F484751
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 888 | 339 | 875 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300005844|Ga0068862_100665284|Ga0068862_1006652841 |
| Length | 209 |
| Sequence | MAEPSPCPAGGWAPSLRGEYPQLVVGLGNPGPQYATTRHNLGFLIADILSDRIGSGFKVHKKSGAEVATGRLGGRSVVLAKPRCYMNESGRQVGPLAKFYSVPPADIVVIHDELDIDFGRIRLKFGGGVAGHNGLRSVGSSLGTNDFQRVRIGIGRPPGRMEGAAFVLSNFTNTEWREVPTICEQAADATELLVADGLEPAQNTVHAWG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 3 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 4 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 5 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 6 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 7 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 8 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 9 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 10 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 11 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 12 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 13 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 14 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 15 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 16 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 17 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 18 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 206 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 212 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 213 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 214 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 215 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 219 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 220 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 221 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 222 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 223 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 224 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 225 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 226 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 227 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 228 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 229 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 230 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 231 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 232 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 233 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 234 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 235 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 236 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 237 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 238 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 239 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 240 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 284 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 285 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 286 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 287 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 288 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 289 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 290 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 291 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 292 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 293 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 294 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 313 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 321 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 322 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 323 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 324 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 328 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 329 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 331 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 332 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 333 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 334 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 335 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 336 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 337 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 338 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 339 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.54 |
| Metatranscriptomes | 0 |
| Isolates | 1.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.77 |
| Nodule | 0.11 |
| Rhizoplane | 8.45 |
| Rhizosphere | 77.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1008944 | 3300001977 | Bacteria | 1504 |
| 2 | JGI24739J22299_10083003 | 3300001989 | Bacteria | 982 |
| 3 | JGI24743J22301_10013189 | 3300001991 | Bacteria | 1512 |
| 4 | JGI24745J21846_1003814 | 3300002073 | Bacteria | 1591 |
| 5 | JGI24745J21846_1016360 | 3300002073 | Bacteria | 860 |
| 6 | JGI24749J21850_1007767 | 3300002076 | Bacteria | 1495 |
| 7 | Ga0055540_1000043 | 3300003792 | Bacteria | 155228 |
| 8 | Ga0055540_1007851 | 3300003792 | Bacteria | 3947 |
| 9 | Ga0070676_10045179 | 3300005328 | Bacteria | 2565 |
| 10 | Ga0070676_10124387 | 3300005328 | Bacteria | 1623 |
| 11 | Ga0070690_100143971 | 3300005330 | Bacteria | 1620 |
| 12 | Ga0070690_100155322 | 3300005330 | Bacteria | 1564 |
| 13 | Ga0070670_100071249 | 3300005331 | Bacteria | 2984 |
| 14 | Ga0070670_100199219 | 3300005331 | Bacteria | 1739 |
| 15 | Ga0070670_100212651 | 3300005331 | Bacteria | 1681 |
| 16 | Ga0070677_10004991 | 3300005333 | Bacteria | 4358 |
| 17 | Ga0068869_100019489 | 3300005334 | Bacteria | 4637 |
| 18 | Ga0068869_100055923 | 3300005334 | Bacteria | 2877 |
| 19 | Ga0068869_100129571 | 3300005334 | Bacteria | 1938 |
| 20 | Ga0068869_101056266 | 3300005334 | Bacteria | 709 |
| 21 | Ga0070666_10080831 | 3300005335 | Bacteria | 2221 |
| 22 | Ga0068868_100001163 | 3300005338 | Bacteria | 18048 |
| 23 | Ga0068868_100681562 | 3300005338 | Bacteria | 918 |
| 24 | Ga0070660_100155321 | 3300005339 | Bacteria | 1841 |
| 25 | Ga0070689_100026826 | 3300005340 | Bacteria | 4339 |
| 26 | Ga0070689_100094272 | 3300005340 | Bacteria | 2363 |
| 27 | Ga0070689_100155719 | 3300005340 | Bacteria | 1845 |
| 28 | Ga0070689_100969405 | 3300005340 | Bacteria | 755 |
| 29 | Ga0070691_10010543 | 3300005341 | Bacteria | 4219 |
| 30 | Ga0070661_100160224 | 3300005344 | Bacteria | 1704 |
| 31 | Ga0070692_10069345 | 3300005345 | Bacteria | 1876 |
| 32 | Ga0070668_100001540 | 3300005347 | Bacteria | 16632 |
| 33 | Ga0070668_100153909 | 3300005347 | Bacteria | 1862 |
| 34 | Ga0070668_100156989 | 3300005347 | Bacteria | 1843 |
| 35 | Ga0070669_100007711 | 3300005353 | Bacteria | 7695 |
| 36 | Ga0070669_100135310 | 3300005353 | Bacteria | 1895 |
| 37 | Ga0070669_100300805 | 3300005353 | Bacteria | 1290 |
| 38 | Ga0070669_100649322 | 3300005353 | Bacteria | 887 |
| 39 | Ga0070675_100161598 | 3300005354 | Bacteria | 1926 |
| 40 | Ga0070675_100222581 | 3300005354 | Bacteria | 1644 |
| 41 | Ga0070671_100043005 | 3300005355 | Bacteria | 3756 |
| 42 | Ga0070671_100085812 | 3300005355 | Bacteria | 2634 |
| 43 | Ga0070671_100086014 | 3300005355 | Bacteria | 2630 |
| 44 | Ga0070671_100169639 | 3300005355 | Bacteria | 1845 |
| 45 | Ga0070674_100089173 | 3300005356 | Bacteria | 2221 |
| 46 | Ga0070674_100229082 | 3300005356 | Bacteria | 1449 |
| 47 | Ga0070674_100309703 | 3300005356 | Bacteria | 1262 |
| 48 | Ga0070673_100005957 | 3300005364 | Bacteria | 7881 |
| 49 | Ga0070673_100188383 | 3300005364 | Bacteria | 1770 |
| 50 | Ga0070673_100203191 | 3300005364 | Bacteria | 1707 |
| 51 | Ga0070688_100257131 | 3300005365 | Bacteria | 1246 |
| 52 | Ga0070688_100720532 | 3300005365 | Bacteria | 774 |
| 53 | Ga0070659_100053946 | 3300005366 | Bacteria | 3165 |
| 54 | Ga0070659_100068613 | 3300005366 | Bacteria | 2813 |
| 55 | Ga0070659_100318681 | 3300005366 | Bacteria | 1299 |
| 56 | Ga0070659_100967381 | 3300005366 | Bacteria | 746 |
| 57 | Ga0070667_100000791 | 3300005367 | Bacteria | 29649 |
| 58 | Ga0070667_100013973 | 3300005367 | Bacteria | 6635 |
| 59 | Ga0070667_100029854 | 3300005367 | Bacteria | 4545 |
| 60 | Ga0070667_100897239 | 3300005367 | Bacteria | 825 |
| 61 | Ga0070703_10308729 | 3300005406 | Bacteria | 662 |
| 62 | Ga0070709_10055686 | 3300005434 | Bacteria | 2498 |
| 63 | Ga0070709_10077029 | 3300005434 | Bacteria | 2167 |
| 64 | Ga0070714_100128686 | 3300005435 | Bacteria | 2261 |
| 65 | Ga0070713_100095738 | 3300005436 | Bacteria | 2562 |
| 66 | Ga0070710_10000690 | 3300005437 | Bacteria | 16057 |
| 67 | Ga0070710_10003060 | 3300005437 | Bacteria | 7951 |
| 68 | Ga0070710_10033713 | 3300005437 | Bacteria | 2782 |
| 69 | Ga0070701_10001806 | 3300005438 | Bacteria | 8078 |
| 70 | Ga0070701_10091749 | 3300005438 | Bacteria | 1665 |
| 71 | Ga0070711_100000160 | 3300005439 | Bacteria | 36517 |
| 72 | Ga0070711_100007595 | 3300005439 | Bacteria | 6597 |
| 73 | Ga0070705_100032461 | 3300005440 | Bacteria | 2901 |
| 74 | Ga0070705_100113172 | 3300005440 | Bacteria | 1738 |
| 75 | Ga0070705_100236165 | 3300005440 | Bacteria | 1275 |
| 76 | Ga0070700_100041374 | 3300005441 | Bacteria | 2825 |
| 77 | Ga0070700_100190486 | 3300005441 | Bacteria | 1433 |
| 78 | Ga0070694_100048520 | 3300005444 | Bacteria | 2857 |
| 79 | Ga0070663_100167351 | 3300005455 | Bacteria | 1697 |
| 80 | Ga0070663_100204504 | 3300005455 | Bacteria | 1543 |
| 81 | Ga0070678_100000117 | 3300005456 | Bacteria | 31126 |
| 82 | Ga0070678_100137249 | 3300005456 | Bacteria | 1952 |
| 83 | Ga0070678_100153911 | 3300005456 | Bacteria | 1855 |
| 84 | Ga0070662_100014176 | 3300005457 | Bacteria | 5319 |
| 85 | Ga0070662_100467765 | 3300005457 | Bacteria | 1048 |
| 86 | Ga0068867_100004067 | 3300005459 | Bacteria | 10296 |
| 87 | Ga0068867_100010852 | 3300005459 | Bacteria | 6425 |
| 88 | Ga0068867_100028527 | 3300005459 | Bacteria | 4020 |
| 89 | Ga0068867_100173347 | 3300005459 | Bacteria | 1710 |
| 90 | Ga0068867_100579427 | 3300005459 | Bacteria | 976 |
| 91 | Ga0070685_10032722 | 3300005466 | Bacteria | 2914 |
| 92 | Ga0070684_101506148 | 3300005535 | Bacteria | 634 |
| 93 | Ga0068853_100023310 | 3300005539 | Bacteria | 5180 |
| 94 | Ga0068853_100079103 | 3300005539 | Bacteria | 2874 |
| 95 | Ga0068853_100124253 | 3300005539 | Bacteria | 2304 |
| 96 | Ga0068853_100147840 | 3300005539 | Bacteria | 2113 |
| 97 | Ga0070672_100067944 | 3300005543 | Bacteria | 2825 |
| 98 | Ga0070686_100081996 | 3300005544 | Bacteria | 2138 |
| 99 | Ga0070686_100148982 | 3300005544 | Bacteria | 1637 |
| 100 | Ga0070695_100487647 | 3300005545 | Bacteria | 951 |
| 101 | Ga0070696_100010017 | 3300005546 | Bacteria | 6339 |
| 102 | Ga0070696_100171824 | 3300005546 | Bacteria | 1603 |
| 103 | Ga0070693_100455667 | 3300005547 | Bacteria | 898 |
| 104 | Ga0070665_100005216 | 3300005548 | Bacteria | 13444 |
| 105 | Ga0070665_100006373 | 3300005548 | Bacteria | 12030 |
| 106 | Ga0070665_100009409 | 3300005548 | Bacteria | 9888 |
| 107 | Ga0070665_100029759 | 3300005548 | Bacteria | 5495 |
| 108 | Ga0070665_100432064 | 3300005548 | Bacteria | 1326 |
| 109 | Ga0070665_101237347 | 3300005548 | Bacteria | 757 |
| 110 | Ga0070704_100041327 | 3300005549 | Bacteria | 3181 |
| 111 | Ga0068855_101237862 | 3300005563 | Bacteria | 775 |
| 112 | Ga0070664_100061616 | 3300005564 | Bacteria | 3198 |
| 113 | Ga0070664_100764736 | 3300005564 | Bacteria | 902 |
| 114 | Ga0068857_100794198 | 3300005577 | Bacteria | 904 |
| 115 | Ga0068854_100009069 | 3300005578 | Bacteria | 6411 |
| 116 | Ga0068854_100127101 | 3300005578 | Bacteria | 1942 |
| 117 | Ga0068854_100286875 | 3300005578 | Bacteria | 1327 |
| 118 | Ga0068854_100931624 | 3300005578 | Bacteria | 765 |
| 119 | Ga0068856_100220476 | 3300005614 | Bacteria | 1912 |
| 120 | Ga0070702_100000873 | 3300005615 | Bacteria | 11690 |
| 121 | Ga0070702_100044762 | 3300005615 | Bacteria | 2500 |
| 122 | Ga0068852_100103135 | 3300005616 | Bacteria | 2579 |
| 123 | Ga0068852_100287681 | 3300005616 | Bacteria | 1586 |
| 124 | Ga0068852_100593908 | 3300005616 | Bacteria | 1111 |
| 125 | Ga0068859_100001042 | 3300005617 | Bacteria | 28409 |
| 126 | Ga0068859_100116679 | 3300005617 | Bacteria | 2734 |
| 127 | Ga0068859_100261551 | 3300005617 | Bacteria | 1822 |
| 128 | Ga0068859_100577187 | 3300005617 | Bacteria | 1218 |
| 129 | Ga0068864_100008552 | 3300005618 | Bacteria | 8447 |
| 130 | Ga0068864_100040080 | 3300005618 | Bacteria | 4006 |
| 131 | Ga0068864_100235403 | 3300005618 | Bacteria | 1695 |
| 132 | Ga0068864_101469661 | 3300005618 | Bacteria | 684 |
| 133 | Ga0068866_10000441 | 3300005718 | Bacteria | 19171 |
| 134 | Ga0068866_10027916 | 3300005718 | Bacteria | 2684 |
| 135 | Ga0068861_100003820 | 3300005719 | Bacteria | 10055 |
| 136 | Ga0068861_100218434 | 3300005719 | Bacteria | 1610 |
| 137 | Ga0068861_100902249 | 3300005719 | Bacteria | 837 |
| 138 | Ga0068870_10496446 | 3300005840 | Bacteria | 813 |
| 139 | Ga0068863_100001025 | 3300005841 | Bacteria | 27909 |
| 140 | Ga0068863_100012259 | 3300005841 | Bacteria | 8277 |
| 141 | Ga0068863_100027751 | 3300005841 | Bacteria | 5403 |
| 142 | Ga0068863_100029840 | 3300005841 | Bacteria | 5208 |
| 143 | Ga0068863_100089781 | 3300005841 | Bacteria | 2914 |
| 144 | Ga0068863_100499357 | 3300005841 | Bacteria | 1198 |
| 145 | Ga0068863_101003205 | 3300005841 | Bacteria | 837 |
| 146 | Ga0068858_100004832 | 3300005842 | Bacteria | 13203 |
| 147 | Ga0068858_100016818 | 3300005842 | Bacteria | 6869 |
| 148 | Ga0068858_100074042 | 3300005842 | Bacteria | 3162 |
| 149 | Ga0068858_100123671 | 3300005842 | Bacteria | 2421 |
| 150 | Ga0068858_101552539 | 3300005842 | Bacteria | 653 |
| 151 | Ga0068860_100000087 | 3300005843 | Bacteria | 158242 |
| 152 | Ga0068860_100008728 | 3300005843 | Bacteria | 10094 |
| 153 | Ga0068860_100049084 | 3300005843 | Bacteria | 4022 |
| 154 | Ga0068860_100184027 | 3300005843 | Bacteria | 2020 |
| 155 | Ga0068860_100283471 | 3300005843 | Bacteria | 1620 |
| 156 | Ga0068860_100582440 | 3300005843 | Bacteria | 1123 |
| 157 | Ga0068862_100000077 | 3300005844 | Bacteria | 116781 |
| 158 | Ga0068862_100008978 | 3300005844 | Bacteria | 8277 |
| 159 | Ga0068862_100045978 | 3300005844 | Bacteria | 3726 |
| 160 | Ga0068862_100081482 | 3300005844 | Bacteria | 2808 |
| 161 | Ga0068862_100083623 | 3300005844 | Bacteria | 2772 |
| 162 | Ga0068862_100298420 | 3300005844 | Bacteria | 1481 |
| 163 | Ga0068862_100621002 | 3300005844 | Bacteria | 1040 |
| 164 | Ga0068862_100665284 | 3300005844 | Bacteria | 1006 |
| 165 | Ga0081455_10253084 | 3300005937 | Bacteria | 1287 |
| 166 | Ga0081538_10067540 | 3300005981 | Bacteria | 1995 |
| 167 | Ga0070717_10489261 | 3300006028 | Bacteria | 1111 |
| 168 | Ga0075365_10408359 | 3300006038 | Bacteria | 958 |
| 169 | Ga0075365_10410611 | 3300006038 | Bacteria | 956 |
| 170 | Ga0075368_10008666 | 3300006042 | Bacteria | 3632 |
| 171 | Ga0075363_100008437 | 3300006048 | Bacteria | 4796 |
| 172 | Ga0075363_100018254 | 3300006048 | Bacteria | 3491 |
| 173 | Ga0075363_100038889 | 3300006048 | Bacteria | 2502 |
| 174 | Ga0075363_100070873 | 3300006048 | Bacteria | 1893 |
| 175 | Ga0075363_100119312 | 3300006048 | Bacteria | 1472 |
| 176 | Ga0075363_100182829 | 3300006048 | Bacteria | 1193 |
| 177 | Ga0075364_10063286 | 3300006051 | Bacteria | 2429 |
| 178 | Ga0070715_10024074 | 3300006163 | Bacteria | 2393 |
| 179 | Ga0070715_10322756 | 3300006163 | Bacteria | 834 |
| 180 | Ga0070716_100009944 | 3300006173 | Bacteria | 4757 |
| 181 | Ga0070716_100034686 | 3300006173 | Bacteria | 2768 |
| 182 | Ga0070716_100284764 | 3300006173 | Bacteria | 1142 |
| 183 | Ga0070712_100000846 | 3300006175 | Bacteria | 18192 |
| 184 | Ga0070712_100002348 | 3300006175 | Bacteria | 11656 |
| 185 | Ga0070712_100216142 | 3300006175 | Bacteria | 1514 |
| 186 | Ga0070712_100787855 | 3300006175 | Bacteria | 815 |
| 187 | Ga0070712_100891951 | 3300006175 | Bacteria | 766 |
| 188 | Ga0075362_10032507 | 3300006177 | Bacteria | 2264 |
| 189 | Ga0075367_10039786 | 3300006178 | Bacteria | 2743 |
| 190 | Ga0075369_10004544 | 3300006186 | Bacteria | 5137 |
| 191 | Ga0075369_10012989 | 3300006186 | Bacteria | 3295 |
| 192 | Ga0075369_10085533 | 3300006186 | Bacteria | 1402 |
| 193 | Ga0097621_100014593 | 3300006237 | Bacteria | 5886 |
| 194 | Ga0075370_10027074 | 3300006353 | Bacteria | 3179 |
| 195 | Ga0075370_10095310 | 3300006353 | Bacteria | 1719 |
| 196 | Ga0075370_10140851 | 3300006353 | Bacteria | 1410 |
| 197 | Ga0075370_10405957 | 3300006353 | Bacteria | 817 |
| 198 | Ga0068871_100003130 | 3300006358 | Bacteria | 11355 |
| 199 | Ga0068871_100007688 | 3300006358 | Bacteria | 7711 |
| 200 | Ga0068871_100048970 | 3300006358 | Bacteria | 3414 |
| 201 | Ga0075428_100071233 | 3300006844 | Bacteria | 3799 |
| 202 | Ga0075428_100101443 | 3300006844 | Bacteria | 3137 |
| 203 | Ga0075428_100138818 | 3300006844 | Bacteria | 2643 |
| 204 | Ga0075430_100099602 | 3300006846 | Bacteria | 2427 |
| 205 | Ga0075430_100123661 | 3300006846 | Bacteria | 2156 |
| 206 | Ga0075431_100111441 | 3300006847 | Bacteria | 2824 |
| 207 | Ga0068865_100010990 | 3300006881 | Bacteria | 5650 |
| 208 | Ga0068865_100063301 | 3300006881 | Bacteria | 2599 |
| 209 | Ga0068865_100144687 | 3300006881 | Bacteria | 1796 |
| 210 | Ga0068865_100512164 | 3300006881 | Bacteria | 1002 |
| 211 | Ga0097620_100001042 | 3300006931 | Bacteria | 28409 |
| 212 | Ga0097620_100116667 | 3300006931 | Bacteria | 2734 |
| 213 | Ga0097620_100261540 | 3300006931 | Bacteria | 1822 |
| 214 | Ga0097620_100577195 | 3300006931 | Bacteria | 1218 |
| 215 | Ga0099795_10039323 | 3300007788 | Bacteria | 1674 |
| 216 | Ga0105250_10194592 | 3300009092 | Bacteria | 854 |
| 217 | Ga0105250_10197597 | 3300009092 | Bacteria | 848 |
| 218 | Ga0105240_10500877 | 3300009093 | Bacteria | 1350 |
| 219 | Ga0105245_10008338 | 3300009098 | Bacteria | 9053 |
| 220 | Ga0105245_10059620 | 3300009098 | Bacteria | 3437 |
| 221 | Ga0105245_10178791 | 3300009098 | Bacteria | 2025 |
| 222 | Ga0105245_10281693 | 3300009098 | Bacteria | 1625 |
| 223 | Ga0105247_10000060 | 3300009101 | Bacteria | 127879 |
| 224 | Ga0105247_10000298 | 3300009101 | Bacteria | 44765 |
| 225 | Ga0105247_10183557 | 3300009101 | Bacteria | 1397 |
| 226 | Ga0105243_10000700 | 3300009148 | Bacteria | 32410 |
| 227 | Ga0105243_10035567 | 3300009148 | Bacteria | 3862 |
| 228 | Ga0105243_10045903 | 3300009148 | Bacteria | 3435 |
| 229 | Ga0105241_10399990 | 3300009174 | Bacteria | 1204 |
| 230 | Ga0105241_11289172 | 3300009174 | Bacteria | 695 |
| 231 | Ga0105242_10001954 | 3300009176 | Bacteria | 16221 |
| 232 | Ga0105248_10000050 | 3300009177 | Bacteria | 152667 |
| 233 | Ga0105248_10003516 | 3300009177 | Bacteria | 17379 |
| 234 | Ga0105248_10056751 | 3300009177 | Bacteria | 4393 |
| 235 | Ga0105248_10271166 | 3300009177 | Bacteria | 1911 |
| 236 | Ga0105237_10006011 | 3300009545 | Bacteria | 13581 |
| 237 | Ga0105237_10011826 | 3300009545 | Bacteria | 9231 |
| 238 | Ga0105237_10027144 | 3300009545 | Bacteria | 5848 |
| 239 | Ga0105237_10336453 | 3300009545 | Bacteria | 1514 |
| 240 | Ga0105237_10942392 | 3300009545 | Bacteria | 870 |
| 241 | Ga0105238_10022028 | 3300009551 | Bacteria | 6494 |
| 242 | Ga0105249_10000042 | 3300009553 | Bacteria | 195242 |
| 243 | Ga0105249_10000470 | 3300009553 | Bacteria | 37482 |
| 244 | Ga0105249_10322643 | 3300009553 | Bacteria | 1556 |
| 245 | Ga0105249_10597676 | 3300009553 | Bacteria | 1158 |
| 246 | Ga0105249_10731922 | 3300009553 | Bacteria | 1050 |
| 247 | Ga0105249_10807360 | 3300009553 | Bacteria | 1002 |
| 248 | Ga0105249_11317480 | 3300009553 | Bacteria | 794 |
| 249 | Ga0099796_10114238 | 3300010159 | Bacteria | 1031 |
| 250 | Ga0105239_10016841 | 3300010375 | Bacteria | 8078 |
| 251 | Ga0105239_10024596 | 3300010375 | Bacteria | 6634 |
| 252 | Ga0105239_10109829 | 3300010375 | Bacteria | 3057 |
| 253 | Ga0105246_10033636 | 3300011119 | Bacteria | 3410 |
| 254 | Ga0105246_10430705 | 3300011119 | Bacteria | 1103 |
| 255 | Ga0157374_10032490 | 3300013296 | Bacteria | 4752 |
| 256 | Ga0157378_10001860 | 3300013297 | Bacteria | 18955 |
| 257 | Ga0157378_10088440 | 3300013297 | Bacteria | 2811 |
| 258 | Ga0163162_10006550 | 3300013306 | Bacteria | 11281 |
| 259 | Ga0163162_10028905 | 3300013306 | Bacteria | 5487 |
| 260 | Ga0163162_10139046 | 3300013306 | Bacteria | 2541 |
| 261 | Ga0163162_10438171 | 3300013306 | Bacteria | 1439 |
| 262 | Ga0157372_10048234 | 3300013307 | Bacteria | 4734 |
| 263 | Ga0157375_10078003 | 3300013308 | Bacteria | 3344 |
| 264 | Ga0157375_10126472 | 3300013308 | Bacteria | 2671 |
| 265 | Ga0157375_10294174 | 3300013308 | Bacteria | 1787 |
| 266 | Ga0157375_10319953 | 3300013308 | Bacteria | 1716 |
| 267 | Ga0157375_10793912 | 3300013308 | Bacteria | 1096 |
| 268 | Ga0163163_10082758 | 3300014325 | Bacteria | 3214 |
| 269 | Ga0163163_10436575 | 3300014325 | Bacteria | 1369 |
| 270 | Ga0163163_10443537 | 3300014325 | Bacteria | 1358 |
| 271 | Ga0163163_10459637 | 3300014325 | Bacteria | 1333 |
| 272 | Ga0157380_10010166 | 3300014326 | Bacteria | 6763 |
| 273 | Ga0157380_10060027 | 3300014326 | Bacteria | 3037 |
| 274 | Ga0157380_10119722 | 3300014326 | Bacteria | 2228 |
| 275 | Ga0157377_10242850 | 3300014745 | Bacteria | 1163 |
| 276 | Ga0157379_10002499 | 3300014968 | Bacteria | 15398 |
| 277 | Ga0157379_10215345 | 3300014968 | Bacteria | 1740 |
| 278 | Ga0157379_10374241 | 3300014968 | Bacteria | 1306 |
| 279 | Ga0157376_10006456 | 3300014969 | Bacteria | 8285 |
| 280 | Ga0157376_10160680 | 3300014969 | Bacteria | 2036 |
| 281 | Ga0157376_10168266 | 3300014969 | Bacteria | 1993 |
| 282 | Ga0157376_10296027 | 3300014969 | Bacteria | 1530 |
| 283 | Ga0163161_10015854 | 3300017792 | Bacteria | 5256 |
| 284 | Ga0163161_10041561 | 3300017792 | Bacteria | 3303 |
| 285 | Ga0163161_10089371 | 3300017792 | Bacteria | 2278 |
| 286 | Ga0163161_10104581 | 3300017792 | Bacteria | 2111 |
| 287 | Ga0209673_1013931 | 3300025273 | Bacteria | 3143 |
| 288 | Ga0209051_1000108 | 3300025303 | Bacteria | 155280 |
| 289 | Ga0209051_1000642 | 3300025303 | Bacteria | 39944 |
| 290 | Ga0209051_1003362 | 3300025303 | Bacteria | 10530 |
| 291 | Ga0209051_1005179 | 3300025303 | Bacteria | 7721 |
| 292 | Ga0207656_10099283 | 3300025321 | Bacteria | 1332 |
| 293 | Ga0207682_10113439 | 3300025893 | Bacteria | 1195 |
| 294 | Ga0207692_10007732 | 3300025898 | Bacteria | 4417 |
| 295 | Ga0207692_10024366 | 3300025898 | Bacteria | 2813 |
| 296 | Ga0207692_10154899 | 3300025898 | Bacteria | 1315 |
| 297 | Ga0207642_10008317 | 3300025899 | Bacteria | 3552 |
| 298 | Ga0207642_10204812 | 3300025899 | Bacteria | 1092 |
| 299 | Ga0207710_10000010 | 3300025900 | Bacteria | 482087 |
| 300 | Ga0207710_10011288 | 3300025900 | Bacteria | 3761 |
| 301 | Ga0207688_10021558 | 3300025901 | Bacteria | 3522 |
| 302 | Ga0207688_10113743 | 3300025901 | Bacteria | 1573 |
| 303 | Ga0207680_10044300 | 3300025903 | Bacteria | 2616 |
| 304 | Ga0207680_10113827 | 3300025903 | Bacteria | 1759 |
| 305 | Ga0207680_10130307 | 3300025903 | Bacteria | 1657 |
| 306 | Ga0207680_10836468 | 3300025903 | Bacteria | 660 |
| 307 | Ga0207647_10013370 | 3300025904 | Bacteria | 5693 |
| 308 | Ga0207699_10005382 | 3300025906 | Bacteria | 6135 |
| 309 | Ga0207645_10061757 | 3300025907 | Bacteria | 2393 |
| 310 | Ga0207645_10126547 | 3300025907 | Bacteria | 1661 |
| 311 | Ga0207684_10642457 | 3300025910 | Bacteria | 904 |
| 312 | Ga0207671_10157610 | 3300025914 | Bacteria | 1757 |
| 313 | Ga0207671_10239844 | 3300025914 | Bacteria | 1424 |
| 314 | Ga0207671_10326293 | 3300025914 | Bacteria | 1215 |
| 315 | Ga0207693_10000754 | 3300025915 | Bacteria | 29034 |
| 316 | Ga0207693_10003890 | 3300025915 | Bacteria | 12718 |
| 317 | Ga0207693_10179300 | 3300025915 | Bacteria | 1667 |
| 318 | Ga0207663_10004087 | 3300025916 | Bacteria | 7234 |
| 319 | Ga0207663_10031934 | 3300025916 | Bacteria | 3121 |
| 320 | Ga0207662_10020192 | 3300025918 | Bacteria | 3800 |
| 321 | Ga0207662_10109101 | 3300025918 | Bacteria | 1724 |
| 322 | Ga0207681_10002155 | 3300025923 | Bacteria | 12552 |
| 323 | Ga0207681_10025217 | 3300025923 | Bacteria | 3822 |
| 324 | Ga0207681_10117074 | 3300025923 | Bacteria | 1948 |
| 325 | Ga0207681_10149310 | 3300025923 | Bacteria | 1749 |
| 326 | Ga0207681_10385135 | 3300025923 | Bacteria | 1129 |
| 327 | Ga0207681_10508799 | 3300025923 | Bacteria | 987 |
| 328 | Ga0207650_10000200 | 3300025925 | Bacteria | 69213 |
| 329 | Ga0207650_10020180 | 3300025925 | Bacteria | 4696 |
| 330 | Ga0207650_10105370 | 3300025925 | Bacteria | 2177 |
| 331 | Ga0207650_10180221 | 3300025925 | Bacteria | 1683 |
| 332 | Ga0207659_10113079 | 3300025926 | Bacteria | 2067 |
| 333 | Ga0207659_10528487 | 3300025926 | Bacteria | 1001 |
| 334 | Ga0207659_10596413 | 3300025926 | Bacteria | 941 |
| 335 | Ga0207687_10016666 | 3300025927 | Bacteria | 4829 |
| 336 | Ga0207687_10266906 | 3300025927 | Bacteria | 1367 |
| 337 | Ga0207644_10026466 | 3300025931 | Bacteria | 3997 |
| 338 | Ga0207644_10092085 | 3300025931 | Bacteria | 2261 |
| 339 | Ga0207644_10155307 | 3300025931 | Bacteria | 1774 |
| 340 | Ga0207644_10158949 | 3300025931 | Bacteria | 1755 |
| 341 | Ga0207644_10262985 | 3300025931 | Bacteria | 1380 |
| 342 | Ga0207644_10323274 | 3300025931 | Bacteria | 1248 |
| 343 | Ga0207690_10078919 | 3300025932 | Bacteria | 2293 |
| 344 | Ga0207706_10043370 | 3300025933 | Bacteria | 3986 |
| 345 | Ga0207706_10060092 | 3300025933 | Bacteria | 3347 |
| 346 | Ga0207706_10081036 | 3300025933 | Bacteria | 2853 |
| 347 | Ga0207709_10007107 | 3300025935 | Bacteria | 6252 |
| 348 | Ga0207709_10116832 | 3300025935 | Bacteria | 1794 |
| 349 | Ga0207709_10312495 | 3300025935 | Bacteria | 1173 |
| 350 | Ga0207670_10102625 | 3300025936 | Bacteria | 2045 |
| 351 | Ga0207670_10125533 | 3300025936 | Bacteria | 1872 |
| 352 | Ga0207670_10477067 | 3300025936 | Bacteria | 1010 |
| 353 | Ga0207669_10020989 | 3300025937 | Bacteria | 3437 |
| 354 | Ga0207669_10075261 | 3300025937 | Bacteria | 2138 |
| 355 | Ga0207669_10528292 | 3300025937 | Bacteria | 948 |
| 356 | Ga0207704_10030692 | 3300025938 | Bacteria | 3017 |
| 357 | Ga0207704_10060877 | 3300025938 | Bacteria | 2338 |
| 358 | Ga0207665_10009094 | 3300025939 | Bacteria | 6524 |
| 359 | Ga0207665_10081070 | 3300025939 | Bacteria | 2233 |
| 360 | Ga0207665_10184661 | 3300025939 | Bacteria | 1512 |
| 361 | Ga0207665_10333124 | 3300025939 | Bacteria | 1142 |
| 362 | Ga0207665_10542385 | 3300025939 | Bacteria | 903 |
| 363 | Ga0207691_10055981 | 3300025940 | Bacteria | 3594 |
| 364 | Ga0207711_10001406 | 3300025941 | Bacteria | 22551 |
| 365 | Ga0207711_10033441 | 3300025941 | Bacteria | 4350 |
| 366 | Ga0207711_10090865 | 3300025941 | Bacteria | 2685 |
| 367 | Ga0207689_10031316 | 3300025942 | Bacteria | 4429 |
| 368 | Ga0207689_10115900 | 3300025942 | Bacteria | 2202 |
| 369 | Ga0207689_10323733 | 3300025942 | Bacteria | 1279 |
| 370 | Ga0207661_10234635 | 3300025944 | Bacteria | 1626 |
| 371 | Ga0207679_10337134 | 3300025945 | Bacteria | 1310 |
| 372 | Ga0207679_10807160 | 3300025945 | Bacteria | 856 |
| 373 | Ga0207667_10090149 | 3300025949 | Bacteria | 3169 |
| 374 | Ga0207667_10320970 | 3300025949 | Bacteria | 1582 |
| 375 | Ga0207651_10152246 | 3300025960 | Bacteria | 1802 |
| 376 | Ga0207712_10000010 | 3300025961 | Bacteria | 455972 |
| 377 | Ga0207712_10001196 | 3300025961 | Bacteria | 17936 |
| 378 | Ga0207712_10136615 | 3300025961 | Bacteria | 1876 |
| 379 | Ga0207712_10242346 | 3300025961 | Bacteria | 1453 |
| 380 | Ga0207668_10002892 | 3300025972 | Bacteria | 10073 |
| 381 | Ga0207668_10096911 | 3300025972 | Bacteria | 2181 |
| 382 | Ga0207668_10577558 | 3300025972 | Bacteria | 977 |
| 383 | Ga0207640_10070334 | 3300025981 | Bacteria | 2353 |
| 384 | Ga0207640_10401704 | 3300025981 | Bacteria | 1116 |
| 385 | Ga0207658_10000677 | 3300025986 | Bacteria | 29704 |
| 386 | Ga0207658_10001961 | 3300025986 | Bacteria | 15354 |
| 387 | Ga0207658_10038741 | 3300025986 | Bacteria | 3436 |
| 388 | Ga0207677_10230267 | 3300026023 | Bacteria | 1492 |
| 389 | Ga0207703_10009823 | 3300026035 | Bacteria | 7505 |
| 390 | Ga0207703_10219734 | 3300026035 | Bacteria | 1698 |
| 391 | Ga0207703_10251707 | 3300026035 | Bacteria | 1592 |
| 392 | Ga0207703_11163531 | 3300026035 | Bacteria | 741 |
| 393 | Ga0207639_10007030 | 3300026041 | Bacteria | 7672 |
| 394 | Ga0207639_10016712 | 3300026041 | Bacteria | 5198 |
| 395 | Ga0207639_10154710 | 3300026041 | Bacteria | 1925 |
| 396 | Ga0207639_10221901 | 3300026041 | Bacteria | 1633 |
| 397 | Ga0207639_10765949 | 3300026041 | Bacteria | 898 |
| 398 | Ga0207678_10009360 | 3300026067 | Bacteria | 8622 |
| 399 | Ga0207678_10016046 | 3300026067 | Bacteria | 6578 |
| 400 | Ga0207678_10085821 | 3300026067 | Bacteria | 2691 |
| 401 | Ga0207678_10136254 | 3300026067 | Bacteria | 2095 |
| 402 | Ga0207678_10850230 | 3300026067 | Bacteria | 806 |
| 403 | Ga0207708_10001431 | 3300026075 | Bacteria | 17904 |
| 404 | Ga0207708_10013446 | 3300026075 | Bacteria | 6119 |
| 405 | Ga0207708_10016479 | 3300026075 | Bacteria | 5557 |
| 406 | Ga0207702_10486428 | 3300026078 | Bacteria | 1202 |
| 407 | Ga0207641_10000849 | 3300026088 | Bacteria | 32380 |
| 408 | Ga0207641_10005077 | 3300026088 | Bacteria | 11285 |
| 409 | Ga0207641_10006938 | 3300026088 | Bacteria | 9479 |
| 410 | Ga0207641_10027685 | 3300026088 | Bacteria | 4682 |
| 411 | Ga0207641_10190822 | 3300026088 | Bacteria | 1883 |
| 412 | Ga0207641_10192318 | 3300026088 | Bacteria | 1876 |
| 413 | Ga0207641_10290775 | 3300026088 | Bacteria | 1540 |
| 414 | Ga0207641_10785188 | 3300026088 | Bacteria | 942 |
| 415 | Ga0207648_10014199 | 3300026089 | Bacteria | 7367 |
| 416 | Ga0207648_10169747 | 3300026089 | Bacteria | 1928 |
| 417 | Ga0207648_10592173 | 3300026089 | Bacteria | 1021 |
| 418 | Ga0207676_10030889 | 3300026095 | Bacteria | 4025 |
| 419 | Ga0207676_10034004 | 3300026095 | Bacteria | 3857 |
| 420 | Ga0207676_10057880 | 3300026095 | Bacteria | 3054 |
| 421 | Ga0207676_10122826 | 3300026095 | Bacteria | 2193 |
| 422 | Ga0207676_10642776 | 3300026095 | Bacteria | 1023 |
| 423 | Ga0207675_100007850 | 3300026118 | Bacteria | 10069 |
| 424 | Ga0207675_100063261 | 3300026118 | Bacteria | 3457 |
| 425 | Ga0207675_100116420 | 3300026118 | Bacteria | 2526 |
| 426 | Ga0207675_100200892 | 3300026118 | Bacteria | 1915 |
| 427 | Ga0207675_101043176 | 3300026118 | Bacteria | 837 |
| 428 | Ga0207683_10000984 | 3300026121 | Bacteria | 26143 |
| 429 | Ga0207683_10050483 | 3300026121 | Bacteria | 3644 |
| 430 | Ga0207683_10058440 | 3300026121 | Bacteria | 3386 |
| 431 | Ga0207683_10163373 | 3300026121 | Bacteria | 2014 |
| 432 | Ga0207698_10151770 | 3300026142 | Bacteria | 2012 |
| 433 | Ga0207698_10161701 | 3300026142 | Bacteria | 1959 |
| 434 | Ga0207698_11238689 | 3300026142 | Bacteria | 760 |
| 435 | Ga0209983_1037523 | 3300027665 | Bacteria | 1043 |
| 436 | Ga0209813_10184443 | 3300027866 | Bacteria | 765 |
| 437 | Ga0209974_10001606 | 3300027876 | Bacteria | 8169 |
| 438 | Ga0209974_10060232 | 3300027876 | Bacteria | 1284 |
| 439 | Ga0209974_10077241 | 3300027876 | Bacteria | 1141 |
| 440 | Ga0268266_10011403 | 3300028379 | Bacteria | 7729 |
| 441 | Ga0268266_10030548 | 3300028379 | Bacteria | 4577 |
| 442 | Ga0268266_10770164 | 3300028379 | Bacteria | 929 |
| 443 | Ga0268265_10000014 | 3300028380 | Bacteria | 330186 |
| 444 | Ga0268265_10003531 | 3300028380 | Bacteria | 11183 |
| 445 | Ga0268264_10000150 | 3300028381 | Bacteria | 158263 |
| 446 | Ga0268264_10027397 | 3300028381 | Bacteria | 4655 |
| 447 | Ga0268264_10034902 | 3300028381 | Bacteria | 4140 |
| 448 | Ga0268264_10057589 | 3300028381 | Bacteria | 3251 |
| 449 | Ga0268264_10357850 | 3300028381 | Bacteria | 1391 |
| 450 | Ga0268264_10469849 | 3300028381 | Bacteria | 1222 |
| 451 | Ga0268264_10527733 | 3300028381 | Bacteria | 1155 |
| 452 | Ga0268264_10563875 | 3300028381 | Bacteria | 1118 |
| 453 | Ga0268264_10745845 | 3300028381 | Bacteria | 975 |
| 454 | Ga0265327_10002508 | 3300031251 | Bacteria | 19190 |
| 455 | Ga0307408_100027291 | 3300031548 | Bacteria | 3932 |
| 456 | Ga0307408_100033296 | 3300031548 | Bacteria | 3599 |
| 457 | Ga0307408_100035312 | 3300031548 | Bacteria | 3507 |
| 458 | Ga0307408_100042286 | 3300031548 | Bacteria | 3236 |
| 459 | Ga0307408_100310639 | 3300031548 | Bacteria | 1324 |
| 460 | Ga0307405_10007163 | 3300031731 | Bacteria | 5549 |
| 461 | Ga0307405_10019495 | 3300031731 | Bacteria | 3769 |
| 462 | Ga0307405_10028387 | 3300031731 | Bacteria | 3258 |
| 463 | Ga0307405_10032703 | 3300031731 | Bacteria | 3076 |
| 464 | Ga0307405_10040394 | 3300031731 | Bacteria | 2826 |
| 465 | Ga0307405_10115560 | 3300031731 | Bacteria | 1826 |
| 466 | Ga0307405_10150351 | 3300031731 | Bacteria | 1636 |
| 467 | Ga0307405_10314544 | 3300031731 | Bacteria | 1193 |
| 468 | Ga0307413_10006149 | 3300031824 | Bacteria | 5450 |
| 469 | Ga0307413_10007453 | 3300031824 | Bacteria | 5083 |
| 470 | Ga0307413_10025791 | 3300031824 | Bacteria | 3228 |
| 471 | Ga0307413_10034510 | 3300031824 | Bacteria | 2892 |
| 472 | Ga0307413_10081440 | 3300031824 | Bacteria | 2075 |
| 473 | Ga0307413_10097484 | 3300031824 | Bacteria | 1933 |
| 474 | Ga0307413_10118621 | 3300031824 | Bacteria | 1787 |
| 475 | Ga0307413_10221061 | 3300031824 | Bacteria | 1384 |
| 476 | Ga0307413_10231476 | 3300031824 | Bacteria | 1357 |
| 477 | Ga0307413_10260493 | 3300031824 | Bacteria | 1292 |
| 478 | Ga0307413_10322469 | 3300031824 | Bacteria | 1180 |
| 479 | Ga0307413_10350035 | 3300031824 | Bacteria | 1140 |
| 480 | Ga0307413_10463325 | 3300031824 | Bacteria | 1009 |
| 481 | Ga0307413_10465328 | 3300031824 | Bacteria | 1007 |
| 482 | Ga0307413_10475481 | 3300031824 | Bacteria | 997 |
| 483 | Ga0307413_10751672 | 3300031824 | Bacteria | 815 |
| 484 | Ga0307410_10005506 | 3300031852 | Bacteria | 6711 |
| 485 | Ga0307410_10007693 | 3300031852 | Bacteria | 5914 |
| 486 | Ga0307410_10013669 | 3300031852 | Bacteria | 4745 |
| 487 | Ga0307410_10017712 | 3300031852 | Bacteria | 4285 |
| 488 | Ga0307410_10026046 | 3300031852 | Bacteria | 3676 |
| 489 | Ga0307410_10036408 | 3300031852 | Bacteria | 3205 |
| 490 | Ga0307410_10041689 | 3300031852 | Bacteria | 3028 |
| 491 | Ga0307410_10110856 | 3300031852 | Bacteria | 1985 |
| 492 | Ga0307410_10114126 | 3300031852 | Bacteria | 1960 |
| 493 | Ga0307410_10116087 | 3300031852 | Bacteria | 1944 |
| 494 | Ga0307410_10205933 | 3300031852 | Bacteria | 1505 |
| 495 | Ga0307406_10000523 | 3300031901 | Bacteria | 22089 |
| 496 | Ga0307406_10001368 | 3300031901 | Bacteria | 13620 |
| 497 | Ga0307406_10071678 | 3300031901 | Bacteria | 2271 |
| 498 | Ga0307406_10145510 | 3300031901 | Bacteria | 1683 |
| 499 | Ga0307406_10210604 | 3300031901 | Bacteria | 1438 |
| 500 | Ga0307406_10229518 | 3300031901 | Bacteria | 1385 |
| 501 | Ga0307406_10235661 | 3300031901 | Bacteria | 1369 |
| 502 | Ga0307406_10716201 | 3300031901 | Bacteria | 837 |
| 503 | Ga0307406_10825586 | 3300031901 | Bacteria | 784 |
| 504 | Ga0307407_10000814 | 3300031903 | Bacteria | 10352 |
| 505 | Ga0307407_10018509 | 3300031903 | Bacteria | 3524 |
| 506 | Ga0307407_10021922 | 3300031903 | Bacteria | 3304 |
| 507 | Ga0307407_10024118 | 3300031903 | Bacteria | 3185 |
| 508 | Ga0307407_10033008 | 3300031903 | Bacteria | 2820 |
| 509 | Ga0307407_10087002 | 3300031903 | Bacteria | 1905 |
| 510 | Ga0307407_10332131 | 3300031903 | Bacteria | 1070 |
| 511 | Ga0307407_10340207 | 3300031903 | Bacteria | 1059 |
| 512 | Ga0307407_10489475 | 3300031903 | Bacteria | 900 |
| 513 | Ga0307412_10010517 | 3300031911 | Bacteria | 5331 |
| 514 | Ga0307412_10010903 | 3300031911 | Bacteria | 5247 |
| 515 | Ga0307412_10062207 | 3300031911 | Bacteria | 2512 |
| 516 | Ga0307412_10071009 | 3300031911 | Bacteria | 2375 |
| 517 | Ga0307412_10178792 | 3300031911 | Bacteria | 1593 |
| 518 | Ga0307412_10449298 | 3300031911 | Bacteria | 1061 |
| 519 | Ga0307412_10502027 | 3300031911 | Bacteria | 1010 |
| 520 | Ga0307412_10659750 | 3300031911 | Bacteria | 893 |
| 521 | Ga0307409_100009090 | 3300031995 | Bacteria | 6082 |
| 522 | Ga0307409_100012827 | 3300031995 | Bacteria | 5359 |
| 523 | Ga0307409_100079565 | 3300031995 | Bacteria | 2642 |
| 524 | Ga0307409_100104456 | 3300031995 | Bacteria | 2359 |
| 525 | Ga0307409_100123379 | 3300031995 | Bacteria | 2198 |
| 526 | Ga0307409_100206648 | 3300031995 | Bacteria | 1761 |
| 527 | Ga0307409_100214432 | 3300031995 | Bacteria | 1733 |
| 528 | Ga0307409_100247234 | 3300031995 | Bacteria | 1628 |
| 529 | Ga0307409_100266862 | 3300031995 | Bacteria | 1574 |
| 530 | Ga0307409_100394702 | 3300031995 | Bacteria | 1319 |
| 531 | Ga0307409_100613971 | 3300031995 | Bacteria | 1076 |
| 532 | Ga0307409_100877112 | 3300031995 | Bacteria | 909 |
| 533 | Ga0307416_100001639 | 3300032002 | Bacteria | 12337 |
| 534 | Ga0307416_100014618 | 3300032002 | Bacteria | 5389 |
| 535 | Ga0307416_100017219 | 3300032002 | Bacteria | 5048 |
| 536 | Ga0307416_100018157 | 3300032002 | Bacteria | 4947 |
| 537 | Ga0307416_100031150 | 3300032002 | Bacteria | 4011 |
| 538 | Ga0307416_100048679 | 3300032002 | Bacteria | 3365 |
| 539 | Ga0307416_100074232 | 3300032002 | Bacteria | 2840 |
| 540 | Ga0307416_100122060 | 3300032002 | Bacteria | 2324 |
| 541 | Ga0307416_100134389 | 3300032002 | Bacteria | 2234 |
| 542 | Ga0307416_100223030 | 3300032002 | Bacteria | 1810 |
| 543 | Ga0307416_100304822 | 3300032002 | Bacteria | 1585 |
| 544 | Ga0307416_100356101 | 3300032002 | Bacteria | 1483 |
| 545 | Ga0307414_10014422 | 3300032004 | Bacteria | 4737 |
| 546 | Ga0307414_10016835 | 3300032004 | Bacteria | 4458 |
| 547 | Ga0307414_10024468 | 3300032004 | Bacteria | 3851 |
| 548 | Ga0307414_10031029 | 3300032004 | Bacteria | 3499 |
| 549 | Ga0307414_10060866 | 3300032004 | Bacteria | 2672 |
| 550 | Ga0307414_10119321 | 3300032004 | Bacteria | 2024 |
| 551 | Ga0307414_10160130 | 3300032004 | Bacteria | 1787 |
| 552 | Ga0307414_10549596 | 3300032004 | Bacteria | 1029 |
| 553 | Ga0307414_10672160 | 3300032004 | Bacteria | 935 |
| 554 | Ga0307411_10004589 | 3300032005 | Bacteria | 6644 |
| 555 | Ga0307411_10005459 | 3300032005 | Bacteria | 6247 |
| 556 | Ga0307411_10020201 | 3300032005 | Bacteria | 3868 |
| 557 | Ga0307411_10058897 | 3300032005 | Bacteria | 2544 |
| 558 | Ga0307411_10059480 | 3300032005 | Bacteria | 2533 |
| 559 | Ga0307411_10071528 | 3300032005 | Bacteria | 2351 |
| 560 | Ga0307411_10108767 | 3300032005 | Bacteria | 1978 |
| 561 | Ga0307411_10122193 | 3300032005 | Bacteria | 1886 |
| 562 | Ga0307411_10152829 | 3300032005 | Bacteria | 1717 |
| 563 | Ga0307411_10529685 | 3300032005 | Bacteria | 1002 |
| 564 | Ga0307411_10541625 | 3300032005 | Bacteria | 991 |
| 565 | Ga0307411_10735522 | 3300032005 | Bacteria | 863 |
| 566 | Ga0307411_10957267 | 3300032005 | Bacteria | 764 |
| 567 | Ga0307411_10969951 | 3300032005 | Bacteria | 759 |
| 568 | Ga0307415_100002442 | 3300032126 | Bacteria | 9278 |
| 569 | Ga0307415_100003563 | 3300032126 | Bacteria | 7947 |
| 570 | Ga0307415_100012546 | 3300032126 | Bacteria | 4904 |
| 571 | Ga0307415_100016775 | 3300032126 | Bacteria | 4375 |
| 572 | Ga0307415_100024800 | 3300032126 | Bacteria | 3753 |
| 573 | Ga0307415_100028792 | 3300032126 | Bacteria | 3540 |
| 574 | Ga0307415_100030405 | 3300032126 | Bacteria | 3466 |
| 575 | Ga0307415_100063805 | 3300032126 | Bacteria | 2561 |
| 576 | Ga0307415_100070851 | 3300032126 | Bacteria | 2449 |
| 577 | Ga0307415_100379944 | 3300032126 | Bacteria | 1199 |
| 578 | Ga0307415_100468052 | 3300032126 | Bacteria | 1094 |
| 579 | Ga0307415_100797379 | 3300032126 | Bacteria | 862 |
| 580 | Ga0373958_0089911 | 3300034819 | Bacteria | 707 |
| 581 | Ga0373928_0050061 | 3300035084 | Bacteria | 984 |
| 582 | Ga0373928_0120553 | 3300035084 | Bacteria | 703 |
| 583 | Ga0373951_0106311 | 3300035091 | Bacteria | 751 |
| 584 | Ga0373923_0362800 | 3300035111 | Bacteria | 693 |
| 585 | Ga0373941_0063875 | 3300035115 | Bacteria | 1205 |
| 586 | Ga0373941_0070119 | 3300035115 | Bacteria | 1162 |
| 587 | Ga0373943_0094195 | 3300035170 | Bacteria | 1556 |
| 588 | Ga0373961_0104894 | 3300035241 | Bacteria | 919 |
| 589 | Ga0395899_0036186 | 3300037312 | Bacteria | 3704 |
| 590 | Ga0395900_0003419 | 3300037418 | Bacteria | 17161 |
| 591 | Ga0395905_0000264 | 3300037471 | Bacteria | 78482 |
| 592 | Ga0395905_1358327 | 3300037471 | Bacteria | 614 |
| 593 | Ga0436364_1355465 | 3300037853 | Bacteria | 2153 |
| 594 | Ga0395901_0001944 | 3300038443 | Bacteria | 21267 |
| 595 | Ga0395901_0910658 | 3300038443 | Bacteria | 861 |
| 596 | Ga0436363_1437196 | 3300039450 | Bacteria | 2116 |
| 597 | Ga0439461_0003028 | 3300041410 | Bacteria | 2738 |
| 598 | Ga0439461_0022542 | 3300041410 | Bacteria | 1262 |
| 599 | Ga0439466_0010268 | 3300041411 | Bacteria | 3480 |
| 600 | Ga0439466_0020018 | 3300041411 | Bacteria | 2390 |
| 601 | Ga0439465_0013937 | 3300041413 | Bacteria | 2503 |
| 602 | Ga0439465_0017737 | 3300041413 | Bacteria | 2224 |
| 603 | Ga0451789_0438445 | 3300041443 | Bacteria | 1299 |
| 604 | Ga0451793_0490399 | 3300041452 | Bacteria | 1168 |
| 605 | Ga0451795_1314229 | 3300041456 | Bacteria | 2228 |
| 606 | Ga0451853_1173337 | 3300041512 | Bacteria | 849 |
| 607 | Ga0439431_0003474 | 3300041997 | Bacteria | 3472 |
| 608 | Ga0439442_005766 | 3300042002 | Bacteria | 2479 |
| 609 | Ga0439445_0014926 | 3300042004 | Bacteria | 1897 |
| 610 | Ga0439432_008671 | 3300042006 | Bacteria | 3565 |
| 611 | Ga0439432_047355 | 3300042006 | Bacteria | 1349 |
| 612 | Ga0439449_0019998 | 3300042007 | Bacteria | 2510 |
| 613 | Ga0439450_063318 | 3300042008 | Bacteria | 897 |
| 614 | Ga0439434_0004459 | 3300042435 | Bacteria | 4093 |
| 615 | Ga0439435_0086491 | 3300042436 | Bacteria | 947 |
| 616 | Ga0466972_0008599 | 3300044658 | Bacteria | 5121 |
| 617 | Ga0466965_0000697 | 3300044683 | Bacteria | 12460 |
| 618 | Ga0466965_0002661 | 3300044683 | Bacteria | 7643 |
| 619 | Ga0466965_0010558 | 3300044683 | Bacteria | 4314 |
| 620 | Ga0466965_0010937 | 3300044683 | Bacteria | 4243 |
| 621 | Ga0466965_0443488 | 3300044683 | Bacteria | 722 |
| 622 | Ga0466966_0001218 | 3300044684 | Bacteria | 16526 |
| 623 | Ga0466966_0015177 | 3300044684 | Bacteria | 5096 |
| 624 | Ga0466966_0409876 | 3300044684 | Bacteria | 814 |
| 625 | Ga0466963_0130110 | 3300044694 | Bacteria | 1738 |
| 626 | Ga0466964_0063071 | 3300044706 | Bacteria | 1547 |
| 627 | Ga0466964_0236617 | 3300044706 | Bacteria | 894 |
| 628 | Ga0466971_0013054 | 3300044719 | Bacteria | 3644 |
| 629 | Ga0466971_0073472 | 3300044719 | Bacteria | 1554 |
| 630 | Ga0466968_0001182 | 3300044735 | Bacteria | 9248 |
| 631 | Ga0466968_0004379 | 3300044735 | Bacteria | 5273 |
| 632 | Ga0466968_0039699 | 3300044735 | Bacteria | 1982 |
| 633 | Ga0466970_0014558 | 3300044765 | Bacteria | 4040 |
| 634 | Ga0466957_0003667 | 3300044842 | Bacteria | 8475 |
| 635 | Ga0466957_0017396 | 3300044842 | Bacteria | 4209 |
| 636 | Ga0466957_0066183 | 3300044842 | Bacteria | 2227 |
| 637 | Ga0466960_0000319 | 3300044901 | Bacteria | 16503 |
| 638 | Ga0466960_0002911 | 3300044901 | Bacteria | 6510 |
| 639 | Ga0466960_0391295 | 3300044901 | Bacteria | 799 |
| 640 | Ga0466960_0433983 | 3300044901 | Bacteria | 761 |
| 641 | Ga0466959_0001867 | 3300045049 | Bacteria | 13243 |
| 642 | Ga0466959_0046101 | 3300045049 | Bacteria | 3208 |
| 643 | Ga0466958_0003868 | 3300045836 | Bacteria | 7832 |
| 644 | Ga0466958_0064035 | 3300045836 | Bacteria | 2242 |
| 645 | Ga0466967_0037323 | 3300045976 | Bacteria | 4157 |
| 646 | Ga0466967_0138626 | 3300045976 | Bacteria | 2264 |
| 647 | Ga0466967_0153412 | 3300045976 | Bacteria | 2155 |
| 648 | Ga0466967_0278445 | 3300045976 | Bacteria | 1604 |
| 649 | Ga0466967_0942457 | 3300045976 | Bacteria | 859 |
| 650 | Ga0495603_0197105 | 3300046455 | Bacteria | 1164 |
| 651 | Ga0495629_0044588 | 3300046459 | Bacteria | 3112 |
| 652 | Ga0495638_0014063 | 3300046460 | Bacteria | 5422 |
| 653 | Ga0495641_0389118 | 3300046461 | Bacteria | 632 |
| 654 | Ga0495582_0117284 | 3300046473 | Bacteria | 1498 |
| 655 | Ga0495583_0029855 | 3300046506 | Bacteria | 2663 |
| 656 | Ga0495606_0027733 | 3300046507 | Bacteria | 4009 |
| 657 | Ga0495616_0108020 | 3300046513 | Bacteria | 1296 |
| 658 | Ga0495620_0069298 | 3300046515 | Bacteria | 1447 |
| 659 | Ga0495648_0015719 | 3300046524 | Bacteria | 5481 |
| 660 | Ga0495654_0017761 | 3300046530 | Bacteria | 3734 |
| 661 | Ga0495665_0091627 | 3300046531 | Bacteria | 1597 |
| 662 | Ga0495640_0074333 | 3300046533 | Bacteria | 2273 |
| 663 | Ga0495668_0034993 | 3300046616 | Bacteria | 2815 |
| 664 | Ga0495611_0133509 | 3300046648 | Bacteria | 1158 |
| 665 | Ga0495647_0034166 | 3300046681 | Bacteria | 1904 |
| 666 | Ga0495669_0133769 | 3300046684 | Bacteria | 1168 |
| 667 | Ga0495624_0019505 | 3300046690 | Bacteria | 4524 |
| 668 | Ga0495649_0062794 | 3300046694 | Bacteria | 1997 |
| 669 | Ga0495589_0261102 | 3300046794 | Bacteria | 808 |
| 670 | Ga0495581_0053343 | 3300047315 | Bacteria | 2335 |
| 671 | Ga0495674_0045891 | 3300047319 | Bacteria | 3880 |
| 672 | Ga0495674_0620515 | 3300047319 | Bacteria | 855 |
| 673 | Ga0495672_0003978 | 3300047320 | Bacteria | 12368 |
| 674 | Ga0495677_0146071 | 3300047445 | Bacteria | 909 |
| 675 | Ga0495673_0002945 | 3300047469 | Bacteria | 11483 |
| 676 | Ga0495686_0001660 | 3300047472 | Bacteria | 23180 |
| 677 | Ga0495593_0065953 | 3300047673 | Bacteria | 1887 |
| 678 | Ga0495626_0260956 | 3300048091 | Bacteria | 692 |
| 679 | Ga0496100_0000084 | 3300048903 | Bacteria | 53649 |
| 680 | Ga0496100_0001148 | 3300048903 | Bacteria | 12879 |
| 681 | Ga0496100_0001530 | 3300048903 | Bacteria | 11346 |
| 682 | Ga0496100_0019526 | 3300048903 | Bacteria | 4045 |
| 683 | Ga0496100_0035016 | 3300048903 | Bacteria | 3156 |
| 684 | Ga0496100_0058895 | 3300048903 | Bacteria | 2522 |
| 685 | Ga0496101_0000100 | 3300048904 | Bacteria | 89811 |
| 686 | Ga0496101_0000110 | 3300048904 | Bacteria | 85776 |
| 687 | Ga0496101_0001605 | 3300048904 | Bacteria | 13597 |
| 688 | Ga0496101_0007060 | 3300048904 | Bacteria | 7261 |
| 689 | Ga0496101_0179253 | 3300048904 | Bacteria | 1631 |
| 690 | Ga0496102_0000006 | 3300048905 | Bacteria | 471494 |
| 691 | Ga0496102_0001053 | 3300048905 | Bacteria | 25521 |
| 692 | Ga0496102_0002926 | 3300048905 | Bacteria | 14485 |
| 693 | Ga0496102_0008322 | 3300048905 | Bacteria | 8887 |
| 694 | Ga0496102_0031183 | 3300048905 | Bacteria | 4780 |
| 695 | Ga0496102_0125264 | 3300048905 | Bacteria | 2401 |
| 696 | Ga0496102_0150869 | 3300048905 | Bacteria | 2184 |
| 697 | Ga0496102_0307215 | 3300048905 | Bacteria | 1495 |
| 698 | Ga0496102_0391051 | 3300048905 | Bacteria | 1308 |
| 699 | Ga0496102_0921061 | 3300048905 | Bacteria | 795 |
| 700 | Ga0496103_0000006 | 3300048906 | Bacteria | 470539 |
| 701 | Ga0496103_0000400 | 3300048906 | Bacteria | 38628 |
| 702 | Ga0496103_0000504 | 3300048906 | Bacteria | 32265 |
| 703 | Ga0496103_0000700 | 3300048906 | Bacteria | 24863 |
| 704 | Ga0496103_0019049 | 3300048906 | Bacteria | 4121 |
| 705 | Ga0496103_0082546 | 3300048906 | Bacteria | 2023 |
| 706 | Ga0496103_0155241 | 3300048906 | Bacteria | 1467 |
| 707 | Ga0496103_0218275 | 3300048906 | Bacteria | 1226 |
| 708 | Ga0496104_0028678 | 3300048907 | Bacteria | 5159 |
| 709 | Ga0496104_0053659 | 3300048907 | Bacteria | 3809 |
| 710 | Ga0496104_0205494 | 3300048907 | Bacteria | 1881 |
| 711 | Ga0496104_0411711 | 3300048907 | Bacteria | 1264 |
| 712 | Ga0496105_0049850 | 3300048908 | Bacteria | 3458 |
| 713 | Ga0496105_0071224 | 3300048908 | Bacteria | 2873 |
| 714 | Ga0496106_0000164 | 3300048909 | Bacteria | 47996 |
| 715 | Ga0496106_0000616 | 3300048909 | Bacteria | 25450 |
| 716 | Ga0496106_0011222 | 3300048909 | Bacteria | 6630 |
| 717 | Ga0496106_0249619 | 3300048909 | Bacteria | 1418 |
| 718 | Ga0496107_0000317 | 3300048910 | Bacteria | 26084 |
| 719 | Ga0496107_0010183 | 3300048910 | Bacteria | 6522 |
| 720 | Ga0496107_0037972 | 3300048910 | Bacteria | 3457 |
| 721 | Ga0496107_0059589 | 3300048910 | Bacteria | 2762 |
| 722 | Ga0496107_0077210 | 3300048910 | Bacteria | 2426 |
| 723 | Ga0496107_0103065 | 3300048910 | Bacteria | 2093 |
| 724 | Ga0496108_0030263 | 3300048911 | Bacteria | 4487 |
| 725 | Ga0496108_0038048 | 3300048911 | Bacteria | 4008 |
| 726 | Ga0496108_0124182 | 3300048911 | Bacteria | 2215 |
| 727 | Ga0496109_0000356 | 3300048912 | Bacteria | 42608 |
| 728 | Ga0496109_0002673 | 3300048912 | Bacteria | 14964 |
| 729 | Ga0496109_0070109 | 3300048912 | Bacteria | 3216 |
| 730 | Ga0496110_0009262 | 3300048913 | Bacteria | 7960 |
| 731 | Ga0496110_0129909 | 3300048913 | Bacteria | 2274 |
| 732 | Ga0496110_0308494 | 3300048913 | Bacteria | 1441 |
| 733 | Ga0496110_1169212 | 3300048913 | Bacteria | 678 |
| 734 | Ga0496112_0012895 | 3300048915 | Bacteria | 7697 |
| 735 | Ga0496112_0021751 | 3300048915 | Bacteria | 6102 |
| 736 | Ga0496112_0063898 | 3300048915 | Bacteria | 3631 |
| 737 | Ga0496112_0338250 | 3300048915 | Bacteria | 1449 |
| 738 | Ga0496112_1113983 | 3300048915 | Bacteria | 707 |
| 739 | Ga0496113_0003931 | 3300048916 | Bacteria | 9016 |
| 740 | Ga0496113_0080931 | 3300048916 | Bacteria | 2489 |
| 741 | Ga0496113_0618937 | 3300048916 | Bacteria | 867 |
| 742 | Ga0496114_0000164 | 3300048917 | Bacteria | 47093 |
| 743 | Ga0496114_0000522 | 3300048917 | Bacteria | 28253 |
| 744 | Ga0496114_0013077 | 3300048917 | Bacteria | 6649 |
| 745 | Ga0496114_0417475 | 3300048917 | Bacteria | 1188 |
| 746 | Ga0496114_0473451 | 3300048917 | Bacteria | 1108 |
| 747 | Ga0496114_0642905 | 3300048917 | Bacteria | 933 |
| 748 | Ga0496115_0002348 | 3300048918 | Bacteria | 13572 |
| 749 | Ga0496115_0111016 | 3300048918 | Bacteria | 2253 |
| 750 | Ga0496115_0128006 | 3300048918 | Bacteria | 2092 |
| 751 | Ga0496116_0000025 | 3300048919 | Bacteria | 470539 |
| 752 | Ga0496116_0002215 | 3300048919 | Bacteria | 20684 |
| 753 | Ga0496116_0065239 | 3300048919 | Bacteria | 2336 |
| 754 | Ga0496117_0000006 | 3300048920 | Bacteria | 758420 |
| 755 | Ga0496117_0001137 | 3300048920 | Bacteria | 40112 |
| 756 | Ga0496117_0042120 | 3300048920 | Bacteria | 3336 |
| 757 | Ga0496118_0000004 | 3300048921 | Bacteria | 758420 |
| 758 | Ga0496118_0001770 | 3300048921 | Bacteria | 31255 |
| 759 | Ga0496118_0008431 | 3300048921 | Bacteria | 10656 |
| 760 | Ga0496119_0000035 | 3300048922 | Bacteria | 217007 |
| 761 | Ga0496119_0004129 | 3300048922 | Bacteria | 14622 |
| 762 | Ga0496119_0053852 | 3300048922 | Bacteria | 2454 |
| 763 | Ga0496120_0000079 | 3300048923 | Bacteria | 160413 |
| 764 | Ga0496120_0017717 | 3300048923 | Bacteria | 4606 |
| 765 | Ga0496120_0021588 | 3300048923 | Bacteria | 4067 |
| 766 | Ga0496120_0187786 | 3300048923 | Bacteria | 1010 |
| 767 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 768 | Ga0496121_0000090 | 3300048924 | Bacteria | 217920 |
| 769 | Ga0496121_0010052 | 3300048924 | Bacteria | 10737 |
| 770 | Ga0496122_0000805 | 3300048925 | Bacteria | 60172 |
| 771 | Ga0496122_0028221 | 3300048925 | Bacteria | 4771 |
| 772 | Ga0496123_0003575 | 3300048926 | Bacteria | 17241 |
| 773 | Ga0496123_0022897 | 3300048926 | Bacteria | 4798 |
| 774 | Ga0496124_0000221 | 3300048927 | Bacteria | 110879 |
| 775 | Ga0496124_0237722 | 3300048927 | Bacteria | 1357 |
| 776 | Ga0496124_0461025 | 3300048927 | Bacteria | 863 |
| 777 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 778 | Ga0496125_0102273 | 3300048928 | Bacteria | 2106 |
| 779 | Ga0496125_0130816 | 3300048928 | Bacteria | 1767 |
| 780 | Ga0496125_0194950 | 3300048928 | Bacteria | 1333 |
| 781 | Ga0496125_0382964 | 3300048928 | Bacteria | 828 |
| 782 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 783 | Ga0496126_0002186 | 3300048929 | Bacteria | 27172 |
| 784 | Ga0496126_0004091 | 3300048929 | Bacteria | 17671 |
| 785 | Ga0496126_0030158 | 3300048929 | Bacteria | 5142 |
| 786 | Ga0496126_0070861 | 3300048929 | Bacteria | 3104 |
| 787 | Ga0496126_0635962 | 3300048929 | Bacteria | 836 |
| 788 | Ga0501032_0005750 | 3300049569 | Bacteria | 9173 |
| 789 | Ga0501033_0022381 | 3300049570 | Bacteria | 4768 |
| 790 | Ga0501033_0067463 | 3300049570 | Bacteria | 2630 |
| 791 | Ga0501034_0004620 | 3300049571 | Bacteria | 15254 |
| 792 | Ga0501034_0026741 | 3300049571 | Bacteria | 5871 |
| 793 | Ga0501034_0033815 | 3300049571 | Bacteria | 5183 |
| 794 | Ga0501036_0024129 | 3300049572 | Bacteria | 5127 |
| 795 | Ga0501037_0012684 | 3300049573 | Bacteria | 6208 |
| 796 | Ga0501037_0022555 | 3300049573 | Bacteria | 4656 |
| 797 | Ga0501037_0359400 | 3300049573 | Bacteria | 1003 |
| 798 | Ga0501038_0075693 | 3300049574 | Bacteria | 2844 |
| 799 | Ga0501038_0323202 | 3300049574 | Bacteria | 1206 |
| 800 | Ga0501039_0000929 | 3300049575 | Bacteria | 21375 |
| 801 | Ga0501041_0459939 | 3300049577 | Bacteria | 808 |
| 802 | Ga0501043_0002664 | 3300049579 | Bacteria | 14997 |
| 803 | Ga0501043_0028459 | 3300049579 | Bacteria | 4387 |
| 804 | Ga0501043_0305864 | 3300049579 | Bacteria | 1214 |
| 805 | Ga0501046_0006675 | 3300049580 | Bacteria | 10192 |
| 806 | Ga0501046_0506179 | 3300049580 | Bacteria | 864 |
| 807 | Ga0501047_0009645 | 3300049581 | Bacteria | 9125 |
| 808 | Ga0501047_0048800 | 3300049581 | Bacteria | 4088 |
| 809 | Ga0501047_0663202 | 3300049581 | Bacteria | 862 |
| 810 | Ga0501048_0005296 | 3300049582 | Bacteria | 9825 |
| 811 | Ga0501069_0091425 | 3300049585 | Bacteria | 1721 |
| 812 | Ga0501070_0099994 | 3300049586 | Bacteria | 2399 |
| 813 | Ga0501070_0360519 | 3300049586 | Bacteria | 1179 |
| 814 | Ga0501073_0100401 | 3300049589 | Bacteria | 2009 |
| 815 | Ga0501074_0134330 | 3300049590 | Bacteria | 1770 |
| 816 | Ga0501076_0211520 | 3300049592 | Bacteria | 1585 |
| 817 | Ga0501224_027442 | 3300049664 | Bacteria | 852 |
| 818 | Ga0501249_044602 | 3300049679 | Bacteria | 1010 |
| 819 | Ga0501079_0323155 | 3300049741 | Bacteria | 1208 |
| 820 | Ga0501080_0083453 | 3300049742 | Bacteria | 2968 |
| 821 | Ga0501080_0307724 | 3300049742 | Bacteria | 1436 |
| 822 | Ga0501080_1156476 | 3300049742 | Bacteria | 667 |
| 823 | Ga0501273_042719 | 3300049770 | Bacteria | 675 |
| 824 | Ga0501035_0000497 | 3300049822 | Bacteria | 44253 |
| 825 | Ga0501035_0010269 | 3300049822 | Bacteria | 8686 |
| 826 | Ga0501044_0007277 | 3300049823 | Bacteria | 12164 |
| 827 | Ga0501044_0018505 | 3300049823 | Bacteria | 7463 |
| 828 | Ga0501044_0087293 | 3300049823 | Bacteria | 3151 |
| 829 | Ga0501045_0310212 | 3300049824 | Bacteria | 1174 |
| 830 | nmdc:mga03683_34821_c1 | 3300050489 | Bacteria | 2039 |
| 831 | nmdc:mga03n38_13610_c1 | 3300050490 | Bacteria | 3095 |
| 832 | nmdc:mga03n38_202559_c1 | 3300050490 | Bacteria | 1028 |
| 833 | nmdc:mga03n38_326880_c1 | 3300050490 | Bacteria | 829 |
| 834 | nmdc:mga03n38_51377_c1 | 3300050490 | Bacteria | 1840 |
| 835 | nmdc:mga03n38_62089_c1 | 3300050490 | Bacteria | 1703 |
| 836 | nmdc:mga03n38_6858_c1 | 3300050490 | Bacteria | 3992 |
| 837 | nmdc:mga00v17_20163_c1 | 3300050491 | Bacteria | 3816 |
| 838 | nmdc:mga00v17_29039_c1 | 3300050491 | Bacteria | 2862 |
| 839 | nmdc:mga00v17_38075_c1 | 3300050491 | Bacteria | 2874 |
| 840 | nmdc:mga00v17_49917_c1 | 3300050491 | Bacteria | 2540 |
| 841 | nmdc:mga00v17_59953_c1 | 3300050491 | Bacteria | 2336 |
| 842 | nmdc:mga00v17_65717_c1 | 3300050491 | Bacteria | 2238 |
| 843 | nmdc:mga0yw44_248853_c1 | 3300050492 | Bacteria | 1182 |
| 844 | nmdc:mga0yw44_2784_c1 | 3300050492 | Bacteria | 7572 |
| 845 | nmdc:mga0yw44_51206_c1 | 3300050492 | Bacteria | 2499 |
| 846 | nmdc:mga04h51_19868_c1 | 3300050495 | Bacteria | 1997 |
| 847 | nmdc:mga07m45_10687_c1 | 3300050496 | Bacteria | 4803 |
| 848 | nmdc:mga07m45_116508_c1 | 3300050496 | Bacteria | 1541 |
| 849 | nmdc:mga07m45_129740_c1 | 3300050496 | Bacteria | 1458 |
| 850 | nmdc:mga07m45_32818_c1 | 3300050496 | Bacteria | 2880 |
| 851 | nmdc:mga07m45_48555_c1 | 3300050496 | Bacteria | 2387 |
| 852 | nmdc:mga06r32_44_c3 | 3300050510 | Bacteria | 1925 |
| 853 | nmdc:mga08y16_1388746_c1 | 3300050511 | Bacteria | 666 |
| 854 | nmdc:mga0sz30_142175_c1 | 3300050516 | Bacteria | 1060 |
| 855 | nmdc:mga0sz30_190092_c1 | 3300050516 | Bacteria | 911 |
| 856 | nmdc:mga0sz30_2321_c1 | 3300050516 | Bacteria | 6793 |
| 857 | nmdc:mga0sz30_29231_c2 | 3300050516 | Bacteria | 889 |
| 858 | nmdc:mga0sz30_38966_c1 | 3300050516 | Bacteria | 1993 |
| 859 | nmdc:mga0sz30_58587_c1 | 3300050516 | Bacteria | 1642 |
| 860 | nmdc:mga0sz30_98168_c1 | 3300050516 | Bacteria | 1278 |
| 861 | Ga0500635_0037216 | 3300053080 | Bacteria | 1608 |
| 862 | Ga0495655_0048121 | 3300053083 | Bacteria | 1118 |
| 863 | Ga0500643_003561 | 3300053087 | Bacteria | 7411 |
| 864 | Ga0500650_0181540 | 3300053098 | Bacteria | 964 |
| 865 | Ga0500650_0384950 | 3300053098 | Bacteria | 609 |
| 866 | Ga0500556_0002920 | 3300053104 | Bacteria | 5180 |
| 867 | Ga0500556_0012047 | 3300053104 | Bacteria | 2573 |
| 868 | Ga0500562_120359 | 3300053108 | Bacteria | 715 |
| 869 | Ga0500628_030460 | 3300053129 | Bacteria | 1167 |
| 870 | Ga0500652_002083 | 3300053131 | Bacteria | 6013 |
| 871 | Ga0500652_029207 | 3300053131 | Bacteria | 2149 |
| 872 | Ga0500568_0081636 | 3300053139 | Bacteria | 1227 |
| 873 | Ga0500616_0007285 | 3300053153 | Bacteria | 7057 |
| 874 | Ga0500645_000490 | 3300053730 | Bacteria | 26762 |
| 875 | Ga0466962_0012658 | 3300061719 | Bacteria | 4059 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_1358327 | Ga0395905_1358327_74_586 | 164 |
| 2 | 3300042006 | Ga0439432_047355 | Ga0439432_047355_44_556 | 164 |
| 3 | 3300025321 | Ga0207656_10099283 | Ga0207656_100992832 | 174 |
| 4 | 3300005330 | Ga0070690_100155322 | Ga0070690_1001553222 | 178 |
| 5 | 3300005334 | Ga0068869_100129571 | Ga0068869_1001295712 | 178 |
| 6 | 3300005340 | Ga0070689_100026826 | Ga0070689_1000268263 | 178 |
| 7 | 3300005354 | Ga0070675_100161598 | Ga0070675_1001615982 | 178 |
| 8 | 3300005364 | Ga0070673_100188383 | Ga0070673_1001883832 | 178 |
| 9 | 3300005365 | Ga0070688_100257131 | Ga0070688_1002571312 | 178 |
| 10 | 3300005440 | Ga0070705_100113172 | Ga0070705_1001131722 | 178 |
| 11 | 3300005459 | Ga0068867_100010852 | Ga0068867_1000108522 | 178 |
| 12 | 3300005544 | Ga0070686_100081996 | Ga0070686_1000819962 | 178 |
| 13 | 3300005618 | Ga0068864_100040080 | Ga0068864_1000400804 | 178 |
| 14 | 3300005843 | Ga0068860_100049084 | Ga0068860_1000490841 | 178 |
| 15 | 3300006237 | Ga0097621_100014593 | Ga0097621_1000145938 | 178 |
| 16 | 3300049592 | Ga0501076_0211520 | Ga0501076_0211520_822_1412 | 178 |
| 17 | 3300049824 | Ga0501045_0310212 | Ga0501045_0310212_211_801 | 178 |
| 18 | 3300009174 | Ga0105241_11289172 | Ga0105241_112891721 | 179 |
| 19 | 3300005331 | Ga0070670_100199219 | Ga0070670_1001992191 | 181 |
| 20 | 3300005338 | Ga0068868_100681562 | Ga0068868_1006815622 | 181 |
| 21 | 3300005340 | Ga0070689_100969405 | Ga0070689_1009694051 | 181 |
| 22 | 3300005355 | Ga0070671_100086014 | Ga0070671_1000860143 | 181 |
| 23 | 3300005356 | Ga0070674_100309703 | Ga0070674_1003097032 | 181 |
| 24 | 3300005365 | Ga0070688_100720532 | Ga0070688_1007205321 | 181 |
| 25 | 3300005406 | Ga0070703_10308729 | Ga0070703_103087291 | 181 |
| 26 | 3300005456 | Ga0070678_100137249 | Ga0070678_1001372492 | 181 |
| 27 | 3300005459 | Ga0068867_100173347 | Ga0068867_1001733472 | 181 |
| 28 | 3300005548 | Ga0070665_100432064 | Ga0070665_1004320642 | 181 |
| 29 | 3300005578 | Ga0068854_100931624 | Ga0068854_1009316241 | 181 |
| 30 | 3300005618 | Ga0068864_100008552 | Ga0068864_1000085523 | 181 |
| 31 | 3300005719 | Ga0068861_100218434 | Ga0068861_1002184342 | 181 |
| 32 | 3300005840 | Ga0068870_10496446 | Ga0068870_104964462 | 181 |
| 33 | 3300005841 | Ga0068863_100027751 | Ga0068863_1000277515 | 181 |
| 34 | 3300005841 | Ga0068863_100029840 | Ga0068863_1000298402 | 181 |
| 35 | 3300005841 | Ga0068863_101003205 | Ga0068863_1010032051 | 181 |
| 36 | 3300005842 | Ga0068858_100074042 | Ga0068858_1000740422 | 181 |
| 37 | 3300005843 | Ga0068860_100283471 | Ga0068860_1002834712 | 181 |
| 38 | 3300005844 | Ga0068862_100081482 | Ga0068862_1000814823 | 181 |
| 39 | 3300006358 | Ga0068871_100003130 | Ga0068871_1000031308 | 181 |
| 40 | 3300006358 | Ga0068871_100007688 | Ga0068871_1000076888 | 181 |
| 41 | 3300006844 | Ga0075428_100138818 | Ga0075428_1001388183 | 181 |
| 42 | 3300006881 | Ga0068865_100063301 | Ga0068865_1000633013 | 181 |
| 43 | 3300009148 | Ga0105243_10035567 | Ga0105243_100355674 | 181 |
| 44 | 3300009177 | Ga0105248_10271166 | Ga0105248_102711662 | 181 |
| 45 | 3300013306 | Ga0163162_10028905 | Ga0163162_100289052 | 181 |
| 46 | 3300013308 | Ga0157375_10126472 | Ga0157375_101264722 | 181 |
| 47 | 3300013308 | Ga0157375_10294174 | Ga0157375_102941741 | 181 |
| 48 | 3300014325 | Ga0163163_10082758 | Ga0163163_100827583 | 181 |
| 49 | 3300014326 | Ga0157380_10119722 | Ga0157380_101197222 | 181 |
| 50 | 3300014968 | Ga0157379_10215345 | Ga0157379_102153452 | 181 |
| 51 | 3300014968 | Ga0157379_10374241 | Ga0157379_103742412 | 181 |
| 52 | 3300014969 | Ga0157376_10006456 | Ga0157376_100064566 | 181 |
| 53 | 3300014969 | Ga0157376_10160680 | Ga0157376_101606802 | 181 |
| 54 | 3300017792 | Ga0163161_10015854 | Ga0163161_100158547 | 181 |
| 55 | 3300025903 | Ga0207680_10130307 | Ga0207680_101303072 | 181 |
| 56 | 3300025923 | Ga0207681_10385135 | Ga0207681_103851351 | 181 |
| 57 | 3300025925 | Ga0207650_10020180 | Ga0207650_100201802 | 181 |
| 58 | 3300025925 | Ga0207650_10180221 | Ga0207650_101802212 | 181 |
| 59 | 3300025926 | Ga0207659_10113079 | Ga0207659_101130793 | 181 |
| 60 | 3300025931 | Ga0207644_10092085 | Ga0207644_100920853 | 181 |
| 61 | 3300025935 | Ga0207709_10312495 | Ga0207709_103124952 | 181 |
| 62 | 3300025936 | Ga0207670_10477067 | Ga0207670_104770672 | 181 |
| 63 | 3300025938 | Ga0207704_10030692 | Ga0207704_100306922 | 181 |
| 64 | 3300025941 | Ga0207711_10090865 | Ga0207711_100908652 | 181 |
| 65 | 3300025942 | Ga0207689_10115900 | Ga0207689_101159002 | 181 |
| 66 | 3300026035 | Ga0207703_10251707 | Ga0207703_102517072 | 181 |
| 67 | 3300026075 | Ga0207708_10013446 | Ga0207708_100134468 | 181 |
| 68 | 3300026088 | Ga0207641_10006938 | Ga0207641_100069388 | 181 |
| 69 | 3300026088 | Ga0207641_10027685 | Ga0207641_100276853 | 181 |
| 70 | 3300026088 | Ga0207641_10190822 | Ga0207641_101908221 | 181 |
| 71 | 3300026089 | Ga0207648_10169747 | Ga0207648_101697472 | 181 |
| 72 | 3300026095 | Ga0207676_10034004 | Ga0207676_100340043 | 181 |
| 73 | 3300026095 | Ga0207676_10057880 | Ga0207676_100578802 | 181 |
| 74 | 3300026095 | Ga0207676_10122826 | Ga0207676_101228262 | 181 |
| 75 | 3300026118 | Ga0207675_100200892 | Ga0207675_1002008922 | 181 |
| 76 | 3300026121 | Ga0207683_10050483 | Ga0207683_100504834 | 181 |
| 77 | 3300028381 | Ga0268264_10034902 | Ga0268264_100349023 | 181 |
| 78 | 3300028381 | Ga0268264_10057589 | Ga0268264_100575893 | 181 |
| 79 | 3300006163 | Ga0070715_10322756 | Ga0070715_103227562 | 182 |
| 80 | 3300005436 | Ga0070713_100095738 | Ga0070713_1000957382 | 185 |
| 81 | 3300005437 | Ga0070710_10033713 | Ga0070710_100337131 | 185 |
| 82 | 3300006028 | Ga0070717_10489261 | Ga0070717_104892612 | 185 |
| 83 | 3300006173 | Ga0070716_100284764 | Ga0070716_1002847641 | 185 |
| 84 | 3300006175 | Ga0070712_100891951 | Ga0070712_1008919511 | 185 |
| 85 | 3300025898 | Ga0207692_10154899 | Ga0207692_101548992 | 185 |
| 86 | 3300025914 | Ga0207671_10326293 | Ga0207671_103262931 | 185 |
| 87 | 3300025939 | Ga0207665_10333124 | Ga0207665_103331241 | 185 |
| 88 | 3300027876 | Ga0209974_10077241 | Ga0209974_100772412 | 185 |
| 89 | 3300039450 | Ga0436363_1437196 | Ga0436363_1437196_181_738 | 185 |
| 90 | 3300053131 | Ga0500652_002083 | Ga0500652_002083_1810_2367 | 185 |
| 91 | 3300001989 | JGI24739J22299_10083003 | JGI24739J22299_100830032 | 186 |
| 92 | 3300005331 | Ga0070670_100212651 | Ga0070670_1002126513 | 186 |
| 93 | 3300005333 | Ga0070677_10004991 | Ga0070677_100049913 | 186 |
| 94 | 3300005347 | Ga0070668_100156989 | Ga0070668_1001569891 | 186 |
| 95 | 3300005353 | Ga0070669_100007711 | Ga0070669_1000077117 | 186 |
| 96 | 3300005353 | Ga0070669_100300805 | Ga0070669_1003008051 | 186 |
| 97 | 3300005353 | Ga0070669_100649322 | Ga0070669_1006493222 | 186 |
| 98 | 3300005355 | Ga0070671_100085812 | Ga0070671_1000858122 | 186 |
| 99 | 3300005364 | Ga0070673_100005957 | Ga0070673_1000059572 | 186 |
| 100 | 3300005364 | Ga0070673_100203191 | Ga0070673_1002031912 | 186 |
| 101 | 3300005366 | Ga0070659_100068613 | Ga0070659_1000686133 | 186 |
| 102 | 3300005459 | Ga0068867_100579427 | Ga0068867_1005794271 | 186 |
| 103 | 3300005564 | Ga0070664_100061616 | Ga0070664_1000616162 | 186 |
| 104 | 3300005577 | Ga0068857_100794198 | Ga0068857_1007941982 | 186 |
| 105 | 3300005617 | Ga0068859_100577187 | Ga0068859_1005771873 | 186 |
| 106 | 3300005844 | Ga0068862_100008978 | Ga0068862_1000089783 | 186 |
| 107 | 3300005844 | Ga0068862_100083623 | Ga0068862_1000836233 | 186 |
| 108 | 3300006844 | Ga0075428_100101443 | Ga0075428_1001014434 | 186 |
| 109 | 3300006931 | Ga0097620_100577195 | Ga0097620_1005771953 | 186 |
| 110 | 3300007788 | Ga0099795_10039323 | Ga0099795_100393232 | 186 |
| 111 | 3300009092 | Ga0105250_10194592 | Ga0105250_101945921 | 186 |
| 112 | 3300009098 | Ga0105245_10059620 | Ga0105245_100596205 | 186 |
| 113 | 3300009101 | Ga0105247_10183557 | Ga0105247_101835572 | 186 |
| 114 | 3300009148 | Ga0105243_10045903 | Ga0105243_100459034 | 186 |
| 115 | 3300009174 | Ga0105241_10399990 | Ga0105241_103999902 | 186 |
| 116 | 3300009545 | Ga0105237_10336453 | Ga0105237_103364532 | 186 |
| 117 | 3300009545 | Ga0105237_10942392 | Ga0105237_109423922 | 186 |
| 118 | 3300009551 | Ga0105238_10022028 | Ga0105238_100220282 | 186 |
| 119 | 3300009553 | Ga0105249_10322643 | Ga0105249_103226432 | 186 |
| 120 | 3300009553 | Ga0105249_11317480 | Ga0105249_113174802 | 186 |
| 121 | 3300010159 | Ga0099796_10114238 | Ga0099796_101142382 | 186 |
| 122 | 3300013296 | Ga0157374_10032490 | Ga0157374_100324906 | 186 |
| 123 | 3300013297 | Ga0157378_10088440 | Ga0157378_100884403 | 186 |
| 124 | 3300013306 | Ga0163162_10006550 | Ga0163162_1000655015 | 186 |
| 125 | 3300014326 | Ga0157380_10060027 | Ga0157380_100600272 | 186 |
| 126 | 3300014969 | Ga0157376_10168266 | Ga0157376_101682662 | 186 |
| 127 | 3300025893 | Ga0207682_10113439 | Ga0207682_101134392 | 186 |
| 128 | 3300025901 | Ga0207688_10113743 | Ga0207688_101137432 | 186 |
| 129 | 3300025915 | Ga0207693_10179300 | Ga0207693_101793003 | 186 |
| 130 | 3300025923 | Ga0207681_10117074 | Ga0207681_101170742 | 186 |
| 131 | 3300025923 | Ga0207681_10149310 | Ga0207681_101493102 | 186 |
| 132 | 3300025923 | Ga0207681_10508799 | Ga0207681_105087992 | 186 |
| 133 | 3300025925 | Ga0207650_10000200 | Ga0207650_1000020029 | 186 |
| 134 | 3300025926 | Ga0207659_10596413 | Ga0207659_105964132 | 186 |
| 135 | 3300025931 | Ga0207644_10323274 | Ga0207644_103232742 | 186 |
| 136 | 3300025933 | Ga0207706_10043370 | Ga0207706_100433702 | 186 |
| 137 | 3300025933 | Ga0207706_10060092 | Ga0207706_100600923 | 186 |
| 138 | 3300025945 | Ga0207679_10337134 | Ga0207679_103371342 | 186 |
| 139 | 3300025960 | Ga0207651_10152246 | Ga0207651_101522462 | 186 |
| 140 | 3300025972 | Ga0207668_10577558 | Ga0207668_105775582 | 186 |
| 141 | 3300026041 | Ga0207639_10154710 | Ga0207639_101547102 | 186 |
| 142 | 3300026089 | Ga0207648_10592173 | Ga0207648_105921732 | 186 |
| 143 | 3300026095 | Ga0207676_10642776 | Ga0207676_106427761 | 186 |
| 144 | 3300027665 | Ga0209983_1037523 | Ga0209983_10375232 | 186 |
| 145 | 3300027876 | Ga0209974_10001606 | Ga0209974_100016066 | 186 |
| 146 | 3300027876 | Ga0209974_10060232 | Ga0209974_100602322 | 186 |
| 147 | 3300028380 | Ga0268265_10003531 | Ga0268265_100035319 | 186 |
| 148 | 3300028381 | Ga0268264_10469849 | Ga0268264_104698491 | 186 |
| 149 | 3300031548 | Ga0307408_100027291 | Ga0307408_1000272913 | 186 |
| 150 | 3300031548 | Ga0307408_100033296 | Ga0307408_1000332964 | 186 |
| 151 | 3300031548 | Ga0307408_100035312 | Ga0307408_1000353122 | 186 |
| 152 | 3300031548 | Ga0307408_100042286 | Ga0307408_1000422862 | 186 |
| 153 | 3300031548 | Ga0307408_100310639 | Ga0307408_1003106392 | 186 |
| 154 | 3300031731 | Ga0307405_10007163 | Ga0307405_100071633 | 186 |
| 155 | 3300031731 | Ga0307405_10019495 | Ga0307405_100194957 | 186 |
| 156 | 3300031731 | Ga0307405_10028387 | Ga0307405_100283871 | 186 |
| 157 | 3300031731 | Ga0307405_10032703 | Ga0307405_100327032 | 186 |
| 158 | 3300031731 | Ga0307405_10115560 | Ga0307405_101155602 | 186 |
| 159 | 3300031731 | Ga0307405_10150351 | Ga0307405_101503513 | 186 |
| 160 | 3300031731 | Ga0307405_10314544 | Ga0307405_103145442 | 186 |
| 161 | 3300031824 | Ga0307413_10006149 | Ga0307413_100061492 | 186 |
| 162 | 3300031824 | Ga0307413_10007453 | Ga0307413_100074535 | 186 |
| 163 | 3300031824 | Ga0307413_10025791 | Ga0307413_100257913 | 186 |
| 164 | 3300031824 | Ga0307413_10034510 | Ga0307413_100345102 | 186 |
| 165 | 3300031824 | Ga0307413_10081440 | Ga0307413_100814402 | 186 |
| 166 | 3300031824 | Ga0307413_10097484 | Ga0307413_100974842 | 186 |
| 167 | 3300031824 | Ga0307413_10118621 | Ga0307413_101186212 | 186 |
| 168 | 3300031824 | Ga0307413_10231476 | Ga0307413_102314762 | 186 |
| 169 | 3300031824 | Ga0307413_10260493 | Ga0307413_102604932 | 186 |
| 170 | 3300031824 | Ga0307413_10322469 | Ga0307413_103224692 | 186 |
| 171 | 3300031824 | Ga0307413_10463325 | Ga0307413_104633252 | 186 |
| 172 | 3300031824 | Ga0307413_10465328 | Ga0307413_104653282 | 186 |
| 173 | 3300031824 | Ga0307413_10475481 | Ga0307413_104754811 | 186 |
| 174 | 3300031852 | Ga0307410_10005506 | Ga0307410_100055066 | 186 |
| 175 | 3300031852 | Ga0307410_10007693 | Ga0307410_100076934 | 186 |
| 176 | 3300031852 | Ga0307410_10013669 | Ga0307410_100136694 | 186 |
| 177 | 3300031852 | Ga0307410_10017712 | Ga0307410_100177122 | 186 |
| 178 | 3300031852 | Ga0307410_10026046 | Ga0307410_100260462 | 186 |
| 179 | 3300031852 | Ga0307410_10036408 | Ga0307410_100364082 | 186 |
| 180 | 3300031852 | Ga0307410_10041689 | Ga0307410_100416891 | 186 |
| 181 | 3300031852 | Ga0307410_10110856 | Ga0307410_101108562 | 186 |
| 182 | 3300031852 | Ga0307410_10116087 | Ga0307410_101160872 | 186 |
| 183 | 3300031852 | Ga0307410_10205933 | Ga0307410_102059332 | 186 |
| 184 | 3300031901 | Ga0307406_10000523 | Ga0307406_1000052323 | 186 |
| 185 | 3300031901 | Ga0307406_10001368 | Ga0307406_100013685 | 186 |
| 186 | 3300031901 | Ga0307406_10145510 | Ga0307406_101455102 | 186 |
| 187 | 3300031901 | Ga0307406_10210604 | Ga0307406_102106042 | 186 |
| 188 | 3300031901 | Ga0307406_10229518 | Ga0307406_102295182 | 186 |
| 189 | 3300031901 | Ga0307406_10235661 | Ga0307406_102356612 | 186 |
| 190 | 3300031901 | Ga0307406_10716201 | Ga0307406_107162012 | 186 |
| 191 | 3300031901 | Ga0307406_10825586 | Ga0307406_108255862 | 186 |
| 192 | 3300031903 | Ga0307407_10000814 | Ga0307407_1000081410 | 186 |
| 193 | 3300031903 | Ga0307407_10018509 | Ga0307407_100185094 | 186 |
| 194 | 3300031903 | Ga0307407_10021922 | Ga0307407_100219223 | 186 |
| 195 | 3300031903 | Ga0307407_10033008 | Ga0307407_100330083 | 186 |
| 196 | 3300031903 | Ga0307407_10087002 | Ga0307407_100870021 | 186 |
| 197 | 3300031903 | Ga0307407_10332131 | Ga0307407_103321311 | 186 |
| 198 | 3300031903 | Ga0307407_10340207 | Ga0307407_103402072 | 186 |
| 199 | 3300031911 | Ga0307412_10010517 | Ga0307412_100105174 | 186 |
| 200 | 3300031911 | Ga0307412_10010903 | Ga0307412_100109034 | 186 |
| 201 | 3300031911 | Ga0307412_10062207 | Ga0307412_100622072 | 186 |
| 202 | 3300031911 | Ga0307412_10071009 | Ga0307412_100710092 | 186 |
| 203 | 3300031911 | Ga0307412_10178792 | Ga0307412_101787922 | 186 |
| 204 | 3300031911 | Ga0307412_10449298 | Ga0307412_104492982 | 186 |
| 205 | 3300031911 | Ga0307412_10659750 | Ga0307412_106597502 | 186 |
| 206 | 3300031995 | Ga0307409_100009090 | Ga0307409_1000090902 | 186 |
| 207 | 3300031995 | Ga0307409_100012827 | Ga0307409_1000128271 | 186 |
| 208 | 3300031995 | Ga0307409_100079565 | Ga0307409_1000795653 | 186 |
| 209 | 3300031995 | Ga0307409_100104456 | Ga0307409_1001044562 | 186 |
| 210 | 3300031995 | Ga0307409_100123379 | Ga0307409_1001233791 | 186 |
| 211 | 3300031995 | Ga0307409_100206648 | Ga0307409_1002066482 | 186 |
| 212 | 3300031995 | Ga0307409_100214432 | Ga0307409_1002144322 | 186 |
| 213 | 3300031995 | Ga0307409_100247234 | Ga0307409_1002472343 | 186 |
| 214 | 3300031995 | Ga0307409_100266862 | Ga0307409_1002668622 | 186 |
| 215 | 3300031995 | Ga0307409_100394702 | Ga0307409_1003947022 | 186 |
| 216 | 3300031995 | Ga0307409_100613971 | Ga0307409_1006139712 | 186 |
| 217 | 3300031995 | Ga0307409_100877112 | Ga0307409_1008771122 | 186 |
| 218 | 3300032002 | Ga0307416_100001639 | Ga0307416_1000016395 | 186 |
| 219 | 3300032002 | Ga0307416_100014618 | Ga0307416_1000146182 | 186 |
| 220 | 3300032002 | Ga0307416_100017219 | Ga0307416_1000172195 | 186 |
| 221 | 3300032002 | Ga0307416_100018157 | Ga0307416_1000181573 | 186 |
| 222 | 3300032002 | Ga0307416_100031150 | Ga0307416_1000311506 | 186 |
| 223 | 3300032002 | Ga0307416_100048679 | Ga0307416_1000486793 | 186 |
| 224 | 3300032002 | Ga0307416_100122060 | Ga0307416_1001220601 | 186 |
| 225 | 3300032002 | Ga0307416_100134389 | Ga0307416_1001343893 | 186 |
| 226 | 3300032002 | Ga0307416_100223030 | Ga0307416_1002230302 | 186 |
| 227 | 3300032002 | Ga0307416_100304822 | Ga0307416_1003048221 | 186 |
| 228 | 3300032002 | Ga0307416_100356101 | Ga0307416_1003561011 | 186 |
| 229 | 3300032004 | Ga0307414_10014422 | Ga0307414_100144224 | 186 |
| 230 | 3300032004 | Ga0307414_10016835 | Ga0307414_100168354 | 186 |
| 231 | 3300032004 | Ga0307414_10024468 | Ga0307414_100244682 | 186 |
| 232 | 3300032004 | Ga0307414_10031029 | Ga0307414_100310293 | 186 |
| 233 | 3300032004 | Ga0307414_10060866 | Ga0307414_100608663 | 186 |
| 234 | 3300032004 | Ga0307414_10119321 | Ga0307414_101193212 | 186 |
| 235 | 3300032004 | Ga0307414_10160130 | Ga0307414_101601302 | 186 |
| 236 | 3300032004 | Ga0307414_10549596 | Ga0307414_105495962 | 186 |
| 237 | 3300032004 | Ga0307414_10672160 | Ga0307414_106721602 | 186 |
| 238 | 3300032005 | Ga0307411_10004589 | Ga0307411_100045895 | 186 |
| 239 | 3300032005 | Ga0307411_10005459 | Ga0307411_100054595 | 186 |
| 240 | 3300032005 | Ga0307411_10020201 | Ga0307411_100202013 | 186 |
| 241 | 3300032005 | Ga0307411_10058897 | Ga0307411_100588973 | 186 |
| 242 | 3300032005 | Ga0307411_10059480 | Ga0307411_100594802 | 186 |
| 243 | 3300032005 | Ga0307411_10071528 | Ga0307411_100715284 | 186 |
| 244 | 3300032005 | Ga0307411_10108767 | Ga0307411_101087673 | 186 |
| 245 | 3300032005 | Ga0307411_10122193 | Ga0307411_101221933 | 186 |
| 246 | 3300032005 | Ga0307411_10152829 | Ga0307411_101528292 | 186 |
| 247 | 3300032005 | Ga0307411_10529685 | Ga0307411_105296852 | 186 |
| 248 | 3300032005 | Ga0307411_10541625 | Ga0307411_105416252 | 186 |
| 249 | 3300032005 | Ga0307411_10735522 | Ga0307411_107355221 | 186 |
| 250 | 3300032005 | Ga0307411_10969951 | Ga0307411_109699512 | 186 |
| 251 | 3300032126 | Ga0307415_100002442 | Ga0307415_1000024426 | 186 |
| 252 | 3300032126 | Ga0307415_100003563 | Ga0307415_1000035634 | 186 |
| 253 | 3300032126 | Ga0307415_100012546 | Ga0307415_1000125462 | 186 |
| 254 | 3300032126 | Ga0307415_100016775 | Ga0307415_1000167753 | 186 |
| 255 | 3300032126 | Ga0307415_100024800 | Ga0307415_1000248001 | 186 |
| 256 | 3300032126 | Ga0307415_100028792 | Ga0307415_1000287923 | 186 |
| 257 | 3300032126 | Ga0307415_100030405 | Ga0307415_1000304052 | 186 |
| 258 | 3300032126 | Ga0307415_100070851 | Ga0307415_1000708512 | 186 |
| 259 | 3300032126 | Ga0307415_100379944 | Ga0307415_1003799442 | 186 |
| 260 | 3300032126 | Ga0307415_100468052 | Ga0307415_1004680521 | 186 |
| 261 | 3300034819 | Ga0373958_0089911 | Ga0373958_0089911_48_608 | 186 |
| 262 | 3300035115 | Ga0373941_0063875 | Ga0373941_0063875_326_886 | 186 |
| 263 | 3300035241 | Ga0373961_0104894 | Ga0373961_0104894_275_835 | 186 |
| 264 | 3300037312 | Ga0395899_0036186 | Ga0395899_0036186_3108_3686 | 186 |
| 265 | 3300037418 | Ga0395900_0003419 | Ga0395900_0003419_14163_14741 | 186 |
| 266 | 3300037471 | Ga0395905_0000264 | Ga0395905_0000264_15263_15841 | 186 |
| 267 | 3300038443 | Ga0395901_0001944 | Ga0395901_0001944_17087_17665 | 186 |
| 268 | 3300038443 | Ga0395901_0910658 | Ga0395901_0910658_104_685 | 186 |
| 269 | 3300042006 | Ga0439432_008671 | Ga0439432_008671_2726_3304 | 186 |
| 270 | 3300042007 | Ga0439449_0019998 | Ga0439449_0019998_598_1176 | 186 |
| 271 | 3300046513 | Ga0495616_0108020 | Ga0495616_0108020_718_1278 | 186 |
| 272 | 3300046684 | Ga0495669_0133769 | Ga0495669_0133769_358_936 | 186 |
| 273 | 3300046794 | Ga0495589_0261102 | Ga0495589_0261102_133_693 | 186 |
| 274 | 3300047445 | Ga0495677_0146071 | Ga0495677_0146071_112_687 | 186 |
| 275 | 3300048903 | Ga0496100_0058895 | Ga0496100_0058895_1835_2395 | 186 |
| 276 | 3300048904 | Ga0496101_0179253 | Ga0496101_0179253_926_1486 | 186 |
| 277 | 3300048905 | Ga0496102_0125264 | Ga0496102_0125264_529_1089 | 186 |
| 278 | 3300048905 | Ga0496102_0921061 | Ga0496102_0921061_32_592 | 186 |
| 279 | 3300048906 | Ga0496103_0019049 | Ga0496103_0019049_947_1507 | 186 |
| 280 | 3300048906 | Ga0496103_0082546 | Ga0496103_0082546_197_778 | 186 |
| 281 | 3300048907 | Ga0496104_0205494 | Ga0496104_0205494_284_844 | 186 |
| 282 | 3300048909 | Ga0496106_0249619 | Ga0496106_0249619_392_952 | 186 |
| 283 | 3300048910 | Ga0496107_0010183 | Ga0496107_0010183_2876_3436 | 186 |
| 284 | 3300048910 | Ga0496107_0103065 | Ga0496107_0103065_1073_1654 | 186 |
| 285 | 3300048911 | Ga0496108_0038048 | Ga0496108_0038048_2422_2982 | 186 |
| 286 | 3300048912 | Ga0496109_0002673 | Ga0496109_0002673_7529_8089 | 186 |
| 287 | 3300048913 | Ga0496110_1169212 | Ga0496110_1169212_107_667 | 186 |
| 288 | 3300048915 | Ga0496112_0012895 | Ga0496112_0012895_179_739 | 186 |
| 289 | 3300048917 | Ga0496114_0642905 | Ga0496114_0642905_357_917 | 186 |
| 290 | 3300048918 | Ga0496115_0111016 | Ga0496115_0111016_383_943 | 186 |
| 291 | 3300049570 | Ga0501033_0067463 | Ga0501033_0067463_1684_2244 | 186 |
| 292 | 3300049577 | Ga0501041_0459939 | Ga0501041_0459939_31_612 | 186 |
| 293 | 3300049664 | Ga0501224_027442 | Ga0501224_027442_255_833 | 186 |
| 294 | 3300049679 | Ga0501249_044602 | Ga0501249_044602_191_769 | 186 |
| 295 | 3300049770 | Ga0501273_042719 | Ga0501273_042719_42_620 | 186 |
| 296 | iso_pu_bacteria | 2643221687 | 2644490705 | 187 |
| 297 | iso_pu_bacteria | 2643221715 | 2644636959 | 187 |
| 298 | iso_pu_bacteria | 2738541264 | 2738668353 | 187 |
| 299 | iso_pu_bacteria | 2738541274 | 2738706941 | 187 |
| 300 | iso_pu_bacteria | 2738541356 | 2739147423 | 187 |
| 301 | iso_pu_bacteria | 2738543028 | 2739333646 | 187 |
| 302 | iso_pu_bacteria | 2902799365 | 2902800573 | 187 |
| 303 | iso_pu_bacteria | 2902810491 | 2902814896 | 187 |
| 304 | iso_pu_bacteria | 2902837492 | 2902838477 | 187 |
| 305 | iso_pu_bacteria | 2929212328 | 2929217425 | 187 |
| 306 | iso_pu_bacteria | 2842134933 | 2842139267 | 188 |
| 307 | iso_pu_bacteria | 2902792274 | 2902798706 | 188 |
| 308 | iso_pu_bacteria | 2939582691 | 2939584662 | 188 |
| 309 | 3300003792 | Ga0055540_1000043 | Ga0055540_100004315 | 191 |
| 310 | 3300003792 | Ga0055540_1007851 | Ga0055540_10078512 | 191 |
| 311 | 3300005353 | Ga0070669_100135310 | Ga0070669_1001353102 | 191 |
| 312 | 3300005356 | Ga0070674_100229082 | Ga0070674_1002290822 | 191 |
| 313 | 3300005366 | Ga0070659_100967381 | Ga0070659_1009673811 | 191 |
| 314 | 3300005367 | Ga0070667_100000791 | Ga0070667_10000079125 | 191 |
| 315 | 3300005367 | Ga0070667_100013973 | Ga0070667_1000139734 | 191 |
| 316 | 3300005435 | Ga0070714_100128686 | Ga0070714_1001286863 | 191 |
| 317 | 3300005466 | Ga0070685_10032722 | Ga0070685_100327223 | 191 |
| 318 | 3300005548 | Ga0070665_100005216 | Ga0070665_10000521611 | 191 |
| 319 | 3300005578 | Ga0068854_100286875 | Ga0068854_1002868752 | 191 |
| 320 | 3300005618 | Ga0068864_101469661 | Ga0068864_1014696611 | 191 |
| 321 | 3300005841 | Ga0068863_100001025 | Ga0068863_10000102523 | 191 |
| 322 | 3300005841 | Ga0068863_100499357 | Ga0068863_1004993572 | 191 |
| 323 | 3300005842 | Ga0068858_100016818 | Ga0068858_1000168189 | 191 |
| 324 | 3300005843 | Ga0068860_100000087 | Ga0068860_10000008726 | 191 |
| 325 | 3300005844 | Ga0068862_100000077 | Ga0068862_10000007769 | 191 |
| 326 | 3300006038 | Ga0075365_10410611 | Ga0075365_104106112 | 191 |
| 327 | 3300006186 | Ga0075369_10012989 | Ga0075369_100129893 | 191 |
| 328 | 3300006186 | Ga0075369_10085533 | Ga0075369_100855332 | 191 |
| 329 | 3300006881 | Ga0068865_100512164 | Ga0068865_1005121642 | 191 |
| 330 | 3300009101 | Ga0105247_10000060 | Ga0105247_1000006070 | 191 |
| 331 | 3300009177 | Ga0105248_10000050 | Ga0105248_1000005021 | 191 |
| 332 | 3300009177 | Ga0105248_10056751 | Ga0105248_100567515 | 191 |
| 333 | 3300009545 | Ga0105237_10027144 | Ga0105237_100271447 | 191 |
| 334 | 3300009553 | Ga0105249_10000042 | Ga0105249_10000042132 | 191 |
| 335 | 3300010375 | Ga0105239_10024596 | Ga0105239_100245966 | 191 |
| 336 | 3300013308 | Ga0157375_10319953 | Ga0157375_103199532 | 191 |
| 337 | 3300014969 | Ga0157376_10296027 | Ga0157376_102960272 | 191 |
| 338 | 3300025273 | Ga0209673_1013931 | Ga0209673_10139312 | 191 |
| 339 | 3300025303 | Ga0209051_1000108 | Ga0209051_1000108147 | 191 |
| 340 | 3300025303 | Ga0209051_1000642 | Ga0209051_100064241 | 191 |
| 341 | 3300025303 | Ga0209051_1003362 | Ga0209051_10033624 | 191 |
| 342 | 3300025303 | Ga0209051_1005179 | Ga0209051_10051796 | 191 |
| 343 | 3300025900 | Ga0207710_10000010 | Ga0207710_1000001072 | 191 |
| 344 | 3300025903 | Ga0207680_10044300 | Ga0207680_100443004 | 191 |
| 345 | 3300025914 | Ga0207671_10157610 | Ga0207671_101576101 | 191 |
| 346 | 3300025923 | Ga0207681_10002155 | Ga0207681_100021554 | 191 |
| 347 | 3300025937 | Ga0207669_10528292 | Ga0207669_105282921 | 191 |
| 348 | 3300025941 | Ga0207711_10001406 | Ga0207711_1000140615 | 191 |
| 349 | 3300025941 | Ga0207711_10033441 | Ga0207711_100334412 | 191 |
| 350 | 3300025961 | Ga0207712_10000010 | Ga0207712_10000010319 | 191 |
| 351 | 3300025986 | Ga0207658_10000677 | Ga0207658_1000067725 | 191 |
| 352 | 3300025986 | Ga0207658_10001961 | Ga0207658_100019617 | 191 |
| 353 | 3300026035 | Ga0207703_10009823 | Ga0207703_1000982310 | 191 |
| 354 | 3300026067 | Ga0207678_10085821 | Ga0207678_100858212 | 191 |
| 355 | 3300026088 | Ga0207641_10000849 | Ga0207641_100008495 | 191 |
| 356 | 3300026088 | Ga0207641_10192318 | Ga0207641_101923182 | 191 |
| 357 | 3300026121 | Ga0207683_10163373 | Ga0207683_101633732 | 191 |
| 358 | 3300028379 | Ga0268266_10030548 | Ga0268266_100305484 | 191 |
| 359 | 3300028380 | Ga0268265_10000014 | Ga0268265_10000014134 | 191 |
| 360 | 3300028381 | Ga0268264_10000150 | Ga0268264_1000015025 | 191 |
| 361 | 3300028381 | Ga0268264_10527733 | Ga0268264_105277332 | 191 |
| 362 | 3300031251 | Ga0265327_10002508 | Ga0265327_100025084 | 191 |
| 363 | 3300031731 | Ga0307405_10040394 | Ga0307405_100403942 | 191 |
| 364 | 3300031824 | Ga0307413_10221061 | Ga0307413_102210612 | 191 |
| 365 | 3300031901 | Ga0307406_10071678 | Ga0307406_100716783 | 191 |
| 366 | 3300037853 | Ga0436364_1355465 | Ga0436364_1355465_490_1065 | 191 |
| 367 | 3300041410 | Ga0439461_0003028 | Ga0439461_0003028_1314_1889 | 191 |
| 368 | 3300041410 | Ga0439461_0022542 | Ga0439461_0022542_613_1188 | 191 |
| 369 | 3300041411 | Ga0439466_0010268 | Ga0439466_0010268_394_969 | 191 |
| 370 | 3300041411 | Ga0439466_0020018 | Ga0439466_0020018_883_1458 | 191 |
| 371 | 3300041413 | Ga0439465_0017737 | Ga0439465_0017737_1134_1709 | 191 |
| 372 | 3300041443 | Ga0451789_0438445 | Ga0451789_0438445_498_1073 | 191 |
| 373 | 3300041452 | Ga0451793_0490399 | Ga0451793_0490399_99_674 | 191 |
| 374 | 3300041456 | Ga0451795_1314229 | Ga0451795_1314229_1011_1586 | 191 |
| 375 | 3300041512 | Ga0451853_1173337 | Ga0451853_1173337_62_637 | 191 |
| 376 | 3300041997 | Ga0439431_0003474 | Ga0439431_0003474_1395_1970 | 191 |
| 377 | 3300042002 | Ga0439442_005766 | Ga0439442_005766_1164_1739 | 191 |
| 378 | 3300042004 | Ga0439445_0014926 | Ga0439445_0014926_160_735 | 191 |
| 379 | 3300042008 | Ga0439450_063318 | Ga0439450_063318_91_666 | 191 |
| 380 | 3300042435 | Ga0439434_0004459 | Ga0439434_0004459_815_1390 | 191 |
| 381 | 3300044683 | Ga0466965_0000697 | Ga0466965_0000697_5469_6044 | 191 |
| 382 | 3300044683 | Ga0466965_0002661 | Ga0466965_0002661_3105_3680 | 191 |
| 383 | 3300044683 | Ga0466965_0010558 | Ga0466965_0010558_3648_4223 | 191 |
| 384 | 3300044684 | Ga0466966_0001218 | Ga0466966_0001218_8197_8772 | 191 |
| 385 | 3300044684 | Ga0466966_0409876 | Ga0466966_0409876_27_602 | 191 |
| 386 | 3300044694 | Ga0466963_0130110 | Ga0466963_0130110_69_644 | 191 |
| 387 | 3300044706 | Ga0466964_0063071 | Ga0466964_0063071_715_1290 | 191 |
| 388 | 3300044719 | Ga0466971_0013054 | Ga0466971_0013054_1877_2452 | 191 |
| 389 | 3300044735 | Ga0466968_0001182 | Ga0466968_0001182_8587_9162 | 191 |
| 390 | 3300044735 | Ga0466968_0004379 | Ga0466968_0004379_2905_3480 | 191 |
| 391 | 3300044765 | Ga0466970_0014558 | Ga0466970_0014558_1405_1980 | 191 |
| 392 | 3300044842 | Ga0466957_0003667 | Ga0466957_0003667_161_736 | 191 |
| 393 | 3300044842 | Ga0466957_0066183 | Ga0466957_0066183_1620_2195 | 191 |
| 394 | 3300044901 | Ga0466960_0000319 | Ga0466960_0000319_34_609 | 191 |
| 395 | 3300044901 | Ga0466960_0002911 | Ga0466960_0002911_473_1048 | 191 |
| 396 | 3300045049 | Ga0466959_0001867 | Ga0466959_0001867_5584_6159 | 191 |
| 397 | 3300045836 | Ga0466958_0003868 | Ga0466958_0003868_2461_3036 | 191 |
| 398 | 3300045836 | Ga0466958_0064035 | Ga0466958_0064035_738_1313 | 191 |
| 399 | 3300045976 | Ga0466967_0037323 | Ga0466967_0037323_3301_3876 | 191 |
| 400 | 3300045976 | Ga0466967_0278445 | Ga0466967_0278445_939_1514 | 191 |
| 401 | 3300046460 | Ga0495638_0014063 | Ga0495638_0014063_1809_2384 | 191 |
| 402 | 3300048903 | Ga0496100_0000084 | Ga0496100_0000084_20519_21094 | 191 |
| 403 | 3300048903 | Ga0496100_0019526 | Ga0496100_0019526_2695_3270 | 191 |
| 404 | 3300048904 | Ga0496101_0000100 | Ga0496101_0000100_11429_12004 | 191 |
| 405 | 3300048904 | Ga0496101_0001605 | Ga0496101_0001605_7405_7980 | 191 |
| 406 | 3300048904 | Ga0496101_0007060 | Ga0496101_0007060_3522_4097 | 191 |
| 407 | 3300048905 | Ga0496102_0001053 | Ga0496102_0001053_19695_20270 | 191 |
| 408 | 3300048905 | Ga0496102_0008322 | Ga0496102_0008322_6222_6797 | 191 |
| 409 | 3300048905 | Ga0496102_0391051 | Ga0496102_0391051_437_1012 | 191 |
| 410 | 3300048906 | Ga0496103_0000504 | Ga0496103_0000504_29802_30377 | 191 |
| 411 | 3300048906 | Ga0496103_0000700 | Ga0496103_0000700_13317_13892 | 191 |
| 412 | 3300048907 | Ga0496104_0028678 | Ga0496104_0028678_2631_3206 | 191 |
| 413 | 3300048908 | Ga0496105_0071224 | Ga0496105_0071224_868_1443 | 191 |
| 414 | 3300048909 | Ga0496106_0000164 | Ga0496106_0000164_13491_14066 | 191 |
| 415 | 3300048909 | Ga0496106_0011222 | Ga0496106_0011222_2074_2649 | 191 |
| 416 | 3300048910 | Ga0496107_0000317 | Ga0496107_0000317_24873_25448 | 191 |
| 417 | 3300048910 | Ga0496107_0037972 | Ga0496107_0037972_1132_1707 | 191 |
| 418 | 3300048910 | Ga0496107_0077210 | Ga0496107_0077210_27_602 | 191 |
| 419 | 3300048912 | Ga0496109_0000356 | Ga0496109_0000356_20514_21089 | 191 |
| 420 | 3300048913 | Ga0496110_0009262 | Ga0496110_0009262_2073_2648 | 191 |
| 421 | 3300048916 | Ga0496113_0003931 | Ga0496113_0003931_7719_8294 | 191 |
| 422 | 3300048916 | Ga0496113_0618937 | Ga0496113_0618937_12_587 | 191 |
| 423 | 3300048917 | Ga0496114_0000164 | Ga0496114_0000164_18008_18583 | 191 |
| 424 | 3300048917 | Ga0496114_0013077 | Ga0496114_0013077_2039_2614 | 191 |
| 425 | 3300048917 | Ga0496114_0417475 | Ga0496114_0417475_170_745 | 191 |
| 426 | 3300048917 | Ga0496114_0473451 | Ga0496114_0473451_284_859 | 191 |
| 427 | 3300048918 | Ga0496115_0128006 | Ga0496115_0128006_1239_1814 | 191 |
| 428 | 3300048919 | Ga0496116_0002215 | Ga0496116_0002215_19131_19706 | 191 |
| 429 | 3300048919 | Ga0496116_0065239 | Ga0496116_0065239_1534_2109 | 191 |
| 430 | 3300048920 | Ga0496117_0001137 | Ga0496117_0001137_14832_15407 | 191 |
| 431 | 3300048920 | Ga0496117_0042120 | Ga0496117_0042120_1783_2358 | 191 |
| 432 | 3300048921 | Ga0496118_0001770 | Ga0496118_0001770_24390_24965 | 191 |
| 433 | 3300048921 | Ga0496118_0008431 | Ga0496118_0008431_8518_9093 | 191 |
| 434 | 3300048922 | Ga0496119_0004129 | Ga0496119_0004129_8645_9220 | 191 |
| 435 | 3300048922 | Ga0496119_0053852 | Ga0496119_0053852_1835_2410 | 191 |
| 436 | 3300048923 | Ga0496120_0017717 | Ga0496120_0017717_2888_3463 | 191 |
| 437 | 3300048923 | Ga0496120_0021588 | Ga0496120_0021588_3163_3738 | 191 |
| 438 | 3300048924 | Ga0496121_0000004 | Ga0496121_0000004_242206_242781 | 191 |
| 439 | 3300048924 | Ga0496121_0010052 | Ga0496121_0010052_1864_2439 | 191 |
| 440 | 3300048925 | Ga0496122_0000805 | Ga0496122_0000805_27845_28420 | 191 |
| 441 | 3300048925 | Ga0496122_0028221 | Ga0496122_0028221_2769_3344 | 191 |
| 442 | 3300048926 | Ga0496123_0003575 | Ga0496123_0003575_8548_9123 | 191 |
| 443 | 3300048926 | Ga0496123_0022897 | Ga0496123_0022897_2641_3216 | 191 |
| 444 | 3300048927 | Ga0496124_0000221 | Ga0496124_0000221_77819_78394 | 191 |
| 445 | 3300048927 | Ga0496124_0237722 | Ga0496124_0237722_66_641 | 191 |
| 446 | 3300048927 | Ga0496124_0461025 | Ga0496124_0461025_234_809 | 191 |
| 447 | 3300048928 | Ga0496125_0000003 | Ga0496125_0000003_946987_947562 | 191 |
| 448 | 3300048928 | Ga0496125_0130816 | Ga0496125_0130816_1108_1683 | 191 |
| 449 | 3300048928 | Ga0496125_0194950 | Ga0496125_0194950_551_1126 | 191 |
| 450 | 3300048928 | Ga0496125_0382964 | Ga0496125_0382964_24_599 | 191 |
| 451 | 3300048929 | Ga0496126_0000001 | Ga0496126_0000001_242206_242781 | 191 |
| 452 | 3300048929 | Ga0496126_0002186 | Ga0496126_0002186_16472_17047 | 191 |
| 453 | 3300048929 | Ga0496126_0004091 | Ga0496126_0004091_14078_14653 | 191 |
| 454 | 3300048929 | Ga0496126_0070861 | Ga0496126_0070861_24_599 | 191 |
| 455 | 3300048929 | Ga0496126_0635962 | Ga0496126_0635962_238_813 | 191 |
| 456 | 3300049569 | Ga0501032_0005750 | Ga0501032_0005750_6618_7193 | 191 |
| 457 | 3300049570 | Ga0501033_0022381 | Ga0501033_0022381_2397_2972 | 191 |
| 458 | 3300049571 | Ga0501034_0004620 | Ga0501034_0004620_14115_14690 | 191 |
| 459 | 3300049571 | Ga0501034_0026741 | Ga0501034_0026741_4679_5254 | 191 |
| 460 | 3300049571 | Ga0501034_0033815 | Ga0501034_0033815_1423_1998 | 191 |
| 461 | 3300049572 | Ga0501036_0024129 | Ga0501036_0024129_4172_4747 | 191 |
| 462 | 3300049573 | Ga0501037_0012684 | Ga0501037_0012684_3715_4290 | 191 |
| 463 | 3300049573 | Ga0501037_0022555 | Ga0501037_0022555_2504_3079 | 191 |
| 464 | 3300049573 | Ga0501037_0359400 | Ga0501037_0359400_241_816 | 191 |
| 465 | 3300049574 | Ga0501038_0075693 | Ga0501038_0075693_490_1065 | 191 |
| 466 | 3300049574 | Ga0501038_0323202 | Ga0501038_0323202_535_1110 | 191 |
| 467 | 3300049575 | Ga0501039_0000929 | Ga0501039_0000929_14064_14639 | 191 |
| 468 | 3300049579 | Ga0501043_0002664 | Ga0501043_0002664_9100_9675 | 191 |
| 469 | 3300049579 | Ga0501043_0028459 | Ga0501043_0028459_712_1287 | 191 |
| 470 | 3300049579 | Ga0501043_0305864 | Ga0501043_0305864_90_665 | 191 |
| 471 | 3300049580 | Ga0501046_0006675 | Ga0501046_0006675_3704_4279 | 191 |
| 472 | 3300049580 | Ga0501046_0506179 | Ga0501046_0506179_90_665 | 191 |
| 473 | 3300049581 | Ga0501047_0009645 | Ga0501047_0009645_3704_4279 | 191 |
| 474 | 3300049581 | Ga0501047_0048800 | Ga0501047_0048800_1717_2292 | 191 |
| 475 | 3300049582 | Ga0501048_0005296 | Ga0501048_0005296_6722_7297 | 191 |
| 476 | 3300049585 | Ga0501069_0091425 | Ga0501069_0091425_1070_1645 | 191 |
| 477 | 3300049586 | Ga0501070_0099994 | Ga0501070_0099994_65_640 | 191 |
| 478 | 3300049586 | Ga0501070_0360519 | Ga0501070_0360519_573_1148 | 191 |
| 479 | 3300049589 | Ga0501073_0100401 | Ga0501073_0100401_892_1467 | 191 |
| 480 | 3300049590 | Ga0501074_0134330 | Ga0501074_0134330_19_594 | 191 |
| 481 | 3300049741 | Ga0501079_0323155 | Ga0501079_0323155_371_946 | 191 |
| 482 | 3300049742 | Ga0501080_0083453 | Ga0501080_0083453_2073_2648 | 191 |
| 483 | 3300049742 | Ga0501080_1156476 | Ga0501080_1156476_31_606 | 191 |
| 484 | 3300049822 | Ga0501035_0000497 | Ga0501035_0000497_8294_8869 | 191 |
| 485 | 3300049822 | Ga0501035_0010269 | Ga0501035_0010269_3108_3683 | 191 |
| 486 | 3300049823 | Ga0501044_0007277 | Ga0501044_0007277_2181_2756 | 191 |
| 487 | 3300049823 | Ga0501044_0018505 | Ga0501044_0018505_4154_4729 | 191 |
| 488 | 3300049823 | Ga0501044_0087293 | Ga0501044_0087293_1069_1644 | 191 |
| 489 | 3300050490 | nmdc:mga03n38_51377_c1 | nmdc:mga03n38_51377_c1_868_1443 | 191 |
| 490 | 3300050491 | nmdc:mga00v17_20163_c1 | nmdc:mga00v17_20163_c1_313_888 | 191 |
| 491 | 3300050492 | nmdc:mga0yw44_248853_c1 | nmdc:mga0yw44_248853_c1_390_965 | 191 |
| 492 | 3300050516 | nmdc:mga0sz30_142175_c1 | nmdc:mga0sz30_142175_c1_43_618 | 191 |
| 493 | 3300050516 | nmdc:mga0sz30_38966_c1 | nmdc:mga0sz30_38966_c1_43_618 | 191 |
| 494 | 3300050516 | nmdc:mga0sz30_98168_c1 | nmdc:mga0sz30_98168_c1_297_872 | 191 |
| 495 | 3300053080 | Ga0500635_0037216 | Ga0500635_0037216_722_1297 | 191 |
| 496 | 3300053098 | Ga0500650_0384950 | Ga0500650_0384950_22_597 | 191 |
| 497 | 3300053131 | Ga0500652_029207 | Ga0500652_029207_1331_1906 | 191 |
| 498 | 3300053139 | Ga0500568_0081636 | Ga0500568_0081636_208_783 | 191 |
| 499 | 3300053730 | Ga0500645_000490 | Ga0500645_000490_20011_20586 | 191 |
| 500 | 3300002073 | JGI24745J21846_1003814 | JGI24745J21846_10038142 | 192 |
| 501 | 3300002076 | JGI24749J21850_1007767 | JGI24749J21850_10077672 | 192 |
| 502 | 3300005328 | Ga0070676_10045179 | Ga0070676_100451793 | 192 |
| 503 | 3300005330 | Ga0070690_100143971 | Ga0070690_1001439712 | 192 |
| 504 | 3300005331 | Ga0070670_100071249 | Ga0070670_1000712494 | 192 |
| 505 | 3300005334 | Ga0068869_100019489 | Ga0068869_1000194894 | 192 |
| 506 | 3300005334 | Ga0068869_101056266 | Ga0068869_1010562661 | 192 |
| 507 | 3300005335 | Ga0070666_10080831 | Ga0070666_100808312 | 192 |
| 508 | 3300005338 | Ga0068868_100001163 | Ga0068868_10000116311 | 192 |
| 509 | 3300005340 | Ga0070689_100094272 | Ga0070689_1000942722 | 192 |
| 510 | 3300005341 | Ga0070691_10010543 | Ga0070691_100105433 | 192 |
| 511 | 3300005344 | Ga0070661_100160224 | Ga0070661_1001602242 | 192 |
| 512 | 3300005347 | Ga0070668_100001540 | Ga0070668_1000015406 | 192 |
| 513 | 3300005347 | Ga0070668_100153909 | Ga0070668_1001539093 | 192 |
| 514 | 3300005354 | Ga0070675_100222581 | Ga0070675_1002225812 | 192 |
| 515 | 3300005355 | Ga0070671_100043005 | Ga0070671_1000430052 | 192 |
| 516 | 3300005355 | Ga0070671_100169639 | Ga0070671_1001696393 | 192 |
| 517 | 3300005366 | Ga0070659_100053946 | Ga0070659_1000539463 | 192 |
| 518 | 3300005367 | Ga0070667_100029854 | Ga0070667_1000298546 | 192 |
| 519 | 3300005367 | Ga0070667_100897239 | Ga0070667_1008972391 | 192 |
| 520 | 3300005434 | Ga0070709_10055686 | Ga0070709_100556862 | 192 |
| 521 | 3300005437 | Ga0070710_10000690 | Ga0070710_100006907 | 192 |
| 522 | 3300005438 | Ga0070701_10001806 | Ga0070701_100018069 | 192 |
| 523 | 3300005439 | Ga0070711_100000160 | Ga0070711_10000016028 | 192 |
| 524 | 3300005440 | Ga0070705_100032461 | Ga0070705_1000324613 | 192 |
| 525 | 3300005441 | Ga0070700_100041374 | Ga0070700_1000413743 | 192 |
| 526 | 3300005444 | Ga0070694_100048520 | Ga0070694_1000485202 | 192 |
| 527 | 3300005455 | Ga0070663_100204504 | Ga0070663_1002045041 | 192 |
| 528 | 3300005456 | Ga0070678_100000117 | Ga0070678_10000011728 | 192 |
| 529 | 3300005457 | Ga0070662_100014176 | Ga0070662_1000141767 | 192 |
| 530 | 3300005459 | Ga0068867_100004067 | Ga0068867_10000406710 | 192 |
| 531 | 3300005535 | Ga0070684_101506148 | Ga0070684_1015061481 | 192 |
| 532 | 3300005539 | Ga0068853_100023310 | Ga0068853_1000233105 | 192 |
| 533 | 3300005539 | Ga0068853_100124253 | Ga0068853_1001242533 | 192 |
| 534 | 3300005539 | Ga0068853_100147840 | Ga0068853_1001478402 | 192 |
| 535 | 3300005544 | Ga0070686_100148982 | Ga0070686_1001489822 | 192 |
| 536 | 3300005546 | Ga0070696_100010017 | Ga0070696_1000100177 | 192 |
| 537 | 3300005548 | Ga0070665_100006373 | Ga0070665_10000637313 | 192 |
| 538 | 3300005548 | Ga0070665_100009409 | Ga0070665_1000094097 | 192 |
| 539 | 3300005548 | Ga0070665_101237347 | Ga0070665_1012373471 | 192 |
| 540 | 3300005549 | Ga0070704_100041327 | Ga0070704_1000413273 | 192 |
| 541 | 3300005564 | Ga0070664_100764736 | Ga0070664_1007647362 | 192 |
| 542 | 3300005578 | Ga0068854_100009069 | Ga0068854_1000090692 | 192 |
| 543 | 3300005614 | Ga0068856_100220476 | Ga0068856_1002204763 | 192 |
| 544 | 3300005615 | Ga0070702_100000873 | Ga0070702_10000087315 | 192 |
| 545 | 3300005616 | Ga0068852_100103135 | Ga0068852_1001031353 | 192 |
| 546 | 3300005617 | Ga0068859_100001042 | Ga0068859_10000104218 | 192 |
| 547 | 3300005617 | Ga0068859_100261551 | Ga0068859_1002615511 | 192 |
| 548 | 3300005718 | Ga0068866_10000441 | Ga0068866_1000044110 | 192 |
| 549 | 3300005719 | Ga0068861_100003820 | Ga0068861_1000038207 | 192 |
| 550 | 3300005719 | Ga0068861_100902249 | Ga0068861_1009022492 | 192 |
| 551 | 3300005841 | Ga0068863_100012259 | Ga0068863_1000122597 | 192 |
| 552 | 3300005842 | Ga0068858_100004832 | Ga0068858_1000048329 | 192 |
| 553 | 3300005842 | Ga0068858_100123671 | Ga0068858_1001236712 | 192 |
| 554 | 3300005842 | Ga0068858_101552539 | Ga0068858_1015525391 | 192 |
| 555 | 3300005843 | Ga0068860_100008728 | Ga0068860_1000087287 | 192 |
| 556 | 3300005843 | Ga0068860_100184027 | Ga0068860_1001840272 | 192 |
| 557 | 3300005843 | Ga0068860_100582440 | Ga0068860_1005824401 | 192 |
| 558 | 3300005844 | Ga0068862_100045978 | Ga0068862_1000459783 | 192 |
| 559 | 3300005844 | Ga0068862_100621002 | Ga0068862_1006210022 | 192 |
| 560 | 3300005937 | Ga0081455_10253084 | Ga0081455_102530842 | 192 |
| 561 | 3300005981 | Ga0081538_10067540 | Ga0081538_100675403 | 192 |
| 562 | 3300006038 | Ga0075365_10408359 | Ga0075365_104083591 | 192 |
| 563 | 3300006042 | Ga0075368_10008666 | Ga0075368_100086663 | 192 |
| 564 | 3300006048 | Ga0075363_100008437 | Ga0075363_1000084375 | 192 |
| 565 | 3300006048 | Ga0075363_100018254 | Ga0075363_1000182543 | 192 |
| 566 | 3300006048 | Ga0075363_100038889 | Ga0075363_1000388893 | 192 |
| 567 | 3300006048 | Ga0075363_100070873 | Ga0075363_1000708733 | 192 |
| 568 | 3300006048 | Ga0075363_100119312 | Ga0075363_1001193122 | 192 |
| 569 | 3300006048 | Ga0075363_100182829 | Ga0075363_1001828292 | 192 |
| 570 | 3300006051 | Ga0075364_10063286 | Ga0075364_100632862 | 192 |
| 571 | 3300006163 | Ga0070715_10024074 | Ga0070715_100240743 | 192 |
| 572 | 3300006173 | Ga0070716_100009944 | Ga0070716_1000099446 | 192 |
| 573 | 3300006175 | Ga0070712_100000846 | Ga0070712_1000008464 | 192 |
| 574 | 3300006175 | Ga0070712_100216142 | Ga0070712_1002161422 | 192 |
| 575 | 3300006175 | Ga0070712_100787855 | Ga0070712_1007878551 | 192 |
| 576 | 3300006177 | Ga0075362_10032507 | Ga0075362_100325073 | 192 |
| 577 | 3300006178 | Ga0075367_10039786 | Ga0075367_100397863 | 192 |
| 578 | 3300006186 | Ga0075369_10004544 | Ga0075369_100045446 | 192 |
| 579 | 3300006353 | Ga0075370_10027074 | Ga0075370_100270743 | 192 |
| 580 | 3300006353 | Ga0075370_10095310 | Ga0075370_100953102 | 192 |
| 581 | 3300006353 | Ga0075370_10140851 | Ga0075370_101408512 | 192 |
| 582 | 3300006353 | Ga0075370_10405957 | Ga0075370_104059571 | 192 |
| 583 | 3300006358 | Ga0068871_100048970 | Ga0068871_1000489702 | 192 |
| 584 | 3300006844 | Ga0075428_100071233 | Ga0075428_1000712333 | 192 |
| 585 | 3300006846 | Ga0075430_100099602 | Ga0075430_1000996023 | 192 |
| 586 | 3300006846 | Ga0075430_100123661 | Ga0075430_1001236612 | 192 |
| 587 | 3300006847 | Ga0075431_100111441 | Ga0075431_1001114413 | 192 |
| 588 | 3300006881 | Ga0068865_100010990 | Ga0068865_1000109903 | 192 |
| 589 | 3300006931 | Ga0097620_100001042 | Ga0097620_10000104218 | 192 |
| 590 | 3300006931 | Ga0097620_100261540 | Ga0097620_1002615401 | 192 |
| 591 | 3300009092 | Ga0105250_10197597 | Ga0105250_101975972 | 192 |
| 592 | 3300009093 | Ga0105240_10500877 | Ga0105240_105008772 | 192 |
| 593 | 3300009098 | Ga0105245_10008338 | Ga0105245_100083386 | 192 |
| 594 | 3300009098 | Ga0105245_10178791 | Ga0105245_101787912 | 192 |
| 595 | 3300009098 | Ga0105245_10281693 | Ga0105245_102816932 | 192 |
| 596 | 3300009101 | Ga0105247_10000298 | Ga0105247_1000029827 | 192 |
| 597 | 3300009148 | Ga0105243_10000700 | Ga0105243_1000070013 | 192 |
| 598 | 3300009176 | Ga0105242_10001954 | Ga0105242_100019544 | 192 |
| 599 | 3300009177 | Ga0105248_10003516 | Ga0105248_100035164 | 192 |
| 600 | 3300009545 | Ga0105237_10006011 | Ga0105237_1000601112 | 192 |
| 601 | 3300009545 | Ga0105237_10011826 | Ga0105237_100118267 | 192 |
| 602 | 3300009553 | Ga0105249_10000470 | Ga0105249_1000047016 | 192 |
| 603 | 3300009553 | Ga0105249_10597676 | Ga0105249_105976762 | 192 |
| 604 | 3300009553 | Ga0105249_10731922 | Ga0105249_107319222 | 192 |
| 605 | 3300009553 | Ga0105249_10807360 | Ga0105249_108073602 | 192 |
| 606 | 3300010375 | Ga0105239_10016841 | Ga0105239_100168414 | 192 |
| 607 | 3300010375 | Ga0105239_10109829 | Ga0105239_101098293 | 192 |
| 608 | 3300011119 | Ga0105246_10430705 | Ga0105246_104307052 | 192 |
| 609 | 3300013297 | Ga0157378_10001860 | Ga0157378_1000186021 | 192 |
| 610 | 3300013306 | Ga0163162_10139046 | Ga0163162_101390463 | 192 |
| 611 | 3300013306 | Ga0163162_10438171 | Ga0163162_104381711 | 192 |
| 612 | 3300013307 | Ga0157372_10048234 | Ga0157372_100482346 | 192 |
| 613 | 3300013308 | Ga0157375_10078003 | Ga0157375_100780035 | 192 |
| 614 | 3300014325 | Ga0163163_10436575 | Ga0163163_104365752 | 192 |
| 615 | 3300014325 | Ga0163163_10443537 | Ga0163163_104435372 | 192 |
| 616 | 3300014325 | Ga0163163_10459637 | Ga0163163_104596372 | 192 |
| 617 | 3300014326 | Ga0157380_10010166 | Ga0157380_100101667 | 192 |
| 618 | 3300014745 | Ga0157377_10242850 | Ga0157377_102428502 | 192 |
| 619 | 3300014968 | Ga0157379_10002499 | Ga0157379_1000249916 | 192 |
| 620 | 3300017792 | Ga0163161_10104581 | Ga0163161_101045812 | 192 |
| 621 | 3300025898 | Ga0207692_10007732 | Ga0207692_100077325 | 192 |
| 622 | 3300025899 | Ga0207642_10008317 | Ga0207642_100083173 | 192 |
| 623 | 3300025900 | Ga0207710_10011288 | Ga0207710_100112883 | 192 |
| 624 | 3300025901 | Ga0207688_10021558 | Ga0207688_100215584 | 192 |
| 625 | 3300025903 | Ga0207680_10113827 | Ga0207680_101138273 | 192 |
| 626 | 3300025903 | Ga0207680_10836468 | Ga0207680_108364681 | 192 |
| 627 | 3300025907 | Ga0207645_10126547 | Ga0207645_101265472 | 192 |
| 628 | 3300025910 | Ga0207684_10642457 | Ga0207684_106424572 | 192 |
| 629 | 3300025915 | Ga0207693_10000754 | Ga0207693_1000075423 | 192 |
| 630 | 3300025916 | Ga0207663_10004087 | Ga0207663_100040877 | 192 |
| 631 | 3300025918 | Ga0207662_10020192 | Ga0207662_100201924 | 192 |
| 632 | 3300025923 | Ga0207681_10025217 | Ga0207681_100252173 | 192 |
| 633 | 3300025925 | Ga0207650_10105370 | Ga0207650_101053702 | 192 |
| 634 | 3300025926 | Ga0207659_10528487 | Ga0207659_105284872 | 192 |
| 635 | 3300025927 | Ga0207687_10016666 | Ga0207687_100166663 | 192 |
| 636 | 3300025931 | Ga0207644_10026466 | Ga0207644_100264664 | 192 |
| 637 | 3300025931 | Ga0207644_10158949 | Ga0207644_101589492 | 192 |
| 638 | 3300025931 | Ga0207644_10262985 | Ga0207644_102629852 | 192 |
| 639 | 3300025933 | Ga0207706_10081036 | Ga0207706_100810363 | 192 |
| 640 | 3300025935 | Ga0207709_10007107 | Ga0207709_100071072 | 192 |
| 641 | 3300025936 | Ga0207670_10102625 | Ga0207670_101026252 | 192 |
| 642 | 3300025937 | Ga0207669_10020989 | Ga0207669_100209893 | 192 |
| 643 | 3300025938 | Ga0207704_10060877 | Ga0207704_100608773 | 192 |
| 644 | 3300025939 | Ga0207665_10009094 | Ga0207665_100090942 | 192 |
| 645 | 3300025939 | Ga0207665_10184661 | Ga0207665_101846612 | 192 |
| 646 | 3300025939 | Ga0207665_10542385 | Ga0207665_105423851 | 192 |
| 647 | 3300025942 | Ga0207689_10031316 | Ga0207689_100313165 | 192 |
| 648 | 3300025942 | Ga0207689_10323733 | Ga0207689_103237332 | 192 |
| 649 | 3300025944 | Ga0207661_10234635 | Ga0207661_102346352 | 192 |
| 650 | 3300025945 | Ga0207679_10807160 | Ga0207679_108071601 | 192 |
| 651 | 3300025949 | Ga0207667_10090149 | Ga0207667_100901493 | 192 |
| 652 | 3300025949 | Ga0207667_10320970 | Ga0207667_103209701 | 192 |
| 653 | 3300025961 | Ga0207712_10001196 | Ga0207712_1000119616 | 192 |
| 654 | 3300025961 | Ga0207712_10136615 | Ga0207712_101366152 | 192 |
| 655 | 3300025972 | Ga0207668_10002892 | Ga0207668_100028928 | 192 |
| 656 | 3300025981 | Ga0207640_10401704 | Ga0207640_104017042 | 192 |
| 657 | 3300025986 | Ga0207658_10038741 | Ga0207658_100387413 | 192 |
| 658 | 3300026023 | Ga0207677_10230267 | Ga0207677_102302672 | 192 |
| 659 | 3300026035 | Ga0207703_10219734 | Ga0207703_102197342 | 192 |
| 660 | 3300026035 | Ga0207703_11163531 | Ga0207703_111635311 | 192 |
| 661 | 3300026041 | Ga0207639_10007030 | Ga0207639_100070309 | 192 |
| 662 | 3300026041 | Ga0207639_10016712 | Ga0207639_100167125 | 192 |
| 663 | 3300026041 | Ga0207639_10221901 | Ga0207639_102219012 | 192 |
| 664 | 3300026067 | Ga0207678_10009360 | Ga0207678_100093607 | 192 |
| 665 | 3300026067 | Ga0207678_10136254 | Ga0207678_101362542 | 192 |
| 666 | 3300026067 | Ga0207678_10850230 | Ga0207678_108502301 | 192 |
| 667 | 3300026075 | Ga0207708_10001431 | Ga0207708_1000143120 | 192 |
| 668 | 3300026078 | Ga0207702_10486428 | Ga0207702_104864282 | 192 |
| 669 | 3300026088 | Ga0207641_10005077 | Ga0207641_100050779 | 192 |
| 670 | 3300026088 | Ga0207641_10785188 | Ga0207641_107851882 | 192 |
| 671 | 3300026089 | Ga0207648_10014199 | Ga0207648_100141994 | 192 |
| 672 | 3300026118 | Ga0207675_100007850 | Ga0207675_1000078508 | 192 |
| 673 | 3300026118 | Ga0207675_100116420 | Ga0207675_1001164203 | 192 |
| 674 | 3300026118 | Ga0207675_101043176 | Ga0207675_1010431762 | 192 |
| 675 | 3300026121 | Ga0207683_10000984 | Ga0207683_100009848 | 192 |
| 676 | 3300026142 | Ga0207698_10151770 | Ga0207698_101517703 | 192 |
| 677 | 3300027866 | Ga0209813_10184443 | Ga0209813_101844432 | 192 |
| 678 | 3300028379 | Ga0268266_10011403 | Ga0268266_100114033 | 192 |
| 679 | 3300028381 | Ga0268264_10027397 | Ga0268264_100273974 | 192 |
| 680 | 3300028381 | Ga0268264_10563875 | Ga0268264_105638751 | 192 |
| 681 | 3300028381 | Ga0268264_10745845 | Ga0268264_107458452 | 192 |
| 682 | 3300031824 | Ga0307413_10350035 | Ga0307413_103500352 | 192 |
| 683 | 3300031824 | Ga0307413_10751672 | Ga0307413_107516722 | 192 |
| 684 | 3300031852 | Ga0307410_10114126 | Ga0307410_101141262 | 192 |
| 685 | 3300031903 | Ga0307407_10024118 | Ga0307407_100241181 | 192 |
| 686 | 3300031903 | Ga0307407_10489475 | Ga0307407_104894751 | 192 |
| 687 | 3300031911 | Ga0307412_10502027 | Ga0307412_105020272 | 192 |
| 688 | 3300032002 | Ga0307416_100074232 | Ga0307416_1000742323 | 192 |
| 689 | 3300032005 | Ga0307411_10957267 | Ga0307411_109572671 | 192 |
| 690 | 3300032126 | Ga0307415_100063805 | Ga0307415_1000638053 | 192 |
| 691 | 3300032126 | Ga0307415_100797379 | Ga0307415_1007973791 | 192 |
| 692 | 3300035084 | Ga0373928_0050061 | Ga0373928_0050061_291_869 | 192 |
| 693 | 3300035084 | Ga0373928_0120553 | Ga0373928_0120553_87_665 | 192 |
| 694 | 3300035091 | Ga0373951_0106311 | Ga0373951_0106311_120_698 | 192 |
| 695 | 3300035111 | Ga0373923_0362800 | Ga0373923_0362800_12_590 | 192 |
| 696 | 3300035115 | Ga0373941_0070119 | Ga0373941_0070119_281_859 | 192 |
| 697 | 3300035170 | Ga0373943_0094195 | Ga0373943_0094195_639_1217 | 192 |
| 698 | 3300041413 | Ga0439465_0013937 | Ga0439465_0013937_1886_2464 | 192 |
| 699 | 3300042436 | Ga0439435_0086491 | Ga0439435_0086491_86_664 | 192 |
| 700 | 3300044658 | Ga0466972_0008599 | Ga0466972_0008599_3034_3612 | 192 |
| 701 | 3300044683 | Ga0466965_0010937 | Ga0466965_0010937_3078_3656 | 192 |
| 702 | 3300044683 | Ga0466965_0443488 | Ga0466965_0443488_93_671 | 192 |
| 703 | 3300044684 | Ga0466966_0015177 | Ga0466966_0015177_1502_2080 | 192 |
| 704 | 3300044706 | Ga0466964_0236617 | Ga0466964_0236617_80_658 | 192 |
| 705 | 3300044719 | Ga0466971_0073472 | Ga0466971_0073472_327_905 | 192 |
| 706 | 3300044735 | Ga0466968_0039699 | Ga0466968_0039699_956_1534 | 192 |
| 707 | 3300044842 | Ga0466957_0017396 | Ga0466957_0017396_2045_2623 | 192 |
| 708 | 3300044901 | Ga0466960_0391295 | Ga0466960_0391295_172_750 | 192 |
| 709 | 3300044901 | Ga0466960_0433983 | Ga0466960_0433983_67_645 | 192 |
| 710 | 3300045049 | Ga0466959_0046101 | Ga0466959_0046101_1906_2484 | 192 |
| 711 | 3300045976 | Ga0466967_0138626 | Ga0466967_0138626_677_1255 | 192 |
| 712 | 3300045976 | Ga0466967_0153412 | Ga0466967_0153412_1216_1794 | 192 |
| 713 | 3300045976 | Ga0466967_0942457 | Ga0466967_0942457_154_732 | 192 |
| 714 | 3300046455 | Ga0495603_0197105 | Ga0495603_0197105_545_1123 | 192 |
| 715 | 3300046459 | Ga0495629_0044588 | Ga0495629_0044588_967_1545 | 192 |
| 716 | 3300046461 | Ga0495641_0389118 | Ga0495641_0389118_16_594 | 192 |
| 717 | 3300046473 | Ga0495582_0117284 | Ga0495582_0117284_392_970 | 192 |
| 718 | 3300046506 | Ga0495583_0029855 | Ga0495583_0029855_1451_2029 | 192 |
| 719 | 3300046507 | Ga0495606_0027733 | Ga0495606_0027733_2576_3154 | 192 |
| 720 | 3300046515 | Ga0495620_0069298 | Ga0495620_0069298_626_1204 | 192 |
| 721 | 3300046524 | Ga0495648_0015719 | Ga0495648_0015719_4591_5169 | 192 |
| 722 | 3300046530 | Ga0495654_0017761 | Ga0495654_0017761_1952_2530 | 192 |
| 723 | 3300046531 | Ga0495665_0091627 | Ga0495665_0091627_244_822 | 192 |
| 724 | 3300046533 | Ga0495640_0074333 | Ga0495640_0074333_879_1457 | 192 |
| 725 | 3300046616 | Ga0495668_0034993 | Ga0495668_0034993_1353_1931 | 192 |
| 726 | 3300046648 | Ga0495611_0133509 | Ga0495611_0133509_312_890 | 192 |
| 727 | 3300046681 | Ga0495647_0034166 | Ga0495647_0034166_1269_1847 | 192 |
| 728 | 3300046690 | Ga0495624_0019505 | Ga0495624_0019505_666_1244 | 192 |
| 729 | 3300046694 | Ga0495649_0062794 | Ga0495649_0062794_109_687 | 192 |
| 730 | 3300047315 | Ga0495581_0053343 | Ga0495581_0053343_441_1019 | 192 |
| 731 | 3300047319 | Ga0495674_0045891 | Ga0495674_0045891_274_852 | 192 |
| 732 | 3300047319 | Ga0495674_0620515 | Ga0495674_0620515_118_696 | 192 |
| 733 | 3300047320 | Ga0495672_0003978 | Ga0495672_0003978_8195_8773 | 192 |
| 734 | 3300047469 | Ga0495673_0002945 | Ga0495673_0002945_5062_5640 | 192 |
| 735 | 3300047472 | Ga0495686_0001660 | Ga0495686_0001660_20813_21391 | 192 |
| 736 | 3300047673 | Ga0495593_0065953 | Ga0495593_0065953_1259_1837 | 192 |
| 737 | 3300048091 | Ga0495626_0260956 | Ga0495626_0260956_58_636 | 192 |
| 738 | 3300048903 | Ga0496100_0001148 | Ga0496100_0001148_8519_9097 | 192 |
| 739 | 3300048903 | Ga0496100_0001530 | Ga0496100_0001530_2922_3500 | 192 |
| 740 | 3300048903 | Ga0496100_0035016 | Ga0496100_0035016_1142_1720 | 192 |
| 741 | 3300048904 | Ga0496101_0000110 | Ga0496101_0000110_15347_15925 | 192 |
| 742 | 3300048905 | Ga0496102_0000006 | Ga0496102_0000006_320284_320862 | 192 |
| 743 | 3300048905 | Ga0496102_0002926 | Ga0496102_0002926_997_1575 | 192 |
| 744 | 3300048905 | Ga0496102_0031183 | Ga0496102_0031183_2141_2719 | 192 |
| 745 | 3300048905 | Ga0496102_0150869 | Ga0496102_0150869_1346_1924 | 192 |
| 746 | 3300048905 | Ga0496102_0307215 | Ga0496102_0307215_467_1045 | 192 |
| 747 | 3300048906 | Ga0496103_0000006 | Ga0496103_0000006_320082_320660 | 192 |
| 748 | 3300048906 | Ga0496103_0000400 | Ga0496103_0000400_35556_36134 | 192 |
| 749 | 3300048906 | Ga0496103_0155241 | Ga0496103_0155241_212_790 | 192 |
| 750 | 3300048906 | Ga0496103_0218275 | Ga0496103_0218275_151_729 | 192 |
| 751 | 3300048907 | Ga0496104_0053659 | Ga0496104_0053659_1631_2209 | 192 |
| 752 | 3300048907 | Ga0496104_0411711 | Ga0496104_0411711_650_1228 | 192 |
| 753 | 3300048908 | Ga0496105_0049850 | Ga0496105_0049850_1479_2057 | 192 |
| 754 | 3300048909 | Ga0496106_0000616 | Ga0496106_0000616_11839_12417 | 192 |
| 755 | 3300048910 | Ga0496107_0059589 | Ga0496107_0059589_1189_1767 | 192 |
| 756 | 3300048911 | Ga0496108_0030263 | Ga0496108_0030263_3839_4417 | 192 |
| 757 | 3300048911 | Ga0496108_0124182 | Ga0496108_0124182_565_1143 | 192 |
| 758 | 3300048912 | Ga0496109_0070109 | Ga0496109_0070109_303_881 | 192 |
| 759 | 3300048913 | Ga0496110_0129909 | Ga0496110_0129909_1432_2010 | 192 |
| 760 | 3300048913 | Ga0496110_0308494 | Ga0496110_0308494_40_618 | 192 |
| 761 | 3300048915 | Ga0496112_0021751 | Ga0496112_0021751_1491_2069 | 192 |
| 762 | 3300048915 | Ga0496112_0063898 | Ga0496112_0063898_2067_2645 | 192 |
| 763 | 3300048915 | Ga0496112_0338250 | Ga0496112_0338250_610_1188 | 192 |
| 764 | 3300048915 | Ga0496112_1113983 | Ga0496112_1113983_25_603 | 192 |
| 765 | 3300048916 | Ga0496113_0080931 | Ga0496113_0080931_904_1482 | 192 |
| 766 | 3300048917 | Ga0496114_0000522 | Ga0496114_0000522_17352_17930 | 192 |
| 767 | 3300048918 | Ga0496115_0002348 | Ga0496115_0002348_3145_3723 | 192 |
| 768 | 3300048919 | Ga0496116_0000025 | Ga0496116_0000025_149880_150458 | 192 |
| 769 | 3300048920 | Ga0496117_0000006 | Ga0496117_0000006_149880_150458 | 192 |
| 770 | 3300048921 | Ga0496118_0000004 | Ga0496118_0000004_149880_150458 | 192 |
| 771 | 3300048922 | Ga0496119_0000035 | Ga0496119_0000035_69929_70507 | 192 |
| 772 | 3300048923 | Ga0496120_0000079 | Ga0496120_0000079_28425_29003 | 192 |
| 773 | 3300048923 | Ga0496120_0187786 | Ga0496120_0187786_419_997 | 192 |
| 774 | 3300048924 | Ga0496121_0000090 | Ga0496121_0000090_97670_98248 | 192 |
| 775 | 3300048928 | Ga0496125_0102273 | Ga0496125_0102273_1209_1787 | 192 |
| 776 | 3300048929 | Ga0496126_0030158 | Ga0496126_0030158_3087_3665 | 192 |
| 777 | 3300049581 | Ga0501047_0663202 | Ga0501047_0663202_221_799 | 192 |
| 778 | 3300050489 | nmdc:mga03683_34821_c1 | nmdc:mga03683_34821_c1_49_627 | 192 |
| 779 | 3300050490 | nmdc:mga03n38_13610_c1 | nmdc:mga03n38_13610_c1_485_1063 | 192 |
| 780 | 3300050490 | nmdc:mga03n38_202559_c1 | nmdc:mga03n38_202559_c1_376_954 | 192 |
| 781 | 3300050490 | nmdc:mga03n38_326880_c1 | nmdc:mga03n38_326880_c1_124_702 | 192 |
| 782 | 3300050490 | nmdc:mga03n38_6858_c1 | nmdc:mga03n38_6858_c1_1641_2219 | 192 |
| 783 | 3300050491 | nmdc:mga00v17_29039_c1 | nmdc:mga00v17_29039_c1_128_706 | 192 |
| 784 | 3300050491 | nmdc:mga00v17_38075_c1 | nmdc:mga00v17_38075_c1_2141_2719 | 192 |
| 785 | 3300050491 | nmdc:mga00v17_49917_c1 | nmdc:mga00v17_49917_c1_1545_2123 | 192 |
| 786 | 3300050491 | nmdc:mga00v17_59953_c1 | nmdc:mga00v17_59953_c1_1457_2035 | 192 |
| 787 | 3300050491 | nmdc:mga00v17_65717_c1 | nmdc:mga00v17_65717_c1_1461_2039 | 192 |
| 788 | 3300050492 | nmdc:mga0yw44_2784_c1 | nmdc:mga0yw44_2784_c1_6086_6664 | 192 |
| 789 | 3300050492 | nmdc:mga0yw44_51206_c1 | nmdc:mga0yw44_51206_c1_575_1153 | 192 |
| 790 | 3300050495 | nmdc:mga04h51_19868_c1 | nmdc:mga04h51_19868_c1_85_663 | 192 |
| 791 | 3300050496 | nmdc:mga07m45_10687_c1 | nmdc:mga07m45_10687_c1_1076_1654 | 192 |
| 792 | 3300050496 | nmdc:mga07m45_116508_c1 | nmdc:mga07m45_116508_c1_613_1191 | 192 |
| 793 | 3300050496 | nmdc:mga07m45_129740_c1 | nmdc:mga07m45_129740_c1_308_886 | 192 |
| 794 | 3300050496 | nmdc:mga07m45_32818_c1 | nmdc:mga07m45_32818_c1_2018_2596 | 192 |
| 795 | 3300050496 | nmdc:mga07m45_48555_c1 | nmdc:mga07m45_48555_c1_1227_1805 | 192 |
| 796 | 3300050511 | nmdc:mga08y16_1388746_c1 | nmdc:mga08y16_1388746_c1_28_606 | 192 |
| 797 | 3300050516 | nmdc:mga0sz30_190092_c1 | nmdc:mga0sz30_190092_c1_27_605 | 192 |
| 798 | 3300050516 | nmdc:mga0sz30_2321_c1 | nmdc:mga0sz30_2321_c1_1365_1943 | 192 |
| 799 | 3300050516 | nmdc:mga0sz30_29231_c2 | nmdc:mga0sz30_29231_c2_166_744 | 192 |
| 800 | 3300050516 | nmdc:mga0sz30_58587_c1 | nmdc:mga0sz30_58587_c1_507_1085 | 192 |
| 801 | 3300053083 | Ga0495655_0048121 | Ga0495655_0048121_209_787 | 192 |
| 802 | 3300053087 | Ga0500643_003561 | Ga0500643_003561_1136_1714 | 192 |
| 803 | 3300053098 | Ga0500650_0181540 | Ga0500650_0181540_245_823 | 192 |
| 804 | 3300053104 | Ga0500556_0002920 | Ga0500556_0002920_1949_2527 | 192 |
| 805 | 3300053104 | Ga0500556_0012047 | Ga0500556_0012047_116_694 | 192 |
| 806 | 3300053108 | Ga0500562_120359 | Ga0500562_120359_77_655 | 192 |
| 807 | 3300053129 | Ga0500628_030460 | Ga0500628_030460_567_1145 | 192 |
| 808 | 3300053153 | Ga0500616_0007285 | Ga0500616_0007285_5332_5910 | 192 |
| 809 | 3300061719 | Ga0466962_0012658 | Ga0466962_0012658_1033_1611 | 192 |
| 810 | 3300050510 | nmdc:mga06r32_44_c3 | nmdc:mga06r32_44_c3_1310_1915 | 193 |
| 811 | 3300049742 | Ga0501080_0307724 | Ga0501080_0307724_61_657 | 197 |
| 812 | 3300050490 | nmdc:mga03n38_62089_c1 | nmdc:mga03n38_62089_c1_25_621 | 197 |
| 813 | 3300001977 | JGI24746J21847_1008944 | JGI24746J21847_10089441 | 202 |
| 814 | 3300001991 | JGI24743J22301_10013189 | JGI24743J22301_100131892 | 202 |
| 815 | 3300002073 | JGI24745J21846_1016360 | JGI24745J21846_10163602 | 202 |
| 816 | 3300005328 | Ga0070676_10124387 | Ga0070676_101243872 | 202 |
| 817 | 3300005334 | Ga0068869_100055923 | Ga0068869_1000559233 | 202 |
| 818 | 3300005339 | Ga0070660_100155321 | Ga0070660_1001553212 | 202 |
| 819 | 3300005340 | Ga0070689_100155719 | Ga0070689_1001557192 | 202 |
| 820 | 3300005345 | Ga0070692_10069345 | Ga0070692_100693451 | 202 |
| 821 | 3300005356 | Ga0070674_100089173 | Ga0070674_1000891732 | 202 |
| 822 | 3300005366 | Ga0070659_100318681 | Ga0070659_1003186812 | 202 |
| 823 | 3300005434 | Ga0070709_10077029 | Ga0070709_100770294 | 202 |
| 824 | 3300005437 | Ga0070710_10003060 | Ga0070710_100030606 | 202 |
| 825 | 3300005438 | Ga0070701_10091749 | Ga0070701_100917492 | 202 |
| 826 | 3300005439 | Ga0070711_100007595 | Ga0070711_1000075952 | 202 |
| 827 | 3300005440 | Ga0070705_100236165 | Ga0070705_1002361651 | 202 |
| 828 | 3300005441 | Ga0070700_100190486 | Ga0070700_1001904861 | 202 |
| 829 | 3300005455 | Ga0070663_100167351 | Ga0070663_1001673511 | 202 |
| 830 | 3300005456 | Ga0070678_100153911 | Ga0070678_1001539112 | 202 |
| 831 | 3300005457 | Ga0070662_100467765 | Ga0070662_1004677652 | 202 |
| 832 | 3300005459 | Ga0068867_100028527 | Ga0068867_1000285274 | 202 |
| 833 | 3300005539 | Ga0068853_100079103 | Ga0068853_1000791034 | 202 |
| 834 | 3300005543 | Ga0070672_100067944 | Ga0070672_1000679442 | 202 |
| 835 | 3300005545 | Ga0070695_100487647 | Ga0070695_1004876472 | 202 |
| 836 | 3300005546 | Ga0070696_100171824 | Ga0070696_1001718241 | 202 |
| 837 | 3300005547 | Ga0070693_100455667 | Ga0070693_1004556671 | 202 |
| 838 | 3300005548 | Ga0070665_100029759 | Ga0070665_1000297597 | 202 |
| 839 | 3300005563 | Ga0068855_101237862 | Ga0068855_1012378621 | 202 |
| 840 | 3300005578 | Ga0068854_100127101 | Ga0068854_1001271012 | 202 |
| 841 | 3300005615 | Ga0070702_100044762 | Ga0070702_1000447621 | 202 |
| 842 | 3300005616 | Ga0068852_100287681 | Ga0068852_1002876812 | 202 |
| 843 | 3300005616 | Ga0068852_100593908 | Ga0068852_1005939081 | 202 |
| 844 | 3300005617 | Ga0068859_100116679 | Ga0068859_1001166793 | 202 |
| 845 | 3300005618 | Ga0068864_100235403 | Ga0068864_1002354031 | 202 |
| 846 | 3300005718 | Ga0068866_10027916 | Ga0068866_100279164 | 202 |
| 847 | 3300005841 | Ga0068863_100089781 | Ga0068863_1000897814 | 202 |
| 848 | 3300005844 | Ga0068862_100298420 | Ga0068862_1002984202 | 202 |
| 849 | 3300005844 | Ga0068862_100665284 | Ga0068862_1006652841 | 202 |
| 850 | 3300006173 | Ga0070716_100034686 | Ga0070716_1000346863 | 202 |
| 851 | 3300006175 | Ga0070712_100002348 | Ga0070712_10000234810 | 202 |
| 852 | 3300006881 | Ga0068865_100144687 | Ga0068865_1001446873 | 202 |
| 853 | 3300006931 | Ga0097620_100116667 | Ga0097620_1001166673 | 202 |
| 854 | 3300011119 | Ga0105246_10033636 | Ga0105246_100336364 | 202 |
| 855 | 3300013308 | Ga0157375_10793912 | Ga0157375_107939122 | 202 |
| 856 | 3300017792 | Ga0163161_10041561 | Ga0163161_100415614 | 202 |
| 857 | 3300017792 | Ga0163161_10089371 | Ga0163161_100893713 | 202 |
| 858 | 3300025898 | Ga0207692_10024366 | Ga0207692_100243663 | 202 |
| 859 | 3300025899 | Ga0207642_10204812 | Ga0207642_102048122 | 202 |
| 860 | 3300025904 | Ga0207647_10013370 | Ga0207647_100133706 | 202 |
| 861 | 3300025906 | Ga0207699_10005382 | Ga0207699_100053824 | 202 |
| 862 | 3300025907 | Ga0207645_10061757 | Ga0207645_100617572 | 202 |
| 863 | 3300025914 | Ga0207671_10239844 | Ga0207671_102398442 | 202 |
| 864 | 3300025915 | Ga0207693_10003890 | Ga0207693_100038908 | 202 |
| 865 | 3300025916 | Ga0207663_10031934 | Ga0207663_100319344 | 202 |
| 866 | 3300025918 | Ga0207662_10109101 | Ga0207662_101091013 | 202 |
| 867 | 3300025927 | Ga0207687_10266906 | Ga0207687_102669062 | 202 |
| 868 | 3300025931 | Ga0207644_10155307 | Ga0207644_101553072 | 202 |
| 869 | 3300025932 | Ga0207690_10078919 | Ga0207690_100789192 | 202 |
| 870 | 3300025935 | Ga0207709_10116832 | Ga0207709_101168322 | 202 |
| 871 | 3300025936 | Ga0207670_10125533 | Ga0207670_101255333 | 202 |
| 872 | 3300025937 | Ga0207669_10075261 | Ga0207669_100752613 | 202 |
| 873 | 3300025939 | Ga0207665_10081070 | Ga0207665_100810703 | 202 |
| 874 | 3300025940 | Ga0207691_10055981 | Ga0207691_100559812 | 202 |
| 875 | 3300025961 | Ga0207712_10242346 | Ga0207712_102423462 | 202 |
| 876 | 3300025972 | Ga0207668_10096911 | Ga0207668_100969112 | 202 |
| 877 | 3300025981 | Ga0207640_10070334 | Ga0207640_100703342 | 202 |
| 878 | 3300026041 | Ga0207639_10765949 | Ga0207639_107659491 | 202 |
| 879 | 3300026067 | Ga0207678_10016046 | Ga0207678_100160468 | 202 |
| 880 | 3300026075 | Ga0207708_10016479 | Ga0207708_100164797 | 202 |
| 881 | 3300026088 | Ga0207641_10290775 | Ga0207641_102907752 | 202 |
| 882 | 3300026095 | Ga0207676_10030889 | Ga0207676_100308895 | 202 |
| 883 | 3300026118 | Ga0207675_100063261 | Ga0207675_1000632612 | 202 |
| 884 | 3300026121 | Ga0207683_10058440 | Ga0207683_100584404 | 202 |
| 885 | 3300026142 | Ga0207698_10161701 | Ga0207698_101617012 | 202 |
| 886 | 3300026142 | Ga0207698_11238689 | Ga0207698_112386891 | 202 |
| 887 | 3300028379 | Ga0268266_10770164 | Ga0268266_107701642 | 202 |
| 888 | 3300028381 | Ga0268264_10357850 | Ga0268264_103578502 | 202 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3p2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution | 0.9896 | 13 | 201 |
| 2z2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9852 | 14 | 190 |
| 7wt6-assembly1.cif.gz_A | crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9776 | 14 | 201 |
| 3p2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution | 0.9742 | 13 | 201 |
| 7wt6-assembly1.cif.gz_A | crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9675 | 14 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54V95_265_452_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9559 | 70 | 199 | 3.40.50.1470 |
| af_Q86Y79_27_209_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9406 | 15 | 192 | 3.40.50.1470 |
| 1rynA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9387 | 11 | 190 | 3.40.50.1470 |
| 4q55B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9355 | 15 | 196 | 3.40.50.1470 |
| 5ektA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9344 | 13 | 200 | 3.40.50.1470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T5WPR7-F1-model_v4 | deleted | 0.9929 | 16 | 202 |
|
| AF-A0A7J9VX40-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9912 | 13 | 199 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A4R2DKB0-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9907 | 15 | 199 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A2M9BG41-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9905 | 13 | 199 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-H0R5L0-F1-model_v4 | Peptidyl-tRNA hydrolase (EC 3.1.1.29) | 0.9865 | 15 | 176 |
GO:0004045
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar