37482
244 Ga0105249_10322643 3300009553 Bacteria 1556
245 Ga0105249_10597676 3300009553 Bacteria 1158
246 Ga0105249_10731922 3300009553 Bacteria 1050
247 Ga0105249_10807360 3300009553 Bacteria 1002
248 Ga0105249_11317480 3300009553 Bacteria 794
249 Ga0099796_10114238 3300010159 Bacteria 1031
250 Ga0105239_10016841 3300010375 Bacteria 8078
251 Ga0105239_10024596 3300010375 Bacteria 6634
252 Ga0105239_10109829 3300010375 Bacteria 3057
253 Ga0105246_10033636 3300011119 Bacteria 3410
254 Ga0105246_10430705 3300011119 Bacteria 1103
255 Ga0157374_10032490 3300013296 Bacteria 4752
256 Ga0157378_10001860 3300013297 Bacteria 18955
257 Ga0157378_10088440 3300013297 Bacteria 2811
258 Ga0163162_10006550 3300013306 Bacteria 11281
259 Ga0163162_10028905 3300013306 Bacteria 5487
260 Ga0163162_10139046 3300013306 Bacteria 2541
261 Ga0163162_10438171 3300013306 Bacteria 1439
262 Ga0157372_10048234 3300013307 Bacteria 4734
263 Ga0157375_10078003 3300013308 Bacteria 3344
264 Ga0157375_10126472 3300013308 Bacteria 2671
265 Ga0157375_10294174 3300013308 Bacteria 1787
266 Ga0157375_10319953 3300013308 Bacteria 1716
267 Ga0157375_10793912 3300013308 Bacteria 1096
268 Ga0163163_10082758 3300014325 Bacteria 3214
269 Ga0163163_10436575 3300014325 Bacteria 1369
270 Ga0163163_10443537 3300014325 Bacteria 1358
271 Ga0163163_10459637 3300014325 Bacteria 1333
272 Ga0157380_10010166 3300014326 Bacteria 6763
273 Ga0157380_10060027 3300014326 Bacteria 3037
274 Ga0157380_10119722 3300014326 Bacteria 2228
275 Ga0157377_10242850 3300014745 Bacteria 1163
276 Ga0157379_10002499 3300014968 Bacteria 15398
277 Ga0157379_10215345 3300014968 Bacteria 1740
278 Ga0157379_10374241 3300014968 Bacteria 1306
279 Ga0157376_10006456 3300014969 Bacteria 8285
280 Ga0157376_10160680 3300014969 Bacteria 2036
281 Ga0157376_10168266 3300014969 Bacteria 1993
282 Ga0157376_10296027 3300014969 Bacteria 1530
283 Ga0163161_10015854 3300017792 Bacteria 5256
284 Ga0163161_10041561 3300017792 Bacteria 3303
285 Ga0163161_10089371 3300017792 Bacteria 2278
286 Ga0163161_10104581 3300017792 Bacteria 2111
287 Ga0209673_1013931 3300025273 Bacteria 3143
288 Ga0209051_1000108 3300025303 Bacteria 155280
289 Ga0209051_1000642 3300025303 Bacteria 39944
290 Ga0209051_1003362 3300025303 Bacteria 10530
291 Ga0209051_1005179 3300025303 Bacteria 7721
292 Ga0207656_10099283 3300025321 Bacteria 1332
293 Ga0207682_10113439 3300025893 Bacteria 1195
294 Ga0207692_10007732 3300025898 Bacteria 4417
295 Ga0207692_10024366 3300025898 Bacteria 2813
296 Ga0207692_10154899 3300025898 Bacteria 1315
297 Ga0207642_10008317 3300025899 Bacteria 3552
298 Ga0207642_10204812 3300025899 Bacteria 1092
299 Ga0207710_10000010 3300025900 Bacteria 482087
300 Ga0207710_10011288 3300025900 Bacteria 3761
301 Ga0207688_10021558 3300025901 Bacteria 3522
302 Ga0207688_10113743 3300025901 Bacteria 1573
303 Ga0207680_10044300 3300025903 Bacteria 2616
304 Ga0207680_10113827 3300025903 Bacteria 1759
305 Ga0207680_10130307 3300025903 Bacteria 1657
306 Ga0207680_10836468 3300025903 Bacteria 660
307 Ga0207647_10013370 3300025904 Bacteria 5693
308 Ga0207699_10005382 3300025906 Bacteria 6135
309 Ga0207645_10061757 3300025907 Bacteria 2393
310 Ga0207645_10126547 3300025907 Bacteria 1661
311 Ga0207684_10642457 3300025910 Bacteria 904
312 Ga0207671_10157610 3300025914 Bacteria 1757
313 Ga0207671_10239844 3300025914 Bacteria 1424
314 Ga0207671_10326293 3300025914 Bacteria 1215
315 Ga0207693_10000754 3300025915 Bacteria 29034
316 Ga0207693_10003890 3300025915 Bacteria 12718
317 Ga0207693_10179300 3300025915 Bacteria 1667
318 Ga0207663_10004087 3300025916 Bacteria 7234
319 Ga0207663_10031934 3300025916 Bacteria 3121
320 Ga0207662_10020192 3300025918 Bacteria 3800
321 Ga0207662_10109101 3300025918 Bacteria 1724
322 Ga0207681_10002155 3300025923 Bacteria 12552
323 Ga0207681_10025217 3300025923 Bacteria 3822
324 Ga0207681_10117074 3300025923 Bacteria 1948
325 Ga0207681_10149310 3300025923 Bacteria 1749
326 Ga0207681_10385135 3300025923 Bacteria 1129
327 Ga0207681_10508799 3300025923 Bacteria 987
328 Ga0207650_10000200 3300025925 Bacteria 69213
329 Ga0207650_10020180 3300025925 Bacteria 4696
330 Ga0207650_10105370 3300025925 Bacteria 2177
331 Ga0207650_10180221 3300025925 Bacteria 1683
332 Ga0207659_10113079 3300025926 Bacteria 2067
333 Ga0207659_10528487 3300025926 Bacteria 1001
334 Ga0207659_10596413 3300025926 Bacteria 941
335 Ga0207687_10016666 3300025927 Bacteria 4829
336 Ga0207687_10266906 3300025927 Bacteria 1367
337 Ga0207644_10026466 3300025931 Bacteria 3997
338 Ga0207644_10092085 3300025931 Bacteria 2261
339 Ga0207644_10155307 3300025931 Bacteria 1774
340 Ga0207644_10158949 3300025931 Bacteria 1755
341 Ga0207644_10262985 3300025931 Bacteria 1380
342 Ga0207644_10323274 3300025931 Bacteria 1248
343 Ga0207690_10078919 3300025932 Bacteria 2293
344 Ga0207706_10043370 3300025933 Bacteria 3986
345 Ga0207706_10060092 3300025933 Bacteria 3347
346 Ga0207706_10081036 3300025933 Bacteria 2853
347 Ga0207709_10007107 3300025935 Bacteria 6252
348 Ga0207709_10116832 3300025935 Bacteria 1794
349 Ga0207709_10312495 3300025935 Bacteria 1173
350 Ga0207670_10102625 3300025936 Bacteria 2045
351 Ga0207670_10125533 3300025936 Bacteria 1872
352 Ga0207670_10477067 3300025936 Bacteria 1010
353 Ga0207669_10020989 3300025937 Bacteria 3437
354 Ga0207669_10075261 3300025937 Bacteria 2138
355 Ga0207669_10528292 3300025937 Bacteria 948
356 Ga0207704_10030692 3300025938 Bacteria 3017
357 Ga0207704_10060877 3300025938 Bacteria 2338
358 Ga0207665_10009094 3300025939 Bacteria 6524
359 Ga0207665_10081070 3300025939 Bacteria 2233
360 Ga0207665_10184661 3300025939 Bacteria 1512
361 Ga0207665_10333124 3300025939 Bacteria 1142
362 Ga0207665_10542385 3300025939 Bacteria 903
363 Ga0207691_10055981 3300025940 Bacteria 3594
364 Ga0207711_10001406 3300025941 Bacteria 22551
365 Ga0207711_10033441 3300025941 Bacteria 4350
366 Ga0207711_10090865 3300025941 Bacteria 2685
367 Ga0207689_10031316 3300025942 Bacteria 4429
368 Ga0207689_10115900 3300025942 Bacteria 2202
369 Ga0207689_10323733 3300025942 Bacteria 1279
370 Ga0207661_10234635 3300025944 Bacteria 1626
371 Ga0207679_10337134 3300025945 Bacteria 1310
372 Ga0207679_10807160 3300025945 Bacteria 856
373 Ga0207667_10090149 3300025949 Bacteria 3169
374 Ga0207667_10320970 3300025949 Bacteria 1582
375 Ga0207651_10152246 3300025960 Bacteria 1802
376 Ga0207712_10000010 3300025961 Bacteria 455972
377 Ga0207712_10001196 3300025961 Bacteria 17936
378 Ga0207712_10136615 3300025961 Bacteria 1876
379 Ga0207712_10242346 3300025961 Bacteria 1453
380 Ga0207668_10002892 3300025972 Bacteria 10073
381 Ga0207668_10096911 3300025972 Bacteria 2181
382 Ga0207668_10577558 3300025972 Bacteria 977
383 Ga0207640_10070334 3300025981 Bacteria 2353
384 Ga0207640_10401704 3300025981 Bacteria 1116
385 Ga0207658_10000677 3300025986 Bacteria 29704
386 Ga0207658_10001961 3300025986 Bacteria 15354
387 Ga0207658_10038741 3300025986 Bacteria 3436
388 Ga0207677_10230267 3300026023 Bacteria 1492
389 Ga0207703_10009823 3300026035 Bacteria 7505
390 Ga0207703_10219734 3300026035 Bacteria 1698
391 Ga0207703_10251707 3300026035 Bacteria 1592
392 Ga0207703_11163531 3300026035 Bacteria 741
393 Ga0207639_10007030 3300026041 Bacteria 7672
394 Ga0207639_10016712 3300026041 Bacteria 5198
395 Ga0207639_10154710 3300026041 Bacteria 1925
396 Ga0207639_10221901 3300026041 Bacteria 1633
397 Ga0207639_10765949 3300026041 Bacteria 898
398 Ga0207678_10009360 3300026067 Bacteria 8622
399 Ga0207678_10016046 3300026067 Bacteria 6578
400 Ga0207678_10085821 3300026067 Bacteria 2691
401 Ga0207678_10136254 3300026067 Bacteria 2095
402 Ga0207678_10850230 3300026067 Bacteria 806
403 Ga0207708_10001431 3300026075 Bacteria 17904
404 Ga0207708_10013446 3300026075 Bacteria 6119
405 Ga0207708_10016479 3300026075 Bacteria 5557
406 Ga0207702_10486428 3300026078 Bacteria 1202
407 Ga0207641_10000849 3300026088 Bacteria 32380
408 Ga0207641_10005077 3300026088 Bacteria 11285
409 Ga0207641_10006938 3300026088 Bacteria 9479
410 Ga0207641_10027685 3300026088 Bacteria 4682
411 Ga0207641_10190822 3300026088 Bacteria 1883
412 Ga0207641_10192318 3300026088 Bacteria 1876
413 Ga0207641_10290775 3300026088 Bacteria 1540
414 Ga0207641_10785188 3300026088 Bacteria 942
415 Ga0207648_10014199 3300026089 Bacteria 7367
416 Ga0207648_10169747 3300026089 Bacteria 1928
417 Ga0207648_10592173 3300026089 Bacteria 1021
418 Ga0207676_10030889 3300026095 Bacteria 4025
419 Ga0207676_10034004 3300026095 Bacteria 3857
420 Ga0207676_10057880 3300026095 Bacteria 3054
421 Ga0207676_10122826 3300026095 Bacteria 2193
422 Ga0207676_10642776 3300026095 Bacteria 1023
423 Ga0207675_100007850 3300026118 Bacteria 10069
424 Ga0207675_100063261 3300026118 Bacteria 3457
425 Ga0207675_100116420 3300026118 Bacteria 2526
426 Ga0207675_100200892 3300026118 Bacteria 1915
427 Ga0207675_101043176 3300026118 Bacteria 837
428 Ga0207683_10000984 3300026121 Bacteria 26143
429 Ga0207683_10050483 3300026121 Bacteria 3644
430 Ga0207683_10058440 3300026121 Bacteria 3386
431 Ga0207683_10163373 3300026121 Bacteria 2014
432 Ga0207698_10151770 3300026142 Bacteria 2012
433 Ga0207698_10161701 3300026142 Bacteria 1959
434 Ga0207698_11238689 3300026142 Bacteria 760
435 Ga0209983_1037523 3300027665 Bacteria 1043
436 Ga0209813_10184443 3300027866 Bacteria 765
437 Ga0209974_10001606 3300027876 Bacteria 8169
438 Ga0209974_10060232 3300027876 Bacteria 1284
439 Ga0209974_10077241 3300027876 Bacteria 1141
440 Ga0268266_10011403 3300028379 Bacteria 7729
441 Ga0268266_10030548 3300028379 Bacteria 4577
442 Ga0268266_10770164 3300028379 Bacteria 929
443 Ga0268265_10000014 3300028380 Bacteria 330186
444 Ga0268265_10003531 3300028380 Bacteria 11183
445 Ga0268264_10000150 3300028381 Bacteria 158263
446 Ga0268264_10027397 3300028381 Bacteria 4655
447 Ga0268264_10034902 3300028381 Bacteria 4140
448 Ga0268264_10057589 3300028381 Bacteria 3251
449 Ga0268264_10357850 3300028381 Bacteria 1391
450 Ga0268264_10469849 3300028381 Bacteria 1222
451 Ga0268264_10527733 3300028381 Bacteria 1155
452 Ga0268264_10563875 3300028381 Bacteria 1118
453 Ga0268264_10745845 3300028381 Bacteria 975
454 Ga0265327_10002508 3300031251 Bacteria 19190
455 Ga0307408_100027291 3300031548 Bacteria 3932
456 Ga0307408_100033296 3300031548 Bacteria 3599
457 Ga0307408_100035312 3300031548 Bacteria 3507
458 Ga0307408_100042286 3300031548 Bacteria 3236
459 Ga0307408_100310639 3300031548 Bacteria 1324
460 Ga0307405_10007163 3300031731 Bacteria 5549
461 Ga0307405_10019495 3300031731 Bacteria 3769
462 Ga0307405_10028387 3300031731 Bacteria 3258
463 Ga0307405_10032703 3300031731 Bacteria 3076
464 Ga0307405_10040394 3300031731 Bacteria 2826
465 Ga0307405_10115560 3300031731 Bacteria 1826
466 Ga0307405_10150351 3300031731 Bacteria 1636
467 Ga0307405_10314544 3300031731 Bacteria 1193
468 Ga0307413_10006149 3300031824 Bacteria 5450
469 Ga0307413_10007453 3300031824 Bacteria 5083
470 Ga0307413_10025791 3300031824 Bacteria 3228
471 Ga0307413_10034510 3300031824 Bacteria 2892
472 Ga0307413_10081440 3300031824 Bacteria 2075
473 Ga0307413_10097484 3300031824 Bacteria 1933
474 Ga0307413_10118621 3300031824 Bacteria 1787
475 Ga0307413_10221061 3300031824 Bacteria 1384
476 Ga0307413_10231476 3300031824 Bacteria 1357
477 Ga0307413_10260493 3300031824 Bacteria 1292
478 Ga0307413_10322469 3300031824 Bacteria 1180
479 Ga0307413_10350035 3300031824 Bacteria 1140
480 Ga0307413_10463325 3300031824 Bacteria 1009
481 Ga0307413_10465328 3300031824 Bacteria 1007
482 Ga0307413_10475481 3300031824 Bacteria 997
483 Ga0307413_10751672 3300031824 Bacteria 815
484 Ga0307410_10005506 3300031852 Bacteria 6711
485 Ga0307410_10007693 3300031852 Bacteria 5914
486 Ga0307410_10013669 3300031852 Bacteria 4745
487 Ga0307410_10017712 3300031852 Bacteria 4285
488 Ga0307410_10026046 3300031852 Bacteria 3676
489 Ga0307410_10036408 3300031852 Bacteria 3205
490 Ga0307410_10041689 3300031852 Bacteria 3028
491 Ga0307410_10110856 3300031852 Bacteria 1985
492 Ga0307410_10114126 3300031852 Bacteria 1960
493 Ga0307410_10116087 3300031852 Bacteria 1944
494 Ga0307410_10205933 3300031852 Bacteria 1505
495 Ga0307406_10000523 3300031901 Bacteria 22089
496 Ga0307406_10001368 3300031901 Bacteria 13620
497 Ga0307406_10071678 3300031901 Bacteria 2271
498 Ga0307406_10145510 3300031901 Bacteria 1683
499 Ga0307406_10210604 3300031901 Bacteria 1438
500 Ga0307406_10229518 3300031901 Bacteria 1385
501 Ga0307406_10235661 3300031901 Bacteria 1369
502 Ga0307406_10716201 3300031901 Bacteria 837
503 Ga0307406_10825586 3300031901 Bacteria 784
504 Ga0307407_10000814 3300031903 Bacteria 10352
505 Ga0307407_10018509 3300031903 Bacteria 3524
506 Ga0307407_10021922 3300031903 Bacteria 3304
507 Ga0307407_10024118 3300031903 Bacteria 3185
508 Ga0307407_10033008 3300031903 Bacteria 2820
509 Ga0307407_10087002 3300031903 Bacteria 1905
510 Ga0307407_10332131 3300031903 Bacteria 1070
511 Ga0307407_10340207 3300031903 Bacteria 1059
512 Ga0307407_10489475 3300031903 Bacteria 900
513 Ga0307412_10010517 3300031911 Bacteria 5331
514 Ga0307412_10010903 3300031911 Bacteria 5247
515 Ga0307412_10062207 3300031911 Bacteria 2512
516 Ga0307412_10071009 3300031911 Bacteria 2375
517 Ga0307412_10178792 3300031911 Bacteria 1593
518 Ga0307412_10449298 3300031911 Bacteria 1061
519 Ga0307412_10502027 3300031911 Bacteria 1010
520 Ga0307412_10659750 3300031911 Bacteria 893
521 Ga0307409_100009090 3300031995 Bacteria 6082
522 Ga0307409_100012827 3300031995 Bacteria 5359
523 Ga0307409_100079565 3300031995 Bacteria 2642
524 Ga0307409_100104456 3300031995 Bacteria 2359
525 Ga0307409_100123379 3300031995 Bacteria 2198
526 Ga0307409_100206648 3300031995 Bacteria 1761
527 Ga0307409_100214432 3300031995 Bacteria 1733
528 Ga0307409_100247234 3300031995 Bacteria 1628
529 Ga0307409_100266862 3300031995 Bacteria 1574
530 Ga0307409_100394702 3300031995 Bacteria 1319
531 Ga0307409_100613971 3300031995 Bacteria 1076
532 Ga0307409_100877112 3300031995 Bacteria 909
533 Ga0307416_100001639 3300032002 Bacteria 12337
534 Ga0307416_100014618 3300032002 Bacteria 5389
535 Ga0307416_100017219 3300032002 Bacteria 5048
536 Ga0307416_100018157 3300032002 Bacteria 4947
537 Ga0307416_100031150 3300032002 Bacteria 4011
538 Ga0307416_100048679 3300032002 Bacteria 3365
539 Ga0307416_100074232 3300032002 Bacteria 2840
540 Ga0307416_100122060 3300032002 Bacteria 2324
541 Ga0307416_100134389 3300032002 Bacteria 2234
542 Ga0307416_100223030 3300032002 Bacteria 1810
543 Ga0307416_100304822 3300032002 Bacteria 1585
544 Ga0307416_100356101 3300032002 Bacteria 1483
545 Ga0307414_10014422 3300032004 Bacteria 4737
546 Ga0307414_10016835 3300032004 Bacteria 4458
547 Ga0307414_10024468 3300032004 Bacteria 3851
548 Ga0307414_10031029 3300032004 Bacteria 3499
549 Ga0307414_10060866 3300032004 Bacteria 2672
550 Ga0307414_10119321 3300032004 Bacteria 2024
551 Ga0307414_10160130 3300032004 Bacteria 1787
552 Ga0307414_10549596 3300032004 Bacteria 1029
553 Ga0307414_10672160 3300032004 Bacteria 935
554 Ga0307411_10004589 3300032005 Bacteria 6644
555 Ga0307411_10005459 3300032005 Bacteria 6247
556 Ga0307411_10020201 3300032005 Bacteria 3868
557 Ga0307411_10058897 3300032005 Bacteria 2544
558 Ga0307411_10059480 3300032005 Bacteria 2533
559 Ga0307411_10071528 3300032005 Bacteria 2351
560 Ga0307411_10108767 3300032005 Bacteria 1978
561 Ga0307411_10122193 3300032005 Bacteria 1886
562 Ga0307411_10152829 3300032005 Bacteria 1717
563 Ga0307411_10529685 3300032005 Bacteria 1002
564 Ga0307411_10541625 3300032005 Bacteria 991
565 Ga0307411_10735522 3300032005 Bacteria 863
566 Ga0307411_10957267 3300032005 Bacteria 764
567 Ga0307411_10969951 3300032005 Bacteria 759
568 Ga0307415_100002442 3300032126 Bacteria 9278
569 Ga0307415_100003563 3300032126 Bacteria 7947
570 Ga0307415_100012546 3300032126 Bacteria 4904
571 Ga0307415_100016775 3300032126 Bacteria 4375
572 Ga0307415_100024800 3300032126 Bacteria 3753
573 Ga0307415_100028792 3300032126 Bacteria 3540
574 Ga0307415_100030405 3300032126 Bacteria 3466
575 Ga0307415_100063805 3300032126 Bacteria 2561
576 Ga0307415_100070851 3300032126 Bacteria 2449
577 Ga0307415_100379944 3300032126 Bacteria 1199
578 Ga0307415_100468052 3300032126 Bacteria 1094
579 Ga0307415_100797379 3300032126 Bacteria 862
580 Ga0373958_0089911 3300034819 Bacteria 707
581 Ga0373928_0050061 3300035084 Bacteria 984
582 Ga0373928_0120553 3300035084 Bacteria 703
583 Ga0373951_0106311 3300035091 Bacteria 751
584 Ga0373923_0362800 3300035111 Bacteria 693
585 Ga0373941_0063875 3300035115 Bacteria 1205
586 Ga0373941_0070119 3300035115 Bacteria 1162
587 Ga0373943_0094195 3300035170 Bacteria 1556
588 Ga0373961_0104894 3300035241 Bacteria 919
589 Ga0395899_0036186 3300037312 Bacteria 3704
590 Ga0395900_0003419 3300037418 Bacteria 17161
591 Ga0395905_0000264 3300037471 Bacteria 78482
592 Ga0395905_1358327 3300037471 Bacteria 614
593 Ga0436364_1355465 3300037853 Bacteria 2153
594 Ga0395901_0001944 3300038443 Bacteria 21267
595 Ga0395901_0910658 3300038443 Bacteria 861
596 Ga0436363_1437196 3300039450 Bacteria 2116
597 Ga0439461_0003028 3300041410 Bacteria 2738
598 Ga0439461_0022542 3300041410 Bacteria 1262
599 Ga0439466_0010268 3300041411 Bacteria 3480
600 Ga0439466_0020018 3300041411 Bacteria 2390
601 Ga0439465_0013937 3300041413 Bacteria 2503
602 Ga0439465_0017737 3300041413 Bacteria 2224
603 Ga0451789_0438445 3300041443 Bacteria 1299
604 Ga0451793_0490399 3300041452 Bacteria 1168
605 Ga0451795_1314229 3300041456 Bacteria 2228
606 Ga0451853_1173337 3300041512 Bacteria 849
607 Ga0439431_0003474 3300041997 Bacteria 3472
608 Ga0439442_005766 3300042002 Bacteria 2479
609 Ga0439445_0014926 3300042004 Bacteria 1897
610 Ga0439432_008671 3300042006 Bacteria 3565
611 Ga0439432_047355 3300042006 Bacteria 1349
612 Ga0439449_0019998 3300042007 Bacteria 2510
613 Ga0439450_063318 3300042008 Bacteria 897
614 Ga0439434_0004459 3300042435 Bacteria 4093
615 Ga0439435_0086491 3300042436 Bacteria 947
616 Ga0466972_0008599 3300044658 Bacteria 5121
617 Ga0466965_0000697 3300044683 Bacteria 12460
618 Ga0466965_0002661 3300044683 Bacteria 7643
619 Ga0466965_0010558 3300044683 Bacteria 4314
620 Ga0466965_0010937 3300044683 Bacteria 4243
621 Ga0466965_0443488 3300044683 Bacteria 722
622 Ga0466966_0001218 3300044684 Bacteria 16526
623 Ga0466966_0015177 3300044684 Bacteria 5096
624 Ga0466966_0409876 3300044684 Bacteria 814
625 Ga0466963_0130110 3300044694 Bacteria 1738
626 Ga0466964_0063071 3300044706 Bacteria 1547
627 Ga0466964_0236617 3300044706 Bacteria 894
628 Ga0466971_0013054 3300044719 Bacteria 3644
629 Ga0466971_0073472 3300044719 Bacteria 1554
630 Ga0466968_0001182 3300044735 Bacteria 9248
631 Ga0466968_0004379 3300044735 Bacteria 5273
632 Ga0466968_0039699 3300044735 Bacteria 1982
633 Ga0466970_0014558 3300044765 Bacteria 4040
634 Ga0466957_0003667 3300044842 Bacteria 8475
635 Ga0466957_0017396 3300044842 Bacteria 4209
636 Ga0466957_0066183 3300044842 Bacteria 2227
637 Ga0466960_0000319 3300044901 Bacteria 16503
638 Ga0466960_0002911 3300044901 Bacteria 6510
639 Ga0466960_0391295 3300044901 Bacteria 799
640 Ga0466960_0433983 3300044901 Bacteria 761
641 Ga0466959_0001867 3300045049 Bacteria 13243
642 Ga0466959_0046101 3300045049 Bacteria 3208
643 Ga0466958_0003868 3300045836 Bacteria 7832
644 Ga0466958_0064035 3300045836 Bacteria 2242
645 Ga0466967_0037323 3300045976 Bacteria 4157
646 Ga0466967_0138626 3300045976 Bacteria 2264
647 Ga0466967_0153412 3300045976 Bacteria 2155
648 Ga0466967_0278445 3300045976 Bacteria 1604
649 Ga0466967_0942457 3300045976 Bacteria 859
650 Ga0495603_0197105 3300046455 Bacteria 1164
651 Ga0495629_0044588 3300046459 Bacteria 3112
652 Ga0495638_0014063 3300046460 Bacteria 5422
653 Ga0495641_0389118 3300046461 Bacteria 632
654 Ga0495582_0117284 3300046473 Bacteria 1498
655 Ga0495583_0029855 3300046506 Bacteria 2663
656 Ga0495606_0027733 3300046507 Bacteria 4009
657 Ga0495616_0108020 3300046513 Bacteria 1296
658 Ga0495620_0069298 3300046515 Bacteria 1447
659 Ga0495648_0015719 3300046524 Bacteria 5481
660 Ga0495654_0017761 3300046530 Bacteria 3734
661 Ga0495665_0091627 3300046531 Bacteria 1597
662 Ga0495640_0074333 3300046533 Bacteria 2273
663 Ga0495668_0034993 3300046616 Bacteria 2815
664 Ga0495611_0133509 3300046648 Bacteria 1158
665 Ga0495647_0034166 3300046681 Bacteria 1904
666 Ga0495669_0133769 3300046684 Bacteria 1168
667 Ga0495624_0019505 3300046690 Bacteria 4524
668 Ga0495649_0062794 3300046694 Bacteria 1997
669 Ga0495589_0261102 3300046794 Bacteria 808
670 Ga0495581_0053343 3300047315 Bacteria 2335
671 Ga0495674_0045891 3300047319 Bacteria 3880
672 Ga0495674_0620515 3300047319 Bacteria 855
673 Ga0495672_0003978 3300047320 Bacteria 12368
674 Ga0495677_0146071 3300047445 Bacteria 909
675 Ga0495673_0002945 3300047469 Bacteria 11483
676 Ga0495686_0001660 3300047472 Bacteria 23180
677 Ga0495593_0065953 3300047673 Bacteria 1887
678 Ga0495626_0260956 3300048091 Bacteria 692
679 Ga0496100_0000084 3300048903 Bacteria 53649
680 Ga0496100_0001148 3300048903 Bacteria 12879
681 Ga0496100_0001530 3300048903 Bacteria 11346
682 Ga0496100_0019526 3300048903 Bacteria 4045
683 Ga0496100_0035016 3300048903 Bacteria 3156
684 Ga0496100_0058895 3300048903 Bacteria 2522
685 Ga0496101_0000100 3300048904 Bacteria 89811
686 Ga0496101_0000110 3300048904 Bacteria 85776
687 Ga0496101_0001605 3300048904 Bacteria 13597
688 Ga0496101_0007060 3300048904 Bacteria 7261
689 Ga0496101_0179253 3300048904 Bacteria 1631
690 Ga0496102_0000006 3300048905 Bacteria 471494
691 Ga0496102_0001053 3300048905 Bacteria 25521
692 Ga0496102_0002926 3300048905 Bacteria 14485
693 Ga0496102_0008322 3300048905 Bacteria 8887
694 Ga0496102_0031183 3300048905 Bacteria 4780
695 Ga0496102_0125264 3300048905 Bacteria 2401
696 Ga0496102_0150869 3300048905 Bacteria 2184
697 Ga0496102_0307215 3300048905 Bacteria 1495
698 Ga0496102_0391051 3300048905 Bacteria 1308
699 Ga0496102_0921061 3300048905 Bacteria 795
700 Ga0496103_0000006 3300048906 Bacteria 470539
701 Ga0496103_0000400 3300048906 Bacteria 38628
702 Ga0496103_0000504 3300048906 Bacteria 32265
703 Ga0496103_0000700 3300048906 Bacteria 24863
704 Ga0496103_0019049 3300048906 Bacteria 4121
705 Ga0496103_0082546 3300048906 Bacteria 2023
706 Ga0496103_0155241 3300048906 Bacteria 1467
707 Ga0496103_0218275 3300048906 Bacteria 1226
708 Ga0496104_0028678 3300048907 Bacteria 5159
709 Ga0496104_0053659 3300048907 Bacteria 3809
710 Ga0496104_0205494 3300048907 Bacteria 1881
711 Ga0496104_0411711 3300048907 Bacteria 1264
712 Ga0496105_0049850 3300048908 Bacteria 3458
713 Ga0496105_0071224 3300048908 Bacteria 2873
714 Ga0496106_0000164 3300048909 Bacteria 47996
715 Ga0496106_0000616 3300048909 Bacteria 25450
716 Ga0496106_0011222 3300048909 Bacteria 6630
717 Ga0496106_0249619 3300048909 Bacteria 1418
718 Ga0496107_0000317 3300048910 Bacteria 26084
719 Ga0496107_0010183 3300048910 Bacteria 6522
720 Ga0496107_0037972 3300048910 Bacteria 3457
721 Ga0496107_0059589 3300048910 Bacteria 2762
722 Ga0496107_0077210 3300048910 Bacteria 2426
723 Ga0496107_0103065 3300048910 Bacteria 2093
724 Ga0496108_0030263 3300048911 Bacteria 4487
725 Ga0496108_0038048 3300048911 Bacteria 4008
726 Ga0496108_0124182 3300048911 Bacteria 2215
727 Ga0496109_0000356 3300048912 Bacteria 42608
728 Ga0496109_0002673 3300048912 Bacteria 14964
729 Ga0496109_0070109 3300048912 Bacteria 3216
730 Ga0496110_0009262 3300048913 Bacteria 7960
731 Ga0496110_0129909 3300048913 Bacteria 2274
732 Ga0496110_0308494 3300048913 Bacteria 1441
733 Ga0496110_1169212 3300048913 Bacteria 678
734 Ga0496112_0012895 3300048915 Bacteria 7697
735 Ga0496112_0021751 3300048915 Bacteria 6102
736 Ga0496112_0063898 3300048915 Bacteria 3631
737 Ga0496112_0338250 3300048915 Bacteria 1449
738 Ga0496112_1113983 3300048915 Bacteria 707
739 Ga0496113_0003931 3300048916 Bacteria 9016
740 Ga0496113_0080931 3300048916 Bacteria 2489
741 Ga0496113_0618937 3300048916 Bacteria 867
742 Ga0496114_0000164 3300048917 Bacteria 47093
743 Ga0496114_0000522 3300048917 Bacteria 28253
744 Ga0496114_0013077 3300048917 Bacteria 6649
745 Ga0496114_0417475 3300048917 Bacteria 1188
746 Ga0496114_0473451 3300048917 Bacteria 1108
747 Ga0496114_0642905 3300048917 Bacteria 933
748 Ga0496115_0002348 3300048918 Bacteria 13572
749 Ga0496115_0111016 3300048918 Bacteria 2253
750 Ga0496115_0128006 3300048918 Bacteria 2092
751 Ga0496116_0000025 3300048919 Bacteria 470539
752 Ga0496116_0002215 3300048919 Bacteria 20684
753 Ga0496116_0065239 3300048919 Bacteria 2336
754 Ga0496117_0000006 3300048920 Bacteria 758420
755 Ga0496117_0001137 3300048920 Bacteria 40112
756 Ga0496117_0042120 3300048920 Bacteria 3336
757 Ga0496118_0000004 3300048921 Bacteria 758420
758 Ga0496118_0001770 3300048921 Bacteria 31255
759 Ga0496118_0008431 3300048921 Bacteria 10656
760 Ga0496119_0000035 3300048922 Bacteria 217007
761 Ga0496119_0004129 3300048922 Bacteria 14622
762 Ga0496119_0053852 3300048922 Bacteria 2454
763 Ga0496120_0000079 3300048923 Bacteria 160413
764 Ga0496120_0017717 3300048923 Bacteria 4606
765 Ga0496120_0021588 3300048923 Bacteria 4067
766 Ga0496120_0187786 3300048923 Bacteria 1010
767 Ga0496121_0000004 3300048924 Bacteria 1139011
768 Ga0496121_0000090 3300048924 Bacteria 217920
769 Ga0496121_0010052 3300048924 Bacteria 10737
770 Ga0496122_0000805 3300048925 Bacteria 60172
771 Ga0496122_0028221 3300048925 Bacteria 4771
772 Ga0496123_0003575 3300048926 Bacteria 17241
773 Ga0496123_0022897 3300048926 Bacteria 4798
774 Ga0496124_0000221 3300048927 Bacteria 110879
775 Ga0496124_0237722 3300048927 Bacteria 1357
776 Ga0496124_0461025 3300048927 Bacteria 863
777 Ga0496125_0000003 3300048928 Bacteria 1189767
778 Ga0496125_0102273 3300048928 Bacteria 2106
779 Ga0496125_0130816 3300048928 Bacteria 1767
780 Ga0496125_0194950 3300048928 Bacteria 1333
781 Ga0496125_0382964 3300048928 Bacteria 828
782 Ga0496126_0000001 3300048929 Bacteria 1139011
783 Ga0496126_0002186 3300048929 Bacteria 27172
784 Ga0496126_0004091 3300048929 Bacteria 17671
785 Ga0496126_0030158 3300048929 Bacteria 5142
786 Ga0496126_0070861 3300048929 Bacteria 3104
787 Ga0496126_0635962 3300048929 Bacteria 836
788 Ga0501032_0005750 3300049569 Bacteria 9173
789 Ga0501033_0022381 3300049570 Bacteria 4768
790 Ga0501033_0067463 3300049570 Bacteria 2630
791 Ga0501034_0004620 3300049571 Bacteria 15254
792 Ga0501034_0026741 3300049571 Bacteria 5871
793 Ga0501034_0033815 3300049571 Bacteria 5183
794 Ga0501036_0024129 3300049572 Bacteria 5127
795 Ga0501037_0012684 3300049573 Bacteria 6208
796 Ga0501037_0022555 3300049573 Bacteria 4656
797 Ga0501037_0359400 3300049573 Bacteria 1003
798 Ga0501038_0075693 3300049574 Bacteria 2844
799 Ga0501038_0323202 3300049574 Bacteria 1206
800 Ga0501039_0000929 3300049575 Bacteria 21375
801 Ga0501041_0459939 3300049577 Bacteria 808
802 Ga0501043_0002664 3300049579 Bacteria 14997
803 Ga0501043_0028459 3300049579 Bacteria 4387
804 Ga0501043_0305864 3300049579 Bacteria 1214
805 Ga0501046_0006675 3300049580 Bacteria 10192
806 Ga0501046_0506179 3300049580 Bacteria 864
807 Ga0501047_0009645 3300049581 Bacteria 9125
808 Ga0501047_0048800 3300049581 Bacteria 4088
809 Ga0501047_0663202 3300049581 Bacteria 862
810 Ga0501048_0005296 3300049582 Bacteria 9825
811 Ga0501069_0091425 3300049585 Bacteria 1721
812 Ga0501070_0099994 3300049586 Bacteria 2399
813 Ga0501070_0360519 3300049586 Bacteria 1179
814 Ga0501073_0100401 3300049589 Bacteria 2009
815 Ga0501074_0134330 3300049590 Bacteria 1770
816 Ga0501076_0211520 3300049592 Bacteria 1585
817 Ga0501224_027442 3300049664 Bacteria 852
818 Ga0501249_044602 3300049679 Bacteria 1010
819 Ga0501079_0323155 3300049741 Bacteria 1208
820 Ga0501080_0083453 3300049742 Bacteria 2968
821 Ga0501080_0307724 3300049742 Bacteria 1436
822 Ga0501080_1156476 3300049742 Bacteria 667
823 Ga0501273_042719 3300049770 Bacteria 675
824 Ga0501035_0000497 3300049822 Bacteria 44253
825 Ga0501035_0010269 3300049822 Bacteria 8686
826 Ga0501044_0007277 3300049823 Bacteria 12164
827 Ga0501044_0018505 3300049823 Bacteria 7463
828 Ga0501044_0087293 3300049823 Bacteria 3151
829 Ga0501045_0310212 3300049824 Bacteria 1174
830 nmdc:mga03683_34821_c1 3300050489 Bacteria 2039
831 nmdc:mga03n38_13610_c1 3300050490 Bacteria 3095
832 nmdc:mga03n38_202559_c1 3300050490 Bacteria 1028
833 nmdc:mga03n38_326880_c1 3300050490 Bacteria 829
834 nmdc:mga03n38_51377_c1 3300050490 Bacteria 1840
835 nmdc:mga03n38_62089_c1 3300050490 Bacteria 1703
836 nmdc:mga03n38_6858_c1 3300050490 Bacteria 3992
837 nmdc:mga00v17_20163_c1 3300050491 Bacteria 3816
838 nmdc:mga00v17_29039_c1 3300050491 Bacteria 2862
839 nmdc:mga00v17_38075_c1 3300050491 Bacteria 2874
840 nmdc:mga00v17_49917_c1 3300050491 Bacteria 2540
841 nmdc:mga00v17_59953_c1 3300050491 Bacteria 2336
842 nmdc:mga00v17_65717_c1 3300050491 Bacteria 2238
843 nmdc:mga0yw44_248853_c1 3300050492 Bacteria 1182
844 nmdc:mga0yw44_2784_c1 3300050492 Bacteria 7572
845 nmdc:mga0yw44_51206_c1 3300050492 Bacteria 2499
846 nmdc:mga04h51_19868_c1 3300050495 Bacteria 1997
847 nmdc:mga07m45_10687_c1 3300050496 Bacteria 4803
848 nmdc:mga07m45_116508_c1 3300050496 Bacteria 1541
849 nmdc:mga07m45_129740_c1 3300050496 Bacteria 1458
850 nmdc:mga07m45_32818_c1 3300050496 Bacteria 2880
851 nmdc:mga07m45_48555_c1 3300050496 Bacteria 2387
852 nmdc:mga06r32_44_c3 3300050510 Bacteria 1925
853 nmdc:mga08y16_1388746_c1 3300050511 Bacteria 666
854 nmdc:mga0sz30_142175_c1 3300050516 Bacteria 1060
855 nmdc:mga0sz30_190092_c1 3300050516 Bacteria 911
856 nmdc:mga0sz30_2321_c1 3300050516 Bacteria 6793
857 nmdc:mga0sz30_29231_c2 3300050516 Bacteria 889
858 nmdc:mga0sz30_38966_c1 3300050516 Bacteria 1993
859 nmdc:mga0sz30_58587_c1 3300050516 Bacteria 1642
860 nmdc:mga0sz30_98168_c1 3300050516 Bacteria 1278
861 Ga0500635_0037216 3300053080 Bacteria 1608
862 Ga0495655_0048121 3300053083 Bacteria 1118
863 Ga0500643_003561 3300053087 Bacteria 7411
864 Ga0500650_0181540 3300053098 Bacteria 964
865 Ga0500650_0384950 3300053098 Bacteria 609
866 Ga0500556_0002920 3300053104 Bacteria 5180
867 Ga0500556_0012047 3300053104 Bacteria 2573
868 Ga0500562_120359 3300053108 Bacteria 715
869 Ga0500628_030460 3300053129 Bacteria 1167
870 Ga0500652_002083 3300053131 Bacteria 6013
871 Ga0500652_029207 3300053131 Bacteria 2149
872 Ga0500568_0081636 3300053139 Bacteria 1227
873 Ga0500616_0007285 3300053153 Bacteria 7057
874 Ga0500645_000490 3300053730 Bacteria 26762
875 Ga0466962_0012658 3300061719 Bacteria 4059

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_1358327 Ga0395905_1358327_74_586 164
2 3300042006 Ga0439432_047355 Ga0439432_047355_44_556 164
3 3300025321 Ga0207656_10099283 Ga0207656_100992832 174
4 3300005330 Ga0070690_100155322 Ga0070690_1001553222 178
5 3300005334 Ga0068869_100129571 Ga0068869_1001295712 178
6 3300005340 Ga0070689_100026826 Ga0070689_1000268263 178
7 3300005354 Ga0070675_100161598 Ga0070675_1001615982 178
8 3300005364 Ga0070673_100188383 Ga0070673_1001883832 178
9 3300005365 Ga0070688_100257131 Ga0070688_1002571312 178
10 3300005440 Ga0070705_100113172 Ga0070705_1001131722 178
11 3300005459 Ga0068867_100010852 Ga0068867_1000108522 178
12 3300005544 Ga0070686_100081996 Ga0070686_1000819962 178
13 3300005618 Ga0068864_100040080 Ga0068864_1000400804 178
14 3300005843 Ga0068860_100049084 Ga0068860_1000490841 178
15 3300006237 Ga0097621_100014593 Ga0097621_1000145938 178
16 3300049592 Ga0501076_0211520 Ga0501076_0211520_822_1412 178
17 3300049824 Ga0501045_0310212 Ga0501045_0310212_211_801 178
18 3300009174 Ga0105241_11289172 Ga0105241_112891721 179
19 3300005331 Ga0070670_100199219 Ga0070670_1001992191 181
20 3300005338 Ga0068868_100681562 Ga0068868_1006815622 181
21 3300005340 Ga0070689_100969405 Ga0070689_1009694051 181
22 3300005355 Ga0070671_100086014 Ga0070671_1000860143 181
23 3300005356 Ga0070674_100309703 Ga0070674_1003097032 181
24 3300005365 Ga0070688_100720532 Ga0070688_1007205321 181
25 3300005406 Ga0070703_10308729 Ga0070703_103087291 181
26 3300005456 Ga0070678_100137249 Ga0070678_1001372492 181
27 3300005459 Ga0068867_100173347 Ga0068867_1001733472 181
28 3300005548 Ga0070665_100432064 Ga0070665_1004320642 181
29 3300005578 Ga0068854_100931624 Ga0068854_1009316241 181
30 3300005618 Ga0068864_100008552 Ga0068864_1000085523 181
31 3300005719 Ga0068861_100218434 Ga0068861_1002184342 181
32 3300005840 Ga0068870_10496446 Ga0068870_104964462 181
33 3300005841 Ga0068863_100027751 Ga0068863_1000277515 181
34 3300005841 Ga0068863_100029840 Ga0068863_1000298402 181
35 3300005841 Ga0068863_101003205 Ga0068863_1010032051 181
36 3300005842 Ga0068858_100074042 Ga0068858_1000740422 181
37 3300005843 Ga0068860_100283471 Ga0068860_1002834712 181
38 3300005844 Ga0068862_100081482 Ga0068862_1000814823 181
39 3300006358 Ga0068871_100003130 Ga0068871_1000031308 181
40 3300006358 Ga0068871_100007688 Ga0068871_1000076888 181
41 3300006844 Ga0075428_100138818 Ga0075428_1001388183 181
42 3300006881 Ga0068865_100063301 Ga0068865_1000633013 181
43 3300009148 Ga0105243_10035567 Ga0105243_100355674 181
44 3300009177 Ga0105248_10271166 Ga0105248_102711662 181
45 3300013306 Ga0163162_10028905 Ga0163162_100289052 181
46 3300013308 Ga0157375_10126472 Ga0157375_101264722 181
47 3300013308 Ga0157375_10294174 Ga0157375_102941741 181
48 3300014325 Ga0163163_10082758 Ga0163163_100827583 181
49 3300014326 Ga0157380_10119722 Ga0157380_101197222 181
50 3300014968 Ga0157379_10215345 Ga0157379_102153452 181
51 3300014968 Ga0157379_10374241 Ga0157379_103742412 181
52 3300014969 Ga0157376_10006456 Ga0157376_100064566 181
53 3300014969 Ga0157376_10160680 Ga0157376_101606802 181
54 3300017792 Ga0163161_10015854 Ga0163161_100158547 181
55 3300025903 Ga0207680_10130307 Ga0207680_101303072 181
56 3300025923 Ga0207681_10385135 Ga0207681_103851351 181
57 3300025925 Ga0207650_10020180 Ga0207650_100201802 181
58 3300025925 Ga0207650_10180221 Ga0207650_101802212 181
59 3300025926 Ga0207659_10113079 Ga0207659_101130793 181
60 3300025931 Ga0207644_10092085 Ga0207644_100920853 181
61 3300025935 Ga0207709_10312495 Ga0207709_103124952 181
62 3300025936 Ga0207670_10477067 Ga0207670_104770672 181
63 3300025938 Ga0207704_10030692 Ga0207704_100306922 181
64 3300025941 Ga0207711_10090865 Ga0207711_100908652 181
65 3300025942 Ga0207689_10115900 Ga0207689_101159002 181
66 3300026035 Ga0207703_10251707 Ga0207703_102517072 181
67 3300026075 Ga0207708_10013446 Ga0207708_100134468 181
68 3300026088 Ga0207641_10006938 Ga0207641_100069388 181
69 3300026088 Ga0207641_10027685 Ga0207641_100276853 181
70 3300026088 Ga0207641_10190822 Ga0207641_101908221 181
71 3300026089 Ga0207648_10169747 Ga0207648_101697472 181
72 3300026095 Ga0207676_10034004 Ga0207676_100340043 181
73 3300026095 Ga0207676_10057880 Ga0207676_100578802 181
74 3300026095 Ga0207676_10122826 Ga0207676_101228262 181
75 3300026118 Ga0207675_100200892 Ga0207675_1002008922 181
76 3300026121 Ga0207683_10050483 Ga0207683_100504834 181
77 3300028381 Ga0268264_10034902 Ga0268264_100349023 181
78 3300028381 Ga0268264_10057589 Ga0268264_100575893 181
79 3300006163 Ga0070715_10322756 Ga0070715_103227562 182
80 3300005436 Ga0070713_100095738 Ga0070713_1000957382 185
81 3300005437 Ga0070710_10033713 Ga0070710_100337131 185
82 3300006028 Ga0070717_10489261 Ga0070717_104892612 185
83 3300006173 Ga0070716_100284764 Ga0070716_1002847641 185
84 3300006175 Ga0070712_100891951 Ga0070712_1008919511 185
85 3300025898 Ga0207692_10154899 Ga0207692_101548992 185
86 3300025914 Ga0207671_10326293 Ga0207671_103262931 185
87 3300025939 Ga0207665_10333124 Ga0207665_103331241 185
88 3300027876 Ga0209974_10077241 Ga0209974_100772412 185
89 3300039450 Ga0436363_1437196 Ga0436363_1437196_181_738 185
90 3300053131 Ga0500652_002083 Ga0500652_002083_1810_2367 185
91 3300001989 JGI24739J22299_10083003 JGI24739J22299_100830032 186
92 3300005331 Ga0070670_100212651 Ga0070670_1002126513 186
93 3300005333 Ga0070677_10004991 Ga0070677_100049913 186
94 3300005347 Ga0070668_100156989 Ga0070668_1001569891 186
95 3300005353 Ga0070669_100007711 Ga0070669_1000077117 186
96 3300005353 Ga0070669_100300805 Ga0070669_1003008051 186
97 3300005353 Ga0070669_100649322 Ga0070669_1006493222 186
98 3300005355 Ga0070671_100085812 Ga0070671_1000858122 186
99 3300005364 Ga0070673_100005957 Ga0070673_1000059572 186
100 3300005364 Ga0070673_100203191 Ga0070673_1002031912 186
101 3300005366 Ga0070659_100068613 Ga0070659_1000686133 186
102 3300005459 Ga0068867_100579427 Ga0068867_1005794271 186
103 3300005564 Ga0070664_100061616 Ga0070664_1000616162 186
104 3300005577 Ga0068857_100794198 Ga0068857_1007941982 186
105 3300005617 Ga0068859_100577187 Ga0068859_1005771873 186
106 3300005844 Ga0068862_100008978 Ga0068862_1000089783 186
107 3300005844 Ga0068862_100083623 Ga0068862_1000836233 186
108 3300006844 Ga0075428_100101443 Ga0075428_1001014434 186
109 3300006931 Ga0097620_100577195 Ga0097620_1005771953 186
110 3300007788 Ga0099795_10039323 Ga0099795_100393232 186
111 3300009092 Ga0105250_10194592 Ga0105250_101945921 186
112 3300009098 Ga0105245_10059620 Ga0105245_100596205 186
113 3300009101 Ga0105247_10183557 Ga0105247_101835572 186
114 3300009148 Ga0105243_10045903 Ga0105243_100459034 186
115 3300009174 Ga0105241_10399990 Ga0105241_103999902 186
116 3300009545 Ga0105237_10336453 Ga0105237_103364532 186
117 3300009545 Ga0105237_10942392 Ga0105237_109423922 186
118 3300009551 Ga0105238_10022028 Ga0105238_100220282 186
119 3300009553 Ga0105249_10322643 Ga0105249_103226432 186
120 3300009553 Ga0105249_11317480 Ga0105249_113174802 186
121 3300010159 Ga0099796_10114238 Ga0099796_101142382 186
122 3300013296 Ga0157374_10032490 Ga0157374_100324906 186
123 3300013297 Ga0157378_10088440 Ga0157378_100884403 186
124 3300013306 Ga0163162_10006550 Ga0163162_1000655015 186
125 3300014326 Ga0157380_10060027 Ga0157380_100600272 186
126 3300014969 Ga0157376_10168266 Ga0157376_101682662 186
127 3300025893 Ga0207682_10113439 Ga0207682_101134392 186
128 3300025901 Ga0207688_10113743 Ga0207688_101137432 186
129 3300025915 Ga0207693_10179300 Ga0207693_101793003 186
130 3300025923 Ga0207681_10117074 Ga0207681_101170742 186
131 3300025923 Ga0207681_10149310 Ga0207681_101493102 186
132 3300025923 Ga0207681_10508799 Ga0207681_105087992 186
133 3300025925 Ga0207650_10000200 Ga0207650_1000020029 186
134 3300025926 Ga0207659_10596413 Ga0207659_105964132 186
135 3300025931 Ga0207644_10323274 Ga0207644_103232742 186
136 3300025933 Ga0207706_10043370 Ga0207706_100433702 186
137 3300025933 Ga0207706_10060092 Ga0207706_100600923 186
138 3300025945 Ga0207679_10337134 Ga0207679_103371342 186
139 3300025960 Ga0207651_10152246 Ga0207651_101522462 186
140 3300025972 Ga0207668_10577558 Ga0207668_105775582 186
141 3300026041 Ga0207639_10154710 Ga0207639_101547102 186
142 3300026089 Ga0207648_10592173 Ga0207648_105921732 186
143 3300026095 Ga0207676_10642776 Ga0207676_106427761 186
144 3300027665 Ga0209983_1037523 Ga0209983_10375232 186
145 3300027876 Ga0209974_10001606 Ga0209974_100016066 186
146 3300027876 Ga0209974_10060232 Ga0209974_100602322 186
147 3300028380 Ga0268265_10003531 Ga0268265_100035319 186
148 3300028381 Ga0268264_10469849 Ga0268264_104698491 186
149 3300031548 Ga0307408_100027291 Ga0307408_1000272913 186
150 3300031548 Ga0307408_100033296 Ga0307408_1000332964 186
151 3300031548 Ga0307408_100035312 Ga0307408_1000353122 186
152 3300031548 Ga0307408_100042286 Ga0307408_1000422862 186
153 3300031548 Ga0307408_100310639 Ga0307408_1003106392 186
154 3300031731 Ga0307405_10007163 Ga0307405_100071633 186
155 3300031731 Ga0307405_10019495 Ga0307405_100194957 186
156 3300031731 Ga0307405_10028387 Ga0307405_100283871 186
157 3300031731 Ga0307405_10032703 Ga0307405_100327032 186
158 3300031731 Ga0307405_10115560 Ga0307405_101155602 186
159 3300031731 Ga0307405_10150351 Ga0307405_101503513 186
160 3300031731 Ga0307405_10314544 Ga0307405_103145442 186
161 3300031824 Ga0307413_10006149 Ga0307413_100061492 186
162 3300031824 Ga0307413_10007453 Ga0307413_100074535 186
163 3300031824 Ga0307413_10025791 Ga0307413_100257913 186
164 3300031824 Ga0307413_10034510 Ga0307413_100345102 186
165 3300031824 Ga0307413_10081440 Ga0307413_100814402 186
166 3300031824 Ga0307413_10097484 Ga0307413_100974842 186
167 3300031824 Ga0307413_10118621 Ga0307413_101186212 186
168 3300031824 Ga0307413_10231476 Ga0307413_102314762 186
169 3300031824 Ga0307413_10260493 Ga0307413_102604932 186
170 3300031824 Ga0307413_10322469 Ga0307413_103224692 186
171 3300031824 Ga0307413_10463325 Ga0307413_104633252 186
172 3300031824 Ga0307413_10465328 Ga0307413_104653282 186
173 3300031824 Ga0307413_10475481 Ga0307413_104754811 186
174 3300031852 Ga0307410_10005506 Ga0307410_100055066 186
175 3300031852 Ga0307410_10007693 Ga0307410_100076934 186
176 3300031852 Ga0307410_10013669 Ga0307410_100136694 186
177 3300031852 Ga0307410_10017712 Ga0307410_100177122 186
178 3300031852 Ga0307410_10026046 Ga0307410_100260462 186
179 3300031852 Ga0307410_10036408 Ga0307410_100364082 186
180 3300031852 Ga0307410_10041689 Ga0307410_100416891 186
181 3300031852 Ga0307410_10110856 Ga0307410_101108562 186
182 3300031852 Ga0307410_10116087 Ga0307410_101160872 186
183 3300031852 Ga0307410_10205933 Ga0307410_102059332 186
184 3300031901 Ga0307406_10000523 Ga0307406_1000052323 186
185 3300031901 Ga0307406_10001368 Ga0307406_100013685 186
186 3300031901 Ga0307406_10145510 Ga0307406_101455102 186
187 3300031901 Ga0307406_10210604 Ga0307406_102106042 186
188 3300031901 Ga0307406_10229518 Ga0307406_102295182 186
189 3300031901 Ga0307406_10235661 Ga0307406_102356612 186
190 3300031901 Ga0307406_10716201 Ga0307406_107162012 186
191 3300031901 Ga0307406_10825586 Ga0307406_108255862 186
192 3300031903 Ga0307407_10000814 Ga0307407_1000081410 186
193 3300031903 Ga0307407_10018509 Ga0307407_100185094 186
194 3300031903 Ga0307407_10021922 Ga0307407_100219223 186
195 3300031903 Ga0307407_10033008 Ga0307407_100330083 186
196 3300031903 Ga0307407_10087002 Ga0307407_100870021 186
197 3300031903 Ga0307407_10332131 Ga0307407_103321311 186
198 3300031903 Ga0307407_10340207 Ga0307407_103402072 186
199 3300031911 Ga0307412_10010517 Ga0307412_100105174 186
200 3300031911 Ga0307412_10010903 Ga0307412_100109034 186
201 3300031911 Ga0307412_10062207 Ga0307412_100622072 186
202 3300031911 Ga0307412_10071009 Ga0307412_100710092 186
203 3300031911 Ga0307412_10178792 Ga0307412_101787922 186
204 3300031911 Ga0307412_10449298 Ga0307412_104492982 186
205 3300031911 Ga0307412_10659750 Ga0307412_106597502 186
206 3300031995 Ga0307409_100009090 Ga0307409_1000090902 186
207 3300031995 Ga0307409_100012827 Ga0307409_1000128271 186
208 3300031995 Ga0307409_100079565 Ga0307409_1000795653 186
209 3300031995 Ga0307409_100104456 Ga0307409_1001044562 186
210 3300031995 Ga0307409_100123379 Ga0307409_1001233791 186
211 3300031995 Ga0307409_100206648 Ga0307409_1002066482 186
212 3300031995 Ga0307409_100214432 Ga0307409_1002144322 186
213 3300031995 Ga0307409_100247234 Ga0307409_1002472343 186
214 3300031995 Ga0307409_100266862 Ga0307409_1002668622 186
215 3300031995 Ga0307409_100394702 Ga0307409_1003947022 186
216 3300031995 Ga0307409_100613971 Ga0307409_1006139712 186
217 3300031995 Ga0307409_100877112 Ga0307409_1008771122 186
218 3300032002 Ga0307416_100001639 Ga0307416_1000016395 186
219 3300032002 Ga0307416_100014618 Ga0307416_1000146182 186
220 3300032002 Ga0307416_100017219 Ga0307416_1000172195 186
221 3300032002 Ga0307416_100018157 Ga0307416_1000181573 186
222 3300032002 Ga0307416_100031150 Ga0307416_1000311506 186
223 3300032002 Ga0307416_100048679 Ga0307416_1000486793 186
224 3300032002 Ga0307416_100122060 Ga0307416_1001220601 186
225 3300032002 Ga0307416_100134389 Ga0307416_1001343893 186
226 3300032002 Ga0307416_100223030 Ga0307416_1002230302 186
227 3300032002 Ga0307416_100304822 Ga0307416_1003048221 186
228 3300032002 Ga0307416_100356101 Ga0307416_1003561011 186
229 3300032004 Ga0307414_10014422 Ga0307414_100144224 186
230 3300032004 Ga0307414_10016835 Ga0307414_100168354 186
231 3300032004 Ga0307414_10024468 Ga0307414_100244682 186
232 3300032004 Ga0307414_10031029 Ga0307414_100310293 186
233 3300032004 Ga0307414_10060866 Ga0307414_100608663 186
234 3300032004 Ga0307414_10119321 Ga0307414_101193212 186
235 3300032004 Ga0307414_10160130 Ga0307414_101601302 186
236 3300032004 Ga0307414_10549596 Ga0307414_105495962 186
237 3300032004 Ga0307414_10672160 Ga0307414_106721602 186
238 3300032005 Ga0307411_10004589 Ga0307411_100045895 186
239 3300032005 Ga0307411_10005459 Ga0307411_100054595 186
240 3300032005 Ga0307411_10020201 Ga0307411_100202013 186
241 3300032005 Ga0307411_10058897 Ga0307411_100588973 186
242 3300032005 Ga0307411_10059480 Ga0307411_100594802 186
243 3300032005 Ga0307411_10071528 Ga0307411_100715284 186
244 3300032005 Ga0307411_10108767 Ga0307411_101087673 186
245 3300032005 Ga0307411_10122193 Ga0307411_101221933 186
246 3300032005 Ga0307411_10152829 Ga0307411_101528292 186
247 3300032005 Ga0307411_10529685 Ga0307411_105296852 186
248 3300032005 Ga0307411_10541625 Ga0307411_105416252 186
249 3300032005 Ga0307411_10735522 Ga0307411_107355221 186
250 3300032005 Ga0307411_10969951 Ga0307411_109699512 186
251 3300032126 Ga0307415_100002442 Ga0307415_1000024426 186
252 3300032126 Ga0307415_100003563 Ga0307415_1000035634 186
253 3300032126 Ga0307415_100012546 Ga0307415_1000125462 186
254 3300032126 Ga0307415_100016775 Ga0307415_1000167753 186
255 3300032126 Ga0307415_100024800 Ga0307415_1000248001 186
256 3300032126 Ga0307415_100028792 Ga0307415_1000287923 186
257 3300032126 Ga0307415_100030405 Ga0307415_1000304052 186
258 3300032126 Ga0307415_100070851 Ga0307415_1000708512 186
259 3300032126 Ga0307415_100379944 Ga0307415_1003799442 186
260 3300032126 Ga0307415_100468052 Ga0307415_1004680521 186
261 3300034819 Ga0373958_0089911 Ga0373958_0089911_48_608 186
262 3300035115 Ga0373941_0063875 Ga0373941_0063875_326_886 186
263 3300035241 Ga0373961_0104894 Ga0373961_0104894_275_835 186
264 3300037312 Ga0395899_0036186 Ga0395899_0036186_3108_3686 186
265 3300037418 Ga0395900_0003419 Ga0395900_0003419_14163_14741 186
266 3300037471 Ga0395905_0000264 Ga0395905_0000264_15263_15841 186
267 3300038443 Ga0395901_0001944 Ga0395901_0001944_17087_17665 186
268 3300038443 Ga0395901_0910658 Ga0395901_0910658_104_685 186
269 3300042006 Ga0439432_008671 Ga0439432_008671_2726_3304 186
270 3300042007 Ga0439449_0019998 Ga0439449_0019998_598_1176 186
271 3300046513 Ga0495616_0108020 Ga0495616_0108020_718_1278 186
272 3300046684 Ga0495669_0133769 Ga0495669_0133769_358_936 186
273 3300046794 Ga0495589_0261102 Ga0495589_0261102_133_693 186
274 3300047445 Ga0495677_0146071 Ga0495677_0146071_112_687 186
275 3300048903 Ga0496100_0058895 Ga0496100_0058895_1835_2395 186
276 3300048904 Ga0496101_0179253 Ga0496101_0179253_926_1486 186
277 3300048905 Ga0496102_0125264 Ga0496102_0125264_529_1089 186
278 3300048905 Ga0496102_0921061 Ga0496102_0921061_32_592 186
279 3300048906 Ga0496103_0019049 Ga0496103_0019049_947_1507 186
280 3300048906 Ga0496103_0082546 Ga0496103_0082546_197_778 186
281 3300048907 Ga0496104_0205494 Ga0496104_0205494_284_844 186
282 3300048909 Ga0496106_0249619 Ga0496106_0249619_392_952 186
283 3300048910 Ga0496107_0010183 Ga0496107_0010183_2876_3436 186
284 3300048910 Ga0496107_0103065 Ga0496107_0103065_1073_1654 186
285 3300048911 Ga0496108_0038048 Ga0496108_0038048_2422_2982 186
286 3300048912 Ga0496109_0002673 Ga0496109_0002673_7529_8089 186
287 3300048913 Ga0496110_1169212 Ga0496110_1169212_107_667 186
288 3300048915 Ga0496112_0012895 Ga0496112_0012895_179_739 186
289 3300048917 Ga0496114_0642905 Ga0496114_0642905_357_917 186
290 3300048918 Ga0496115_0111016 Ga0496115_0111016_383_943 186
291 3300049570 Ga0501033_0067463 Ga0501033_0067463_1684_2244 186
292 3300049577 Ga0501041_0459939 Ga0501041_0459939_31_612 186
293 3300049664 Ga0501224_027442 Ga0501224_027442_255_833 186
294 3300049679 Ga0501249_044602 Ga0501249_044602_191_769 186
295 3300049770 Ga0501273_042719 Ga0501273_042719_42_620 186
296 iso_pu_bacteria 2643221687 2644490705 187
297 iso_pu_bacteria 2643221715 2644636959 187
298 iso_pu_bacteria 2738541264 2738668353 187
299 iso_pu_bacteria 2738541274 2738706941 187
300 iso_pu_bacteria 2738541356 2739147423 187
301 iso_pu_bacteria 2738543028 2739333646 187
302 iso_pu_bacteria 2902799365 2902800573 187
303 iso_pu_bacteria 2902810491 2902814896 187
304 iso_pu_bacteria 2902837492 2902838477 187
305 iso_pu_bacteria 2929212328 2929217425 187
306 iso_pu_bacteria 2842134933 2842139267 188
307 iso_pu_bacteria 2902792274 2902798706 188
308 iso_pu_bacteria 2939582691 2939584662 188
309 3300003792 Ga0055540_1000043 Ga0055540_100004315 191
310 3300003792 Ga0055540_1007851 Ga0055540_10078512 191
311 3300005353 Ga0070669_100135310 Ga0070669_1001353102 191
312 3300005356 Ga0070674_100229082 Ga0070674_1002290822 191
313 3300005366 Ga0070659_100967381 Ga0070659_1009673811 191
314 3300005367 Ga0070667_100000791 Ga0070667_10000079125 191
315 3300005367 Ga0070667_100013973 Ga0070667_1000139734 191
316 3300005435 Ga0070714_100128686 Ga0070714_1001286863 191
317 3300005466 Ga0070685_10032722 Ga0070685_100327223 191
318 3300005548 Ga0070665_100005216 Ga0070665_10000521611 191
319 3300005578 Ga0068854_100286875 Ga0068854_1002868752 191
320 3300005618 Ga0068864_101469661 Ga0068864_1014696611 191
321 3300005841 Ga0068863_100001025 Ga0068863_10000102523 191
322 3300005841 Ga0068863_100499357 Ga0068863_1004993572 191
323 3300005842 Ga0068858_100016818 Ga0068858_1000168189 191
324 3300005843 Ga0068860_100000087 Ga0068860_10000008726 191
325 3300005844 Ga0068862_100000077 Ga0068862_10000007769 191
326 3300006038 Ga0075365_10410611 Ga0075365_104106112 191
327 3300006186 Ga0075369_10012989 Ga0075369_100129893 191
328 3300006186 Ga0075369_10085533 Ga0075369_100855332 191
329 3300006881 Ga0068865_100512164 Ga0068865_1005121642 191
330 3300009101 Ga0105247_10000060 Ga0105247_1000006070 191
331 3300009177 Ga0105248_10000050 Ga0105248_1000005021 191
332 3300009177 Ga0105248_10056751 Ga0105248_100567515 191
333 3300009545 Ga0105237_10027144 Ga0105237_100271447 191
334 3300009553 Ga0105249_10000042 Ga0105249_10000042132 191
335 3300010375 Ga0105239_10024596 Ga0105239_100245966 191
336 3300013308 Ga0157375_10319953 Ga0157375_103199532 191
337 3300014969 Ga0157376_10296027 Ga0157376_102960272 191
338 3300025273 Ga0209673_1013931 Ga0209673_10139312 191
339 3300025303 Ga0209051_1000108 Ga0209051_1000108147 191
340 3300025303 Ga0209051_1000642 Ga0209051_100064241 191
341 3300025303 Ga0209051_1003362 Ga0209051_10033624 191
342 3300025303 Ga0209051_1005179 Ga0209051_10051796 191
343 3300025900 Ga0207710_10000010 Ga0207710_1000001072 191
344 3300025903 Ga0207680_10044300 Ga0207680_100443004 191
345 3300025914 Ga0207671_10157610 Ga0207671_101576101 191
346 3300025923 Ga0207681_10002155 Ga0207681_100021554 191
347 3300025937 Ga0207669_10528292 Ga0207669_105282921 191
348 3300025941 Ga0207711_10001406 Ga0207711_1000140615 191
349 3300025941 Ga0207711_10033441 Ga0207711_100334412 191
350 3300025961 Ga0207712_10000010 Ga0207712_10000010319 191
351 3300025986 Ga0207658_10000677 Ga0207658_1000067725 191
352 3300025986 Ga0207658_10001961 Ga0207658_100019617 191
353 3300026035 Ga0207703_10009823 Ga0207703_1000982310 191
354 3300026067 Ga0207678_10085821 Ga0207678_100858212 191
355 3300026088 Ga0207641_10000849 Ga0207641_100008495 191
356 3300026088 Ga0207641_10192318 Ga0207641_101923182 191
357 3300026121 Ga0207683_10163373 Ga0207683_101633732 191
358 3300028379 Ga0268266_10030548 Ga0268266_100305484 191
359 3300028380 Ga0268265_10000014 Ga0268265_10000014134 191
360 3300028381 Ga0268264_10000150 Ga0268264_1000015025 191
361 3300028381 Ga0268264_10527733 Ga0268264_105277332 191
362 3300031251 Ga0265327_10002508 Ga0265327_100025084 191
363 3300031731 Ga0307405_10040394 Ga0307405_100403942 191
364 3300031824 Ga0307413_10221061 Ga0307413_102210612 191
365 3300031901 Ga0307406_10071678 Ga0307406_100716783 191
366 3300037853 Ga0436364_1355465 Ga0436364_1355465_490_1065 191
367 3300041410 Ga0439461_0003028 Ga0439461_0003028_1314_1889 191
368 3300041410 Ga0439461_0022542 Ga0439461_0022542_613_1188 191
369 3300041411 Ga0439466_0010268 Ga0439466_0010268_394_969 191
370 3300041411 Ga0439466_0020018 Ga0439466_0020018_883_1458 191
371 3300041413 Ga0439465_0017737 Ga0439465_0017737_1134_1709 191
372 3300041443 Ga0451789_0438445 Ga0451789_0438445_498_1073 191
373 3300041452 Ga0451793_0490399 Ga0451793_0490399_99_674 191
374 3300041456 Ga0451795_1314229 Ga0451795_1314229_1011_1586 191
375 3300041512 Ga0451853_1173337 Ga0451853_1173337_62_637 191
376 3300041997 Ga0439431_0003474 Ga0439431_0003474_1395_1970 191
377 3300042002 Ga0439442_005766 Ga0439442_005766_1164_1739 191
378 3300042004 Ga0439445_0014926 Ga0439445_0014926_160_735 191
379 3300042008 Ga0439450_063318 Ga0439450_063318_91_666 191
380 3300042435 Ga0439434_0004459 Ga0439434_0004459_815_1390 191
381 3300044683 Ga0466965_0000697 Ga0466965_0000697_5469_6044 191
382 3300044683 Ga0466965_0002661 Ga0466965_0002661_3105_3680 191
383 3300044683 Ga0466965_0010558 Ga0466965_0010558_3648_4223 191
384 3300044684 Ga0466966_0001218 Ga0466966_0001218_8197_8772 191
385 3300044684 Ga0466966_0409876 Ga0466966_0409876_27_602 191
386 3300044694 Ga0466963_0130110 Ga0466963_0130110_69_644 191
387 3300044706 Ga0466964_0063071 Ga0466964_0063071_715_1290 191
388 3300044719 Ga0466971_0013054 Ga0466971_0013054_1877_2452 191
389 3300044735 Ga0466968_0001182 Ga0466968_0001182_8587_9162 191
390 3300044735 Ga0466968_0004379 Ga0466968_0004379_2905_3480 191
391 3300044765 Ga0466970_0014558 Ga0466970_0014558_1405_1980 191
392 3300044842 Ga0466957_0003667 Ga0466957_0003667_161_736 191
393 3300044842 Ga0466957_0066183 Ga0466957_0066183_1620_2195 191
394 3300044901 Ga0466960_0000319 Ga0466960_0000319_34_609 191
395 3300044901 Ga0466960_0002911 Ga0466960_0002911_473_1048 191
396 3300045049 Ga0466959_0001867 Ga0466959_0001867_5584_6159 191
397 3300045836 Ga0466958_0003868 Ga0466958_0003868_2461_3036 191
398 3300045836 Ga0466958_0064035 Ga0466958_0064035_738_1313 191
399 3300045976 Ga0466967_0037323 Ga0466967_0037323_3301_3876 191
400 3300045976 Ga0466967_0278445 Ga0466967_0278445_939_1514 191
401 3300046460 Ga0495638_0014063 Ga0495638_0014063_1809_2384 191
402 3300048903 Ga0496100_0000084 Ga0496100_0000084_20519_21094 191
403 3300048903 Ga0496100_0019526 Ga0496100_0019526_2695_3270 191
404 3300048904 Ga0496101_0000100 Ga0496101_0000100_11429_12004 191
405 3300048904 Ga0496101_0001605 Ga0496101_0001605_7405_7980 191
406 3300048904 Ga0496101_0007060 Ga0496101_0007060_3522_4097 191
407 3300048905 Ga0496102_0001053 Ga0496102_0001053_19695_20270 191
408 3300048905 Ga0496102_0008322 Ga0496102_0008322_6222_6797 191
409 3300048905 Ga0496102_0391051 Ga0496102_0391051_437_1012 191
410 3300048906 Ga0496103_0000504 Ga0496103_0000504_29802_30377 191
411 3300048906 Ga0496103_0000700 Ga0496103_0000700_13317_13892 191
412 3300048907 Ga0496104_0028678 Ga0496104_0028678_2631_3206 191
413 3300048908 Ga0496105_0071224 Ga0496105_0071224_868_1443 191
414 3300048909 Ga0496106_0000164 Ga0496106_0000164_13491_14066 191
415 3300048909 Ga0496106_0011222 Ga0496106_0011222_2074_2649 191
416 3300048910 Ga0496107_0000317 Ga0496107_0000317_24873_25448 191
417 3300048910 Ga0496107_0037972 Ga0496107_0037972_1132_1707 191
418 3300048910 Ga0496107_0077210 Ga0496107_0077210_27_602 191
419 3300048912 Ga0496109_0000356 Ga0496109_0000356_20514_21089 191
420 3300048913 Ga0496110_0009262 Ga0496110_0009262_2073_2648 191
421 3300048916 Ga0496113_0003931 Ga0496113_0003931_7719_8294 191
422 3300048916 Ga0496113_0618937 Ga0496113_0618937_12_587 191
423 3300048917 Ga0496114_0000164 Ga0496114_0000164_18008_18583 191
424 3300048917 Ga0496114_0013077 Ga0496114_0013077_2039_2614 191
425 3300048917 Ga0496114_0417475 Ga0496114_0417475_170_745 191
426 3300048917 Ga0496114_0473451 Ga0496114_0473451_284_859 191
427 3300048918 Ga0496115_0128006 Ga0496115_0128006_1239_1814 191
428 3300048919 Ga0496116_0002215 Ga0496116_0002215_19131_19706 191
429 3300048919 Ga0496116_0065239 Ga0496116_0065239_1534_2109 191
430 3300048920 Ga0496117_0001137 Ga0496117_0001137_14832_15407 191
431 3300048920 Ga0496117_0042120 Ga0496117_0042120_1783_2358 191
432 3300048921 Ga0496118_0001770 Ga0496118_0001770_24390_24965 191
433 3300048921 Ga0496118_0008431 Ga0496118_0008431_8518_9093 191
434 3300048922 Ga0496119_0004129 Ga0496119_0004129_8645_9220 191
435 3300048922 Ga0496119_0053852 Ga0496119_0053852_1835_2410 191
436 3300048923 Ga0496120_0017717 Ga0496120_0017717_2888_3463 191
437 3300048923 Ga0496120_0021588 Ga0496120_0021588_3163_3738 191
438 3300048924 Ga0496121_0000004 Ga0496121_0000004_242206_242781 191
439 3300048924 Ga0496121_0010052 Ga0496121_0010052_1864_2439 191
440 3300048925 Ga0496122_0000805 Ga0496122_0000805_27845_28420 191
441 3300048925 Ga0496122_0028221 Ga0496122_0028221_2769_3344 191
442 3300048926 Ga0496123_0003575 Ga0496123_0003575_8548_9123 191
443 3300048926 Ga0496123_0022897 Ga0496123_0022897_2641_3216 191
444 3300048927 Ga0496124_0000221 Ga0496124_0000221_77819_78394 191
445 3300048927 Ga0496124_0237722 Ga0496124_0237722_66_641 191
446 3300048927 Ga0496124_0461025 Ga0496124_0461025_234_809 191
447 3300048928 Ga0496125_0000003 Ga0496125_0000003_946987_947562 191
448 3300048928 Ga0496125_0130816 Ga0496125_0130816_1108_1683 191
449 3300048928 Ga0496125_0194950 Ga0496125_0194950_551_1126 191
450 3300048928 Ga0496125_0382964 Ga0496125_0382964_24_599 191
451 3300048929 Ga0496126_0000001 Ga0496126_0000001_242206_242781 191
452 3300048929 Ga0496126_0002186 Ga0496126_0002186_16472_17047 191
453 3300048929 Ga0496126_0004091 Ga0496126_0004091_14078_14653 191
454 3300048929 Ga0496126_0070861 Ga0496126_0070861_24_599 191
455 3300048929 Ga0496126_0635962 Ga0496126_0635962_238_813 191
456 3300049569 Ga0501032_0005750 Ga0501032_0005750_6618_7193 191
457 3300049570 Ga0501033_0022381 Ga0501033_0022381_2397_2972 191
458 3300049571 Ga0501034_0004620 Ga0501034_0004620_14115_14690 191
459 3300049571 Ga0501034_0026741 Ga0501034_0026741_4679_5254 191
460 3300049571 Ga0501034_0033815 Ga0501034_0033815_1423_1998 191
461 3300049572 Ga0501036_0024129 Ga0501036_0024129_4172_4747 191
462 3300049573 Ga0501037_0012684 Ga0501037_0012684_3715_4290 191
463 3300049573 Ga0501037_0022555 Ga0501037_0022555_2504_3079 191
464 3300049573 Ga0501037_0359400 Ga0501037_0359400_241_816 191
465 3300049574 Ga0501038_0075693 Ga0501038_0075693_490_1065 191
466 3300049574 Ga0501038_0323202 Ga0501038_0323202_535_1110 191
467 3300049575 Ga0501039_0000929 Ga0501039_0000929_14064_14639 191
468 3300049579 Ga0501043_0002664 Ga0501043_0002664_9100_9675 191
469 3300049579 Ga0501043_0028459 Ga0501043_0028459_712_1287 191
470 3300049579 Ga0501043_0305864 Ga0501043_0305864_90_665 191
471 3300049580 Ga0501046_0006675 Ga0501046_0006675_3704_4279 191
472 3300049580 Ga0501046_0506179 Ga0501046_0506179_90_665 191
473 3300049581 Ga0501047_0009645 Ga0501047_0009645_3704_4279 191
474 3300049581 Ga0501047_0048800 Ga0501047_0048800_1717_2292 191
475 3300049582 Ga0501048_0005296 Ga0501048_0005296_6722_7297 191
476 3300049585 Ga0501069_0091425 Ga0501069_0091425_1070_1645 191
477 3300049586 Ga0501070_0099994 Ga0501070_0099994_65_640 191
478 3300049586 Ga0501070_0360519 Ga0501070_0360519_573_1148 191
479 3300049589 Ga0501073_0100401 Ga0501073_0100401_892_1467 191
480 3300049590 Ga0501074_0134330 Ga0501074_0134330_19_594 191
481 3300049741 Ga0501079_0323155 Ga0501079_0323155_371_946 191
482 3300049742 Ga0501080_0083453 Ga0501080_0083453_2073_2648 191
483 3300049742 Ga0501080_1156476 Ga0501080_1156476_31_606 191
484 3300049822 Ga0501035_0000497 Ga0501035_0000497_8294_8869 191
485 3300049822 Ga0501035_0010269 Ga0501035_0010269_3108_3683 191
486 3300049823 Ga0501044_0007277 Ga0501044_0007277_2181_2756 191
487 3300049823 Ga0501044_0018505 Ga0501044_0018505_4154_4729 191
488 3300049823 Ga0501044_0087293 Ga0501044_0087293_1069_1644 191
489 3300050490 nmdc:mga03n38_51377_c1 nmdc:mga03n38_51377_c1_868_1443 191
490 3300050491 nmdc:mga00v17_20163_c1 nmdc:mga00v17_20163_c1_313_888 191
491 3300050492 nmdc:mga0yw44_248853_c1 nmdc:mga0yw44_248853_c1_390_965 191
492 3300050516 nmdc:mga0sz30_142175_c1 nmdc:mga0sz30_142175_c1_43_618 191
493 3300050516 nmdc:mga0sz30_38966_c1 nmdc:mga0sz30_38966_c1_43_618 191
494 3300050516 nmdc:mga0sz30_98168_c1 nmdc:mga0sz30_98168_c1_297_872 191
495 3300053080 Ga0500635_0037216 Ga0500635_0037216_722_1297 191
496 3300053098 Ga0500650_0384950 Ga0500650_0384950_22_597 191
497 3300053131 Ga0500652_029207 Ga0500652_029207_1331_1906 191
498 3300053139 Ga0500568_0081636 Ga0500568_0081636_208_783 191
499 3300053730 Ga0500645_000490 Ga0500645_000490_20011_20586 191
500 3300002073 JGI24745J21846_1003814 JGI24745J21846_10038142 192
501 3300002076 JGI24749J21850_1007767 JGI24749J21850_10077672 192
502 3300005328 Ga0070676_10045179 Ga0070676_100451793 192
503 3300005330 Ga0070690_100143971 Ga0070690_1001439712 192
504 3300005331 Ga0070670_100071249 Ga0070670_1000712494 192
505 3300005334 Ga0068869_100019489 Ga0068869_1000194894 192
506 3300005334 Ga0068869_101056266 Ga0068869_1010562661 192
507 3300005335 Ga0070666_10080831 Ga0070666_100808312 192
508 3300005338 Ga0068868_100001163 Ga0068868_10000116311 192
509 3300005340 Ga0070689_100094272 Ga0070689_1000942722 192
510 3300005341 Ga0070691_10010543 Ga0070691_100105433 192
511 3300005344 Ga0070661_100160224 Ga0070661_1001602242 192
512 3300005347 Ga0070668_100001540 Ga0070668_1000015406 192
513 3300005347 Ga0070668_100153909 Ga0070668_1001539093 192
514 3300005354 Ga0070675_100222581 Ga0070675_1002225812 192
515 3300005355 Ga0070671_100043005 Ga0070671_1000430052 192
516 3300005355 Ga0070671_100169639 Ga0070671_1001696393 192
517 3300005366 Ga0070659_100053946 Ga0070659_1000539463 192
518 3300005367 Ga0070667_100029854 Ga0070667_1000298546 192
519 3300005367 Ga0070667_100897239 Ga0070667_1008972391 192
520 3300005434 Ga0070709_10055686 Ga0070709_100556862 192
521 3300005437 Ga0070710_10000690 Ga0070710_100006907 192
522 3300005438 Ga0070701_10001806 Ga0070701_100018069 192
523 3300005439 Ga0070711_100000160 Ga0070711_10000016028 192
524 3300005440 Ga0070705_100032461 Ga0070705_1000324613 192
525 3300005441 Ga0070700_100041374 Ga0070700_1000413743 192
526 3300005444 Ga0070694_100048520 Ga0070694_1000485202 192
527 3300005455 Ga0070663_100204504 Ga0070663_1002045041 192
528 3300005456 Ga0070678_100000117 Ga0070678_10000011728 192
529 3300005457 Ga0070662_100014176 Ga0070662_1000141767 192
530 3300005459 Ga0068867_100004067 Ga0068867_10000406710 192
531 3300005535 Ga0070684_101506148 Ga0070684_1015061481 192
532 3300005539 Ga0068853_100023310 Ga0068853_1000233105 192
533 3300005539 Ga0068853_100124253 Ga0068853_1001242533 192
534 3300005539 Ga0068853_100147840 Ga0068853_1001478402 192
535 3300005544 Ga0070686_100148982 Ga0070686_1001489822 192
536 3300005546 Ga0070696_100010017 Ga0070696_1000100177 192
537 3300005548 Ga0070665_100006373 Ga0070665_10000637313 192
538 3300005548 Ga0070665_100009409 Ga0070665_1000094097 192
539 3300005548 Ga0070665_101237347 Ga0070665_1012373471 192
540 3300005549 Ga0070704_100041327 Ga0070704_1000413273 192
541 3300005564 Ga0070664_100764736 Ga0070664_1007647362 192
542 3300005578 Ga0068854_100009069 Ga0068854_1000090692 192
543 3300005614 Ga0068856_100220476 Ga0068856_1002204763 192
544 3300005615 Ga0070702_100000873 Ga0070702_10000087315 192
545 3300005616 Ga0068852_100103135 Ga0068852_1001031353 192
546 3300005617 Ga0068859_100001042 Ga0068859_10000104218 192
547 3300005617 Ga0068859_100261551 Ga0068859_1002615511 192
548 3300005718 Ga0068866_10000441 Ga0068866_1000044110 192
549 3300005719 Ga0068861_100003820 Ga0068861_1000038207 192
550 3300005719 Ga0068861_100902249 Ga0068861_1009022492 192
551 3300005841 Ga0068863_100012259 Ga0068863_1000122597 192
552 3300005842 Ga0068858_100004832 Ga0068858_1000048329 192
553 3300005842 Ga0068858_100123671 Ga0068858_1001236712 192
554 3300005842 Ga0068858_101552539 Ga0068858_1015525391 192
555 3300005843 Ga0068860_100008728 Ga0068860_1000087287 192
556 3300005843 Ga0068860_100184027 Ga0068860_1001840272 192
557 3300005843 Ga0068860_100582440 Ga0068860_1005824401 192
558 3300005844 Ga0068862_100045978 Ga0068862_1000459783 192
559 3300005844 Ga0068862_100621002 Ga0068862_1006210022 192
560 3300005937 Ga0081455_10253084 Ga0081455_102530842 192
561 3300005981 Ga0081538_10067540 Ga0081538_100675403 192
562 3300006038 Ga0075365_10408359 Ga0075365_104083591 192
563 3300006042 Ga0075368_10008666 Ga0075368_100086663 192
564 3300006048 Ga0075363_100008437 Ga0075363_1000084375 192
565 3300006048 Ga0075363_100018254 Ga0075363_1000182543 192
566 3300006048 Ga0075363_100038889 Ga0075363_1000388893 192
567 3300006048 Ga0075363_100070873 Ga0075363_1000708733 192
568 3300006048 Ga0075363_100119312 Ga0075363_1001193122 192
569 3300006048 Ga0075363_100182829 Ga0075363_1001828292 192
570 3300006051 Ga0075364_10063286 Ga0075364_100632862 192
571 3300006163 Ga0070715_10024074 Ga0070715_100240743 192
572 3300006173 Ga0070716_100009944 Ga0070716_1000099446 192
573 3300006175 Ga0070712_100000846 Ga0070712_1000008464 192
574 3300006175 Ga0070712_100216142 Ga0070712_1002161422 192
575 3300006175 Ga0070712_100787855 Ga0070712_1007878551 192
576 3300006177 Ga0075362_10032507 Ga0075362_100325073 192
577 3300006178 Ga0075367_10039786 Ga0075367_100397863 192
578 3300006186 Ga0075369_10004544 Ga0075369_100045446 192
579 3300006353 Ga0075370_10027074 Ga0075370_100270743 192
580 3300006353 Ga0075370_10095310 Ga0075370_100953102 192
581 3300006353 Ga0075370_10140851 Ga0075370_101408512 192
582 3300006353 Ga0075370_10405957 Ga0075370_104059571 192
583 3300006358 Ga0068871_100048970 Ga0068871_1000489702 192
584 3300006844 Ga0075428_100071233 Ga0075428_1000712333 192
585 3300006846 Ga0075430_100099602 Ga0075430_1000996023 192
586 3300006846 Ga0075430_100123661 Ga0075430_1001236612 192
587 3300006847 Ga0075431_100111441 Ga0075431_1001114413 192
588 3300006881 Ga0068865_100010990 Ga0068865_1000109903 192
589 3300006931 Ga0097620_100001042 Ga0097620_10000104218 192
590 3300006931 Ga0097620_100261540 Ga0097620_1002615401 192
591 3300009092 Ga0105250_10197597 Ga0105250_101975972 192
592 3300009093 Ga0105240_10500877 Ga0105240_105008772 192
593 3300009098 Ga0105245_10008338 Ga0105245_100083386 192
594 3300009098 Ga0105245_10178791 Ga0105245_101787912 192
595 3300009098 Ga0105245_10281693 Ga0105245_102816932 192
596 3300009101 Ga0105247_10000298 Ga0105247_1000029827 192
597 3300009148 Ga0105243_10000700 Ga0105243_1000070013 192
598 3300009176 Ga0105242_10001954 Ga0105242_100019544 192
599 3300009177 Ga0105248_10003516 Ga0105248_100035164 192
600 3300009545 Ga0105237_10006011 Ga0105237_1000601112 192
601 3300009545 Ga0105237_10011826 Ga0105237_100118267 192
602 3300009553 Ga0105249_10000470 Ga0105249_1000047016 192
603 3300009553 Ga0105249_10597676 Ga0105249_105976762 192
604 3300009553 Ga0105249_10731922 Ga0105249_107319222 192
605 3300009553 Ga0105249_10807360 Ga0105249_108073602 192
606 3300010375 Ga0105239_10016841 Ga0105239_100168414 192
607 3300010375 Ga0105239_10109829 Ga0105239_101098293 192
608 3300011119 Ga0105246_10430705 Ga0105246_104307052 192
609 3300013297 Ga0157378_10001860 Ga0157378_1000186021 192
610 3300013306 Ga0163162_10139046 Ga0163162_101390463 192
611 3300013306 Ga0163162_10438171 Ga0163162_104381711 192
612 3300013307 Ga0157372_10048234 Ga0157372_100482346 192
613 3300013308 Ga0157375_10078003 Ga0157375_100780035 192
614 3300014325 Ga0163163_10436575 Ga0163163_104365752 192
615 3300014325 Ga0163163_10443537 Ga0163163_104435372 192
616 3300014325 Ga0163163_10459637 Ga0163163_104596372 192
617 3300014326 Ga0157380_10010166 Ga0157380_100101667 192
618 3300014745 Ga0157377_10242850 Ga0157377_102428502 192
619 3300014968 Ga0157379_10002499 Ga0157379_1000249916 192
620 3300017792 Ga0163161_10104581 Ga0163161_101045812 192
621 3300025898 Ga0207692_10007732 Ga0207692_100077325 192
622 3300025899 Ga0207642_10008317 Ga0207642_100083173 192
623 3300025900 Ga0207710_10011288 Ga0207710_100112883 192
624 3300025901 Ga0207688_10021558 Ga0207688_100215584 192
625 3300025903 Ga0207680_10113827 Ga0207680_101138273 192
626 3300025903 Ga0207680_10836468 Ga0207680_108364681 192
627 3300025907 Ga0207645_10126547 Ga0207645_101265472 192
628 3300025910 Ga0207684_10642457 Ga0207684_106424572 192
629 3300025915 Ga0207693_10000754 Ga0207693_1000075423 192
630 3300025916 Ga0207663_10004087 Ga0207663_100040877 192
631 3300025918 Ga0207662_10020192 Ga0207662_100201924 192
632 3300025923 Ga0207681_10025217 Ga0207681_100252173 192
633 3300025925 Ga0207650_10105370 Ga0207650_101053702 192
634 3300025926 Ga0207659_10528487 Ga0207659_105284872 192
635 3300025927 Ga0207687_10016666 Ga0207687_100166663 192
636 3300025931 Ga0207644_10026466 Ga0207644_100264664 192
637 3300025931 Ga0207644_10158949 Ga0207644_101589492 192
638 3300025931 Ga0207644_10262985 Ga0207644_102629852 192
639 3300025933 Ga0207706_10081036 Ga0207706_100810363 192
640 3300025935 Ga0207709_10007107 Ga0207709_100071072 192
641 3300025936 Ga0207670_10102625 Ga0207670_101026252 192
642 3300025937 Ga0207669_10020989 Ga0207669_100209893 192
643 3300025938 Ga0207704_10060877 Ga0207704_100608773 192
644 3300025939 Ga0207665_10009094 Ga0207665_100090942 192
645 3300025939 Ga0207665_10184661 Ga0207665_101846612 192
646 3300025939 Ga0207665_10542385 Ga0207665_105423851 192
647 3300025942 Ga0207689_10031316 Ga0207689_100313165 192
648 3300025942 Ga0207689_10323733 Ga0207689_103237332 192
649 3300025944 Ga0207661_10234635 Ga0207661_102346352 192
650 3300025945 Ga0207679_10807160 Ga0207679_108071601 192
651 3300025949 Ga0207667_10090149 Ga0207667_100901493 192
652 3300025949 Ga0207667_10320970 Ga0207667_103209701 192
653 3300025961 Ga0207712_10001196 Ga0207712_1000119616 192
654 3300025961 Ga0207712_10136615 Ga0207712_101366152 192
655 3300025972 Ga0207668_10002892 Ga0207668_100028928 192
656 3300025981 Ga0207640_10401704 Ga0207640_104017042 192
657 3300025986 Ga0207658_10038741 Ga0207658_100387413 192
658 3300026023 Ga0207677_10230267 Ga0207677_102302672 192
659 3300026035 Ga0207703_10219734 Ga0207703_102197342 192
660 3300026035 Ga0207703_11163531 Ga0207703_111635311 192
661 3300026041 Ga0207639_10007030 Ga0207639_100070309 192
662 3300026041 Ga0207639_10016712 Ga0207639_100167125 192
663 3300026041 Ga0207639_10221901 Ga0207639_102219012 192
664 3300026067 Ga0207678_10009360 Ga0207678_100093607 192
665 3300026067 Ga0207678_10136254 Ga0207678_101362542 192
666 3300026067 Ga0207678_10850230 Ga0207678_108502301 192
667 3300026075 Ga0207708_10001431 Ga0207708_1000143120 192
668 3300026078 Ga0207702_10486428 Ga0207702_104864282 192
669 3300026088 Ga0207641_10005077 Ga0207641_100050779 192
670 3300026088 Ga0207641_10785188 Ga0207641_107851882 192
671 3300026089 Ga0207648_10014199 Ga0207648_100141994 192
672 3300026118 Ga0207675_100007850 Ga0207675_1000078508 192
673 3300026118 Ga0207675_100116420 Ga0207675_1001164203 192
674 3300026118 Ga0207675_101043176 Ga0207675_1010431762 192
675 3300026121 Ga0207683_10000984 Ga0207683_100009848 192
676 3300026142 Ga0207698_10151770 Ga0207698_101517703 192
677 3300027866 Ga0209813_10184443 Ga0209813_101844432 192
678 3300028379 Ga0268266_10011403 Ga0268266_100114033 192
679 3300028381 Ga0268264_10027397 Ga0268264_100273974 192
680 3300028381 Ga0268264_10563875 Ga0268264_105638751 192
681 3300028381 Ga0268264_10745845 Ga0268264_107458452 192
682 3300031824 Ga0307413_10350035 Ga0307413_103500352 192
683 3300031824 Ga0307413_10751672 Ga0307413_107516722 192
684 3300031852 Ga0307410_10114126 Ga0307410_101141262 192
685 3300031903 Ga0307407_10024118 Ga0307407_100241181 192
686 3300031903 Ga0307407_10489475 Ga0307407_104894751 192
687 3300031911 Ga0307412_10502027 Ga0307412_105020272 192
688 3300032002 Ga0307416_100074232 Ga0307416_1000742323 192
689 3300032005 Ga0307411_10957267 Ga0307411_109572671 192
690 3300032126 Ga0307415_100063805 Ga0307415_1000638053 192
691 3300032126 Ga0307415_100797379 Ga0307415_1007973791 192
692 3300035084 Ga0373928_0050061 Ga0373928_0050061_291_869 192
693 3300035084 Ga0373928_0120553 Ga0373928_0120553_87_665 192
694 3300035091 Ga0373951_0106311 Ga0373951_0106311_120_698 192
695 3300035111 Ga0373923_0362800 Ga0373923_0362800_12_590 192
696 3300035115 Ga0373941_0070119 Ga0373941_0070119_281_859 192
697 3300035170 Ga0373943_0094195 Ga0373943_0094195_639_1217 192
698 3300041413 Ga0439465_0013937 Ga0439465_0013937_1886_2464 192
699 3300042436 Ga0439435_0086491 Ga0439435_0086491_86_664 192
700 3300044658 Ga0466972_0008599 Ga0466972_0008599_3034_3612 192
701 3300044683 Ga0466965_0010937 Ga0466965_0010937_3078_3656 192
702 3300044683 Ga0466965_0443488 Ga0466965_0443488_93_671 192
703 3300044684 Ga0466966_0015177 Ga0466966_0015177_1502_2080 192
704 3300044706 Ga0466964_0236617 Ga0466964_0236617_80_658 192
705 3300044719 Ga0466971_0073472 Ga0466971_0073472_327_905 192
706 3300044735 Ga0466968_0039699 Ga0466968_0039699_956_1534 192
707 3300044842 Ga0466957_0017396 Ga0466957_0017396_2045_2623 192
708 3300044901 Ga0466960_0391295 Ga0466960_0391295_172_750 192
709 3300044901 Ga0466960_0433983 Ga0466960_0433983_67_645 192
710 3300045049 Ga0466959_0046101 Ga0466959_0046101_1906_2484 192
711 3300045976 Ga0466967_0138626 Ga0466967_0138626_677_1255 192
712 3300045976 Ga0466967_0153412 Ga0466967_0153412_1216_1794 192
713 3300045976 Ga0466967_0942457 Ga0466967_0942457_154_732 192
714 3300046455 Ga0495603_0197105 Ga0495603_0197105_545_1123 192
715 3300046459 Ga0495629_0044588 Ga0495629_0044588_967_1545 192
716 3300046461 Ga0495641_0389118 Ga0495641_0389118_16_594 192
717 3300046473 Ga0495582_0117284 Ga0495582_0117284_392_970 192
718 3300046506 Ga0495583_0029855 Ga0495583_0029855_1451_2029 192
719 3300046507 Ga0495606_0027733 Ga0495606_0027733_2576_3154 192
720 3300046515 Ga0495620_0069298 Ga0495620_0069298_626_1204 192
721 3300046524 Ga0495648_0015719 Ga0495648_0015719_4591_5169 192
722 3300046530 Ga0495654_0017761 Ga0495654_0017761_1952_2530 192
723 3300046531 Ga0495665_0091627 Ga0495665_0091627_244_822 192
724 3300046533 Ga0495640_0074333 Ga0495640_0074333_879_1457 192
725 3300046616 Ga0495668_0034993 Ga0495668_0034993_1353_1931 192
726 3300046648 Ga0495611_0133509 Ga0495611_0133509_312_890 192
727 3300046681 Ga0495647_0034166 Ga0495647_0034166_1269_1847 192
728 3300046690 Ga0495624_0019505 Ga0495624_0019505_666_1244 192
729 3300046694 Ga0495649_0062794 Ga0495649_0062794_109_687 192
730 3300047315 Ga0495581_0053343 Ga0495581_0053343_441_1019 192
731 3300047319 Ga0495674_0045891 Ga0495674_0045891_274_852 192
732 3300047319 Ga0495674_0620515 Ga0495674_0620515_118_696 192
733 3300047320 Ga0495672_0003978 Ga0495672_0003978_8195_8773 192
734 3300047469 Ga0495673_0002945 Ga0495673_0002945_5062_5640 192
735 3300047472 Ga0495686_0001660 Ga0495686_0001660_20813_21391 192
736 3300047673 Ga0495593_0065953 Ga0495593_0065953_1259_1837 192
737 3300048091 Ga0495626_0260956 Ga0495626_0260956_58_636 192
738 3300048903 Ga0496100_0001148 Ga0496100_0001148_8519_9097 192
739 3300048903 Ga0496100_0001530 Ga0496100_0001530_2922_3500 192
740 3300048903 Ga0496100_0035016 Ga0496100_0035016_1142_1720 192
741 3300048904 Ga0496101_0000110 Ga0496101_0000110_15347_15925 192
742 3300048905 Ga0496102_0000006 Ga0496102_0000006_320284_320862 192
743 3300048905 Ga0496102_0002926 Ga0496102_0002926_997_1575 192
744 3300048905 Ga0496102_0031183 Ga0496102_0031183_2141_2719 192
745 3300048905 Ga0496102_0150869 Ga0496102_0150869_1346_1924 192
746 3300048905 Ga0496102_0307215 Ga0496102_0307215_467_1045 192
747 3300048906 Ga0496103_0000006 Ga0496103_0000006_320082_320660 192
748 3300048906 Ga0496103_0000400 Ga0496103_0000400_35556_36134 192
749 3300048906 Ga0496103_0155241 Ga0496103_0155241_212_790 192
750 3300048906 Ga0496103_0218275 Ga0496103_0218275_151_729 192
751 3300048907 Ga0496104_0053659 Ga0496104_0053659_1631_2209 192
752 3300048907 Ga0496104_0411711 Ga0496104_0411711_650_1228 192
753 3300048908 Ga0496105_0049850 Ga0496105_0049850_1479_2057 192
754 3300048909 Ga0496106_0000616 Ga0496106_0000616_11839_12417 192
755 3300048910 Ga0496107_0059589 Ga0496107_0059589_1189_1767 192
756 3300048911 Ga0496108_0030263 Ga0496108_0030263_3839_4417 192
757 3300048911 Ga0496108_0124182 Ga0496108_0124182_565_1143 192
758 3300048912 Ga0496109_0070109 Ga0496109_0070109_303_881 192
759 3300048913 Ga0496110_0129909 Ga0496110_0129909_1432_2010 192
760 3300048913 Ga0496110_0308494 Ga0496110_0308494_40_618 192
761 3300048915 Ga0496112_0021751 Ga0496112_0021751_1491_2069 192
762 3300048915 Ga0496112_0063898 Ga0496112_0063898_2067_2645 192
763 3300048915 Ga0496112_0338250 Ga0496112_0338250_610_1188 192
764 3300048915 Ga0496112_1113983 Ga0496112_1113983_25_603 192
765 3300048916 Ga0496113_0080931 Ga0496113_0080931_904_1482 192
766 3300048917 Ga0496114_0000522 Ga0496114_0000522_17352_17930 192
767 3300048918 Ga0496115_0002348 Ga0496115_0002348_3145_3723 192
768 3300048919 Ga0496116_0000025 Ga0496116_0000025_149880_150458 192
769 3300048920 Ga0496117_0000006 Ga0496117_0000006_149880_150458 192
770 3300048921 Ga0496118_0000004 Ga0496118_0000004_149880_150458 192
771 3300048922 Ga0496119_0000035 Ga0496119_0000035_69929_70507 192
772 3300048923 Ga0496120_0000079 Ga0496120_0000079_28425_29003 192
773 3300048923 Ga0496120_0187786 Ga0496120_0187786_419_997 192
774 3300048924 Ga0496121_0000090 Ga0496121_0000090_97670_98248 192
775 3300048928 Ga0496125_0102273 Ga0496125_0102273_1209_1787 192
776 3300048929 Ga0496126_0030158 Ga0496126_0030158_3087_3665 192
777 3300049581 Ga0501047_0663202 Ga0501047_0663202_221_799 192
778 3300050489 nmdc:mga03683_34821_c1 nmdc:mga03683_34821_c1_49_627 192
779 3300050490 nmdc:mga03n38_13610_c1 nmdc:mga03n38_13610_c1_485_1063 192
780 3300050490 nmdc:mga03n38_202559_c1 nmdc:mga03n38_202559_c1_376_954 192
781 3300050490 nmdc:mga03n38_326880_c1 nmdc:mga03n38_326880_c1_124_702 192
782 3300050490 nmdc:mga03n38_6858_c1 nmdc:mga03n38_6858_c1_1641_2219 192
783 3300050491 nmdc:mga00v17_29039_c1 nmdc:mga00v17_29039_c1_128_706 192
784 3300050491 nmdc:mga00v17_38075_c1 nmdc:mga00v17_38075_c1_2141_2719 192
785 3300050491 nmdc:mga00v17_49917_c1 nmdc:mga00v17_49917_c1_1545_2123 192
786 3300050491 nmdc:mga00v17_59953_c1 nmdc:mga00v17_59953_c1_1457_2035 192
787 3300050491 nmdc:mga00v17_65717_c1 nmdc:mga00v17_65717_c1_1461_2039 192
788 3300050492 nmdc:mga0yw44_2784_c1 nmdc:mga0yw44_2784_c1_6086_6664 192
789 3300050492 nmdc:mga0yw44_51206_c1 nmdc:mga0yw44_51206_c1_575_1153 192
790 3300050495 nmdc:mga04h51_19868_c1 nmdc:mga04h51_19868_c1_85_663 192
791 3300050496 nmdc:mga07m45_10687_c1 nmdc:mga07m45_10687_c1_1076_1654 192
792 3300050496 nmdc:mga07m45_116508_c1 nmdc:mga07m45_116508_c1_613_1191 192
793 3300050496 nmdc:mga07m45_129740_c1 nmdc:mga07m45_129740_c1_308_886 192
794 3300050496 nmdc:mga07m45_32818_c1 nmdc:mga07m45_32818_c1_2018_2596 192
795 3300050496 nmdc:mga07m45_48555_c1 nmdc:mga07m45_48555_c1_1227_1805 192
796 3300050511 nmdc:mga08y16_1388746_c1 nmdc:mga08y16_1388746_c1_28_606 192
797 3300050516 nmdc:mga0sz30_190092_c1 nmdc:mga0sz30_190092_c1_27_605 192
798 3300050516 nmdc:mga0sz30_2321_c1 nmdc:mga0sz30_2321_c1_1365_1943 192
799 3300050516 nmdc:mga0sz30_29231_c2 nmdc:mga0sz30_29231_c2_166_744 192
800 3300050516 nmdc:mga0sz30_58587_c1 nmdc:mga0sz30_58587_c1_507_1085 192
801 3300053083 Ga0495655_0048121 Ga0495655_0048121_209_787 192
802 3300053087 Ga0500643_003561 Ga0500643_003561_1136_1714 192
803 3300053098 Ga0500650_0181540 Ga0500650_0181540_245_823 192
804 3300053104 Ga0500556_0002920 Ga0500556_0002920_1949_2527 192
805 3300053104 Ga0500556_0012047 Ga0500556_0012047_116_694 192
806 3300053108 Ga0500562_120359 Ga0500562_120359_77_655 192
807 3300053129 Ga0500628_030460 Ga0500628_030460_567_1145 192
808 3300053153 Ga0500616_0007285 Ga0500616_0007285_5332_5910 192
809 3300061719 Ga0466962_0012658 Ga0466962_0012658_1033_1611 192
810 3300050510 nmdc:mga06r32_44_c3 nmdc:mga06r32_44_c3_1310_1915 193
811 3300049742 Ga0501080_0307724 Ga0501080_0307724_61_657 197
812 3300050490 nmdc:mga03n38_62089_c1 nmdc:mga03n38_62089_c1_25_621 197
813 3300001977 JGI24746J21847_1008944 JGI24746J21847_10089441 202
814 3300001991 JGI24743J22301_10013189 JGI24743J22301_100131892 202
815 3300002073 JGI24745J21846_1016360 JGI24745J21846_10163602 202
816 3300005328 Ga0070676_10124387 Ga0070676_101243872 202
817 3300005334 Ga0068869_100055923 Ga0068869_1000559233 202
818 3300005339 Ga0070660_100155321 Ga0070660_1001553212 202
819 3300005340 Ga0070689_100155719 Ga0070689_1001557192 202
820 3300005345 Ga0070692_10069345 Ga0070692_100693451 202
821 3300005356 Ga0070674_100089173 Ga0070674_1000891732 202
822 3300005366 Ga0070659_100318681 Ga0070659_1003186812 202
823 3300005434 Ga0070709_10077029 Ga0070709_100770294 202
824 3300005437 Ga0070710_10003060 Ga0070710_100030606 202
825 3300005438 Ga0070701_10091749 Ga0070701_100917492 202
826 3300005439 Ga0070711_100007595 Ga0070711_1000075952 202
827 3300005440 Ga0070705_100236165 Ga0070705_1002361651 202
828 3300005441 Ga0070700_100190486 Ga0070700_1001904861 202
829 3300005455 Ga0070663_100167351 Ga0070663_1001673511 202
830 3300005456 Ga0070678_100153911 Ga0070678_1001539112 202
831 3300005457 Ga0070662_100467765 Ga0070662_1004677652 202
832 3300005459 Ga0068867_100028527 Ga0068867_1000285274 202
833 3300005539 Ga0068853_100079103 Ga0068853_1000791034 202
834 3300005543 Ga0070672_100067944 Ga0070672_1000679442 202
835 3300005545 Ga0070695_100487647 Ga0070695_1004876472 202
836 3300005546 Ga0070696_100171824 Ga0070696_1001718241 202
837 3300005547 Ga0070693_100455667 Ga0070693_1004556671 202
838 3300005548 Ga0070665_100029759 Ga0070665_1000297597 202
839 3300005563 Ga0068855_101237862 Ga0068855_1012378621 202
840 3300005578 Ga0068854_100127101 Ga0068854_1001271012 202
841 3300005615 Ga0070702_100044762 Ga0070702_1000447621 202
842 3300005616 Ga0068852_100287681 Ga0068852_1002876812 202
843 3300005616 Ga0068852_100593908 Ga0068852_1005939081 202
844 3300005617 Ga0068859_100116679 Ga0068859_1001166793 202
845 3300005618 Ga0068864_100235403 Ga0068864_1002354031 202
846 3300005718 Ga0068866_10027916 Ga0068866_100279164 202
847 3300005841 Ga0068863_100089781 Ga0068863_1000897814 202
848 3300005844 Ga0068862_100298420 Ga0068862_1002984202 202
849 3300005844 Ga0068862_100665284 Ga0068862_1006652841 202
850 3300006173 Ga0070716_100034686 Ga0070716_1000346863 202
851 3300006175 Ga0070712_100002348 Ga0070712_10000234810 202
852 3300006881 Ga0068865_100144687 Ga0068865_1001446873 202
853 3300006931 Ga0097620_100116667 Ga0097620_1001166673 202
854 3300011119 Ga0105246_10033636 Ga0105246_100336364 202
855 3300013308 Ga0157375_10793912 Ga0157375_107939122 202
856 3300017792 Ga0163161_10041561 Ga0163161_100415614 202
857 3300017792 Ga0163161_10089371 Ga0163161_100893713 202
858 3300025898 Ga0207692_10024366 Ga0207692_100243663 202
859 3300025899 Ga0207642_10204812 Ga0207642_102048122 202
860 3300025904 Ga0207647_10013370 Ga0207647_100133706 202
861 3300025906 Ga0207699_10005382 Ga0207699_100053824 202
862 3300025907 Ga0207645_10061757 Ga0207645_100617572 202
863 3300025914 Ga0207671_10239844 Ga0207671_102398442 202
864 3300025915 Ga0207693_10003890 Ga0207693_100038908 202
865 3300025916 Ga0207663_10031934 Ga0207663_100319344 202
866 3300025918 Ga0207662_10109101 Ga0207662_101091013 202
867 3300025927 Ga0207687_10266906 Ga0207687_102669062 202
868 3300025931 Ga0207644_10155307 Ga0207644_101553072 202
869 3300025932 Ga0207690_10078919 Ga0207690_100789192 202
870 3300025935 Ga0207709_10116832 Ga0207709_101168322 202
871 3300025936 Ga0207670_10125533 Ga0207670_101255333 202
872 3300025937 Ga0207669_10075261 Ga0207669_100752613 202
873 3300025939 Ga0207665_10081070 Ga0207665_100810703 202
874 3300025940 Ga0207691_10055981 Ga0207691_100559812 202
875 3300025961 Ga0207712_10242346 Ga0207712_102423462 202
876 3300025972 Ga0207668_10096911 Ga0207668_100969112 202
877 3300025981 Ga0207640_10070334 Ga0207640_100703342 202
878 3300026041 Ga0207639_10765949 Ga0207639_107659491 202
879 3300026067 Ga0207678_10016046 Ga0207678_100160468 202
880 3300026075 Ga0207708_10016479 Ga0207708_100164797 202
881 3300026088 Ga0207641_10290775 Ga0207641_102907752 202
882 3300026095 Ga0207676_10030889 Ga0207676_100308895 202
883 3300026118 Ga0207675_100063261 Ga0207675_1000632612 202
884 3300026121 Ga0207683_10058440 Ga0207683_100584404 202
885 3300026142 Ga0207698_10161701 Ga0207698_101617012 202
886 3300026142 Ga0207698_11238689 Ga0207698_112386891 202
887 3300028379 Ga0268266_10770164 Ga0268266_107701642 202
888 3300028381 Ga0268264_10357850 Ga0268264_103578502 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

23

206

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution 0.9896 13 201
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9852 14 190
7wt6-assembly1.cif.gz_A crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9776 14 201
3p2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution 0.9742 13 201
7wt6-assembly1.cif.gz_A crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9675 14 201
ID Description Score Start End Superfamily
af_Q54V95_265_452_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9559 70 199 3.40.50.1470
af_Q86Y79_27_209_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9406 15 192 3.40.50.1470
1rynA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9387 11 190 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9355 15 196 3.40.50.1470
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9344 13 200 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A7T5WPR7-F1-model_v4 deleted 0.9929 16 202
AF-A0A7J9VX40-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9912 13 199 GO:0004045
GO:0005737
GO:0006412
AF-A0A4R2DKB0-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9907 15 199 GO:0004045
GO:0005737
GO:0006412
AF-A0A2M9BG41-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9905 13 199 GO:0004045
GO:0005737
GO:0006412
AF-H0R5L0-F1-model_v4 Peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9865 15 176 GO:0004045

Feature Viewer

pLDDT pTM Quality
93.04 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map