F484748
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 888 | 559 | 687 | 538 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10003273|Ga0070681_100032739 |
| Length | 625 |
| Sequence | MTSMTGGEAIVSSLVAHGVDTVFGLPGAQVYGLFDAFHQAQLKVIGARHEQACAYMAYGYARSSGKPGVFSVVPGPGVLNAGAGLLTAFGGNEPVLCLTGQVPTQFLDKGRGHLHEMPDQLATLRTFVKWADRIEYPDIAPTMVSRAFQEMMSGRRGPVALEMPWDVFTQRADVGVSKVFDPFRIKEAAALITASKRPMIFVGSGAIHAREEVLELAELIDAPVVAFRSGRGIVSNAHELGLTMAAAYRLWPTTDLMIGIGTRLELPTMSRWPYRPDGLKSVRIDIDPIEMRRYTSDVSVISDSRAGTRDLLAAVRKAGYEATAAAQEEIQKVQPQMAYLNILREVLPDNAIVTDELSQVGFTSWYGFPIYEPRTFITSGYQGTLGSGFPTALGAKVANPDRPVVAITGDGGFMFGVQELSTAVQFNIGVVTLVFNNNAYGNVRRDQRTRFDGRVVAADLVNPDFVKLAESFGVAASRVTAPDHFRPALEKALAHGGPSLIAVEVPRDSEVTPWTFIHPGCAQRRPGIWRLRRRKRNRADLRRFPERQVDALAAEQRVLAIGQRRHAVKGEPRRPAPDHDVAMHQPVTCRPVCTFQSAPQEGRGQAERHRDDRRVIVLLVAVLVQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 6 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 7 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 8 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 9 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 10 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 11 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 12 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 16 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 20 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 21 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 25 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 26 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 27 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 28 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 29 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 30 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 31 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 32 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 33 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 34 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 35 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 36 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 37 | 2791355199 | |||
| 38 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 39 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 40 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 41 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 42 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 43 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 44 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 45 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 46 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 47 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 48 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 49 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 50 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 51 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 52 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 53 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 54 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 55 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 56 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 57 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 58 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 59 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 60 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 61 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 62 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 63 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 64 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 65 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 66 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 67 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 68 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 69 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 70 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 71 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 72 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 73 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 74 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 75 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 76 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 77 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 78 | 2904699407 | |||
| 79 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 80 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 81 | 2906610324 | |||
| 82 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 83 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 84 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 85 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 86 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 87 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 88 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 89 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 90 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 91 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 92 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 93 | 2922368715 | |||
| 94 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 95 | 2922425934 | |||
| 96 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 97 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 98 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 99 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 100 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 101 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 102 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 103 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 104 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 105 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 106 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 107 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 108 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 109 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 110 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 111 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 112 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 113 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 114 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 115 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 116 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 117 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 118 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 119 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 120 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 121 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 122 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 123 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 124 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 125 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 126 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 127 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 128 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 129 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 130 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 131 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 132 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 133 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 134 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 135 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 136 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 137 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 138 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 139 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 140 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 141 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 142 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 143 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 144 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 145 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 146 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 147 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 148 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 149 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 150 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 151 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 152 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 153 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 154 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 155 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 156 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 157 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 158 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 159 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 160 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 161 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 162 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 163 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 164 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 165 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 166 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 167 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 168 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 169 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 170 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 171 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 172 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 173 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 174 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 176 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 177 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 178 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 180 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 181 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 184 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 186 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 187 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 188 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 191 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 192 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 193 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 194 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 195 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 197 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 200 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 201 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 202 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 203 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 204 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 205 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 206 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 207 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 208 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 209 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 210 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 211 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 212 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 213 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 215 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 216 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 217 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 218 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 219 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 220 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 222 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 223 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 224 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 225 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 235 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 236 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 240 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 241 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 242 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 243 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 244 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 245 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 246 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 251 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 254 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 301 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 302 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 303 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 304 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 308 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 309 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 310 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 311 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 312 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 313 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 314 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 315 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 316 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 317 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 318 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 319 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 320 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 321 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 322 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 323 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 324 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 325 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 326 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 327 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 328 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 329 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 330 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 331 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 332 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 333 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 334 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 335 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 336 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 337 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 338 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 339 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 340 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 341 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 342 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 343 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 344 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 345 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 346 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 347 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 348 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 349 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 350 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 351 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 352 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 353 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 354 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 355 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 356 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 357 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 358 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 359 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 360 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 361 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 362 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 363 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 364 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 365 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 366 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 367 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 368 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 369 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 370 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 371 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 372 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 429 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 430 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 431 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 432 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 433 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 434 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 436 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 437 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 438 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 439 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 440 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 441 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 442 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 443 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 444 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 445 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 446 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 447 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 448 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 449 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 450 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 451 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 479 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 480 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 486 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 489 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 490 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 491 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 492 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 493 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 494 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 495 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 496 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 497 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 498 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 499 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 500 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 501 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 502 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 503 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 504 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 505 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 506 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 507 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 508 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 509 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 510 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 511 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 512 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 513 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 514 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 515 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 516 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 517 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 518 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 519 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 521 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 522 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 523 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 524 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 525 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 526 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 527 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 528 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 529 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 530 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 531 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 532 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 533 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 534 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 535 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 536 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 537 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 538 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 539 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 540 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 541 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 542 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 543 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 544 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 545 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 546 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 547 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 548 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 549 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 550 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 551 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 552 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 553 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 554 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 555 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 556 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 557 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 558 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 559 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.8 |
| Metatranscriptomes | 0 |
| Isolates | 22.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.57 |
| Nodule | 18.36 |
| Rhizoplane | 6.19 |
| Rhizosphere | 53.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000214 | 3300003203 | Bacteria | 25609 |
| 2 | JGI25406J46586_10011772 | 3300003203 | Bacteria | 3819 |
| 3 | JGI25406J46586_10013111 | 3300003203 | Bacteria | 3574 |
| 4 | JGI25153J46596_10005616 | 3300003215 | Bacteria | 6556 |
| 5 | JGI25153J46596_10011211 | 3300003215 | Bacteria | 3980 |
| 6 | JGI25160J50197_1015299 | 3300003354 | Bacteria | 2525 |
| 7 | JGI25404J52841_10005921 | 3300003659 | Bacteria | 2538 |
| 8 | Ga0055536_1002776 | 3300003781 | Bacteria | 9691 |
| 9 | Ga0055540_1000098 | 3300003792 | Bacteria | 96649 |
| 10 | Ga0055540_1000450 | 3300003792 | Bacteria | 32053 |
| 11 | Ga0055540_1001832 | 3300003792 | Bacteria | 12014 |
| 12 | Ga0055531_10000635 | 3300003794 | Bacteria | 30252 |
| 13 | Ga0058692_1008427 | 3300003856 | Bacteria | 2661 |
| 14 | Ga0055543_1003833 | 3300004625 | Bacteria | 4269 |
| 15 | Ga0065165_1000048 | 3300005262 | Bacteria | 196539 |
| 16 | Ga0065165_1002220 | 3300005262 | Bacteria | 17337 |
| 17 | Ga0070658_10036019 | 3300005327 | Bacteria | 3987 |
| 18 | Ga0070683_100142289 | 3300005329 | Bacteria | 2273 |
| 19 | Ga0070683_100231605 | 3300005329 | Bacteria | 1756 |
| 20 | Ga0070680_100007991 | 3300005336 | Bacteria | 8078 |
| 21 | Ga0070680_100012621 | 3300005336 | Bacteria | 6567 |
| 22 | Ga0068868_100022399 | 3300005338 | Bacteria | 4767 |
| 23 | Ga0068868_100171781 | 3300005338 | Bacteria | 1794 |
| 24 | Ga0070660_100003001 | 3300005339 | Bacteria | 11625 |
| 25 | Ga0070660_100135869 | 3300005339 | Bacteria | 1970 |
| 26 | Ga0070689_100070593 | 3300005340 | Bacteria | 2728 |
| 27 | Ga0070691_10045166 | 3300005341 | Unclassified | 2090 |
| 28 | Ga0070668_100072015 | 3300005347 | Bacteria | 2692 |
| 29 | Ga0070668_100120141 | 3300005347 | Bacteria | 2100 |
| 30 | Ga0070675_100114799 | 3300005354 | Bacteria | 2282 |
| 31 | Ga0070709_10000203 | 3300005434 | Bacteria | 38151 |
| 32 | Ga0070709_10004227 | 3300005434 | Bacteria | 7743 |
| 33 | Ga0070709_10036894 | 3300005434 | Bacteria | 2981 |
| 34 | Ga0070709_10040280 | 3300005434 | Bacteria | 2871 |
| 35 | Ga0070714_100002121 | 3300005435 | Bacteria | 14564 |
| 36 | Ga0070714_100009406 | 3300005435 | Bacteria | 7683 |
| 37 | Ga0070713_100001761 | 3300005436 | Bacteria | 13967 |
| 38 | Ga0070713_100010384 | 3300005436 | Bacteria | 6727 |
| 39 | Ga0070713_100012830 | 3300005436 | Bacteria | 6162 |
| 40 | Ga0070713_100016592 | 3300005436 | Bacteria | 5539 |
| 41 | Ga0070710_10001622 | 3300005437 | Bacteria | 10623 |
| 42 | Ga0070701_10005782 | 3300005438 | Bacteria | 5147 |
| 43 | Ga0070701_10047203 | 3300005438 | Bacteria | 2217 |
| 44 | Ga0070711_100006659 | 3300005439 | Bacteria | 6985 |
| 45 | Ga0070711_100019115 | 3300005439 | Bacteria | 4390 |
| 46 | Ga0070711_100041758 | 3300005439 | Unclassified | 3099 |
| 47 | Ga0070711_100059731 | 3300005439 | Bacteria | 2648 |
| 48 | Ga0070663_100001485 | 3300005455 | Bacteria | 12892 |
| 49 | Ga0070663_100060541 | 3300005455 | Bacteria | 2724 |
| 50 | Ga0070663_100115250 | 3300005455 | Bacteria | 2024 |
| 51 | Ga0070663_100136246 | 3300005455 | Bacteria | 1870 |
| 52 | Ga0070681_10003273 | 3300005458 | Bacteria | 15113 |
| 53 | Ga0070681_10069475 | 3300005458 | Bacteria | 3489 |
| 54 | Ga0070706_100148505 | 3300005467 | Bacteria | 2188 |
| 55 | Ga0070679_100013810 | 3300005530 | Bacteria | 7739 |
| 56 | Ga0070679_100019456 | 3300005530 | Bacteria | 6601 |
| 57 | Ga0070679_100024100 | 3300005530 | Bacteria | 5962 |
| 58 | Ga0070684_100009975 | 3300005535 | Bacteria | 7508 |
| 59 | Ga0068853_100016892 | 3300005539 | Bacteria | 6014 |
| 60 | Ga0070672_100151133 | 3300005543 | Bacteria | 1921 |
| 61 | Ga0070695_100067456 | 3300005545 | Bacteria | 2333 |
| 62 | Ga0070693_100041241 | 3300005547 | Bacteria | 2596 |
| 63 | Ga0070665_100000229 | 3300005548 | Bacteria | 93160 |
| 64 | Ga0070665_100004434 | 3300005548 | Bacteria | 14746 |
| 65 | Ga0070665_100127191 | 3300005548 | Bacteria | 2550 |
| 66 | Ga0068855_100000283 | 3300005563 | Bacteria | 62643 |
| 67 | Ga0068855_100020164 | 3300005563 | Bacteria | 8006 |
| 68 | Ga0068855_100031608 | 3300005563 | Bacteria | 6321 |
| 69 | Ga0068855_100191175 | 3300005563 | Bacteria | 2309 |
| 70 | Ga0068857_100001551 | 3300005577 | Bacteria | 18401 |
| 71 | Ga0068857_100021668 | 3300005577 | Bacteria | 5655 |
| 72 | Ga0068854_100140792 | 3300005578 | Bacteria | 1851 |
| 73 | Ga0068856_100003347 | 3300005614 | Bacteria | 16276 |
| 74 | Ga0068856_100083462 | 3300005614 | Bacteria | 3173 |
| 75 | Ga0068859_100001045 | 3300005617 | Bacteria | 28373 |
| 76 | Ga0068864_100184021 | 3300005618 | Bacteria | 1912 |
| 77 | Ga0068870_10032793 | 3300005840 | Bacteria | 2645 |
| 78 | Ga0068863_100000126 | 3300005841 | Bacteria | 80622 |
| 79 | Ga0068858_100008148 | 3300005842 | Bacteria | 10073 |
| 80 | Ga0068858_100106470 | 3300005842 | Bacteria | 2617 |
| 81 | Ga0068860_100000081 | 3300005843 | Bacteria | 170066 |
| 82 | Ga0081455_10000730 | 3300005937 | Bacteria | 42670 |
| 83 | Ga0081455_10001734 | 3300005937 | Bacteria | 26379 |
| 84 | Ga0081455_10013417 | 3300005937 | Bacteria | 8100 |
| 85 | Ga0081455_10015026 | 3300005937 | Bacteria | 7541 |
| 86 | Ga0081455_10028177 | 3300005937 | Bacteria | 5135 |
| 87 | Ga0081538_10071250 | 3300005981 | Bacteria | 1913 |
| 88 | Ga0081540_1003965 | 3300005983 | Bacteria | 11501 |
| 89 | Ga0081540_1014480 | 3300005983 | Bacteria | 5048 |
| 90 | Ga0081540_1015123 | 3300005983 | Bacteria | 4898 |
| 91 | Ga0081540_1018499 | 3300005983 | Bacteria | 4270 |
| 92 | Ga0081540_1023084 | 3300005983 | Bacteria | 3652 |
| 93 | Ga0081539_10000058 | 3300005985 | Bacteria | 256212 |
| 94 | Ga0081539_10000768 | 3300005985 | Bacteria | 63055 |
| 95 | Ga0081539_10001470 | 3300005985 | Bacteria | 39952 |
| 96 | Ga0081539_10007479 | 3300005985 | Bacteria | 9938 |
| 97 | Ga0070717_10001267 | 3300006028 | Bacteria | 17258 |
| 98 | Ga0070717_10026341 | 3300006028 | Bacteria | 4638 |
| 99 | Ga0070717_10082336 | 3300006028 | Bacteria | 2704 |
| 100 | Ga0070717_10141457 | 3300006028 | Bacteria | 2076 |
| 101 | Ga0070716_100014285 | 3300006173 | Bacteria | 4065 |
| 102 | Ga0070716_100036351 | 3300006173 | Unclassified | 2715 |
| 103 | Ga0070712_100006733 | 3300006175 | Bacteria | 7144 |
| 104 | Ga0075370_10014516 | 3300006353 | Bacteria | 4204 |
| 105 | Ga0075428_100251938 | 3300006844 | Bacteria | 1903 |
| 106 | Ga0075430_100041932 | 3300006846 | Bacteria | 3871 |
| 107 | Ga0075433_10010163 | 3300006852 | Bacteria | 7548 |
| 108 | Ga0075433_10057133 | 3300006852 | Bacteria | 3410 |
| 109 | Ga0097620_100001045 | 3300006931 | Bacteria | 28373 |
| 110 | Ga0099824_1007408 | 3300006942 | Bacteria | 14551 |
| 111 | Ga0099822_1018218 | 3300006943 | Bacteria | 7346 |
| 112 | Ga0075435_100019518 | 3300007076 | Bacteria | 5181 |
| 113 | Ga0105240_10000944 | 3300009093 | Bacteria | 51695 |
| 114 | Ga0105240_10017034 | 3300009093 | Bacteria | 9816 |
| 115 | Ga0105240_10034221 | 3300009093 | Bacteria | 6557 |
| 116 | Ga0105240_10034709 | 3300009093 | Bacteria | 6503 |
| 117 | Ga0105240_10037447 | 3300009093 | Bacteria | 6234 |
| 118 | Ga0105240_10114967 | 3300009093 | Bacteria | 3250 |
| 119 | Ga0105240_10165503 | 3300009093 | Bacteria | 2623 |
| 120 | Ga0105240_10170691 | 3300009093 | Bacteria | 2577 |
| 121 | Ga0105240_10184829 | 3300009093 | Bacteria | 2456 |
| 122 | Ga0111539_10014859 | 3300009094 | Bacteria | 9707 |
| 123 | Ga0111539_10015429 | 3300009094 | Bacteria | 9504 |
| 124 | Ga0111539_10037482 | 3300009094 | Bacteria | 5853 |
| 125 | Ga0105245_10058514 | 3300009098 | Bacteria | 3469 |
| 126 | Ga0114129_10078597 | 3300009147 | Bacteria | 4588 |
| 127 | Ga0114129_10411862 | 3300009147 | Bacteria | 1780 |
| 128 | Ga0105241_10007759 | 3300009174 | Bacteria | 7890 |
| 129 | Ga0105241_10021246 | 3300009174 | Bacteria | 4797 |
| 130 | Ga0105241_10041064 | 3300009174 | Bacteria | 3493 |
| 131 | Ga0105248_10039794 | 3300009177 | Bacteria | 5268 |
| 132 | Ga0105237_10016720 | 3300009545 | Bacteria | 7617 |
| 133 | Ga0105237_10018952 | 3300009545 | Bacteria | 7111 |
| 134 | Ga0105237_10023096 | 3300009545 | Bacteria | 6377 |
| 135 | Ga0105237_10046497 | 3300009545 | Bacteria | 4365 |
| 136 | Ga0105237_10084676 | 3300009545 | Bacteria | 3161 |
| 137 | Ga0105237_10098524 | 3300009545 | Bacteria | 2914 |
| 138 | Ga0105237_10158498 | 3300009545 | Bacteria | 2261 |
| 139 | Ga0105238_10021930 | 3300009551 | Bacteria | 6508 |
| 140 | Ga0105238_10025577 | 3300009551 | Bacteria | 6019 |
| 141 | Ga0105238_10132830 | 3300009551 | Bacteria | 2467 |
| 142 | Ga0105238_10137354 | 3300009551 | Bacteria | 2422 |
| 143 | Ga0105249_10067353 | 3300009553 | Bacteria | 3299 |
| 144 | Ga0105239_10011360 | 3300010375 | Bacteria | 9935 |
| 145 | Ga0105239_10051695 | 3300010375 | Bacteria | 4504 |
| 146 | Ga0105239_10091133 | 3300010375 | Bacteria | 3364 |
| 147 | Ga0157369_10012270 | 3300013105 | Bacteria | 9731 |
| 148 | Ga0157369_10021190 | 3300013105 | Bacteria | 7267 |
| 149 | Ga0157369_10056186 | 3300013105 | Bacteria | 4248 |
| 150 | Ga0157369_10160148 | 3300013105 | Bacteria | 2376 |
| 151 | Ga0157378_10009041 | 3300013297 | Bacteria | 8671 |
| 152 | Ga0163163_10001576 | 3300014325 | Bacteria | 19224 |
| 153 | Ga0163163_10011315 | 3300014325 | Bacteria | 8088 |
| 154 | Ga0163163_10150767 | 3300014325 | Bacteria | 2369 |
| 155 | Ga0157380_10088443 | 3300014326 | Bacteria | 2549 |
| 156 | Ga0157376_10080530 | 3300014969 | Bacteria | 2794 |
| 157 | Ga0214544_1001813 | 3300021320 | Bacteria | 44864 |
| 158 | Ga0214542_1001236 | 3300021321 | Bacteria | 51849 |
| 159 | Ga0214545_1000924 | 3300021324 | Bacteria | 51830 |
| 160 | Ga0214543_1003531 | 3300021327 | Bacteria | 30263 |
| 161 | Ga0214543_1024471 | 3300021327 | Bacteria | 3724 |
| 162 | Ga0213874_10003719 | 3300021377 | Bacteria | 3415 |
| 163 | Ga0213874_10013879 | 3300021377 | Bacteria | 2097 |
| 164 | Ga0213876_10008410 | 3300021384 | Bacteria | 5584 |
| 165 | Ga0213875_10000880 | 3300021388 | Bacteria | 22051 |
| 166 | Ga0209563_104010 | 3300025230 | Bacteria | 2901 |
| 167 | Ga0209148_1000180 | 3300025254 | Bacteria | 124830 |
| 168 | Ga0209233_1001700 | 3300025261 | Bacteria | 8514 |
| 169 | Ga0209233_1011023 | 3300025261 | Bacteria | 2678 |
| 170 | Ga0209455_1001704 | 3300025272 | Bacteria | 9408 |
| 171 | Ga0209455_1004280 | 3300025272 | Bacteria | 4732 |
| 172 | Ga0209673_1000206 | 3300025273 | Bacteria | 118136 |
| 173 | Ga0209130_1000071 | 3300025284 | Bacteria | 178273 |
| 174 | Ga0209025_1002646 | 3300025294 | Bacteria | 18319 |
| 175 | Ga0209564_1000385 | 3300025295 | Bacteria | 80273 |
| 176 | Ga0209758_1000115 | 3300025297 | Bacteria | 199268 |
| 177 | Ga0209758_1001210 | 3300025297 | Bacteria | 32486 |
| 178 | Ga0209758_1004569 | 3300025297 | Bacteria | 11413 |
| 179 | Ga0209758_1008059 | 3300025297 | Bacteria | 6953 |
| 180 | Ga0209050_1005280 | 3300025298 | Bacteria | 8219 |
| 181 | Ga0207426_1000572 | 3300025302 | Bacteria | 49561 |
| 182 | Ga0209051_1000359 | 3300025303 | Bacteria | 67167 |
| 183 | Ga0209051_1024810 | 3300025303 | Bacteria | 2456 |
| 184 | Ga0209257_1001808 | 3300025304 | Bacteria | 23469 |
| 185 | Ga0209257_1002263 | 3300025304 | Bacteria | 19660 |
| 186 | Ga0207692_10003008 | 3300025898 | Bacteria | 6534 |
| 187 | Ga0207692_10015388 | 3300025898 | Bacteria | 3365 |
| 188 | Ga0207692_10088948 | 3300025898 | Bacteria | 1670 |
| 189 | Ga0207688_10043415 | 3300025901 | Bacteria | 2503 |
| 190 | Ga0207688_10049164 | 3300025901 | Bacteria | 2356 |
| 191 | Ga0207699_10008564 | 3300025906 | Bacteria | 5056 |
| 192 | Ga0207699_10020956 | 3300025906 | Bacteria | 3514 |
| 193 | Ga0207705_10043989 | 3300025909 | Bacteria | 3208 |
| 194 | Ga0207654_10014803 | 3300025911 | Bacteria | 4037 |
| 195 | Ga0207707_10000419 | 3300025912 | Bacteria | 44410 |
| 196 | Ga0207707_10002705 | 3300025912 | Bacteria | 15850 |
| 197 | Ga0207707_10018343 | 3300025912 | Bacteria | 6098 |
| 198 | Ga0207707_10066929 | 3300025912 | Bacteria | 3128 |
| 199 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 200 | Ga0207695_10008914 | 3300025913 | Bacteria | 12491 |
| 201 | Ga0207695_10077014 | 3300025913 | Bacteria | 3389 |
| 202 | Ga0207695_10136750 | 3300025913 | Bacteria | 2403 |
| 203 | Ga0207671_10005294 | 3300025914 | Bacteria | 11960 |
| 204 | Ga0207671_10016590 | 3300025914 | Bacteria | 5718 |
| 205 | Ga0207671_10045059 | 3300025914 | Bacteria | 3261 |
| 206 | Ga0207693_10006974 | 3300025915 | Bacteria | 9332 |
| 207 | Ga0207693_10014354 | 3300025915 | Bacteria | 6372 |
| 208 | Ga0207693_10019720 | 3300025915 | Bacteria | 5362 |
| 209 | Ga0207693_10037039 | 3300025915 | Bacteria | 3845 |
| 210 | Ga0207693_10081201 | 3300025915 | Bacteria | 2538 |
| 211 | Ga0207693_10088222 | 3300025915 | Bacteria | 2431 |
| 212 | Ga0207663_10001473 | 3300025916 | Bacteria | 10968 |
| 213 | Ga0207663_10002050 | 3300025916 | Bacteria | 9597 |
| 214 | Ga0207663_10017003 | 3300025916 | Unclassified | 4044 |
| 215 | Ga0207663_10088244 | 3300025916 | Bacteria | 2051 |
| 216 | Ga0207660_10034957 | 3300025917 | Bacteria | 3486 |
| 217 | Ga0207660_10055477 | 3300025917 | Bacteria | 2832 |
| 218 | Ga0207657_10001672 | 3300025919 | Bacteria | 23919 |
| 219 | Ga0207657_10006890 | 3300025919 | Bacteria | 11724 |
| 220 | Ga0207649_10059216 | 3300025920 | Bacteria | 2402 |
| 221 | Ga0207652_10001690 | 3300025921 | Bacteria | 19300 |
| 222 | Ga0207694_10005031 | 3300025924 | Bacteria | 10225 |
| 223 | Ga0207700_10009160 | 3300025928 | Bacteria | 6168 |
| 224 | Ga0207700_10026155 | 3300025928 | Bacteria | 4065 |
| 225 | Ga0207664_10000425 | 3300025929 | Bacteria | 30101 |
| 226 | Ga0207664_10002721 | 3300025929 | Bacteria | 11731 |
| 227 | Ga0207644_10035487 | 3300025931 | Bacteria | 3495 |
| 228 | Ga0207669_10014394 | 3300025937 | Bacteria | 3963 |
| 229 | Ga0207704_10015826 | 3300025938 | Bacteria | 3857 |
| 230 | Ga0207665_10001320 | 3300025939 | Bacteria | 16732 |
| 231 | Ga0207665_10001972 | 3300025939 | Bacteria | 13825 |
| 232 | Ga0207665_10061672 | 3300025939 | Bacteria | 2542 |
| 233 | Ga0207689_10017224 | 3300025942 | Bacteria | 6114 |
| 234 | Ga0207689_10073542 | 3300025942 | Bacteria | 2808 |
| 235 | Ga0207661_10001270 | 3300025944 | Bacteria | 16867 |
| 236 | Ga0207679_10024233 | 3300025945 | Bacteria | 4160 |
| 237 | Ga0207679_10031497 | 3300025945 | Bacteria | 3712 |
| 238 | Ga0207667_10002017 | 3300025949 | Bacteria | 25487 |
| 239 | Ga0207712_10021041 | 3300025961 | Bacteria | 4278 |
| 240 | Ga0207668_10018860 | 3300025972 | Bacteria | 4348 |
| 241 | Ga0207640_10116625 | 3300025981 | Bacteria | 1904 |
| 242 | Ga0207703_10032019 | 3300026035 | Bacteria | 4160 |
| 243 | Ga0207639_10018667 | 3300026041 | Bacteria | 4932 |
| 244 | Ga0207678_10000089 | 3300026067 | Bacteria | 75976 |
| 245 | Ga0207678_10013434 | 3300026067 | Bacteria | 7187 |
| 246 | Ga0207678_10033534 | 3300026067 | Bacteria | 4472 |
| 247 | Ga0207678_10119968 | 3300026067 | Bacteria | 2244 |
| 248 | Ga0207708_10021169 | 3300026075 | Bacteria | 4905 |
| 249 | Ga0207708_10028255 | 3300026075 | Bacteria | 4247 |
| 250 | Ga0207708_10051448 | 3300026075 | Bacteria | 3136 |
| 251 | Ga0207702_10000548 | 3300026078 | Bacteria | 41978 |
| 252 | Ga0207702_10205565 | 3300026078 | Bacteria | 1828 |
| 253 | Ga0207641_10000503 | 3300026088 | Bacteria | 43979 |
| 254 | Ga0207648_10095735 | 3300026089 | Bacteria | 2597 |
| 255 | Ga0207648_10129840 | 3300026089 | Bacteria | 2218 |
| 256 | Ga0207676_10022448 | 3300026095 | Bacteria | 4642 |
| 257 | Ga0207674_10024654 | 3300026116 | Bacteria | 6423 |
| 258 | Ga0207674_10030004 | 3300026116 | Bacteria | 5721 |
| 259 | Ga0207674_10034375 | 3300026116 | Bacteria | 5300 |
| 260 | Ga0207674_10165888 | 3300026116 | Bacteria | 2163 |
| 261 | Ga0207675_100016194 | 3300026118 | Bacteria | 6960 |
| 262 | Ga0207675_100022726 | 3300026118 | Bacteria | 5835 |
| 263 | Ga0207675_100152562 | 3300026118 | Bacteria | 2200 |
| 264 | Ga0207683_10102624 | 3300026121 | Bacteria | 2554 |
| 265 | Ga0207698_10048930 | 3300026142 | Bacteria | 3213 |
| 266 | Ga0209371_1000741 | 3300027312 | Bacteria | 27385 |
| 267 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 268 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 269 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 270 | Ga0207428_10017652 | 3300027907 | Bacteria | 6119 |
| 271 | Ga0268266_10006018 | 3300028379 | Bacteria | 11191 |
| 272 | Ga0268266_10008590 | 3300028379 | Bacteria | 9072 |
| 273 | Ga0268266_10071038 | 3300028379 | Bacteria | 3017 |
| 274 | Ga0268265_10072621 | 3300028380 | Bacteria | 2684 |
| 275 | Ga0268264_10000048 | 3300028381 | Bacteria | 334457 |
| 276 | Ga0265334_10001696 | 3300028573 | Bacteria | 10529 |
| 277 | Ga0265334_10008302 | 3300028573 | Bacteria | 4418 |
| 278 | Ga0265322_10001590 | 3300028654 | Bacteria | 7289 |
| 279 | Ga0265336_10000135 | 3300028666 | Bacteria | 52478 |
| 280 | Ga0307517_10000634 | 3300028786 | Bacteria | 60194 |
| 281 | Ga0307515_10006012 | 3300028794 | Bacteria | 24419 |
| 282 | Ga0307515_10022923 | 3300028794 | Bacteria | 10979 |
| 283 | Ga0307515_10102563 | 3300028794 | Bacteria | 3440 |
| 284 | Ga0265338_10000034 | 3300028800 | Bacteria | 244623 |
| 285 | Ga0265338_10006948 | 3300028800 | Bacteria | 14236 |
| 286 | Ga0265324_10016573 | 3300029957 | Bacteria | 2687 |
| 287 | Ga0268256_1001268 | 3300030500 | Bacteria | 15677 |
| 288 | Ga0265330_10018111 | 3300031235 | Bacteria | 3237 |
| 289 | Ga0265332_10033695 | 3300031238 | Bacteria | 2229 |
| 290 | Ga0265340_10027705 | 3300031247 | Bacteria | 2855 |
| 291 | Ga0265339_10004321 | 3300031249 | Bacteria | 9716 |
| 292 | Ga0265331_10008950 | 3300031250 | Bacteria | 5658 |
| 293 | Ga0265331_10013135 | 3300031250 | Bacteria | 4461 |
| 294 | Ga0307513_10082153 | 3300031456 | Bacteria | 3318 |
| 295 | Ga0307509_10000840 | 3300031507 | Bacteria | 52810 |
| 296 | Ga0307509_10005537 | 3300031507 | Bacteria | 17522 |
| 297 | Ga0307509_10120250 | 3300031507 | Bacteria | 2606 |
| 298 | Ga0307408_100044133 | 3300031548 | Bacteria | 3176 |
| 299 | Ga0307508_10000032 | 3300031616 | Bacteria | 163293 |
| 300 | Ga0307508_10026534 | 3300031616 | Bacteria | 5251 |
| 301 | Ga0307508_10042188 | 3300031616 | Bacteria | 4094 |
| 302 | Ga0265314_10004266 | 3300031711 | Bacteria | 13380 |
| 303 | Ga0265342_10020228 | 3300031712 | Bacteria | 4276 |
| 304 | Ga0307516_10005934 | 3300031730 | Bacteria | 14450 |
| 305 | Ga0307516_10010247 | 3300031730 | Bacteria | 10328 |
| 306 | Ga0307516_10082192 | 3300031730 | Bacteria | 3063 |
| 307 | Ga0307413_10036229 | 3300031824 | Bacteria | 2839 |
| 308 | Ga0307409_100050246 | 3300031995 | Bacteria | 3183 |
| 309 | Ga0307416_100105720 | 3300032002 | Bacteria | 2465 |
| 310 | Ga0307411_10092001 | 3300032005 | Bacteria | 2120 |
| 311 | Ga0307507_10011278 | 3300033179 | Bacteria | 11327 |
| 312 | Ga0307507_10012617 | 3300033179 | Bacteria | 10410 |
| 313 | Ga0307507_10140766 | 3300033179 | Bacteria | 1851 |
| 314 | Ga0307510_10023885 | 3300033180 | Bacteria | 7075 |
| 315 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 316 | Ga0373926_0018702 | 3300035083 | Bacteria | 2386 |
| 317 | Ga0373934_0005355 | 3300035086 | Bacteria | 4752 |
| 318 | Ga0373952_0010982 | 3300035092 | Bacteria | 1759 |
| 319 | Ga0373923_0021021 | 3300035111 | Bacteria | 2543 |
| 320 | Ga0373936_0009069 | 3300035113 | Bacteria | 3752 |
| 321 | Ga0373945_0014977 | 3300035116 | Bacteria | 2604 |
| 322 | Ga0373953_0000604 | 3300035117 | Bacteria | 9932 |
| 323 | Ga0373953_0025139 | 3300035117 | Bacteria | 2272 |
| 324 | Ga0373954_0008754 | 3300035118 | Bacteria | 4450 |
| 325 | Ga0373954_0025683 | 3300035118 | Bacteria | 2695 |
| 326 | Ga0373956_0001292 | 3300035119 | Bacteria | 10365 |
| 327 | Ga0373957_0015911 | 3300035120 | Bacteria | 2596 |
| 328 | Ga0373943_0008899 | 3300035170 | Bacteria | 4498 |
| 329 | Ga0373946_0004997 | 3300035171 | Bacteria | 4775 |
| 330 | Ga0373955_0020984 | 3300035172 | Bacteria | 3290 |
| 331 | Ga0373924_0037068 | 3300035410 | Bacteria | 1983 |
| 332 | Ga0373931_0000333 | 3300035691 | Bacteria | 19659 |
| 333 | Ga0373931_0000972 | 3300035691 | Bacteria | 12128 |
| 334 | Ga0373931_0003529 | 3300035691 | Bacteria | 7049 |
| 335 | Ga0373931_0009359 | 3300035691 | Bacteria | 4683 |
| 336 | Ga0373927_0002882 | 3300035695 | Bacteria | 12525 |
| 337 | Ga0373927_0013220 | 3300035695 | Bacteria | 5489 |
| 338 | Ga0373927_0021108 | 3300035695 | Bacteria | 4268 |
| 339 | Ga0373927_0082950 | 3300035695 | Bacteria | 2078 |
| 340 | Ga0373933_0000182 | 3300035724 | Bacteria | 41434 |
| 341 | Ga0373933_0013111 | 3300035724 | Bacteria | 4590 |
| 342 | Ga0373933_0067748 | 3300035724 | Bacteria | 2166 |
| 343 | Ga0373947_0036931 | 3300035725 | Bacteria | 2897 |
| 344 | Ga0373937_0028281 | 3300036401 | Bacteria | 5072 |
| 345 | Ga0373937_0031478 | 3300036401 | Bacteria | 4807 |
| 346 | Ga0373937_0075826 | 3300036401 | Bacteria | 3105 |
| 347 | Ga0373937_0102341 | 3300036401 | Bacteria | 2659 |
| 348 | Ga0373925_0023291 | 3300037068 | Bacteria | 4519 |
| 349 | Ga0395898_0015307 | 3300037466 | Bacteria | 7872 |
| 350 | Ga0395898_0022553 | 3300037466 | Bacteria | 6376 |
| 351 | Ga0395898_0036427 | 3300037466 | Bacteria | 4885 |
| 352 | Ga0395905_0091429 | 3300037471 | Bacteria | 2853 |
| 353 | Ga0436364_0899751 | 3300037853 | Bacteria | 1943 |
| 354 | Ga0436364_1001517 | 3300037853 | Bacteria | 39180 |
| 355 | Ga0436364_1222257 | 3300037853 | Bacteria | 3625 |
| 356 | Ga0395901_0104867 | 3300038443 | Bacteria | 2967 |
| 357 | Ga0395901_0143373 | 3300038443 | Bacteria | 2511 |
| 358 | Ga0400483_068219 | 3300039062 | Bacteria | 6843 |
| 359 | Ga0400483_086418 | 3300039062 | Bacteria | 4191 |
| 360 | Ga0436365_0862990 | 3300039437 | Bacteria | 14031 |
| 361 | Ga0436363_1480026 | 3300039450 | Bacteria | 16321 |
| 362 | Ga0436363_1487883 | 3300039450 | Bacteria | 10937 |
| 363 | Ga0436362_0413279 | 3300039453 | Bacteria | 4306 |
| 364 | Ga0466969_0007732 | 3300044656 | Bacteria | 5715 |
| 365 | Ga0466972_0000172 | 3300044658 | Bacteria | 50564 |
| 366 | Ga0466972_0025282 | 3300044658 | Bacteria | 2944 |
| 367 | Ga0466966_0000128 | 3300044684 | Bacteria | 48511 |
| 368 | Ga0466961_0000236 | 3300044693 | Bacteria | 37237 |
| 369 | Ga0466963_0164241 | 3300044694 | Bacteria | 1546 |
| 370 | Ga0466968_0023471 | 3300044735 | Bacteria | 2513 |
| 371 | Ga0466957_0047062 | 3300044842 | Bacteria | 2620 |
| 372 | Ga0466960_0025406 | 3300044901 | Bacteria | 2680 |
| 373 | Ga0466960_0026031 | 3300044901 | Bacteria | 2653 |
| 374 | Ga0466959_0001099 | 3300045049 | Bacteria | 16214 |
| 375 | Ga0466959_0017193 | 3300045049 | Bacteria | 5297 |
| 376 | Ga0466967_0033446 | 3300045976 | Bacteria | 4353 |
| 377 | Ga0466967_0193005 | 3300045976 | Bacteria | 1926 |
| 378 | Ga0495627_000642 | 3300046453 | Bacteria | 27306 |
| 379 | Ga0495592_0013200 | 3300046454 | Bacteria | 6288 |
| 380 | Ga0495592_0036667 | 3300046454 | Bacteria | 3691 |
| 381 | Ga0495592_0060346 | 3300046454 | Bacteria | 2790 |
| 382 | Ga0495603_0000217 | 3300046455 | Bacteria | 29788 |
| 383 | Ga0495603_0015187 | 3300046455 | Bacteria | 4659 |
| 384 | Ga0495603_0025667 | 3300046455 | Bacteria | 3563 |
| 385 | Ga0495603_0034107 | 3300046455 | Bacteria | 3062 |
| 386 | Ga0495629_0000862 | 3300046459 | Bacteria | 24478 |
| 387 | Ga0495629_0053128 | 3300046459 | Bacteria | 2835 |
| 388 | Ga0495638_0005277 | 3300046460 | Bacteria | 9656 |
| 389 | Ga0495638_0007591 | 3300046460 | Bacteria | 7759 |
| 390 | Ga0495641_0003672 | 3300046461 | Bacteria | 11330 |
| 391 | Ga0495653_0002374 | 3300046463 | Bacteria | 14971 |
| 392 | Ga0495653_0036154 | 3300046463 | Bacteria | 3892 |
| 393 | Ga0495580_0005364 | 3300046472 | Bacteria | 10616 |
| 394 | Ga0495580_0006588 | 3300046472 | Bacteria | 9437 |
| 395 | Ga0495582_0000990 | 3300046473 | Bacteria | 15910 |
| 396 | Ga0495582_0010745 | 3300046473 | Bacteria | 5037 |
| 397 | Ga0495639_0000544 | 3300046475 | Bacteria | 17562 |
| 398 | Ga0495662_0001589 | 3300046476 | Bacteria | 11287 |
| 399 | Ga0495664_0001505 | 3300046477 | Bacteria | 12344 |
| 400 | Ga0495664_0028129 | 3300046477 | Bacteria | 3282 |
| 401 | Ga0495584_0025028 | 3300046491 | Bacteria | 3026 |
| 402 | Ga0495585_0024148 | 3300046492 | Bacteria | 3487 |
| 403 | Ga0495594_0000128 | 3300046499 | Bacteria | 35750 |
| 404 | Ga0495606_0021320 | 3300046507 | Bacteria | 4747 |
| 405 | Ga0495608_0002876 | 3300046511 | Bacteria | 12326 |
| 406 | Ga0495608_0039619 | 3300046511 | Bacteria | 3157 |
| 407 | Ga0495618_0009642 | 3300046514 | Bacteria | 5830 |
| 408 | Ga0495628_0040736 | 3300046516 | Bacteria | 3710 |
| 409 | Ga0495630_0018933 | 3300046517 | Bacteria | 5060 |
| 410 | Ga0495630_0162802 | 3300046517 | Bacteria | 1698 |
| 411 | Ga0495637_0000328 | 3300046520 | Bacteria | 36941 |
| 412 | Ga0495643_0079997 | 3300046522 | Bacteria | 1702 |
| 413 | Ga0495648_0000936 | 3300046524 | Bacteria | 30292 |
| 414 | Ga0495648_0021356 | 3300046524 | Unclassified | 4485 |
| 415 | Ga0495648_0054832 | 3300046524 | Bacteria | 2406 |
| 416 | Ga0495652_0167087 | 3300046529 | Bacteria | 1702 |
| 417 | Ga0495665_0006186 | 3300046531 | Bacteria | 6465 |
| 418 | Ga0495640_0002595 | 3300046533 | Bacteria | 14526 |
| 419 | Ga0495640_0038605 | 3300046533 | Bacteria | 3358 |
| 420 | Ga0495587_0004571 | 3300046536 | Bacteria | 9088 |
| 421 | Ga0495587_0035375 | 3300046536 | Bacteria | 3008 |
| 422 | Ga0495587_0056120 | 3300046536 | Bacteria | 2318 |
| 423 | Ga0495645_0013557 | 3300046543 | Bacteria | 5768 |
| 424 | Ga0495622_0014846 | 3300046557 | Bacteria | 3620 |
| 425 | Ga0495667_0017811 | 3300046559 | Bacteria | 4799 |
| 426 | Ga0495667_0042318 | 3300046559 | Bacteria | 3020 |
| 427 | Ga0495667_0093450 | 3300046559 | Bacteria | 1947 |
| 428 | Ga0495634_0001583 | 3300046642 | Bacteria | 19998 |
| 429 | Ga0495625_0021621 | 3300046660 | Bacteria | 4948 |
| 430 | Ga0495635_0000436 | 3300046663 | Bacteria | 26341 |
| 431 | Ga0495635_0015088 | 3300046663 | Bacteria | 5404 |
| 432 | Ga0495635_0018594 | 3300046663 | Bacteria | 4847 |
| 433 | Ga0495635_0041063 | 3300046663 | Bacteria | 3196 |
| 434 | Ga0495588_0002049 | 3300046674 | Bacteria | 8621 |
| 435 | Ga0495657_0019591 | 3300046675 | Bacteria | 4879 |
| 436 | Ga0495599_0019045 | 3300046678 | Bacteria | 4280 |
| 437 | Ga0495599_0063533 | 3300046678 | Bacteria | 2307 |
| 438 | Ga0495623_0015025 | 3300046679 | Bacteria | 5005 |
| 439 | Ga0495623_0052805 | 3300046679 | Bacteria | 2568 |
| 440 | Ga0495646_0005491 | 3300046680 | Bacteria | 8015 |
| 441 | Ga0495646_0013510 | 3300046680 | Bacteria | 5190 |
| 442 | Ga0495646_0014776 | 3300046680 | Bacteria | 4962 |
| 443 | Ga0495647_0000394 | 3300046681 | Bacteria | 12460 |
| 444 | Ga0495658_0003203 | 3300046683 | Bacteria | 8153 |
| 445 | Ga0495658_0010677 | 3300046683 | Bacteria | 4599 |
| 446 | Ga0495669_0000650 | 3300046684 | Bacteria | 15146 |
| 447 | Ga0495669_0064047 | 3300046684 | Bacteria | 1668 |
| 448 | Ga0495613_0017135 | 3300046689 | Bacteria | 5394 |
| 449 | Ga0495613_0098186 | 3300046689 | Bacteria | 2116 |
| 450 | Ga0495624_0021243 | 3300046690 | Bacteria | 4308 |
| 451 | Ga0495624_0024480 | 3300046690 | Bacteria | 3972 |
| 452 | Ga0495624_0044115 | 3300046690 | Bacteria | 2843 |
| 453 | Ga0495600_0034678 | 3300046809 | Bacteria | 3277 |
| 454 | Ga0495600_0121999 | 3300046809 | Bacteria | 1695 |
| 455 | Ga0495581_0003127 | 3300047315 | Bacteria | 9472 |
| 456 | Ga0495581_0029014 | 3300047315 | Bacteria | 3208 |
| 457 | Ga0495581_0060277 | 3300047315 | Bacteria | 2193 |
| 458 | Ga0495581_0074093 | 3300047315 | Bacteria | 1970 |
| 459 | Ga0495674_0007898 | 3300047319 | Bacteria | 10159 |
| 460 | Ga0495674_0008903 | 3300047319 | Bacteria | 9546 |
| 461 | Ga0495674_0020170 | 3300047319 | Bacteria | 6174 |
| 462 | Ga0495674_0041495 | 3300047319 | Bacteria | 4110 |
| 463 | Ga0495672_0006488 | 3300047320 | Bacteria | 9047 |
| 464 | Ga0495672_0042578 | 3300047320 | Bacteria | 2737 |
| 465 | Ga0495676_0028303 | 3300047321 | Bacteria | 4787 |
| 466 | Ga0495680_0001711 | 3300047322 | Bacteria | 23324 |
| 467 | Ga0495675_0005291 | 3300047444 | Bacteria | 7859 |
| 468 | Ga0495684_0022668 | 3300047471 | Bacteria | 4830 |
| 469 | Ga0495684_0024888 | 3300047471 | Bacteria | 4604 |
| 470 | Ga0495684_0039304 | 3300047471 | Bacteria | 3626 |
| 471 | Ga0495684_0082746 | 3300047471 | Bacteria | 2434 |
| 472 | Ga0495686_0007775 | 3300047472 | Bacteria | 7981 |
| 473 | Ga0495593_0000439 | 3300047673 | Bacteria | 23237 |
| 474 | Ga0495602_0009113 | 3300048088 | Bacteria | 10332 |
| 475 | Ga0496100_0043018 | 3300048903 | Bacteria | 2887 |
| 476 | Ga0496100_0053587 | 3300048903 | Bacteria | 2627 |
| 477 | Ga0496101_0031035 | 3300048904 | Bacteria | 3753 |
| 478 | Ga0496101_0133023 | 3300048904 | Bacteria | 1890 |
| 479 | Ga0496102_0001771 | 3300048905 | Bacteria | 18745 |
| 480 | Ga0496102_0085244 | 3300048905 | Bacteria | 2916 |
| 481 | Ga0496102_0114203 | 3300048905 | Bacteria | 2520 |
| 482 | Ga0496102_0177997 | 3300048905 | Bacteria | 2003 |
| 483 | Ga0496103_0052678 | 3300048906 | Bacteria | 2520 |
| 484 | Ga0496104_0011101 | 3300048907 | Bacteria | 8061 |
| 485 | Ga0496104_0015144 | 3300048907 | Bacteria | 6978 |
| 486 | Ga0496104_0058723 | 3300048907 | Bacteria | 3641 |
| 487 | Ga0496104_0070856 | 3300048907 | Bacteria | 3315 |
| 488 | Ga0496104_0087081 | 3300048907 | Bacteria | 2982 |
| 489 | Ga0496104_0159382 | 3300048907 | Bacteria | 2165 |
| 490 | Ga0496105_0003099 | 3300048908 | Bacteria | 12229 |
| 491 | Ga0496105_0048124 | 3300048908 | Bacteria | 3519 |
| 492 | Ga0496105_0069984 | 3300048908 | Bacteria | 2900 |
| 493 | Ga0496105_0127461 | 3300048908 | Bacteria | 2098 |
| 494 | Ga0496106_0009997 | 3300048909 | Bacteria | 7007 |
| 495 | Ga0496107_0005793 | 3300048910 | Bacteria | 8456 |
| 496 | Ga0496107_0009818 | 3300048910 | Bacteria | 6638 |
| 497 | Ga0496107_0115098 | 3300048910 | Bacteria | 1979 |
| 498 | Ga0496108_0003885 | 3300048911 | Bacteria | 11996 |
| 499 | Ga0496108_0019931 | 3300048911 | Bacteria | 5508 |
| 500 | Ga0496108_0022937 | 3300048911 | Bacteria | 5136 |
| 501 | Ga0496109_0016029 | 3300048912 | Bacteria | 6550 |
| 502 | Ga0496109_0135498 | 3300048912 | Bacteria | 2300 |
| 503 | Ga0496109_0143471 | 3300048912 | Bacteria | 2233 |
| 504 | Ga0496110_0013689 | 3300048913 | Bacteria | 6719 |
| 505 | Ga0496110_0014333 | 3300048913 | Bacteria | 6577 |
| 506 | Ga0496110_0017906 | 3300048913 | Bacteria | 5931 |
| 507 | Ga0496110_0070692 | 3300048913 | Bacteria | 3093 |
| 508 | Ga0496111_0013221 | 3300048914 | Bacteria | 5611 |
| 509 | Ga0496111_0023874 | 3300048914 | Bacteria | 4297 |
| 510 | Ga0496111_0027477 | 3300048914 | Bacteria | 4025 |
| 511 | Ga0496111_0039869 | 3300048914 | Bacteria | 3370 |
| 512 | Ga0496112_0000017 | 3300048915 | Bacteria | 191284 |
| 513 | Ga0496112_0019263 | 3300048915 | Bacteria | 6437 |
| 514 | Ga0496112_0023520 | 3300048915 | Bacteria | 5888 |
| 515 | Ga0496112_0108292 | 3300048915 | Bacteria | 2749 |
| 516 | Ga0496112_0141386 | 3300048915 | Bacteria | 2376 |
| 517 | Ga0496112_0189591 | 3300048915 | Bacteria | 2018 |
| 518 | Ga0496113_0006361 | 3300048916 | Bacteria | 7474 |
| 519 | Ga0496113_0013216 | 3300048916 | Bacteria | 5582 |
| 520 | Ga0496113_0043065 | 3300048916 | Bacteria | 3338 |
| 521 | Ga0496113_0043185 | 3300048916 | Bacteria | 3335 |
| 522 | Ga0496114_0249115 | 3300048917 | Bacteria | 1563 |
| 523 | Ga0496115_0002841 | 3300048918 | Bacteria | 12459 |
| 524 | Ga0496115_0020774 | 3300048918 | Bacteria | 5066 |
| 525 | Ga0496115_0039864 | 3300048918 | Bacteria | 3732 |
| 526 | Ga0496115_0039874 | 3300048918 | Bacteria | 3732 |
| 527 | Ga0496115_0088101 | 3300048918 | Unclassified | 2534 |
| 528 | Ga0496116_0000588 | 3300048919 | Bacteria | 48678 |
| 529 | Ga0496116_0003125 | 3300048919 | Bacteria | 16633 |
| 530 | Ga0496116_0018009 | 3300048919 | Bacteria | 5461 |
| 531 | Ga0496117_0008313 | 3300048920 | Bacteria | 9876 |
| 532 | Ga0496117_0091650 | 3300048920 | Bacteria | 1954 |
| 533 | Ga0496118_0000781 | 3300048921 | Bacteria | 51011 |
| 534 | Ga0496118_0003407 | 3300048921 | Bacteria | 20095 |
| 535 | Ga0496119_0034548 | 3300048922 | Bacteria | 3326 |
| 536 | Ga0496120_0047967 | 3300048923 | Bacteria | 2460 |
| 537 | Ga0496121_0000230 | 3300048924 | Bacteria | 120616 |
| 538 | Ga0496121_0000359 | 3300048924 | Bacteria | 93676 |
| 539 | Ga0496121_0004694 | 3300048924 | Bacteria | 18101 |
| 540 | Ga0496121_0008031 | 3300048924 | Bacteria | 12580 |
| 541 | Ga0496121_0010422 | 3300048924 | Bacteria | 10487 |
| 542 | Ga0496121_0017764 | 3300048924 | Bacteria | 7233 |
| 543 | Ga0496121_0038181 | 3300048924 | Bacteria | 4257 |
| 544 | Ga0496121_0048525 | 3300048924 | Bacteria | 3611 |
| 545 | Ga0496121_0066502 | 3300048924 | Bacteria | 2926 |
| 546 | Ga0496122_0114335 | 3300048925 | Bacteria | 1761 |
| 547 | Ga0496125_0000040 | 3300048928 | Bacteria | 314478 |
| 548 | Ga0496125_0004755 | 3300048928 | Bacteria | 15477 |
| 549 | Ga0496125_0022192 | 3300048928 | Bacteria | 5899 |
| 550 | Ga0496125_0043840 | 3300048928 | Bacteria | 3791 |
| 551 | Ga0496126_0000065 | 3300048929 | Bacteria | 252549 |
| 552 | Ga0496126_0002483 | 3300048929 | Bacteria | 24817 |
| 553 | Ga0496126_0003684 | 3300048929 | Bacteria | 19137 |
| 554 | Ga0496126_0012513 | 3300048929 | Bacteria | 8686 |
| 555 | Ga0496126_0022270 | 3300048929 | Bacteria | 6169 |
| 556 | Ga0496126_0026298 | 3300048929 | Bacteria | 5582 |
| 557 | Ga0496126_0029779 | 3300048929 | Bacteria | 5182 |
| 558 | Ga0496126_0048948 | 3300048929 | Bacteria | 3860 |
| 559 | Ga0496126_0054002 | 3300048929 | Bacteria | 3642 |
| 560 | Ga0496126_0078303 | 3300048929 | Bacteria | 2929 |
| 561 | Ga0496126_0079880 | 3300048929 | Bacteria | 2895 |
| 562 | Ga0496126_0091610 | 3300048929 | Bacteria | 2672 |
| 563 | Ga0496126_0143002 | 3300048929 | Bacteria | 2057 |
| 564 | Ga0496126_0145053 | 3300048929 | Bacteria | 2040 |
| 565 | Ga0496126_0180376 | 3300048929 | Bacteria | 1794 |
| 566 | Ga0495678_001313 | 3300049459 | Bacteria | 20022 |
| 567 | Ga0501031_0006214 | 3300049568 | Bacteria | 7792 |
| 568 | Ga0501031_0008668 | 3300049568 | Bacteria | 6613 |
| 569 | Ga0501032_0000189 | 3300049569 | Bacteria | 50924 |
| 570 | Ga0501032_0000769 | 3300049569 | Bacteria | 26023 |
| 571 | Ga0501033_0000311 | 3300049570 | Bacteria | 46039 |
| 572 | Ga0501033_0001037 | 3300049570 | Bacteria | 25294 |
| 573 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 574 | Ga0501034_0007343 | 3300049571 | Bacteria | 11740 |
| 575 | Ga0501034_0016524 | 3300049571 | Bacteria | 7570 |
| 576 | Ga0501034_0043788 | 3300049571 | Bacteria | 4528 |
| 577 | Ga0501036_0000127 | 3300049572 | Bacteria | 48559 |
| 578 | Ga0501036_0000134 | 3300049572 | Bacteria | 47683 |
| 579 | Ga0501037_0000025 | 3300049573 | Bacteria | 143276 |
| 580 | Ga0501037_0002272 | 3300049573 | Bacteria | 13880 |
| 581 | Ga0501038_0000342 | 3300049574 | Bacteria | 40148 |
| 582 | Ga0501038_0000929 | 3300049574 | Bacteria | 26055 |
| 583 | Ga0501039_0000840 | 3300049575 | Bacteria | 22181 |
| 584 | Ga0501039_0002379 | 3300049575 | Bacteria | 14002 |
| 585 | Ga0501043_0000120 | 3300049579 | Bacteria | 72670 |
| 586 | Ga0501043_0002576 | 3300049579 | Bacteria | 15337 |
| 587 | Ga0501046_0000359 | 3300049580 | Bacteria | 45929 |
| 588 | Ga0501046_0034847 | 3300049580 | Bacteria | 4060 |
| 589 | Ga0501047_0000379 | 3300049581 | Bacteria | 50147 |
| 590 | Ga0501047_0000866 | 3300049581 | Bacteria | 30920 |
| 591 | Ga0501047_0011773 | 3300049581 | Bacteria | 8273 |
| 592 | Ga0501047_0012334 | 3300049581 | Bacteria | 8090 |
| 593 | Ga0501047_0017605 | 3300049581 | Bacteria | 6847 |
| 594 | Ga0501048_0000352 | 3300049582 | Bacteria | 31854 |
| 595 | Ga0501067_0000025 | 3300049583 | Bacteria | 91481 |
| 596 | Ga0501068_0003851 | 3300049584 | Bacteria | 8144 |
| 597 | Ga0501069_0001694 | 3300049585 | Bacteria | 10972 |
| 598 | Ga0501069_0005415 | 3300049585 | Bacteria | 6637 |
| 599 | Ga0501070_0002185 | 3300049586 | Bacteria | 17207 |
| 600 | Ga0501070_0003638 | 3300049586 | Bacteria | 13324 |
| 601 | Ga0501070_0047009 | 3300049586 | Bacteria | 3589 |
| 602 | Ga0501072_0003699 | 3300049588 | Bacteria | 11536 |
| 603 | Ga0501072_0080205 | 3300049588 | Bacteria | 2585 |
| 604 | Ga0501073_0000091 | 3300049589 | Bacteria | 57029 |
| 605 | Ga0501073_0008652 | 3300049589 | Bacteria | 7542 |
| 606 | Ga0501073_0054577 | 3300049589 | Bacteria | 2797 |
| 607 | Ga0501074_0000489 | 3300049590 | Bacteria | 24170 |
| 608 | Ga0501074_0003064 | 3300049590 | Bacteria | 11785 |
| 609 | Ga0501077_0039792 | 3300049593 | Bacteria | 2995 |
| 610 | Ga0501079_0004084 | 3300049741 | Bacteria | 10807 |
| 611 | Ga0501080_0000200 | 3300049742 | Bacteria | 44051 |
| 612 | Ga0501080_0000321 | 3300049742 | Bacteria | 36637 |
| 613 | Ga0501080_0013729 | 3300049742 | Bacteria | 7457 |
| 614 | Ga0501083_0000284 | 3300049744 | Bacteria | 32169 |
| 615 | Ga0501035_0000598 | 3300049822 | Bacteria | 39723 |
| 616 | Ga0501035_0001251 | 3300049822 | Bacteria | 26410 |
| 617 | Ga0501044_0000274 | 3300049823 | Bacteria | 65668 |
| 618 | Ga0501044_0000887 | 3300049823 | Bacteria | 36069 |
| 619 | Ga0501044_0020320 | 3300049823 | Bacteria | 7089 |
| 620 | Ga0501044_0147435 | 3300049823 | Bacteria | 2337 |
| 621 | Ga0501045_0040862 | 3300049824 | Bacteria | 3373 |
| 622 | nmdc:mga06z11_22778_c1 | 3300050494 | Bacteria | 2931 |
| 623 | nmdc:mga07m45_745_c1 | 3300050496 | Bacteria | 13914 |
| 624 | nmdc:mga05p37_203976_c1 | 3300050507 | Bacteria | 2393 |
| 625 | nmdc:mga0rr50_31297_c1 | 3300050513 | Bacteria | 3777 |
| 626 | nmdc:mga0a205_1736_c2 | 3300050515 | Bacteria | 7483 |
| 627 | nmdc:mga0a205_8002_c1 | 3300050515 | Bacteria | 9605 |
| 628 | Ga0495601_0021098 | 3300053077 | Bacteria | 3986 |
| 629 | Ga0495601_0027072 | 3300053077 | Bacteria | 3543 |
| 630 | Ga0495612_0018136 | 3300053078 | Bacteria | 2817 |
| 631 | Ga0495612_0033510 | 3300053078 | Bacteria | 2078 |
| 632 | Ga0500635_0002485 | 3300053080 | Bacteria | 4573 |
| 633 | Ga0500635_0002838 | 3300053080 | Bacteria | 4307 |
| 634 | Ga0495595_0003433 | 3300053084 | Bacteria | 6283 |
| 635 | Ga0495619_0046179 | 3300053085 | Bacteria | 2863 |
| 636 | Ga0500643_000456 | 3300053087 | Bacteria | 30270 |
| 637 | Ga0500651_0004914 | 3300053093 | Bacteria | 7562 |
| 638 | Ga0500566_0000043 | 3300053094 | Bacteria | 62755 |
| 639 | Ga0500566_0000370 | 3300053094 | Bacteria | 24642 |
| 640 | Ga0500566_0001762 | 3300053094 | Bacteria | 12726 |
| 641 | Ga0500640_005288 | 3300053095 | Bacteria | 4795 |
| 642 | Ga0500641_0010815 | 3300053096 | Bacteria | 3306 |
| 643 | Ga0500641_0039111 | 3300053096 | Bacteria | 1909 |
| 644 | Ga0500650_0000365 | 3300053098 | Bacteria | 10988 |
| 645 | Ga0500556_0000468 | 3300053104 | Bacteria | 28502 |
| 646 | Ga0500562_006967 | 3300053108 | Bacteria | 2850 |
| 647 | Ga0500572_000024 | 3300053111 | Bacteria | 47391 |
| 648 | Ga0500572_000704 | 3300053111 | Bacteria | 10837 |
| 649 | Ga0500592_002667 | 3300053116 | Bacteria | 2870 |
| 650 | Ga0500595_002343 | 3300053119 | Bacteria | 9470 |
| 651 | Ga0500595_003301 | 3300053119 | Bacteria | 7598 |
| 652 | Ga0500595_016164 | 3300053119 | Bacteria | 2784 |
| 653 | Ga0500608_001300 | 3300053122 | Bacteria | 8888 |
| 654 | Ga0500614_001091 | 3300053123 | Bacteria | 6714 |
| 655 | Ga0500642_0000019 | 3300053130 | Bacteria | 159944 |
| 656 | Ga0500642_0000252 | 3300053130 | Bacteria | 20158 |
| 657 | Ga0500658_0017676 | 3300053134 | Bacteria | 2666 |
| 658 | Ga0500559_0001011 | 3300053136 | Bacteria | 17309 |
| 659 | Ga0500559_0001379 | 3300053136 | Bacteria | 13865 |
| 660 | Ga0500559_0004998 | 3300053136 | Bacteria | 6157 |
| 661 | Ga0500559_0011705 | 3300053136 | Bacteria | 3741 |
| 662 | Ga0500568_0001665 | 3300053139 | Bacteria | 13926 |
| 663 | Ga0500568_0018981 | 3300053139 | Bacteria | 3000 |
| 664 | Ga0500568_0027575 | 3300053139 | Bacteria | 2373 |
| 665 | Ga0500577_0003874 | 3300053142 | Bacteria | 3909 |
| 666 | Ga0500577_0011877 | 3300053142 | Bacteria | 2614 |
| 667 | Ga0500586_000414 | 3300053145 | Bacteria | 8543 |
| 668 | Ga0500590_068324 | 3300053148 | Bacteria | 1771 |
| 669 | Ga0500603_000391 | 3300053150 | Bacteria | 11472 |
| 670 | Ga0500603_000801 | 3300053150 | Bacteria | 7516 |
| 671 | Ga0500604_0001275 | 3300053151 | Bacteria | 7050 |
| 672 | Ga0500616_0000041 | 3300053153 | Bacteria | 359328 |
| 673 | Ga0500616_0000104 | 3300053153 | Bacteria | 159954 |
| 674 | Ga0500622_0002498 | 3300053156 | Bacteria | 13232 |
| 675 | Ga0500630_000112 | 3300053159 | Bacteria | 26672 |
| 676 | Ga0500638_001152 | 3300053162 | Bacteria | 7931 |
| 677 | Ga0500639_000040 | 3300053163 | Bacteria | 63516 |
| 678 | Ga0500636_0000365 | 3300053177 | Bacteria | 24884 |
| 679 | Ga0500636_0012982 | 3300053177 | Bacteria | 4887 |
| 680 | Ga0500637_0000042 | 3300053178 | Bacteria | 46215 |
| 681 | Ga0500637_0002167 | 3300053178 | Bacteria | 8637 |
| 682 | Ga0500656_001811 | 3300053732 | Bacteria | 1882 |
| 683 | Ga0500601_000203 | 3300053737 | Bacteria | 12048 |
| 684 | Ga0501084_0027916 | 3300054114 | Bacteria | 4716 |
| 685 | Ga0500661_000056 | 3300055283 | Bacteria | 17736 |
| 686 | Ga0501082_0007446 | 3300060353 | Bacteria | 9446 |
| 687 | Ga0501082_0059100 | 3300060353 | Bacteria | 3304 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053732 | Ga0500656_001811 | Ga0500656_001811_504_1838 | 436 |
| 2 | 3300035410 | Ga0373924_0037068 | Ga0373924_0037068_602_1945 | 446 |
| 3 | 3300048917 | Ga0496114_0249115 | Ga0496114_0249115_21_1415 | 446 |
| 4 | 3300048904 | Ga0496101_0133023 | Ga0496101_0133023_482_1879 | 448 |
| 5 | iso_pu_bacteria | 8016622563 | 8016625629 | 451 |
| 6 | 3300037853 | Ga0436364_0899751 | Ga0436364_0899751_560_1933 | 455 |
| 7 | 3300046455 | Ga0495603_0025667 | Ga0495603_0025667_23_1447 | 458 |
| 8 | 3300044901 | Ga0466960_0026031 | Ga0466960_0026031_859_2265 | 460 |
| 9 | 3300048910 | Ga0496107_0009818 | Ga0496107_0009818_5186_6613 | 462 |
| 10 | 3300046663 | Ga0495635_0015088 | Ga0495635_0015088_3956_5377 | 465 |
| 11 | 3300046529 | Ga0495652_0167087 | Ga0495652_0167087_200_1669 | 467 |
| 12 | 3300048912 | Ga0496109_0135498 | Ga0496109_0135498_24_1484 | 472 |
| 13 | 3300005563 | Ga0068855_100031608 | Ga0068855_1000316087 | 473 |
| 14 | 3300046684 | Ga0495669_0064047 | Ga0495669_0064047_211_1638 | 473 |
| 15 | 3300048905 | Ga0496102_0114203 | Ga0496102_0114203_42_1493 | 482 |
| 16 | iso_pu_bacteria | 8019530166 | 8019533652 | 482 |
| 17 | 3300044694 | Ga0466963_0164241 | Ga0466963_0164241_12_1472 | 486 |
| 18 | 3300039062 | Ga0400483_068219 | Ga0400483_068219_4886_6538 | 491 |
| 19 | 3300005617 | Ga0068859_100001045 | Ga0068859_1000010452 | 495 |
| 20 | 3300005842 | Ga0068858_100008148 | Ga0068858_1000081484 | 495 |
| 21 | 3300006931 | Ga0097620_100001045 | Ga0097620_10000104522 | 495 |
| 22 | 3300026035 | Ga0207703_10032019 | Ga0207703_100320191 | 495 |
| 23 | 3300021388 | Ga0213875_10000880 | Ga0213875_1000088015 | 496 |
| 24 | 3300037853 | Ga0436364_1001517 | Ga0436364_1001517_12214_13845 | 496 |
| 25 | 3300039062 | Ga0400483_086418 | Ga0400483_086418_1711_3324 | 497 |
| 26 | 3300048924 | Ga0496121_0000359 | Ga0496121_0000359_68398_70074 | 498 |
| 27 | 3300048929 | Ga0496126_0003684 | Ga0496126_0003684_9310_10986 | 498 |
| 28 | 3300049593 | Ga0501077_0039792 | Ga0501077_0039792_589_2160 | 498 |
| 29 | 3300009094 | Ga0111539_10015429 | Ga0111539_100154292 | 500 |
| 30 | 3300053078 | Ga0495612_0033510 | Ga0495612_0033510_14_1516 | 500 |
| 31 | 3300048929 | Ga0496126_0079880 | Ga0496126_0079880_102_1700 | 501 |
| 32 | 3300050513 | nmdc:mga0rr50_31297_c1 | nmdc:mga0rr50_31297_c1_1137_2783 | 502 |
| 33 | 3300050515 | nmdc:mga0a205_1736_c2 | nmdc:mga0a205_1736_c2_5136_6782 | 502 |
| 34 | 3300006852 | Ga0075433_10010163 | Ga0075433_100101637 | 503 |
| 35 | 3300007076 | Ga0075435_100019518 | Ga0075435_1000195184 | 503 |
| 36 | 3300027907 | Ga0207428_10017652 | Ga0207428_100176522 | 503 |
| 37 | 3300009094 | Ga0111539_10014859 | Ga0111539_100148592 | 505 |
| 38 | 3300026088 | Ga0207641_10000503 | Ga0207641_1000050316 | 505 |
| 39 | 3300006846 | Ga0075430_100041932 | Ga0075430_1000419324 | 506 |
| 40 | 3300025272 | Ga0209455_1004280 | Ga0209455_10042804 | 506 |
| 41 | 3300046460 | Ga0495638_0007591 | Ga0495638_0007591_413_2002 | 506 |
| 42 | 3300005455 | Ga0070663_100001485 | Ga0070663_10000148512 | 508 |
| 43 | 3300026067 | Ga0207678_10000089 | Ga0207678_1000008951 | 508 |
| 44 | 3300035092 | Ga0373952_0010982 | Ga0373952_0010982_13_1659 | 508 |
| 45 | 3300035691 | Ga0373931_0000972 | Ga0373931_0000972_5123_6769 | 508 |
| 46 | 3300049581 | Ga0501047_0012334 | Ga0501047_0012334_978_2573 | 508 |
| 47 | 3300033179 | Ga0307507_10012617 | Ga0307507_100126171 | 511 |
| 48 | 3300044684 | Ga0466966_0000128 | Ga0466966_0000128_19233_20858 | 511 |
| 49 | 3300044693 | Ga0466961_0000236 | Ga0466961_0000236_18503_20128 | 511 |
| 50 | 3300045049 | Ga0466959_0001099 | Ga0466959_0001099_13546_15171 | 511 |
| 51 | 3300046559 | Ga0495667_0017811 | Ga0495667_0017811_888_2507 | 512 |
| 52 | 3300046683 | Ga0495658_0010677 | Ga0495658_0010677_2004_3623 | 512 |
| 53 | 3300047319 | Ga0495674_0020170 | Ga0495674_0020170_3203_4822 | 512 |
| 54 | 3300048929 | Ga0496126_0000065 | Ga0496126_0000065_210192_211844 | 512 |
| 55 | iso_pu_bacteria | 2917736166 | 2917742546 | 513 |
| 56 | 3300005841 | Ga0068863_100000126 | Ga0068863_10000012654 | 514 |
| 57 | 3300049588 | Ga0501072_0080205 | Ga0501072_0080205_88_1707 | 514 |
| 58 | 3300003792 | Ga0055540_1000098 | Ga0055540_100009875 | 515 |
| 59 | 3300003792 | Ga0055540_1000450 | Ga0055540_100045023 | 515 |
| 60 | 3300005435 | Ga0070714_100002121 | Ga0070714_1000021213 | 515 |
| 61 | 3300005548 | Ga0070665_100127191 | Ga0070665_1001271912 | 515 |
| 62 | 3300006028 | Ga0070717_10026341 | Ga0070717_100263413 | 515 |
| 63 | 3300006844 | Ga0075428_100251938 | Ga0075428_1002519382 | 515 |
| 64 | 3300025273 | Ga0209673_1000206 | Ga0209673_100020620 | 515 |
| 65 | 3300025298 | Ga0209050_1005280 | Ga0209050_10052803 | 515 |
| 66 | 3300025303 | Ga0209051_1000359 | Ga0209051_100035955 | 515 |
| 67 | 3300025304 | Ga0209257_1002263 | Ga0209257_10022639 | 515 |
| 68 | 3300025929 | Ga0207664_10000425 | Ga0207664_1000042510 | 515 |
| 69 | 3300028379 | Ga0268266_10071038 | Ga0268266_100710382 | 515 |
| 70 | 3300035083 | Ga0373926_0018702 | Ga0373926_0018702_555_2183 | 515 |
| 71 | 3300035695 | Ga0373927_0021108 | Ga0373927_0021108_2086_3714 | 515 |
| 72 | 3300035725 | Ga0373947_0036931 | Ga0373947_0036931_271_1899 | 515 |
| 73 | 3300036401 | Ga0373937_0102341 | Ga0373937_0102341_216_1844 | 515 |
| 74 | 3300046472 | Ga0495580_0006588 | Ga0495580_0006588_4717_6345 | 515 |
| 75 | 3300046473 | Ga0495582_0010745 | Ga0495582_0010745_2063_3691 | 515 |
| 76 | 3300046517 | Ga0495630_0162802 | Ga0495630_0162802_39_1667 | 515 |
| 77 | 3300046536 | Ga0495587_0056120 | Ga0495587_0056120_657_2282 | 515 |
| 78 | 3300046679 | Ga0495623_0052805 | Ga0495623_0052805_141_1769 | 515 |
| 79 | 3300046690 | Ga0495624_0021243 | Ga0495624_0021243_51_1679 | 515 |
| 80 | 3300047315 | Ga0495581_0029014 | Ga0495581_0029014_181_1809 | 515 |
| 81 | 3300047471 | Ga0495684_0024888 | Ga0495684_0024888_2634_4262 | 515 |
| 82 | 3300053177 | Ga0500636_0000365 | Ga0500636_0000365_7559_9184 | 515 |
| 83 | 3300025939 | Ga0207665_10061672 | Ga0207665_100616722 | 517 |
| 84 | 3300046453 | Ga0495627_000642 | Ga0495627_000642_5311_6924 | 517 |
| 85 | 3300021377 | Ga0213874_10003719 | Ga0213874_100037192 | 518 |
| 86 | 3300035691 | Ga0373931_0000333 | Ga0373931_0000333_5772_7409 | 518 |
| 87 | 3300036401 | Ga0373937_0075826 | Ga0373937_0075826_509_2140 | 518 |
| 88 | 3300048924 | Ga0496121_0038181 | Ga0496121_0038181_2116_3732 | 518 |
| 89 | 3300048929 | Ga0496126_0180376 | Ga0496126_0180376_64_1680 | 518 |
| 90 | 3300005563 | Ga0068855_100000283 | Ga0068855_1000002834 | 519 |
| 91 | 3300005577 | Ga0068857_100021668 | Ga0068857_1000216684 | 519 |
| 92 | 3300009093 | Ga0105240_10037447 | Ga0105240_100374472 | 519 |
| 93 | 3300009551 | Ga0105238_10137354 | Ga0105238_101373542 | 519 |
| 94 | 3300026116 | Ga0207674_10034375 | Ga0207674_100343753 | 519 |
| 95 | 3300037466 | Ga0395898_0036427 | Ga0395898_0036427_3079_4719 | 519 |
| 96 | 3300037471 | Ga0395905_0091429 | Ga0395905_0091429_566_2206 | 519 |
| 97 | 3300037853 | Ga0436364_1222257 | Ga0436364_1222257_915_2537 | 519 |
| 98 | 3300038443 | Ga0395901_0104867 | Ga0395901_0104867_238_1878 | 519 |
| 99 | 3300039450 | Ga0436363_1487883 | Ga0436363_1487883_6493_8136 | 519 |
| 100 | 3300053119 | Ga0500595_003301 | Ga0500595_003301_2968_4605 | 519 |
| 101 | 3300005455 | Ga0070663_100115250 | Ga0070663_1001152501 | 520 |
| 102 | 3300009545 | Ga0105237_10158498 | Ga0105237_101584982 | 520 |
| 103 | 3300035691 | Ga0373931_0009359 | Ga0373931_0009359_2598_4223 | 520 |
| 104 | 3300047319 | Ga0495674_0007898 | Ga0495674_0007898_4672_6456 | 520 |
| 105 | 3300048913 | Ga0496110_0070692 | Ga0496110_0070692_483_2108 | 520 |
| 106 | 3300053080 | Ga0500635_0002485 | Ga0500635_0002485_2996_4558 | 520 |
| 107 | 3300009093 | Ga0105240_10114967 | Ga0105240_101149673 | 521 |
| 108 | 3300025913 | Ga0207695_10077014 | Ga0207695_100770142 | 521 |
| 109 | 3300053093 | Ga0500651_0004914 | Ga0500651_0004914_5098_6711 | 521 |
| 110 | 3300005458 | Ga0070681_10003273 | Ga0070681_100032739 | 522 |
| 111 | 3300005530 | Ga0070679_100019456 | Ga0070679_1000194562 | 522 |
| 112 | 3300009093 | Ga0105240_10034709 | Ga0105240_100347096 | 522 |
| 113 | 3300013105 | Ga0157369_10012270 | Ga0157369_100122705 | 522 |
| 114 | 3300025912 | Ga0207707_10000419 | Ga0207707_1000041929 | 522 |
| 115 | 3300037466 | Ga0395898_0015307 | Ga0395898_0015307_6108_7724 | 522 |
| 116 | 3300038443 | Ga0395901_0143373 | Ga0395901_0143373_516_2132 | 522 |
| 117 | 3300006852 | Ga0075433_10057133 | Ga0075433_100571334 | 523 |
| 118 | 3300014325 | Ga0163163_10011315 | Ga0163163_100113152 | 523 |
| 119 | 3300048915 | Ga0496112_0019263 | Ga0496112_0019263_2689_4314 | 523 |
| 120 | 3300048923 | Ga0496120_0047967 | Ga0496120_0047967_165_1790 | 523 |
| 121 | 3300050515 | nmdc:mga0a205_8002_c1 | nmdc:mga0a205_8002_c1_5453_7129 | 523 |
| 122 | iso_pu_bacteria | 2510917026 | 2511172029 | 523 |
| 123 | iso_pu_bacteria | 2585427633 | 2585992505 | 523 |
| 124 | iso_pu_bacteria | 2585427634 | 2586003261 | 523 |
| 125 | iso_pu_bacteria | 2919171160 | 2919174148 | 523 |
| 126 | 3300005338 | Ga0068868_100171781 | Ga0068868_1001717812 | 525 |
| 127 | 3300005438 | Ga0070701_10047203 | Ga0070701_100472032 | 525 |
| 128 | 3300005577 | Ga0068857_100001551 | Ga0068857_10000155116 | 525 |
| 129 | 3300005937 | Ga0081455_10028177 | Ga0081455_100281775 | 525 |
| 130 | 3300005983 | Ga0081540_1014480 | Ga0081540_10144802 | 525 |
| 131 | 3300005983 | Ga0081540_1023084 | Ga0081540_10230842 | 525 |
| 132 | 3300014325 | Ga0163163_10150767 | Ga0163163_101507672 | 525 |
| 133 | 3300025901 | Ga0207688_10049164 | Ga0207688_100491642 | 525 |
| 134 | 3300025915 | Ga0207693_10019720 | Ga0207693_100197202 | 525 |
| 135 | 3300025920 | Ga0207649_10059216 | Ga0207649_100592162 | 525 |
| 136 | 3300025942 | Ga0207689_10017224 | Ga0207689_100172242 | 525 |
| 137 | 3300025945 | Ga0207679_10031497 | Ga0207679_100314972 | 525 |
| 138 | 3300026075 | Ga0207708_10051448 | Ga0207708_100514481 | 525 |
| 139 | 3300026095 | Ga0207676_10022448 | Ga0207676_100224482 | 525 |
| 140 | 3300026116 | Ga0207674_10165888 | Ga0207674_101658882 | 525 |
| 141 | 3300031507 | Ga0307509_10000840 | Ga0307509_1000084022 | 525 |
| 142 | 3300032002 | Ga0307416_100105720 | Ga0307416_1001057202 | 525 |
| 143 | 3300046491 | Ga0495584_0025028 | Ga0495584_0025028_459_2081 | 525 |
| 144 | 3300048909 | Ga0496106_0009997 | Ga0496106_0009997_588_2216 | 525 |
| 145 | 3300048911 | Ga0496108_0022937 | Ga0496108_0022937_2622_4244 | 525 |
| 146 | 3300048912 | Ga0496109_0016029 | Ga0496109_0016029_2853_4475 | 525 |
| 147 | 3300048913 | Ga0496110_0013689 | Ga0496110_0013689_966_2588 | 525 |
| 148 | 3300048914 | Ga0496111_0013221 | Ga0496111_0013221_2321_3943 | 525 |
| 149 | 3300053119 | Ga0500595_002343 | Ga0500595_002343_7169_8797 | 525 |
| 150 | 3300053162 | Ga0500638_001152 | Ga0500638_001152_5715_7343 | 525 |
| 151 | 3300053178 | Ga0500637_0000042 | Ga0500637_0000042_14153_15781 | 525 |
| 152 | 3300055283 | Ga0500661_000056 | Ga0500661_000056_2166_3794 | 525 |
| 153 | 3300003203 | JGI25406J46586_10011772 | JGI25406J46586_100117722 | 526 |
| 154 | 3300003659 | JGI25404J52841_10005921 | JGI25404J52841_100059213 | 526 |
| 155 | 3300005338 | Ga0068868_100022399 | Ga0068868_1000223993 | 526 |
| 156 | 3300005455 | Ga0070663_100060541 | Ga0070663_1000605412 | 526 |
| 157 | 3300005618 | Ga0068864_100184021 | Ga0068864_1001840211 | 526 |
| 158 | 3300005983 | Ga0081540_1015123 | Ga0081540_10151235 | 526 |
| 159 | 3300005985 | Ga0081539_10001470 | Ga0081539_100014706 | 526 |
| 160 | 3300009094 | Ga0111539_10037482 | Ga0111539_100374822 | 526 |
| 161 | 3300009147 | Ga0114129_10078597 | Ga0114129_100785974 | 526 |
| 162 | 3300009177 | Ga0105248_10039794 | Ga0105248_100397943 | 526 |
| 163 | 3300013105 | Ga0157369_10056186 | Ga0157369_100561863 | 526 |
| 164 | 3300014325 | Ga0163163_10001576 | Ga0163163_1000157610 | 526 |
| 165 | 3300025294 | Ga0209025_1002646 | Ga0209025_10026463 | 526 |
| 166 | 3300025901 | Ga0207688_10043415 | Ga0207688_100434152 | 526 |
| 167 | 3300025915 | Ga0207693_10088222 | Ga0207693_100882222 | 526 |
| 168 | 3300026067 | Ga0207678_10013434 | Ga0207678_100134342 | 526 |
| 169 | 3300026121 | Ga0207683_10102624 | Ga0207683_101026242 | 526 |
| 170 | 3300028794 | Ga0307515_10006012 | Ga0307515_1000601210 | 526 |
| 171 | 3300031249 | Ga0265339_10004321 | Ga0265339_100043219 | 526 |
| 172 | 3300044842 | Ga0466957_0047062 | Ga0466957_0047062_515_2131 | 526 |
| 173 | 3300047315 | Ga0495581_0060277 | Ga0495581_0060277_400_2040 | 526 |
| 174 | 3300048903 | Ga0496100_0043018 | Ga0496100_0043018_936_2564 | 526 |
| 175 | 3300048905 | Ga0496102_0001771 | Ga0496102_0001771_4113_5741 | 526 |
| 176 | 3300048907 | Ga0496104_0015144 | Ga0496104_0015144_2875_4512 | 526 |
| 177 | 3300048907 | Ga0496104_0087081 | Ga0496104_0087081_420_2048 | 526 |
| 178 | 3300048910 | Ga0496107_0005793 | Ga0496107_0005793_119_1747 | 526 |
| 179 | 3300048911 | Ga0496108_0003885 | Ga0496108_0003885_9907_11544 | 526 |
| 180 | 3300048911 | Ga0496108_0019931 | Ga0496108_0019931_1567_3195 | 526 |
| 181 | 3300048912 | Ga0496109_0143471 | Ga0496109_0143471_441_2069 | 526 |
| 182 | 3300048913 | Ga0496110_0017906 | Ga0496110_0017906_3005_4642 | 526 |
| 183 | 3300048914 | Ga0496111_0023874 | Ga0496111_0023874_1763_3400 | 526 |
| 184 | 3300048916 | Ga0496113_0006361 | Ga0496113_0006361_799_2427 | 526 |
| 185 | 3300048918 | Ga0496115_0039864 | Ga0496115_0039864_904_2553 | 526 |
| 186 | 3300050507 | nmdc:mga05p37_203976_c1 | nmdc:mga05p37_203976_c1_757_2382 | 526 |
| 187 | 3300053085 | Ga0495619_0046179 | Ga0495619_0046179_16_1644 | 526 |
| 188 | 3300003215 | JGI25153J46596_10011211 | JGI25153J46596_100112113 | 527 |
| 189 | 3300003781 | Ga0055536_1002776 | Ga0055536_10027769 | 527 |
| 190 | 3300003792 | Ga0055540_1001832 | Ga0055540_10018329 | 527 |
| 191 | 3300003794 | Ga0055531_10000635 | Ga0055531_1000063513 | 527 |
| 192 | 3300005436 | Ga0070713_100012830 | Ga0070713_1000128304 | 527 |
| 193 | 3300006028 | Ga0070717_10141457 | Ga0070717_101414572 | 527 |
| 194 | 3300025297 | Ga0209758_1000115 | Ga0209758_1000115182 | 527 |
| 195 | 3300025303 | Ga0209051_1024810 | Ga0209051_10248101 | 527 |
| 196 | 3300025304 | Ga0209257_1001808 | Ga0209257_100180816 | 527 |
| 197 | 3300025928 | Ga0207700_10009160 | Ga0207700_100091604 | 527 |
| 198 | 3300048916 | Ga0496113_0013216 | Ga0496113_0013216_452_2089 | 527 |
| 199 | 3300053153 | Ga0500616_0000104 | Ga0500616_0000104_13083_14681 | 527 |
| 200 | 3300005937 | Ga0081455_10013417 | Ga0081455_100134175 | 528 |
| 201 | 3300031247 | Ga0265340_10027705 | Ga0265340_100277051 | 528 |
| 202 | 3300031616 | Ga0307508_10042188 | Ga0307508_100421883 | 528 |
| 203 | 3300005530 | Ga0070679_100013810 | Ga0070679_1000138101 | 529 |
| 204 | 3300025297 | Ga0209758_1008059 | Ga0209758_10080596 | 529 |
| 205 | 3300025912 | Ga0207707_10018343 | Ga0207707_100183435 | 529 |
| 206 | 3300035724 | Ga0373933_0000182 | Ga0373933_0000182_16121_17746 | 529 |
| 207 | 3300005439 | Ga0070711_100041758 | Ga0070711_1000417583 | 530 |
| 208 | 3300006173 | Ga0070716_100036351 | Ga0070716_1000363512 | 530 |
| 209 | 3300009545 | Ga0105237_10098524 | Ga0105237_100985242 | 530 |
| 210 | 3300010375 | Ga0105239_10091133 | Ga0105239_100911333 | 530 |
| 211 | 3300025916 | Ga0207663_10017003 | Ga0207663_100170033 | 530 |
| 212 | 3300025931 | Ga0207644_10035487 | Ga0207644_100354873 | 530 |
| 213 | 3300026142 | Ga0207698_10048930 | Ga0207698_100489303 | 530 |
| 214 | 3300031235 | Ga0265330_10018111 | Ga0265330_100181113 | 530 |
| 215 | 3300035691 | Ga0373931_0003529 | Ga0373931_0003529_455_2098 | 530 |
| 216 | 3300039437 | Ga0436365_0862990 | Ga0436365_0862990_7603_9399 | 530 |
| 217 | 3300039450 | Ga0436363_1480026 | Ga0436363_1480026_2850_4646 | 530 |
| 218 | 3300048903 | Ga0496100_0053587 | Ga0496100_0053587_637_2280 | 530 |
| 219 | 3300048904 | Ga0496101_0031035 | Ga0496101_0031035_2090_3733 | 530 |
| 220 | 3300048905 | Ga0496102_0085244 | Ga0496102_0085244_1081_2724 | 530 |
| 221 | 3300048907 | Ga0496104_0058723 | Ga0496104_0058723_1799_3442 | 530 |
| 222 | 3300048908 | Ga0496105_0048124 | Ga0496105_0048124_460_2100 | 530 |
| 223 | 3300048908 | Ga0496105_0069984 | Ga0496105_0069984_178_1821 | 530 |
| 224 | 3300048913 | Ga0496110_0014333 | Ga0496110_0014333_4637_6280 | 530 |
| 225 | 3300048914 | Ga0496111_0027477 | Ga0496111_0027477_604_2235 | 530 |
| 226 | 3300048915 | Ga0496112_0023520 | Ga0496112_0023520_56_1687 | 530 |
| 227 | 3300048916 | Ga0496113_0043065 | Ga0496113_0043065_1525_3168 | 530 |
| 228 | 3300048918 | Ga0496115_0002841 | Ga0496115_0002841_3513_5156 | 530 |
| 229 | 3300048918 | Ga0496115_0088101 | Ga0496115_0088101_718_2358 | 530 |
| 230 | 3300049571 | Ga0501034_0043788 | Ga0501034_0043788_757_2391 | 530 |
| 231 | 3300049589 | Ga0501073_0054577 | Ga0501073_0054577_257_1882 | 530 |
| 232 | 3300060353 | Ga0501082_0059100 | Ga0501082_0059100_430_2064 | 530 |
| 233 | 3300028794 | Ga0307515_10022923 | Ga0307515_1002292311 | 531 |
| 234 | 3300049586 | Ga0501070_0047009 | Ga0501070_0047009_109_1734 | 531 |
| 235 | 3300049742 | Ga0501080_0013729 | Ga0501080_0013729_259_1884 | 531 |
| 236 | 3300053094 | Ga0500566_0001762 | Ga0500566_0001762_11069_12694 | 531 |
| 237 | 3300053136 | Ga0500559_0001379 | Ga0500559_0001379_7518_9146 | 531 |
| 238 | 3300005340 | Ga0070689_100070593 | Ga0070689_1000705932 | 532 |
| 239 | 3300005840 | Ga0068870_10032793 | Ga0068870_100327932 | 532 |
| 240 | 3300005842 | Ga0068858_100106470 | Ga0068858_1001064702 | 532 |
| 241 | 3300005937 | Ga0081455_10015026 | Ga0081455_100150265 | 532 |
| 242 | 3300005981 | Ga0081538_10071250 | Ga0081538_100712502 | 532 |
| 243 | 3300009098 | Ga0105245_10058514 | Ga0105245_100585143 | 532 |
| 244 | 3300009553 | Ga0105249_10067353 | Ga0105249_100673532 | 532 |
| 245 | 3300014969 | Ga0157376_10080530 | Ga0157376_100805302 | 532 |
| 246 | 3300025937 | Ga0207669_10014394 | Ga0207669_100143943 | 532 |
| 247 | 3300025938 | Ga0207704_10015826 | Ga0207704_100158262 | 532 |
| 248 | 3300025961 | Ga0207712_10021041 | Ga0207712_100210412 | 532 |
| 249 | 3300025972 | Ga0207668_10018860 | Ga0207668_100188603 | 532 |
| 250 | 3300026067 | Ga0207678_10119968 | Ga0207678_101199682 | 532 |
| 251 | 3300026075 | Ga0207708_10028255 | Ga0207708_100282551 | 532 |
| 252 | 3300026089 | Ga0207648_10095735 | Ga0207648_100957352 | 532 |
| 253 | 3300026118 | Ga0207675_100022726 | Ga0207675_1000227265 | 532 |
| 254 | 3300026118 | Ga0207675_100152562 | Ga0207675_1001525622 | 532 |
| 255 | 3300031616 | Ga0307508_10026534 | Ga0307508_100265343 | 532 |
| 256 | 3300031995 | Ga0307409_100050246 | Ga0307409_1000502463 | 532 |
| 257 | 3300032005 | Ga0307411_10092001 | Ga0307411_100920012 | 532 |
| 258 | 3300046684 | Ga0495669_0000650 | Ga0495669_0000650_56_1687 | 532 |
| 259 | 3300048905 | Ga0496102_0177997 | Ga0496102_0177997_116_1744 | 532 |
| 260 | 3300048910 | Ga0496107_0115098 | Ga0496107_0115098_240_1868 | 532 |
| 261 | 3300048929 | Ga0496126_0145053 | Ga0496126_0145053_94_1731 | 532 |
| 262 | 3300049571 | Ga0501034_0016524 | Ga0501034_0016524_5077_6708 | 532 |
| 263 | 3300049581 | Ga0501047_0011773 | Ga0501047_0011773_320_1951 | 532 |
| 264 | 3300053096 | Ga0500641_0010815 | Ga0500641_0010815_1598_3229 | 532 |
| 265 | iso_pu_bacteria | 2739367653 | 2739604431 | 532 |
| 266 | iso_pu_bacteria | 2857727296 | 2857728810 | 532 |
| 267 | 3300003354 | JGI25160J50197_1015299 | JGI25160J50197_10152992 | 533 |
| 268 | 3300004625 | Ga0055543_1003833 | Ga0055543_10038332 | 533 |
| 269 | 3300005262 | Ga0065165_1002220 | Ga0065165_100222012 | 533 |
| 270 | 3300005347 | Ga0070668_100072015 | Ga0070668_1000720152 | 533 |
| 271 | 3300005530 | Ga0070679_100024100 | Ga0070679_1000241003 | 533 |
| 272 | 3300005535 | Ga0070684_100009975 | Ga0070684_1000099751 | 533 |
| 273 | 3300006028 | Ga0070717_10082336 | Ga0070717_100823362 | 533 |
| 274 | 3300009174 | Ga0105241_10021246 | Ga0105241_100212464 | 533 |
| 275 | 3300009545 | Ga0105237_10023096 | Ga0105237_100230963 | 533 |
| 276 | 3300009551 | Ga0105238_10132830 | Ga0105238_101328302 | 533 |
| 277 | 3300021320 | Ga0214544_1001813 | Ga0214544_100181319 | 533 |
| 278 | 3300021321 | Ga0214542_1001236 | Ga0214542_100123620 | 533 |
| 279 | 3300021324 | Ga0214545_1000924 | Ga0214545_100092425 | 533 |
| 280 | 3300021327 | Ga0214543_1003531 | Ga0214543_100353119 | 533 |
| 281 | 3300021327 | Ga0214543_1024471 | Ga0214543_10244713 | 533 |
| 282 | 3300025297 | Ga0209758_1001210 | Ga0209758_100121022 | 533 |
| 283 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008789 | 533 |
| 284 | 3300025914 | Ga0207671_10005294 | Ga0207671_1000529410 | 533 |
| 285 | 3300025944 | Ga0207661_10001270 | Ga0207661_1000127010 | 533 |
| 286 | 3300028786 | Ga0307517_10000634 | Ga0307517_1000063442 | 533 |
| 287 | 3300031507 | Ga0307509_10005537 | Ga0307509_1000553710 | 533 |
| 288 | 3300031548 | Ga0307408_100044133 | Ga0307408_1000441332 | 533 |
| 289 | 3300031730 | Ga0307516_10010247 | Ga0307516_1001024711 | 533 |
| 290 | 3300033179 | Ga0307507_10140766 | Ga0307507_101407661 | 533 |
| 291 | 3300033180 | Ga0307510_10023885 | Ga0307510_100238856 | 533 |
| 292 | 3300046477 | Ga0495664_0028129 | Ga0495664_0028129_124_1776 | 533 |
| 293 | 3300046516 | Ga0495628_0040736 | Ga0495628_0040736_1118_2743 | 533 |
| 294 | 3300046536 | Ga0495587_0035375 | Ga0495587_0035375_245_1870 | 533 |
| 295 | 3300046543 | Ga0495645_0013557 | Ga0495645_0013557_1579_3204 | 533 |
| 296 | 3300046559 | Ga0495667_0042318 | Ga0495667_0042318_754_2379 | 533 |
| 297 | 3300046675 | Ga0495657_0019591 | Ga0495657_0019591_205_1830 | 533 |
| 298 | 3300046678 | Ga0495599_0019045 | Ga0495599_0019045_1688_3313 | 533 |
| 299 | 3300046678 | Ga0495599_0063533 | Ga0495599_0063533_209_1861 | 533 |
| 300 | 3300046809 | Ga0495600_0034678 | Ga0495600_0034678_779_2404 | 533 |
| 301 | 3300046809 | Ga0495600_0121999 | Ga0495600_0121999_22_1650 | 533 |
| 302 | 3300047319 | Ga0495674_0041495 | Ga0495674_0041495_1680_3305 | 533 |
| 303 | 3300047320 | Ga0495672_0006488 | Ga0495672_0006488_321_1949 | 533 |
| 304 | 3300047322 | Ga0495680_0001711 | Ga0495680_0001711_3223_4848 | 533 |
| 305 | 3300047444 | Ga0495675_0005291 | Ga0495675_0005291_3999_5624 | 533 |
| 306 | 3300048918 | Ga0496115_0039874 | Ga0496115_0039874_1839_3464 | 533 |
| 307 | 3300048919 | Ga0496116_0000588 | Ga0496116_0000588_39518_41233 | 533 |
| 308 | 3300048920 | Ga0496117_0008313 | Ga0496117_0008313_3490_5205 | 533 |
| 309 | 3300048921 | Ga0496118_0000781 | Ga0496118_0000781_9285_11000 | 533 |
| 310 | 3300053078 | Ga0495612_0018136 | Ga0495612_0018136_890_2518 | 533 |
| 311 | 3300053119 | Ga0500595_016164 | Ga0500595_016164_740_2368 | 533 |
| 312 | iso_pu_bacteria | 8002784119 | 8002788881 | 533 |
| 313 | 3300003203 | JGI25406J46586_10013111 | JGI25406J46586_100131113 | 534 |
| 314 | 3300005341 | Ga0070691_10045166 | Ga0070691_100451661 | 534 |
| 315 | 3300005438 | Ga0070701_10005782 | Ga0070701_100057825 | 534 |
| 316 | 3300005545 | Ga0070695_100067456 | Ga0070695_1000674562 | 534 |
| 317 | 3300005937 | Ga0081455_10000730 | Ga0081455_100007304 | 534 |
| 318 | 3300005985 | Ga0081539_10000058 | Ga0081539_10000058201 | 534 |
| 319 | 3300014326 | Ga0157380_10088443 | Ga0157380_100884433 | 534 |
| 320 | 3300025230 | Ga0209563_104010 | Ga0209563_1040102 | 534 |
| 321 | 3300026075 | Ga0207708_10021169 | Ga0207708_100211694 | 534 |
| 322 | 3300026118 | Ga0207675_100016194 | Ga0207675_1000161942 | 534 |
| 323 | 3300031456 | Ga0307513_10082153 | Ga0307513_100821533 | 534 |
| 324 | 3300031507 | Ga0307509_10120250 | Ga0307509_101202503 | 534 |
| 325 | 3300031824 | Ga0307413_10036229 | Ga0307413_100362292 | 534 |
| 326 | 3300035113 | Ga0373936_0009069 | Ga0373936_0009069_1151_2824 | 534 |
| 327 | 3300035116 | Ga0373945_0014977 | Ga0373945_0014977_873_2546 | 534 |
| 328 | 3300035170 | Ga0373943_0008899 | Ga0373943_0008899_2593_4266 | 534 |
| 329 | 3300035171 | Ga0373946_0004997 | Ga0373946_0004997_2781_4409 | 534 |
| 330 | 3300035695 | Ga0373927_0002882 | Ga0373927_0002882_2551_4224 | 534 |
| 331 | 3300037068 | Ga0373925_0023291 | Ga0373925_0023291_1985_3658 | 534 |
| 332 | 3300044658 | Ga0466972_0025282 | Ga0466972_0025282_1168_2793 | 534 |
| 333 | 3300044735 | Ga0466968_0023471 | Ga0466968_0023471_326_1951 | 534 |
| 334 | 3300044901 | Ga0466960_0025406 | Ga0466960_0025406_972_2597 | 534 |
| 335 | 3300046454 | Ga0495592_0013200 | Ga0495592_0013200_1093_2766 | 534 |
| 336 | 3300046455 | Ga0495603_0000217 | Ga0495603_0000217_24040_25713 | 534 |
| 337 | 3300046459 | Ga0495629_0000862 | Ga0495629_0000862_13264_14937 | 534 |
| 338 | 3300046461 | Ga0495641_0003672 | Ga0495641_0003672_2041_3714 | 534 |
| 339 | 3300046472 | Ga0495580_0005364 | Ga0495580_0005364_7124_8797 | 534 |
| 340 | 3300046473 | Ga0495582_0000990 | Ga0495582_0000990_12555_14228 | 534 |
| 341 | 3300046475 | Ga0495639_0000544 | Ga0495639_0000544_8201_9874 | 534 |
| 342 | 3300046476 | Ga0495662_0001589 | Ga0495662_0001589_8092_9765 | 534 |
| 343 | 3300046477 | Ga0495664_0001505 | Ga0495664_0001505_4003_5676 | 534 |
| 344 | 3300046499 | Ga0495594_0000128 | Ga0495594_0000128_32396_34069 | 534 |
| 345 | 3300046517 | Ga0495630_0018933 | Ga0495630_0018933_1965_3638 | 534 |
| 346 | 3300046524 | Ga0495648_0054832 | Ga0495648_0054832_521_2146 | 534 |
| 347 | 3300046531 | Ga0495665_0006186 | Ga0495665_0006186_1984_3657 | 534 |
| 348 | 3300046533 | Ga0495640_0002595 | Ga0495640_0002595_5996_7669 | 534 |
| 349 | 3300046557 | Ga0495622_0014846 | Ga0495622_0014846_992_2620 | 534 |
| 350 | 3300046642 | Ga0495634_0001583 | Ga0495634_0001583_3570_5243 | 534 |
| 351 | 3300046663 | Ga0495635_0000436 | Ga0495635_0000436_7387_9060 | 534 |
| 352 | 3300046680 | Ga0495646_0013510 | Ga0495646_0013510_2038_3711 | 534 |
| 353 | 3300046681 | Ga0495647_0000394 | Ga0495647_0000394_8221_9894 | 534 |
| 354 | 3300046683 | Ga0495658_0003203 | Ga0495658_0003203_2170_3843 | 534 |
| 355 | 3300046689 | Ga0495613_0017135 | Ga0495613_0017135_3435_5063 | 534 |
| 356 | 3300046690 | Ga0495624_0044115 | Ga0495624_0044115_288_1961 | 534 |
| 357 | 3300047315 | Ga0495581_0003127 | Ga0495581_0003127_3691_5364 | 534 |
| 358 | 3300047319 | Ga0495674_0008903 | Ga0495674_0008903_7173_8846 | 534 |
| 359 | 3300047471 | Ga0495684_0022668 | Ga0495684_0022668_595_2268 | 534 |
| 360 | 3300047673 | Ga0495593_0000439 | Ga0495593_0000439_4042_5715 | 534 |
| 361 | 3300053139 | Ga0500568_0018981 | Ga0500568_0018981_859_2532 | 534 |
| 362 | iso_pu_bacteria | 2919034639 | 2919037945 | 534 |
| 363 | 3300003856 | Ga0058692_1008427 | Ga0058692_10084271 | 535 |
| 364 | 3300005548 | Ga0070665_100000229 | Ga0070665_10000022941 | 535 |
| 365 | 3300005985 | Ga0081539_10007479 | Ga0081539_1000747910 | 535 |
| 366 | 3300026067 | Ga0207678_10033534 | Ga0207678_100335342 | 535 |
| 367 | 3300027312 | Ga0209371_1000741 | Ga0209371_100074118 | 535 |
| 368 | 3300028379 | Ga0268266_10006018 | Ga0268266_100060185 | 535 |
| 369 | 3300030500 | Ga0268256_1001268 | Ga0268256_100126811 | 535 |
| 370 | iso_pu_bacteria | 2517572101 | 2517764493 | 535 |
| 371 | 3300005262 | Ga0065165_1000048 | Ga0065165_100004880 | 536 |
| 372 | 3300005329 | Ga0070683_100231605 | Ga0070683_1002316051 | 536 |
| 373 | 3300005339 | Ga0070660_100135869 | Ga0070660_1001358691 | 536 |
| 374 | 3300005354 | Ga0070675_100114799 | Ga0070675_1001147991 | 536 |
| 375 | 3300005436 | Ga0070713_100010384 | Ga0070713_1000103844 | 536 |
| 376 | 3300005439 | Ga0070711_100059731 | Ga0070711_1000597312 | 536 |
| 377 | 3300005458 | Ga0070681_10069475 | Ga0070681_100694752 | 536 |
| 378 | 3300005539 | Ga0068853_100016892 | Ga0068853_1000168923 | 536 |
| 379 | 3300005543 | Ga0070672_100151133 | Ga0070672_1001511332 | 536 |
| 380 | 3300005547 | Ga0070693_100041241 | Ga0070693_1000412412 | 536 |
| 381 | 3300009093 | Ga0105240_10000944 | Ga0105240_1000094431 | 536 |
| 382 | 3300009093 | Ga0105240_10017034 | Ga0105240_100170345 | 536 |
| 383 | 3300009093 | Ga0105240_10184829 | Ga0105240_101848291 | 536 |
| 384 | 3300009174 | Ga0105241_10007759 | Ga0105241_100077593 | 536 |
| 385 | 3300009174 | Ga0105241_10041064 | Ga0105241_100410643 | 536 |
| 386 | 3300009545 | Ga0105237_10016720 | Ga0105237_100167203 | 536 |
| 387 | 3300009545 | Ga0105237_10018952 | Ga0105237_100189523 | 536 |
| 388 | 3300009545 | Ga0105237_10084676 | Ga0105237_100846762 | 536 |
| 389 | 3300009551 | Ga0105238_10021930 | Ga0105238_100219302 | 536 |
| 390 | 3300009551 | Ga0105238_10025577 | Ga0105238_100255773 | 536 |
| 391 | 3300010375 | Ga0105239_10051695 | Ga0105239_100516952 | 536 |
| 392 | 3300013105 | Ga0157369_10160148 | Ga0157369_101601482 | 536 |
| 393 | 3300013297 | Ga0157378_10009041 | Ga0157378_100090415 | 536 |
| 394 | 3300025284 | Ga0209130_1000071 | Ga0209130_100007162 | 536 |
| 395 | 3300025911 | Ga0207654_10014803 | Ga0207654_100148032 | 536 |
| 396 | 3300025913 | Ga0207695_10008914 | Ga0207695_100089144 | 536 |
| 397 | 3300025914 | Ga0207671_10016590 | Ga0207671_100165902 | 536 |
| 398 | 3300026041 | Ga0207639_10018667 | Ga0207639_100186672 | 536 |
| 399 | 3300026116 | Ga0207674_10024654 | Ga0207674_100246541 | 536 |
| 400 | 3300026116 | Ga0207674_10030004 | Ga0207674_100300042 | 536 |
| 401 | 3300033179 | Ga0307507_10011278 | Ga0307507_100112786 | 536 |
| 402 | 3300044656 | Ga0466969_0007732 | Ga0466969_0007732_2547_4175 | 536 |
| 403 | 3300045049 | Ga0466959_0017193 | Ga0466959_0017193_873_2501 | 536 |
| 404 | 3300047321 | Ga0495676_0028303 | Ga0495676_0028303_2920_4545 | 536 |
| 405 | iso_pu_bacteria | 2513237096 | 2513654074 | 536 |
| 406 | iso_pu_bacteria | 2513237145 | 2513918414 | 536 |
| 407 | iso_pu_bacteria | 2523231067 | 2523467281 | 536 |
| 408 | iso_pu_bacteria | 2643221651 | 2644288726 | 536 |
| 409 | iso_pu_bacteria | 2738543031 | 2739347785 | 536 |
| 410 | iso_pu_bacteria | 2841760612 | 2841766401 | 536 |
| 411 | iso_pu_bacteria | 2844104063 | 2844106168 | 536 |
| 412 | iso_pu_bacteria | 2851182111 | 2851186669 | 536 |
| 413 | iso_pu_bacteria | 2851246043 | 2851246524 | 536 |
| 414 | iso_pu_bacteria | 8016522445 | 8016528702 | 536 |
| 415 | iso_pu_bacteria | 8057529695 | 8057531282 | 536 |
| 416 | 3300005434 | Ga0070709_10040280 | Ga0070709_100402802 | 537 |
| 417 | 3300028800 | Ga0265338_10006948 | Ga0265338_1000694810 | 537 |
| 418 | iso_pu_bacteria | 2507262055 | 2507507678 | 537 |
| 419 | iso_pu_bacteria | 2508501009 | 2508541794 | 537 |
| 420 | iso_pu_bacteria | 2508501042 | 2508692658 | 537 |
| 421 | iso_pu_bacteria | 2508501128 | 2509149315 | 537 |
| 422 | iso_pu_bacteria | 2511231028 | 2511400926 | 537 |
| 423 | iso_pu_bacteria | 2513237092 | 2513628415 | 537 |
| 424 | iso_pu_bacteria | 2513237094 | 2513642972 | 537 |
| 425 | iso_pu_bacteria | 2513237095 | 2513647499 | 537 |
| 426 | iso_pu_bacteria | 2513237104 | 2513719467 | 537 |
| 427 | iso_pu_bacteria | 2513237137 | 2513856826 | 537 |
| 428 | iso_pu_bacteria | 2513237141 | 2513891267 | 537 |
| 429 | iso_pu_bacteria | 2515154112 | 2515626064 | 537 |
| 430 | iso_pu_bacteria | 2517093001 | 2517104144 | 537 |
| 431 | iso_pu_bacteria | 2517572143 | 2517891352 | 537 |
| 432 | iso_pu_bacteria | 2524023205 | 2524436292 | 537 |
| 433 | iso_pu_bacteria | 2524023210 | 2524468465 | 537 |
| 434 | iso_pu_bacteria | 2528768022 | 2528848996 | 537 |
| 435 | iso_pu_bacteria | 2602042107 | 2603860913 | 537 |
| 436 | iso_pu_bacteria | 2617270741 | 2617372713 | 537 |
| 437 | iso_pu_bacteria | 2667528175 | 2671118868 | 537 |
| 438 | iso_pu_bacteria | 2721755755 | 2723843699 | 537 |
| 439 | iso_pu_bacteria | 2728368998 | 2728750064 | 537 |
| 440 | iso_pu_bacteria | 2744054633 | 2745080753 | 537 |
| 441 | iso_pu_bacteria | 2791355197 | 2793066720 | 537 |
| 442 | iso_pu_bacteria | 2791355199 | 2793080656 | 537 |
| 443 | iso_pu_bacteria | 2816332527 | 2818236536 | 537 |
| 444 | iso_pu_bacteria | 2824661429 | 2824666472 | 537 |
| 445 | iso_pu_bacteria | 2824704595 | 2824710245 | 537 |
| 446 | iso_pu_bacteria | 2824732956 | 2824735844 | 537 |
| 447 | iso_pu_bacteria | 2824746037 | 2824750091 | 537 |
| 448 | iso_pu_bacteria | 2824753945 | 2824755967 | 537 |
| 449 | iso_pu_bacteria | 2824763712 | 2824767505 | 537 |
| 450 | iso_pu_bacteria | 2824773399 | 2824775140 | 537 |
| 451 | iso_pu_bacteria | 2841957949 | 2841959706 | 537 |
| 452 | iso_pu_bacteria | 2844315083 | 2844320007 | 537 |
| 453 | iso_pu_bacteria | 2857509624 | 2857512785 | 537 |
| 454 | iso_pu_bacteria | 2857524615 | 2857524635 | 537 |
| 455 | iso_pu_bacteria | 2874590934 | 2874598788 | 537 |
| 456 | iso_pu_bacteria | 2874604998 | 2874607392 | 537 |
| 457 | iso_pu_bacteria | 2874628541 | 2874635021 | 537 |
| 458 | iso_pu_bacteria | 2874645413 | 2874652244 | 537 |
| 459 | iso_pu_bacteria | 2876761206 | 2876766226 | 537 |
| 460 | iso_pu_bacteria | 2876771140 | 2876778827 | 537 |
| 461 | iso_pu_bacteria | 2876808645 | 2876814621 | 537 |
| 462 | iso_pu_bacteria | 2876818435 | 2876824278 | 537 |
| 463 | iso_pu_bacteria | 2879074833 | 2879082620 | 537 |
| 464 | iso_pu_bacteria | 2879099564 | 2879107117 | 537 |
| 465 | iso_pu_bacteria | 2879110137 | 2879114702 | 537 |
| 466 | iso_pu_bacteria | 2879127579 | 2879131537 | 537 |
| 467 | iso_pu_bacteria | 2879142872 | 2879147983 | 537 |
| 468 | iso_pu_bacteria | 2885383462 | 2885384045 | 537 |
| 469 | iso_pu_bacteria | 2885409591 | 2885410278 | 537 |
| 470 | iso_pu_bacteria | 2888378607 | 2888385436 | 537 |
| 471 | iso_pu_bacteria | 2888388044 | 2888392797 | 537 |
| 472 | iso_pu_bacteria | 2889033259 | 2889038031 | 537 |
| 473 | iso_pu_bacteria | 2893066018 | 2893069156 | 537 |
| 474 | iso_pu_bacteria | 2903727486 | 2903730318 | 537 |
| 475 | iso_pu_bacteria | 2903748898 | 2903755313 | 537 |
| 476 | iso_pu_bacteria | 2903768456 | 2903769713 | 537 |
| 477 | iso_pu_bacteria | 2904690495 | 2904691220 | 537 |
| 478 | iso_pu_bacteria | 2904699407 | 2904701306 | 537 |
| 479 | iso_pu_bacteria | 2904711408 | 2904711988 | 537 |
| 480 | iso_pu_bacteria | 2906602504 | 2906604747 | 537 |
| 481 | iso_pu_bacteria | 2906610324 | 2906616538 | 537 |
| 482 | iso_pu_bacteria | 2906635258 | 2906635311 | 537 |
| 483 | iso_pu_bacteria | 2906643746 | 2906643928 | 537 |
| 484 | iso_pu_bacteria | 2906660503 | 2906666856 | 537 |
| 485 | iso_pu_bacteria | 2908739725 | 2908741706 | 537 |
| 486 | iso_pu_bacteria | 2908756301 | 2908759139 | 537 |
| 487 | iso_pu_bacteria | 2908775508 | 2908781156 | 537 |
| 488 | iso_pu_bacteria | 2919073203 | 2919078517 | 537 |
| 489 | iso_pu_bacteria | 2922361189 | 2922366030 | 537 |
| 490 | iso_pu_bacteria | 2922368715 | 2922372422 | 537 |
| 491 | iso_pu_bacteria | 2922386360 | 2922387365 | 537 |
| 492 | iso_pu_bacteria | 2922425934 | 2922431442 | 537 |
| 493 | iso_pu_bacteria | 2929615660 | 2929621008 | 537 |
| 494 | iso_pu_bacteria | 2929624759 | 2929626161 | 537 |
| 495 | iso_pu_bacteria | 2932784394 | 2932784960 | 537 |
| 496 | iso_pu_bacteria | 2932794094 | 2932795162 | 537 |
| 497 | iso_pu_bacteria | 2932801729 | 2932805690 | 537 |
| 498 | iso_pu_bacteria | 2932809354 | 2932809992 | 537 |
| 499 | iso_pu_bacteria | 2932818245 | 2932818265 | 537 |
| 500 | iso_pu_bacteria | 2932828146 | 2932828797 | 537 |
| 501 | iso_pu_bacteria | 2933577622 | 2933583122 | 537 |
| 502 | iso_pu_bacteria | 2935608549 | 2935609812 | 537 |
| 503 | iso_pu_bacteria | 2935616580 | 2935619783 | 537 |
| 504 | iso_pu_bacteria | 2935630451 | 2935634038 | 537 |
| 505 | iso_pu_bacteria | 2935638405 | 2935638764 | 537 |
| 506 | iso_pu_bacteria | 2935648319 | 2935652158 | 537 |
| 507 | iso_pu_bacteria | 2935656913 | 2935659869 | 537 |
| 508 | iso_pu_bacteria | 2935665750 | 2935666385 | 537 |
| 509 | iso_pu_bacteria | 2935675223 | 2935676569 | 537 |
| 510 | iso_pu_bacteria | 2935684952 | 2935684952 | 537 |
| 511 | iso_pu_bacteria | 2935694250 | 2935694649 | 537 |
| 512 | iso_pu_bacteria | 2935703347 | 2935703770 | 537 |
| 513 | iso_pu_bacteria | 2935713505 | 2935713505 | 537 |
| 514 | iso_pu_bacteria | 2935722832 | 2935724125 | 537 |
| 515 | iso_pu_bacteria | 2935732158 | 2935733517 | 537 |
| 516 | iso_pu_bacteria | 2935741537 | 2935742896 | 537 |
| 517 | iso_pu_bacteria | 2935750917 | 2935750917 | 537 |
| 518 | iso_pu_bacteria | 2935760218 | 2935760552 | 537 |
| 519 | iso_pu_bacteria | 2935769743 | 2935771958 | 537 |
| 520 | iso_pu_bacteria | 2935777560 | 2935784326 | 537 |
| 521 | iso_pu_bacteria | 2935785616 | 2935787654 | 537 |
| 522 | iso_pu_bacteria | 2935793552 | 2935796286 | 537 |
| 523 | iso_pu_bacteria | 2935801545 | 2935801907 | 537 |
| 524 | iso_pu_bacteria | 2935810662 | 2935810678 | 537 |
| 525 | iso_pu_bacteria | 2935819856 | 2935822973 | 537 |
| 526 | iso_pu_bacteria | 2935827899 | 2935828258 | 537 |
| 527 | iso_pu_bacteria | 2935837841 | 2935842462 | 537 |
| 528 | iso_pu_bacteria | 2935847175 | 2935848555 | 537 |
| 529 | iso_pu_bacteria | 2935855204 | 2935857902 | 537 |
| 530 | iso_pu_bacteria | 2935864058 | 2935868756 | 537 |
| 531 | iso_pu_bacteria | 2935873716 | 2935874171 | 537 |
| 532 | iso_pu_bacteria | 2935883170 | 2935883940 | 537 |
| 533 | iso_pu_bacteria | 2935908558 | 2935909637 | 537 |
| 534 | iso_pu_bacteria | 2935916978 | 2935917362 | 537 |
| 535 | iso_pu_bacteria | 2935926038 | 2935927118 | 537 |
| 536 | iso_pu_bacteria | 2935934488 | 2935937038 | 537 |
| 537 | iso_pu_bacteria | 2935942939 | 2935944659 | 537 |
| 538 | iso_pu_bacteria | 2935951376 | 2935953096 | 537 |
| 539 | iso_pu_bacteria | 2935959822 | 2935966597 | 537 |
| 540 | iso_pu_bacteria | 2935967501 | 2935969936 | 537 |
| 541 | iso_pu_bacteria | 2935975950 | 2935980227 | 537 |
| 542 | iso_pu_bacteria | 2935984226 | 2935987013 | 537 |
| 543 | iso_pu_bacteria | 2935992306 | 2935992904 | 537 |
| 544 | iso_pu_bacteria | 2936002035 | 2936002817 | 537 |
| 545 | iso_pu_bacteria | 2936011229 | 2936014285 | 537 |
| 546 | iso_pu_bacteria | 2936019824 | 2936023875 | 537 |
| 547 | iso_pu_bacteria | 2936028420 | 2936031518 | 537 |
| 548 | iso_pu_bacteria | 2936037263 | 2936037902 | 537 |
| 549 | iso_pu_bacteria | 2936046547 | 2936049391 | 537 |
| 550 | iso_pu_bacteria | 2936055302 | 2936062141 | 537 |
| 551 | iso_pu_bacteria | 2940556831 | 2940558280 | 537 |
| 552 | iso_pu_bacteria | 2941507105 | 2941510659 | 537 |
| 553 | iso_pu_bacteria | 2941515067 | 2941518043 | 537 |
| 554 | iso_pu_bacteria | 2941523033 | 2941527086 | 537 |
| 555 | iso_pu_bacteria | 2941531003 | 2941531192 | 537 |
| 556 | iso_pu_bacteria | 2941538514 | 2941542511 | 537 |
| 557 | iso_pu_bacteria | 3005474847 | 3005481235 | 537 |
| 558 | iso_pu_bacteria | 3005594810 | 3005600298 | 537 |
| 559 | iso_pu_bacteria | 3005710791 | 3005715792 | 537 |
| 560 | iso_pu_bacteria | 3005718088 | 3005723148 | 537 |
| 561 | iso_pu_bacteria | 8006926726 | 8006927957 | 537 |
| 562 | iso_pu_bacteria | 8006933436 | 8006939474 | 537 |
| 563 | iso_pu_bacteria | 8006964411 | 8006972132 | 537 |
| 564 | iso_pu_bacteria | 8006973647 | 8006979224 | 537 |
| 565 | iso_pu_bacteria | 8006984368 | 8006984413 | 537 |
| 566 | iso_pu_bacteria | 8006994254 | 8007001347 | 537 |
| 567 | iso_pu_bacteria | 8016511872 | 8016520676 | 537 |
| 568 | iso_pu_bacteria | 8016548790 | 8016555016 | 537 |
| 569 | iso_pu_bacteria | 8016566248 | 8016572219 | 537 |
| 570 | iso_pu_bacteria | 8016575299 | 8016576408 | 537 |
| 571 | iso_pu_bacteria | 8016595262 | 8016601136 | 537 |
| 572 | iso_pu_bacteria | 8016613128 | 8016615592 | 537 |
| 573 | iso_pu_bacteria | 8016630954 | 8016639196 | 537 |
| 574 | iso_pu_bacteria | 8017057580 | 8017064906 | 537 |
| 575 | iso_pu_bacteria | 8019547302 | 8019552707 | 537 |
| 576 | iso_pu_bacteria | 8019555841 | 8019565352 | 537 |
| 577 | iso_pu_bacteria | 8019565922 | 8019575452 | 537 |
| 578 | iso_pu_bacteria | 8019576017 | 8019584282 | 537 |
| 579 | iso_pu_bacteria | 8019586578 | 8019592050 | 537 |
| 580 | iso_pu_bacteria | 8019597564 | 8019599233 | 537 |
| 581 | iso_pu_bacteria | 8019608314 | 8019609125 | 537 |
| 582 | iso_pu_bacteria | 8019619141 | 8019619798 | 537 |
| 583 | iso_pu_bacteria | 8019629233 | 8019633317 | 537 |
| 584 | iso_pu_bacteria | 8019638758 | 8019646583 | 537 |
| 585 | iso_pu_bacteria | 8019648815 | 8019649353 | 537 |
| 586 | iso_pu_bacteria | 8019659431 | 8019661191 | 537 |
| 587 | iso_pu_bacteria | 8019668869 | 8019670742 | 537 |
| 588 | iso_pu_bacteria | 8019678201 | 8019685462 | 537 |
| 589 | iso_pu_bacteria | 8019687851 | 8019691052 | 537 |
| 590 | iso_pu_bacteria | 8055742211 | 8055745129 | 537 |
| 591 | iso_pu_bacteria | 8056673599 | 8056681091 | 537 |
| 592 | iso_pu_bacteria | 8056681323 | 8056684738 | 537 |
| 593 | iso_pu_bacteria | 8056967851 | 8056975086 | 537 |
| 594 | 3300005548 | Ga0070665_100004434 | Ga0070665_1000044344 | 538 |
| 595 | 3300009093 | Ga0105240_10165503 | Ga0105240_101655032 | 538 |
| 596 | 3300037466 | Ga0395898_0022553 | Ga0395898_0022553_1955_3571 | 538 |
| 597 | 3300039453 | Ga0436362_0413279 | Ga0436362_0413279_739_2355 | 538 |
| 598 | 3300046520 | Ga0495637_0000328 | Ga0495637_0000328_27445_29103 | 538 |
| 599 | 3300046524 | Ga0495648_0021356 | Ga0495648_0021356_1524_3191 | 538 |
| 600 | 3300047472 | Ga0495686_0007775 | Ga0495686_0007775_3299_4957 | 538 |
| 601 | 3300049459 | Ga0495678_001313 | Ga0495678_001313_5006_6673 | 538 |
| 602 | 3300005327 | Ga0070658_10036019 | Ga0070658_100360192 | 539 |
| 603 | 3300005336 | Ga0070680_100007991 | Ga0070680_1000079912 | 539 |
| 604 | 3300005434 | Ga0070709_10036894 | Ga0070709_100368941 | 539 |
| 605 | 3300005614 | Ga0068856_100083462 | Ga0068856_1000834622 | 539 |
| 606 | 3300010375 | Ga0105239_10011360 | Ga0105239_100113606 | 539 |
| 607 | 3300025898 | Ga0207692_10088948 | Ga0207692_100889481 | 539 |
| 608 | 3300025906 | Ga0207699_10008564 | Ga0207699_100085644 | 539 |
| 609 | 3300025909 | Ga0207705_10043989 | Ga0207705_100439892 | 539 |
| 610 | 3300025912 | Ga0207707_10066929 | Ga0207707_100669292 | 539 |
| 611 | 3300025914 | Ga0207671_10045059 | Ga0207671_100450593 | 539 |
| 612 | 3300025915 | Ga0207693_10006974 | Ga0207693_1000697410 | 539 |
| 613 | 3300026078 | Ga0207702_10205565 | Ga0207702_102055652 | 539 |
| 614 | 3300031250 | Ga0265331_10013135 | Ga0265331_100131352 | 539 |
| 615 | 3300048921 | Ga0496118_0003407 | Ga0496118_0003407_15563_17182 | 539 |
| 616 | 3300048924 | Ga0496121_0010422 | Ga0496121_0010422_721_2343 | 539 |
| 617 | 3300048928 | Ga0496125_0000040 | Ga0496125_0000040_13699_15363 | 539 |
| 618 | 3300048928 | Ga0496125_0004755 | Ga0496125_0004755_7567_9228 | 539 |
| 619 | 3300048929 | Ga0496126_0143002 | Ga0496126_0143002_156_1775 | 539 |
| 620 | 3300053142 | Ga0500577_0003874 | Ga0500577_0003874_1299_2921 | 539 |
| 621 | 3300025919 | Ga0207657_10001672 | Ga0207657_1000167217 | 540 |
| 622 | 3300049568 | Ga0501031_0006214 | Ga0501031_0006214_4387_6015 | 540 |
| 623 | 3300049569 | Ga0501032_0000189 | Ga0501032_0000189_1995_3761 | 540 |
| 624 | 3300049570 | Ga0501033_0001037 | Ga0501033_0001037_23610_25247 | 540 |
| 625 | 3300049571 | Ga0501034_0007343 | Ga0501034_0007343_8581_10347 | 540 |
| 626 | 3300049572 | Ga0501036_0000134 | Ga0501036_0000134_22102_23868 | 540 |
| 627 | 3300049573 | Ga0501037_0002272 | Ga0501037_0002272_7116_8882 | 540 |
| 628 | 3300049574 | Ga0501038_0000929 | Ga0501038_0000929_346_2112 | 540 |
| 629 | 3300049575 | Ga0501039_0002379 | Ga0501039_0002379_352_2118 | 540 |
| 630 | 3300049579 | Ga0501043_0002576 | Ga0501043_0002576_7964_9730 | 540 |
| 631 | 3300049580 | Ga0501046_0034847 | Ga0501046_0034847_888_2654 | 540 |
| 632 | 3300049581 | Ga0501047_0000866 | Ga0501047_0000866_28088_29854 | 540 |
| 633 | 3300049581 | Ga0501047_0017605 | Ga0501047_0017605_3224_4849 | 540 |
| 634 | 3300049584 | Ga0501068_0003851 | Ga0501068_0003851_4856_6622 | 540 |
| 635 | 3300049585 | Ga0501069_0005415 | Ga0501069_0005415_4768_6534 | 540 |
| 636 | 3300049586 | Ga0501070_0003638 | Ga0501070_0003638_3077_4843 | 540 |
| 637 | 3300049589 | Ga0501073_0008652 | Ga0501073_0008652_3498_5264 | 540 |
| 638 | 3300049590 | Ga0501074_0003064 | Ga0501074_0003064_2662_4428 | 540 |
| 639 | 3300049742 | Ga0501080_0000200 | Ga0501080_0000200_14699_16465 | 540 |
| 640 | 3300049822 | Ga0501035_0000598 | Ga0501035_0000598_36891_38657 | 540 |
| 641 | 3300049823 | Ga0501044_0000887 | Ga0501044_0000887_31469_33235 | 540 |
| 642 | 3300049823 | Ga0501044_0020320 | Ga0501044_0020320_5424_7046 | 540 |
| 643 | 3300049823 | Ga0501044_0147435 | Ga0501044_0147435_505_2127 | 540 |
| 644 | 3300053145 | Ga0500586_000414 | Ga0500586_000414_6223_7890 | 540 |
| 645 | 3300003203 | JGI25406J46586_10000214 | JGI25406J46586_1000021416 | 541 |
| 646 | 3300003215 | JGI25153J46596_10005616 | JGI25153J46596_100056164 | 541 |
| 647 | 3300005329 | Ga0070683_100142289 | Ga0070683_1001422892 | 541 |
| 648 | 3300005336 | Ga0070680_100012621 | Ga0070680_1000126217 | 541 |
| 649 | 3300005339 | Ga0070660_100003001 | Ga0070660_1000030013 | 541 |
| 650 | 3300005347 | Ga0070668_100120141 | Ga0070668_1001201412 | 541 |
| 651 | 3300005434 | Ga0070709_10000203 | Ga0070709_1000020326 | 541 |
| 652 | 3300005434 | Ga0070709_10004227 | Ga0070709_100042272 | 541 |
| 653 | 3300005435 | Ga0070714_100009406 | Ga0070714_1000094062 | 541 |
| 654 | 3300005436 | Ga0070713_100001761 | Ga0070713_1000017617 | 541 |
| 655 | 3300005436 | Ga0070713_100016592 | Ga0070713_1000165924 | 541 |
| 656 | 3300005437 | Ga0070710_10001622 | Ga0070710_1000162210 | 541 |
| 657 | 3300005439 | Ga0070711_100006659 | Ga0070711_1000066595 | 541 |
| 658 | 3300005439 | Ga0070711_100019115 | Ga0070711_1000191153 | 541 |
| 659 | 3300005455 | Ga0070663_100136246 | Ga0070663_1001362461 | 541 |
| 660 | 3300005467 | Ga0070706_100148505 | Ga0070706_1001485052 | 541 |
| 661 | 3300005563 | Ga0068855_100020164 | Ga0068855_1000201642 | 541 |
| 662 | 3300005563 | Ga0068855_100191175 | Ga0068855_1001911752 | 541 |
| 663 | 3300005578 | Ga0068854_100140792 | Ga0068854_1001407921 | 541 |
| 664 | 3300005614 | Ga0068856_100003347 | Ga0068856_1000033471 | 541 |
| 665 | 3300005843 | Ga0068860_100000081 | Ga0068860_10000008189 | 541 |
| 666 | 3300005937 | Ga0081455_10001734 | Ga0081455_100017345 | 541 |
| 667 | 3300005983 | Ga0081540_1003965 | Ga0081540_10039658 | 541 |
| 668 | 3300005983 | Ga0081540_1018499 | Ga0081540_10184992 | 541 |
| 669 | 3300005985 | Ga0081539_10000768 | Ga0081539_1000076836 | 541 |
| 670 | 3300006028 | Ga0070717_10001267 | Ga0070717_100012678 | 541 |
| 671 | 3300006173 | Ga0070716_100014285 | Ga0070716_1000142853 | 541 |
| 672 | 3300006175 | Ga0070712_100006733 | Ga0070712_1000067335 | 541 |
| 673 | 3300006353 | Ga0075370_10014516 | Ga0075370_100145163 | 541 |
| 674 | 3300006942 | Ga0099824_1007408 | Ga0099824_100740811 | 541 |
| 675 | 3300006943 | Ga0099822_1018218 | Ga0099822_10182185 | 541 |
| 676 | 3300009093 | Ga0105240_10034221 | Ga0105240_100342216 | 541 |
| 677 | 3300009093 | Ga0105240_10170691 | Ga0105240_101706912 | 541 |
| 678 | 3300009147 | Ga0114129_10411862 | Ga0114129_104118622 | 541 |
| 679 | 3300009545 | Ga0105237_10046497 | Ga0105237_100464974 | 541 |
| 680 | 3300013105 | Ga0157369_10021190 | Ga0157369_100211901 | 541 |
| 681 | 3300021377 | Ga0213874_10013879 | Ga0213874_100138792 | 541 |
| 682 | 3300021384 | Ga0213876_10008410 | Ga0213876_100084103 | 541 |
| 683 | 3300025254 | Ga0209148_1000180 | Ga0209148_100018098 | 541 |
| 684 | 3300025261 | Ga0209233_1001700 | Ga0209233_10017007 | 541 |
| 685 | 3300025261 | Ga0209233_1011023 | Ga0209233_10110232 | 541 |
| 686 | 3300025272 | Ga0209455_1001704 | Ga0209455_10017049 | 541 |
| 687 | 3300025295 | Ga0209564_1000385 | Ga0209564_100038569 | 541 |
| 688 | 3300025297 | Ga0209758_1004569 | Ga0209758_100456911 | 541 |
| 689 | 3300025302 | Ga0207426_1000572 | Ga0207426_100057226 | 541 |
| 690 | 3300025898 | Ga0207692_10003008 | Ga0207692_100030082 | 541 |
| 691 | 3300025898 | Ga0207692_10015388 | Ga0207692_100153883 | 541 |
| 692 | 3300025906 | Ga0207699_10020956 | Ga0207699_100209563 | 541 |
| 693 | 3300025912 | Ga0207707_10002705 | Ga0207707_100027058 | 541 |
| 694 | 3300025913 | Ga0207695_10136750 | Ga0207695_101367502 | 541 |
| 695 | 3300025915 | Ga0207693_10014354 | Ga0207693_100143545 | 541 |
| 696 | 3300025915 | Ga0207693_10037039 | Ga0207693_100370393 | 541 |
| 697 | 3300025915 | Ga0207693_10081201 | Ga0207693_100812012 | 541 |
| 698 | 3300025916 | Ga0207663_10001473 | Ga0207663_100014732 | 541 |
| 699 | 3300025916 | Ga0207663_10002050 | Ga0207663_100020506 | 541 |
| 700 | 3300025916 | Ga0207663_10088244 | Ga0207663_100882442 | 541 |
| 701 | 3300025917 | Ga0207660_10034957 | Ga0207660_100349571 | 541 |
| 702 | 3300025917 | Ga0207660_10055477 | Ga0207660_100554772 | 541 |
| 703 | 3300025919 | Ga0207657_10006890 | Ga0207657_100068903 | 541 |
| 704 | 3300025921 | Ga0207652_10001690 | Ga0207652_1000169011 | 541 |
| 705 | 3300025924 | Ga0207694_10005031 | Ga0207694_1000503111 | 541 |
| 706 | 3300025928 | Ga0207700_10026155 | Ga0207700_100261553 | 541 |
| 707 | 3300025929 | Ga0207664_10002721 | Ga0207664_1000272112 | 541 |
| 708 | 3300025939 | Ga0207665_10001320 | Ga0207665_1000132014 | 541 |
| 709 | 3300025939 | Ga0207665_10001972 | Ga0207665_100019727 | 541 |
| 710 | 3300025942 | Ga0207689_10073542 | Ga0207689_100735422 | 541 |
| 711 | 3300025945 | Ga0207679_10024233 | Ga0207679_100242334 | 541 |
| 712 | 3300025949 | Ga0207667_10002017 | Ga0207667_1000201714 | 541 |
| 713 | 3300025981 | Ga0207640_10116625 | Ga0207640_101166252 | 541 |
| 714 | 3300026078 | Ga0207702_10000548 | Ga0207702_1000054834 | 541 |
| 715 | 3300026089 | Ga0207648_10129840 | Ga0207648_101298402 | 541 |
| 716 | 3300027357 | Ga0209589_1000014 | Ga0209589_1000014171 | 541 |
| 717 | 3300027361 | Ga0209489_100014 | Ga0209489_100014171 | 541 |
| 718 | 3300027363 | Ga0209700_100024 | Ga0209700_100024171 | 541 |
| 719 | 3300028379 | Ga0268266_10008590 | Ga0268266_100085907 | 541 |
| 720 | 3300028380 | Ga0268265_10072621 | Ga0268265_100726212 | 541 |
| 721 | 3300028381 | Ga0268264_10000048 | Ga0268264_1000004884 | 541 |
| 722 | 3300028573 | Ga0265334_10001696 | Ga0265334_100016967 | 541 |
| 723 | 3300028573 | Ga0265334_10008302 | Ga0265334_100083023 | 541 |
| 724 | 3300028654 | Ga0265322_10001590 | Ga0265322_100015906 | 541 |
| 725 | 3300028666 | Ga0265336_10000135 | Ga0265336_1000013530 | 541 |
| 726 | 3300028794 | Ga0307515_10102563 | Ga0307515_101025632 | 541 |
| 727 | 3300028800 | Ga0265338_10000034 | Ga0265338_10000034176 | 541 |
| 728 | 3300029957 | Ga0265324_10016573 | Ga0265324_100165732 | 541 |
| 729 | 3300031238 | Ga0265332_10033695 | Ga0265332_100336952 | 541 |
| 730 | 3300031250 | Ga0265331_10008950 | Ga0265331_100089502 | 541 |
| 731 | 3300031616 | Ga0307508_10000032 | Ga0307508_1000003274 | 541 |
| 732 | 3300031711 | Ga0265314_10004266 | Ga0265314_100042661 | 541 |
| 733 | 3300031712 | Ga0265342_10020228 | Ga0265342_100202283 | 541 |
| 734 | 3300031730 | Ga0307516_10005934 | Ga0307516_100059348 | 541 |
| 735 | 3300031730 | Ga0307516_10082192 | Ga0307516_100821922 | 541 |
| 736 | 3300033442 | Ga0315911_1000002 | Ga0315911_1000002149 | 541 |
| 737 | 3300035086 | Ga0373934_0005355 | Ga0373934_0005355_2492_4120 | 541 |
| 738 | 3300035111 | Ga0373923_0021021 | Ga0373923_0021021_696_2324 | 541 |
| 739 | 3300035117 | Ga0373953_0000604 | Ga0373953_0000604_1630_3258 | 541 |
| 740 | 3300035117 | Ga0373953_0025139 | Ga0373953_0025139_304_1929 | 541 |
| 741 | 3300035118 | Ga0373954_0008754 | Ga0373954_0008754_1579_3207 | 541 |
| 742 | 3300035118 | Ga0373954_0025683 | Ga0373954_0025683_29_1654 | 541 |
| 743 | 3300035119 | Ga0373956_0001292 | Ga0373956_0001292_119_1747 | 541 |
| 744 | 3300035120 | Ga0373957_0015911 | Ga0373957_0015911_346_1974 | 541 |
| 745 | 3300035172 | Ga0373955_0020984 | Ga0373955_0020984_620_2248 | 541 |
| 746 | 3300035695 | Ga0373927_0013220 | Ga0373927_0013220_1122_2747 | 541 |
| 747 | 3300035695 | Ga0373927_0082950 | Ga0373927_0082950_114_1739 | 541 |
| 748 | 3300035724 | Ga0373933_0013111 | Ga0373933_0013111_1263_2891 | 541 |
| 749 | 3300035724 | Ga0373933_0067748 | Ga0373933_0067748_125_1756 | 541 |
| 750 | 3300036401 | Ga0373937_0028281 | Ga0373937_0028281_464_2098 | 541 |
| 751 | 3300036401 | Ga0373937_0031478 | Ga0373937_0031478_1440_3065 | 541 |
| 752 | 3300044658 | Ga0466972_0000172 | Ga0466972_0000172_46707_48332 | 541 |
| 753 | 3300045976 | Ga0466967_0033446 | Ga0466967_0033446_1262_2887 | 541 |
| 754 | 3300045976 | Ga0466967_0193005 | Ga0466967_0193005_190_1815 | 541 |
| 755 | 3300046454 | Ga0495592_0036667 | Ga0495592_0036667_363_1988 | 541 |
| 756 | 3300046454 | Ga0495592_0060346 | Ga0495592_0060346_633_2261 | 541 |
| 757 | 3300046455 | Ga0495603_0015187 | Ga0495603_0015187_1018_2646 | 541 |
| 758 | 3300046455 | Ga0495603_0034107 | Ga0495603_0034107_1194_2819 | 541 |
| 759 | 3300046459 | Ga0495629_0053128 | Ga0495629_0053128_867_2492 | 541 |
| 760 | 3300046460 | Ga0495638_0005277 | Ga0495638_0005277_2514_4142 | 541 |
| 761 | 3300046463 | Ga0495653_0002374 | Ga0495653_0002374_12440_14068 | 541 |
| 762 | 3300046463 | Ga0495653_0036154 | Ga0495653_0036154_709_2334 | 541 |
| 763 | 3300046492 | Ga0495585_0024148 | Ga0495585_0024148_1832_3460 | 541 |
| 764 | 3300046507 | Ga0495606_0021320 | Ga0495606_0021320_1744_3369 | 541 |
| 765 | 3300046511 | Ga0495608_0002876 | Ga0495608_0002876_6866_8494 | 541 |
| 766 | 3300046511 | Ga0495608_0039619 | Ga0495608_0039619_1391_3016 | 541 |
| 767 | 3300046514 | Ga0495618_0009642 | Ga0495618_0009642_3253_4878 | 541 |
| 768 | 3300046522 | Ga0495643_0079997 | Ga0495643_0079997_34_1662 | 541 |
| 769 | 3300046524 | Ga0495648_0000936 | Ga0495648_0000936_27071_28705 | 541 |
| 770 | 3300046533 | Ga0495640_0038605 | Ga0495640_0038605_658_2286 | 541 |
| 771 | 3300046536 | Ga0495587_0004571 | Ga0495587_0004571_6902_8530 | 541 |
| 772 | 3300046559 | Ga0495667_0093450 | Ga0495667_0093450_184_1809 | 541 |
| 773 | 3300046660 | Ga0495625_0021621 | Ga0495625_0021621_1240_2865 | 541 |
| 774 | 3300046663 | Ga0495635_0018594 | Ga0495635_0018594_1957_3585 | 541 |
| 775 | 3300046663 | Ga0495635_0041063 | Ga0495635_0041063_186_1811 | 541 |
| 776 | 3300046674 | Ga0495588_0002049 | Ga0495588_0002049_5379_7004 | 541 |
| 777 | 3300046679 | Ga0495623_0015025 | Ga0495623_0015025_826_2451 | 541 |
| 778 | 3300046680 | Ga0495646_0005491 | Ga0495646_0005491_210_1838 | 541 |
| 779 | 3300046680 | Ga0495646_0014776 | Ga0495646_0014776_1766_3391 | 541 |
| 780 | 3300046689 | Ga0495613_0098186 | Ga0495613_0098186_146_1771 | 541 |
| 781 | 3300046690 | Ga0495624_0024480 | Ga0495624_0024480_1795_3420 | 541 |
| 782 | 3300047315 | Ga0495581_0074093 | Ga0495581_0074093_283_1908 | 541 |
| 783 | 3300047320 | Ga0495672_0042578 | Ga0495672_0042578_420_2048 | 541 |
| 784 | 3300047471 | Ga0495684_0039304 | Ga0495684_0039304_306_1931 | 541 |
| 785 | 3300047471 | Ga0495684_0082746 | Ga0495684_0082746_602_2230 | 541 |
| 786 | 3300048088 | Ga0495602_0009113 | Ga0495602_0009113_7029_8654 | 541 |
| 787 | 3300048906 | Ga0496103_0052678 | Ga0496103_0052678_573_2198 | 541 |
| 788 | 3300048907 | Ga0496104_0011101 | Ga0496104_0011101_5000_6625 | 541 |
| 789 | 3300048907 | Ga0496104_0070856 | Ga0496104_0070856_933_2564 | 541 |
| 790 | 3300048907 | Ga0496104_0159382 | Ga0496104_0159382_448_2073 | 541 |
| 791 | 3300048908 | Ga0496105_0003099 | Ga0496105_0003099_10585_12210 | 541 |
| 792 | 3300048908 | Ga0496105_0127461 | Ga0496105_0127461_82_1707 | 541 |
| 793 | 3300048914 | Ga0496111_0039869 | Ga0496111_0039869_1350_2975 | 541 |
| 794 | 3300048915 | Ga0496112_0000017 | Ga0496112_0000017_136828_138453 | 541 |
| 795 | 3300048915 | Ga0496112_0108292 | Ga0496112_0108292_160_1785 | 541 |
| 796 | 3300048915 | Ga0496112_0141386 | Ga0496112_0141386_220_1845 | 541 |
| 797 | 3300048915 | Ga0496112_0189591 | Ga0496112_0189591_102_1727 | 541 |
| 798 | 3300048916 | Ga0496113_0043185 | Ga0496113_0043185_17_1642 | 541 |
| 799 | 3300048918 | Ga0496115_0020774 | Ga0496115_0020774_1422_3059 | 541 |
| 800 | 3300048919 | Ga0496116_0003125 | Ga0496116_0003125_12976_14604 | 541 |
| 801 | 3300048919 | Ga0496116_0018009 | Ga0496116_0018009_975_2600 | 541 |
| 802 | 3300048920 | Ga0496117_0091650 | Ga0496117_0091650_19_1692 | 541 |
| 803 | 3300048922 | Ga0496119_0034548 | Ga0496119_0034548_1503_3128 | 541 |
| 804 | 3300048924 | Ga0496121_0000230 | Ga0496121_0000230_70253_71881 | 541 |
| 805 | 3300048924 | Ga0496121_0004694 | Ga0496121_0004694_12591_14219 | 541 |
| 806 | 3300048924 | Ga0496121_0008031 | Ga0496121_0008031_10262_11887 | 541 |
| 807 | 3300048924 | Ga0496121_0017764 | Ga0496121_0017764_2332_3957 | 541 |
| 808 | 3300048924 | Ga0496121_0048525 | Ga0496121_0048525_1917_3542 | 541 |
| 809 | 3300048924 | Ga0496121_0066502 | Ga0496121_0066502_774_2402 | 541 |
| 810 | 3300048925 | Ga0496122_0114335 | Ga0496122_0114335_65_1693 | 541 |
| 811 | 3300048928 | Ga0496125_0022192 | Ga0496125_0022192_116_1744 | 541 |
| 812 | 3300048928 | Ga0496125_0043840 | Ga0496125_0043840_1301_2926 | 541 |
| 813 | 3300048929 | Ga0496126_0002483 | Ga0496126_0002483_210_1838 | 541 |
| 814 | 3300048929 | Ga0496126_0012513 | Ga0496126_0012513_2833_4470 | 541 |
| 815 | 3300048929 | Ga0496126_0022270 | Ga0496126_0022270_1165_2790 | 541 |
| 816 | 3300048929 | Ga0496126_0026298 | Ga0496126_0026298_1742_3367 | 541 |
| 817 | 3300048929 | Ga0496126_0029779 | Ga0496126_0029779_2585_4222 | 541 |
| 818 | 3300048929 | Ga0496126_0048948 | Ga0496126_0048948_129_1781 | 541 |
| 819 | 3300048929 | Ga0496126_0054002 | Ga0496126_0054002_1452_3077 | 541 |
| 820 | 3300048929 | Ga0496126_0078303 | Ga0496126_0078303_450_2090 | 541 |
| 821 | 3300048929 | Ga0496126_0091610 | Ga0496126_0091610_979_2604 | 541 |
| 822 | 3300049568 | Ga0501031_0008668 | Ga0501031_0008668_1575_3200 | 541 |
| 823 | 3300049569 | Ga0501032_0000769 | Ga0501032_0000769_22487_24112 | 541 |
| 824 | 3300049570 | Ga0501033_0000311 | Ga0501033_0000311_13799_15424 | 541 |
| 825 | 3300049571 | Ga0501034_0000039 | Ga0501034_0000039_220231_221856 | 541 |
| 826 | 3300049572 | Ga0501036_0000127 | Ga0501036_0000127_15633_17258 | 541 |
| 827 | 3300049573 | Ga0501037_0000025 | Ga0501037_0000025_122800_124425 | 541 |
| 828 | 3300049574 | Ga0501038_0000342 | Ga0501038_0000342_36735_38360 | 541 |
| 829 | 3300049575 | Ga0501039_0000840 | Ga0501039_0000840_7756_9381 | 541 |
| 830 | 3300049579 | Ga0501043_0000120 | Ga0501043_0000120_28603_30228 | 541 |
| 831 | 3300049580 | Ga0501046_0000359 | Ga0501046_0000359_15652_17277 | 541 |
| 832 | 3300049581 | Ga0501047_0000379 | Ga0501047_0000379_5588_7213 | 541 |
| 833 | 3300049582 | Ga0501048_0000352 | Ga0501048_0000352_18779_20404 | 541 |
| 834 | 3300049583 | Ga0501067_0000025 | Ga0501067_0000025_14215_15840 | 541 |
| 835 | 3300049585 | Ga0501069_0001694 | Ga0501069_0001694_6782_8407 | 541 |
| 836 | 3300049586 | Ga0501070_0002185 | Ga0501070_0002185_8432_10057 | 541 |
| 837 | 3300049588 | Ga0501072_0003699 | Ga0501072_0003699_2089_3714 | 541 |
| 838 | 3300049589 | Ga0501073_0000091 | Ga0501073_0000091_9978_11603 | 541 |
| 839 | 3300049590 | Ga0501074_0000489 | Ga0501074_0000489_13918_15543 | 541 |
| 840 | 3300049741 | Ga0501079_0004084 | Ga0501079_0004084_1780_3405 | 541 |
| 841 | 3300049742 | Ga0501080_0000321 | Ga0501080_0000321_26791_28416 | 541 |
| 842 | 3300049744 | Ga0501083_0000284 | Ga0501083_0000284_21197_22822 | 541 |
| 843 | 3300049822 | Ga0501035_0001251 | Ga0501035_0001251_20407_22032 | 541 |
| 844 | 3300049823 | Ga0501044_0000274 | Ga0501044_0000274_50173_51798 | 541 |
| 845 | 3300049824 | Ga0501045_0040862 | Ga0501045_0040862_1094_2719 | 541 |
| 846 | 3300050494 | nmdc:mga06z11_22778_c1 | nmdc:mga06z11_22778_c1_225_1856 | 541 |
| 847 | 3300050496 | nmdc:mga07m45_745_c1 | nmdc:mga07m45_745_c1_9945_11576 | 541 |
| 848 | 3300053077 | Ga0495601_0021098 | Ga0495601_0021098_2300_3928 | 541 |
| 849 | 3300053077 | Ga0495601_0027072 | Ga0495601_0027072_256_1881 | 541 |
| 850 | 3300053080 | Ga0500635_0002838 | Ga0500635_0002838_58_1686 | 541 |
| 851 | 3300053084 | Ga0495595_0003433 | Ga0495595_0003433_1263_2891 | 541 |
| 852 | 3300053087 | Ga0500643_000456 | Ga0500643_000456_12402_14027 | 541 |
| 853 | 3300053094 | Ga0500566_0000043 | Ga0500566_0000043_58738_60366 | 541 |
| 854 | 3300053094 | Ga0500566_0000370 | Ga0500566_0000370_11589_13214 | 541 |
| 855 | 3300053095 | Ga0500640_005288 | Ga0500640_005288_929_2557 | 541 |
| 856 | 3300053096 | Ga0500641_0039111 | Ga0500641_0039111_236_1861 | 541 |
| 857 | 3300053098 | Ga0500650_0000365 | Ga0500650_0000365_4582_6207 | 541 |
| 858 | 3300053104 | Ga0500556_0000468 | Ga0500556_0000468_14445_16073 | 541 |
| 859 | 3300053108 | Ga0500562_006967 | Ga0500562_006967_45_1673 | 541 |
| 860 | 3300053111 | Ga0500572_000024 | Ga0500572_000024_9678_11306 | 541 |
| 861 | 3300053111 | Ga0500572_000704 | Ga0500572_000704_8130_9758 | 541 |
| 862 | 3300053116 | Ga0500592_002667 | Ga0500592_002667_358_1986 | 541 |
| 863 | 3300053122 | Ga0500608_001300 | Ga0500608_001300_7037_8665 | 541 |
| 864 | 3300053123 | Ga0500614_001091 | Ga0500614_001091_1935_3563 | 541 |
| 865 | 3300053130 | Ga0500642_0000019 | Ga0500642_0000019_138573_140201 | 541 |
| 866 | 3300053130 | Ga0500642_0000252 | Ga0500642_0000252_11502_13127 | 541 |
| 867 | 3300053134 | Ga0500658_0017676 | Ga0500658_0017676_88_1713 | 541 |
| 868 | 3300053136 | Ga0500559_0001011 | Ga0500559_0001011_8803_10428 | 541 |
| 869 | 3300053136 | Ga0500559_0004998 | Ga0500559_0004998_370_1995 | 541 |
| 870 | 3300053136 | Ga0500559_0011705 | Ga0500559_0011705_1125_2753 | 541 |
| 871 | 3300053139 | Ga0500568_0001665 | Ga0500568_0001665_2521_4146 | 541 |
| 872 | 3300053139 | Ga0500568_0027575 | Ga0500568_0027575_622_2247 | 541 |
| 873 | 3300053142 | Ga0500577_0011877 | Ga0500577_0011877_680_2305 | 541 |
| 874 | 3300053148 | Ga0500590_068324 | Ga0500590_068324_48_1673 | 541 |
| 875 | 3300053150 | Ga0500603_000391 | Ga0500603_000391_2797_4422 | 541 |
| 876 | 3300053150 | Ga0500603_000801 | Ga0500603_000801_70_1698 | 541 |
| 877 | 3300053151 | Ga0500604_0001275 | Ga0500604_0001275_3189_4814 | 541 |
| 878 | 3300053153 | Ga0500616_0000041 | Ga0500616_0000041_12599_14227 | 541 |
| 879 | 3300053156 | Ga0500622_0002498 | Ga0500622_0002498_25_1653 | 541 |
| 880 | 3300053159 | Ga0500630_000112 | Ga0500630_000112_12020_13648 | 541 |
| 881 | 3300053163 | Ga0500639_000040 | Ga0500639_000040_32843_34471 | 541 |
| 882 | 3300053177 | Ga0500636_0012982 | Ga0500636_0012982_1170_2795 | 541 |
| 883 | 3300053178 | Ga0500637_0002167 | Ga0500637_0002167_4174_5799 | 541 |
| 884 | 3300053737 | Ga0500601_000203 | Ga0500601_000203_3445_5070 | 541 |
| 885 | 3300054114 | Ga0501084_0027916 | Ga0501084_0027916_1095_2720 | 541 |
| 886 | 3300060353 | Ga0501082_0007446 | Ga0501082_0007446_1136_2761 | 541 |
| 887 | iso_pu_bacteria | 2513237098 | 2513679254 | 541 |
| 888 | iso_pu_bacteria | 2513237101 | 2513698089 | 541 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qpz-assembly2.cif.gz_F | crystal structure of the formolase fls_v2 in space group p 21 | 0.9227 | 2 | 527 |
| 4qq8-assembly1.cif.gz_B | crystal structure of the formolase fls in space group p 43 21 2 | 0.9216 | 2 | 527 |
| 2q28-assembly1.cif.gz_A | crystal structure of oxalyl-coa decarboxylase from escherichia coli in complex with adenosine-5`-diphosphate | 0.9182 | 1 | 531 |
| 7b2e-assembly2.cif.gz_D | quadruple mutant of oxalyl-coa decarboxylase from methylorubrum extorquens with bound tpp and adp | 0.9176 | 1 | 531 |
| 6lpi-assembly4.cif.gz_D | crystal structure of ahas holo-enzyme | 0.9174 | 2 | 529 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0DP89_1_170_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9646 | 4 | 175 | 3.40.50.970 |
| af_P9WG39_1_179_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9573 | 2 | 172 | 3.40.50.970 |
| af_B0G117_40_223_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9542 | 4 | 170 | 3.40.50.970 |
| af_P0DP89_1_170_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9537 | 4 | 175 | 3.40.50.970 |
| af_Q9Y7M1_1_173_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9498 | 2 | 173 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522ZEN2-F1-model_v4 | TPP-binding protein | 0.977 | 1 | 540 |
GO:0000287
GO:0003984 GO:0005948 GO:0009097 GO:0009099 GO:0030976 GO:0050660 |
| AF-A0A845DIY8-F1-model_v4 | Thiamine pyrophosphate-binding protein | 0.9729 | 387 | 525 |
GO:0000287
GO:0003984 GO:0005948 GO:0009097 GO:0009099 GO:0030976 GO:0050660 |
| AF-A0A530Z970-F1-model_v4 | Thiamine pyrophosphate enzyme N-terminal TPP-binding domain-containing protein | 0.9665 | 7 | 108 |
GO:0003984
GO:0005948 GO:0009097 GO:0009099 GO:0030976 GO:0050660 |
| AF-A0A3N5UJ56-F1-model_v4 | Thiamine pyrophosphate-binding protein | 0.9648 | 2 | 172 |
GO:0003984
GO:0005948 GO:0009097 GO:0009099 GO:0030976 GO:0050660 |
| AF-A0A7R9H3J0-F1-model_v4 | Thiamine pyrophosphate enzyme N-terminal TPP-binding domain-containing protein | 0.9647 | 4 | 170 |
GO:0003984
GO:0005948 GO:0009097 GO:0009099 GO:0030976 GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar