F484748

General Info

Members Datasets Scaffolds Average Seq Length
888 559 687 538

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10003273|Ga0070681_100032739
Length 625
Sequence MTSMTGGEAIVSSLVAHGVDTVFGLPGAQVYGLFDAFHQAQLKVIGARHEQACAYMAYGYARSSGKPGVFSVVPGPGVLNAGAGLLTAFGGNEPVLCLTGQVPTQFLDKGRGHLHEMPDQLATLRTFVKWADRIEYPDIAPTMVSRAFQEMMSGRRGPVALEMPWDVFTQRADVGVSKVFDPFRIKEAAALITASKRPMIFVGSGAIHAREEVLELAELIDAPVVAFRSGRGIVSNAHELGLTMAAAYRLWPTTDLMIGIGTRLELPTMSRWPYRPDGLKSVRIDIDPIEMRRYTSDVSVISDSRAGTRDLLAAVRKAGYEATAAAQEEIQKVQPQMAYLNILREVLPDNAIVTDELSQVGFTSWYGFPIYEPRTFITSGYQGTLGSGFPTALGAKVANPDRPVVAITGDGGFMFGVQELSTAVQFNIGVVTLVFNNNAYGNVRRDQRTRFDGRVVAADLVNPDFVKLAESFGVAASRVTAPDHFRPALEKALAHGGPSLIAVEVPRDSEVTPWTFIHPGCAQRRPGIWRLRRRKRNRADLRRFPERQVDALAAEQRVLAIGQRRHAVKGEPRRPAPDHDVAMHQPVTCRPVCTFQSAPQEGRGQAERHRDDRRVIVLLVAVLVQ

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
16 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572101 Frankia sp. DC12 Isolate Nodule
20 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
21 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
25 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
26 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
27 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2643221651 Afipia sp. Root123D2 Isolate Unclassified
30 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
31 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
32 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
33 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
34 2739367653 Kocuria sp. OV113 Isolate Unclassified
35 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
36 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
37 2791355199
38 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
39 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
40 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
41 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
42 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
43 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
44 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
45 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
46 2841760612 Bosea sp. Tri-49 Isolate Nodule
47 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
48 2844104063 Bosea sp. Tri-39 Isolate Nodule
49 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
50 2851182111 Bosea sp. Tri-44 Isolate Nodule
51 2851246043 Bosea sp. Tri-54 Isolate Nodule
52 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
53 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
54 2857727296 Kocuria sp. R-72562 Isolate Unclassified
55 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
56 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
57 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
58 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
59 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
60 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
61 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
62 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
63 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
64 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
65 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
66 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
67 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
68 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
69 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
70 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
71 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
72 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
73 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
74 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
75 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
76 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
77 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
78 2904699407
79 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
80 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
81 2906610324
82 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
83 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
84 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
85 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
86 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
87 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
88 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
89 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
90 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
91 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
92 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
93 2922368715
94 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
95 2922425934
96 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
97 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
98 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
99 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
100 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
101 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
102 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
103 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
104 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
105 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
106 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
107 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
108 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
109 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
110 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
111 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
112 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
113 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
114 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
115 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
116 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
117 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
118 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
119 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
120 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
121 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
122 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
123 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
124 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
125 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
126 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
127 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
128 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
129 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
130 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
131 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
132 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
133 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
134 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
135 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
136 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
137 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
138 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
139 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
140 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
141 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
142 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
143 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
144 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
145 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
146 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
147 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
148 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
149 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
150 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
151 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
152 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
153 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
154 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
155 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
156 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
157 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
158 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
159 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
160 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
161 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
162 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
163 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
164 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
165 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
166 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
167 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
168 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
169 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
170 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
171 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
172 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
173 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
174 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
175 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
176 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
177 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
178 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
179 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
180 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
181 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
182 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
183 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
184 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
185 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
186 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
187 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
188 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
189 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
190 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
191 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
192 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
193 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
194 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
195 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
196 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
197 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
198 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
199 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
200 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
201 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
202 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
203 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
204 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
205 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
206 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
207 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
208 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
209 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
210 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
211 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
212 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
213 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
214 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
215 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
216 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
217 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
218 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
219 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
220 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
221 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
222 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
223 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
224 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
225 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
226 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
227 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
228 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
229 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
230 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
231 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
232 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
233 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
234 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
235 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
236 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
237 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
238 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
239 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
240 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
241 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
242 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
243 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
244 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
245 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
246 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
249 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
251 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
252 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
253 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
254 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
255 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
257 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
300 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
301 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
302 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
303 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
304 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
308 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
309 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
310 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
311 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
312 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
313 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
314 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
315 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
316 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
317 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
318 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
319 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
320 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
321 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
322 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
323 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
324 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
325 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
326 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
327 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
328 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
329 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
330 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
331 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
332 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
333 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
334 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
335 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
336 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
337 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
338 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
339 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
340 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
341 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
342 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
343 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
344 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
345 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
346 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
347 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
348 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
349 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
350 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
351 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
352 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
353 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
354 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
355 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
356 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
357 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
358 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
359 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
360 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
361 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
362 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
363 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
364 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
365 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
366 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
367 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
368 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
369 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
370 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
371 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
372 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
373 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
374 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
375 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
376 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
377 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
378 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
379 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
380 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
381 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
382 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
383 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
384 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
385 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
386 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
387 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
388 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
389 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
390 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
391 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
392 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
393 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
394 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
395 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
396 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
397 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
398 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
399 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
400 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
401 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
402 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
403 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
404 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
405 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
406 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
407 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
408 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
409 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
410 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
411 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
412 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
413 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
414 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
415 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
416 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
417 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
418 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
419 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
420 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
421 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
422 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
423 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
424 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
425 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
426 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
427 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
428 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
429 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
430 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
431 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
432 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
433 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
434 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
435 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
436 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
437 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
438 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
439 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
440 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
441 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
442 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
443 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
444 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
445 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
446 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
447 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
448 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
449 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
450 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
451 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
452 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
465 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
466 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
467 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
468 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
469 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
470 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
471 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
472 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
473 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
474 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
475 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
478 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
479 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
480 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
481 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
482 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
483 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
484 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
485 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
486 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
487 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
488 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
489 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
490 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
491 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
492 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
493 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
494 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
495 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
496 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
497 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
498 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
499 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
500 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
501 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
502 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
503 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
504 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
505 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
506 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
507 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
508 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
509 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
510 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
511 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
512 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
513 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
514 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
515 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
516 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
517 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
518 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
519 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
520 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
521 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
522 8002784119 Frankia sp. AgB1.9 Isolate Nodule
523 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
524 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
525 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
526 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
527 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
528 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
529 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
530 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
531 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
532 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
533 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
534 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
535 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
536 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
537 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
538 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
539 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
540 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
541 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
542 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
543 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
544 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
545 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
546 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
547 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
548 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
549 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
550 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
551 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
552 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
553 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
554 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
555 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
556 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
557 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
558 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
559 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.8
Metatranscriptomes 0
Isolates 22.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.57
Nodule 18.36
Rhizoplane 6.19
Rhizosphere 53.27
Stem 0
Stem Tuber 0
Unclassified 12.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000214 3300003203 Bacteria 25609
2 JGI25406J46586_10011772 3300003203 Bacteria 3819
3 JGI25406J46586_10013111 3300003203 Bacteria 3574
4 JGI25153J46596_10005616 3300003215 Bacteria 6556
5 JGI25153J46596_10011211 3300003215 Bacteria 3980
6 JGI25160J50197_1015299 3300003354 Bacteria 2525
7 JGI25404J52841_10005921 3300003659 Bacteria 2538
8 Ga0055536_1002776 3300003781 Bacteria 9691
9 Ga0055540_1000098 3300003792 Bacteria 96649
10 Ga0055540_1000450 3300003792 Bacteria 32053
11 Ga0055540_1001832 3300003792 Bacteria 12014
12 Ga0055531_10000635 3300003794 Bacteria 30252
13 Ga0058692_1008427 3300003856 Bacteria 2661
14 Ga0055543_1003833 3300004625 Bacteria 4269
15 Ga0065165_1000048 3300005262 Bacteria 196539
16 Ga0065165_1002220 3300005262 Bacteria 17337
17 Ga0070658_10036019 3300005327 Bacteria 3987
18 Ga0070683_100142289 3300005329 Bacteria 2273
19 Ga0070683_100231605 3300005329 Bacteria 1756
20 Ga0070680_100007991 3300005336 Bacteria 8078
21 Ga0070680_100012621 3300005336 Bacteria 6567
22 Ga0068868_100022399 3300005338 Bacteria 4767
23 Ga0068868_100171781 3300005338 Bacteria 1794
24 Ga0070660_100003001 3300005339 Bacteria 11625
25 Ga0070660_100135869 3300005339 Bacteria 1970
26 Ga0070689_100070593 3300005340 Bacteria 2728
27 Ga0070691_10045166 3300005341 Unclassified 2090
28 Ga0070668_100072015 3300005347 Bacteria 2692
29 Ga0070668_100120141 3300005347 Bacteria 2100
30 Ga0070675_100114799 3300005354 Bacteria 2282
31 Ga0070709_10000203 3300005434 Bacteria 38151
32 Ga0070709_10004227 3300005434 Bacteria 7743
33 Ga0070709_10036894 3300005434 Bacteria 2981
34 Ga0070709_10040280 3300005434 Bacteria 2871
35 Ga0070714_100002121 3300005435 Bacteria 14564
36 Ga0070714_100009406 3300005435 Bacteria 7683
37 Ga0070713_100001761 3300005436 Bacteria 13967
38 Ga0070713_100010384 3300005436 Bacteria 6727
39 Ga0070713_100012830 3300005436 Bacteria 6162
40 Ga0070713_100016592 3300005436 Bacteria 5539
41 Ga0070710_10001622 3300005437 Bacteria 10623
42 Ga0070701_10005782 3300005438 Bacteria 5147
43 Ga0070701_10047203 3300005438 Bacteria 2217
44 Ga0070711_100006659 3300005439 Bacteria 6985
45 Ga0070711_100019115 3300005439 Bacteria 4390
46 Ga0070711_100041758 3300005439 Unclassified 3099
47 Ga0070711_100059731 3300005439 Bacteria 2648
48 Ga0070663_100001485 3300005455 Bacteria 12892
49 Ga0070663_100060541 3300005455 Bacteria 2724
50 Ga0070663_100115250 3300005455 Bacteria 2024
51 Ga0070663_100136246 3300005455 Bacteria 1870
52 Ga0070681_10003273 3300005458 Bacteria 15113
53 Ga0070681_10069475 3300005458 Bacteria 3489
54 Ga0070706_100148505 3300005467 Bacteria 2188
55 Ga0070679_100013810 3300005530 Bacteria 7739
56 Ga0070679_100019456 3300005530 Bacteria 6601
57 Ga0070679_100024100 3300005530 Bacteria 5962
58 Ga0070684_100009975 3300005535 Bacteria 7508
59 Ga0068853_100016892 3300005539 Bacteria 6014
60 Ga0070672_100151133 3300005543 Bacteria 1921
61 Ga0070695_100067456 3300005545 Bacteria 2333
62 Ga0070693_100041241 3300005547 Bacteria 2596
63 Ga0070665_100000229 3300005548 Bacteria 93160
64 Ga0070665_100004434 3300005548 Bacteria 14746
65 Ga0070665_100127191 3300005548 Bacteria 2550
66 Ga0068855_100000283 3300005563 Bacteria 62643
67 Ga0068855_100020164 3300005563 Bacteria 8006
68 Ga0068855_100031608 3300005563 Bacteria 6321
69 Ga0068855_100191175 3300005563 Bacteria 2309
70 Ga0068857_100001551 3300005577 Bacteria 18401
71 Ga0068857_100021668 3300005577 Bacteria 5655
72 Ga0068854_100140792 3300005578 Bacteria 1851
73 Ga0068856_100003347 3300005614 Bacteria 16276
74 Ga0068856_100083462 3300005614 Bacteria 3173
75 Ga0068859_100001045 3300005617 Bacteria 28373
76 Ga0068864_100184021 3300005618 Bacteria 1912
77 Ga0068870_10032793 3300005840 Bacteria 2645
78 Ga0068863_100000126 3300005841 Bacteria 80622
79 Ga0068858_100008148 3300005842 Bacteria 10073
80 Ga0068858_100106470 3300005842 Bacteria 2617
81 Ga0068860_100000081 3300005843 Bacteria 170066
82 Ga0081455_10000730 3300005937 Bacteria 42670
83 Ga0081455_10001734 3300005937 Bacteria 26379
84 Ga0081455_10013417 3300005937 Bacteria 8100
85 Ga0081455_10015026 3300005937 Bacteria 7541
86 Ga0081455_10028177 3300005937 Bacteria 5135
87 Ga0081538_10071250 3300005981 Bacteria 1913
88 Ga0081540_1003965 3300005983 Bacteria 11501
89 Ga0081540_1014480 3300005983 Bacteria 5048
90 Ga0081540_1015123 3300005983 Bacteria 4898
91 Ga0081540_1018499 3300005983 Bacteria 4270
92 Ga0081540_1023084 3300005983 Bacteria 3652
93 Ga0081539_10000058 3300005985 Bacteria 256212
94 Ga0081539_10000768 3300005985 Bacteria 63055
95 Ga0081539_10001470 3300005985 Bacteria 39952
96 Ga0081539_10007479 3300005985 Bacteria 9938
97 Ga0070717_10001267 3300006028 Bacteria 17258
98 Ga0070717_10026341 3300006028 Bacteria 4638
99 Ga0070717_10082336 3300006028 Bacteria 2704
100 Ga0070717_10141457 3300006028 Bacteria 2076
101 Ga0070716_100014285 3300006173 Bacteria 4065
102 Ga0070716_100036351 3300006173 Unclassified 2715
103 Ga0070712_100006733 3300006175 Bacteria 7144
104 Ga0075370_10014516 3300006353 Bacteria 4204
105 Ga0075428_100251938 3300006844 Bacteria 1903
106 Ga0075430_100041932 3300006846 Bacteria 3871
107 Ga0075433_10010163 3300006852 Bacteria 7548
108 Ga0075433_10057133 3300006852 Bacteria 3410
109 Ga0097620_100001045 3300006931 Bacteria 28373
110 Ga0099824_1007408 3300006942 Bacteria 14551
111 Ga0099822_1018218 3300006943 Bacteria 7346
112 Ga0075435_100019518 3300007076 Bacteria 5181
113 Ga0105240_10000944 3300009093 Bacteria 51695
114 Ga0105240_10017034 3300009093 Bacteria 9816
115 Ga0105240_10034221 3300009093 Bacteria 6557
116 Ga0105240_10034709 3300009093 Bacteria 6503
117 Ga0105240_10037447 3300009093 Bacteria 6234
118 Ga0105240_10114967 3300009093 Bacteria 3250
119 Ga0105240_10165503 3300009093 Bacteria 2623
120 Ga0105240_10170691 3300009093 Bacteria 2577
121 Ga0105240_10184829 3300009093 Bacteria 2456
122 Ga0111539_10014859 3300009094 Bacteria 9707
123 Ga0111539_10015429 3300009094 Bacteria 9504
124 Ga0111539_10037482 3300009094 Bacteria 5853
125 Ga0105245_10058514 3300009098 Bacteria 3469
126 Ga0114129_10078597 3300009147 Bacteria 4588
127 Ga0114129_10411862 3300009147 Bacteria 1780
128 Ga0105241_10007759 3300009174 Bacteria 7890
129 Ga0105241_10021246 3300009174 Bacteria 4797
130 Ga0105241_10041064 3300009174 Bacteria 3493
131 Ga0105248_10039794 3300009177 Bacteria 5268
132 Ga0105237_10016720 3300009545 Bacteria 7617
133 Ga0105237_10018952 3300009545 Bacteria 7111
134 Ga0105237_10023096 3300009545 Bacteria 6377
135 Ga0105237_10046497 3300009545 Bacteria 4365
136 Ga0105237_10084676 3300009545 Bacteria 3161
137 Ga0105237_10098524 3300009545 Bacteria 2914
138 Ga0105237_10158498 3300009545 Bacteria 2261
139 Ga0105238_10021930 3300009551 Bacteria 6508
140 Ga0105238_10025577 3300009551 Bacteria 6019
141 Ga0105238_10132830 3300009551 Bacteria 2467
142 Ga0105238_10137354 3300009551 Bacteria 2422
143 Ga0105249_10067353 3300009553 Bacteria 3299
144 Ga0105239_10011360 3300010375 Bacteria 9935
145 Ga0105239_10051695 3300010375 Bacteria 4504
146 Ga0105239_10091133 3300010375 Bacteria 3364
147 Ga0157369_10012270 3300013105 Bacteria 9731
148 Ga0157369_10021190 3300013105 Bacteria 7267
149 Ga0157369_10056186 3300013105 Bacteria 4248
150 Ga0157369_10160148 3300013105 Bacteria 2376
151 Ga0157378_10009041 3300013297 Bacteria 8671
152 Ga0163163_10001576 3300014325 Bacteria 19224
153 Ga0163163_10011315 3300014325 Bacteria 8088
154 Ga0163163_10150767 3300014325 Bacteria 2369
155 Ga0157380_10088443 3300014326 Bacteria 2549
156 Ga0157376_10080530 3300014969 Bacteria 2794
157 Ga0214544_1001813 3300021320 Bacteria 44864
158 Ga0214542_1001236 3300021321 Bacteria 51849
159 Ga0214545_1000924 3300021324 Bacteria 51830
160 Ga0214543_1003531 3300021327 Bacteria 30263
161 Ga0214543_1024471 3300021327 Bacteria 3724
162 Ga0213874_10003719 3300021377 Bacteria 3415
163 Ga0213874_10013879 3300021377 Bacteria 2097
164 Ga0213876_10008410 3300021384 Bacteria 5584
165 Ga0213875_10000880 3300021388 Bacteria 22051
166 Ga0209563_104010 3300025230 Bacteria 2901
167 Ga0209148_1000180 3300025254 Bacteria 124830
168 Ga0209233_1001700 3300025261 Bacteria 8514
169 Ga0209233_1011023 3300025261 Bacteria 2678
170 Ga0209455_1001704 3300025272 Bacteria 9408
171 Ga0209455_1004280 3300025272 Bacteria 4732
172 Ga0209673_1000206 3300025273 Bacteria 118136
173 Ga0209130_1000071 3300025284 Bacteria 178273
174 Ga0209025_1002646 3300025294 Bacteria 18319
175 Ga0209564_1000385 3300025295 Bacteria 80273
176 Ga0209758_1000115 3300025297 Bacteria 199268
177 Ga0209758_1001210 3300025297 Bacteria 32486
178 Ga0209758_1004569 3300025297 Bacteria 11413
179 Ga0209758_1008059 3300025297 Bacteria 6953
180 Ga0209050_1005280 3300025298 Bacteria 8219
181 Ga0207426_1000572 3300025302 Bacteria 49561
182 Ga0209051_1000359 3300025303 Bacteria 67167
183 Ga0209051_1024810 3300025303 Bacteria 2456
184 Ga0209257_1001808 3300025304 Bacteria 23469
185 Ga0209257_1002263 3300025304 Bacteria 19660
186 Ga0207692_10003008 3300025898 Bacteria 6534
187 Ga0207692_10015388 3300025898 Bacteria 3365
188 Ga0207692_10088948 3300025898 Bacteria 1670
189 Ga0207688_10043415 3300025901 Bacteria 2503
190 Ga0207688_10049164 3300025901 Bacteria 2356
191 Ga0207699_10008564 3300025906 Bacteria 5056
192 Ga0207699_10020956 3300025906 Bacteria 3514
193 Ga0207705_10043989 3300025909 Bacteria 3208
194 Ga0207654_10014803 3300025911 Bacteria 4037
195 Ga0207707_10000419 3300025912 Bacteria 44410
196 Ga0207707_10002705 3300025912 Bacteria 15850
197 Ga0207707_10018343 3300025912 Bacteria 6098
198 Ga0207707_10066929 3300025912 Bacteria 3128
199 Ga0207695_10000008 3300025913 Bacteria 1058268
200 Ga0207695_10008914 3300025913 Bacteria 12491
201 Ga0207695_10077014 3300025913 Bacteria 3389
202 Ga0207695_10136750 3300025913 Bacteria 2403
203 Ga0207671_10005294 3300025914 Bacteria 11960
204 Ga0207671_10016590 3300025914 Bacteria 5718
205 Ga0207671_10045059 3300025914 Bacteria 3261
206 Ga0207693_10006974 3300025915 Bacteria 9332
207 Ga0207693_10014354 3300025915 Bacteria 6372
208 Ga0207693_10019720 3300025915 Bacteria 5362
209 Ga0207693_10037039 3300025915 Bacteria 3845
210 Ga0207693_10081201 3300025915 Bacteria 2538
211 Ga0207693_10088222 3300025915 Bacteria 2431
212 Ga0207663_10001473 3300025916 Bacteria 10968
213 Ga0207663_10002050 3300025916 Bacteria 9597
214 Ga0207663_10017003 3300025916 Unclassified 4044
215 Ga0207663_10088244 3300025916 Bacteria 2051
216 Ga0207660_10034957 3300025917 Bacteria 3486
217 Ga0207660_10055477 3300025917 Bacteria 2832
218 Ga0207657_10001672 3300025919 Bacteria 23919
219 Ga0207657_10006890 3300025919 Bacteria 11724
220 Ga0207649_10059216 3300025920 Bacteria 2402
221 Ga0207652_10001690 3300025921 Bacteria 19300
222 Ga0207694_10005031 3300025924 Bacteria 10225
223 Ga0207700_10009160 3300025928 Bacteria 6168
224 Ga0207700_10026155 3300025928 Bacteria 4065
225 Ga0207664_10000425 3300025929 Bacteria 30101
226 Ga0207664_10002721 3300025929 Bacteria 11731
227 Ga0207644_10035487 3300025931 Bacteria 3495
228 Ga0207669_10014394 3300025937 Bacteria 3963
229 Ga0207704_10015826 3300025938 Bacteria 3857
230 Ga0207665_10001320 3300025939 Bacteria 16732
231 Ga0207665_10001972 3300025939 Bacteria 13825
232 Ga0207665_10061672 3300025939 Bacteria 2542
233 Ga0207689_10017224 3300025942 Bacteria 6114
234 Ga0207689_10073542 3300025942 Bacteria 2808
235 Ga0207661_10001270 3300025944 Bacteria 16867
236 Ga0207679_10024233 3300025945 Bacteria 4160
237 Ga0207679_10031497 3300025945 Bacteria 3712
238 Ga0207667_10002017 3300025949 Bacteria 25487
239 Ga0207712_10021041 3300025961 Bacteria 4278
240 Ga0207668_10018860 3300025972 Bacteria 4348
241 Ga0207640_10116625 3300025981 Bacteria 1904
242 Ga0207703_10032019 3300026035 Bacteria 4160
243 Ga0207639_10018667 3300026041 Bacteria 4932
244 Ga0207678_10000089 3300026067 Bacteria 75976
245 Ga0207678_10013434 3300026067 Bacteria 7187
246 Ga0207678_10033534 3300026067 Bacteria 4472
247 Ga0207678_10119968 3300026067 Bacteria 2244
248 Ga0207708_10021169 3300026075 Bacteria 4905
249 Ga0207708_10028255 3300026075 Bacteria 4247
250 Ga0207708_10051448 3300026075 Bacteria 3136
251 Ga0207702_10000548 3300026078 Bacteria 41978
252 Ga0207702_10205565 3300026078 Bacteria 1828
253 Ga0207641_10000503 3300026088 Bacteria 43979
254 Ga0207648_10095735 3300026089 Bacteria 2597
255 Ga0207648_10129840 3300026089 Bacteria 2218
256 Ga0207676_10022448 3300026095 Bacteria 4642
257 Ga0207674_10024654 3300026116 Bacteria 6423
258 Ga0207674_10030004 3300026116 Bacteria 5721
259 Ga0207674_10034375 3300026116 Bacteria 5300
260 Ga0207674_10165888 3300026116 Bacteria 2163
261 Ga0207675_100016194 3300026118 Bacteria 6960
262 Ga0207675_100022726 3300026118 Bacteria 5835
263 Ga0207675_100152562 3300026118 Bacteria 2200
264 Ga0207683_10102624 3300026121 Bacteria 2554
265 Ga0207698_10048930 3300026142 Bacteria 3213
266 Ga0209371_1000741 3300027312 Bacteria 27385
267 Ga0209589_1000014 3300027357 Bacteria 227996
268 Ga0209489_100014 3300027361 Bacteria 227996
269 Ga0209700_100024 3300027363 Bacteria 227996
270 Ga0207428_10017652 3300027907 Bacteria 6119
271 Ga0268266_10006018 3300028379 Bacteria 11191
272 Ga0268266_10008590 3300028379 Bacteria 9072
273 Ga0268266_10071038 3300028379 Bacteria 3017
274 Ga0268265_10072621 3300028380 Bacteria 2684
275 Ga0268264_10000048 3300028381 Bacteria 334457
276 Ga0265334_10001696 3300028573 Bacteria 10529
277 Ga0265334_10008302 3300028573 Bacteria 4418
278 Ga0265322_10001590 3300028654 Bacteria 7289
279 Ga0265336_10000135 3300028666 Bacteria 52478
280 Ga0307517_10000634 3300028786 Bacteria 60194
281 Ga0307515_10006012 3300028794 Bacteria 24419
282 Ga0307515_10022923 3300028794 Bacteria 10979
283 Ga0307515_10102563 3300028794 Bacteria 3440
284 Ga0265338_10000034 3300028800 Bacteria 244623
285 Ga0265338_10006948 3300028800 Bacteria 14236
286 Ga0265324_10016573 3300029957 Bacteria 2687
287 Ga0268256_1001268 3300030500 Bacteria 15677
288 Ga0265330_10018111 3300031235 Bacteria 3237
289 Ga0265332_10033695 3300031238 Bacteria 2229
290 Ga0265340_10027705 3300031247 Bacteria 2855
291 Ga0265339_10004321 3300031249 Bacteria 9716
292 Ga0265331_10008950 3300031250 Bacteria 5658
293 Ga0265331_10013135 3300031250 Bacteria 4461
294 Ga0307513_10082153 3300031456 Bacteria 3318
295 Ga0307509_10000840 3300031507 Bacteria 52810
296 Ga0307509_10005537 3300031507 Bacteria 17522
297 Ga0307509_10120250 3300031507 Bacteria 2606
298 Ga0307408_100044133 3300031548 Bacteria 3176
299 Ga0307508_10000032 3300031616 Bacteria 163293
300 Ga0307508_10026534 3300031616 Bacteria 5251
301 Ga0307508_10042188 3300031616 Bacteria 4094
302 Ga0265314_10004266 3300031711 Bacteria 13380
303 Ga0265342_10020228 3300031712 Bacteria 4276
304 Ga0307516_10005934 3300031730 Bacteria 14450
305 Ga0307516_10010247 3300031730 Bacteria 10328
306 Ga0307516_10082192 3300031730 Bacteria 3063
307 Ga0307413_10036229 3300031824 Bacteria 2839
308 Ga0307409_100050246 3300031995 Bacteria 3183
309 Ga0307416_100105720 3300032002 Bacteria 2465
310 Ga0307411_10092001 3300032005 Bacteria 2120
311 Ga0307507_10011278 3300033179 Bacteria 11327
312 Ga0307507_10012617 3300033179 Bacteria 10410
313 Ga0307507_10140766 3300033179 Bacteria 1851
314 Ga0307510_10023885 3300033180 Bacteria 7075
315 Ga0315911_1000002 3300033442 Bacteria 926833
316 Ga0373926_0018702 3300035083 Bacteria 2386
317 Ga0373934_0005355 3300035086 Bacteria 4752
318 Ga0373952_0010982 3300035092 Bacteria 1759
319 Ga0373923_0021021 3300035111 Bacteria 2543
320 Ga0373936_0009069 3300035113 Bacteria 3752
321 Ga0373945_0014977 3300035116 Bacteria 2604
322 Ga0373953_0000604 3300035117 Bacteria 9932
323 Ga0373953_0025139 3300035117 Bacteria 2272
324 Ga0373954_0008754 3300035118 Bacteria 4450
325 Ga0373954_0025683 3300035118 Bacteria 2695
326 Ga0373956_0001292 3300035119 Bacteria 10365
327 Ga0373957_0015911 3300035120 Bacteria 2596
328 Ga0373943_0008899 3300035170 Bacteria 4498
329 Ga0373946_0004997 3300035171 Bacteria 4775
330 Ga0373955_0020984 3300035172 Bacteria 3290
331 Ga0373924_0037068 3300035410 Bacteria 1983
332 Ga0373931_0000333 3300035691 Bacteria 19659
333 Ga0373931_0000972 3300035691 Bacteria 12128
334 Ga0373931_0003529 3300035691 Bacteria 7049
335 Ga0373931_0009359 3300035691 Bacteria 4683
336 Ga0373927_0002882 3300035695 Bacteria 12525
337 Ga0373927_0013220 3300035695 Bacteria 5489
338 Ga0373927_0021108 3300035695 Bacteria 4268
339 Ga0373927_0082950 3300035695 Bacteria 2078
340 Ga0373933_0000182 3300035724 Bacteria 41434
341 Ga0373933_0013111 3300035724 Bacteria 4590
342 Ga0373933_0067748 3300035724 Bacteria 2166
343 Ga0373947_0036931 3300035725 Bacteria 2897
344 Ga0373937_0028281 3300036401 Bacteria 5072
345 Ga0373937_0031478 3300036401 Bacteria 4807
346 Ga0373937_0075826 3300036401 Bacteria 3105
347 Ga0373937_0102341 3300036401 Bacteria 2659
348 Ga0373925_0023291 3300037068 Bacteria 4519
349 Ga0395898_0015307 3300037466 Bacteria 7872
350 Ga0395898_0022553 3300037466 Bacteria 6376
351 Ga0395898_0036427 3300037466 Bacteria 4885
352 Ga0395905_0091429 3300037471 Bacteria 2853
353 Ga0436364_0899751 3300037853 Bacteria 1943
354 Ga0436364_1001517 3300037853 Bacteria 39180
355 Ga0436364_1222257 3300037853 Bacteria 3625
356 Ga0395901_0104867 3300038443 Bacteria 2967
357 Ga0395901_0143373 3300038443 Bacteria 2511
358 Ga0400483_068219 3300039062 Bacteria 6843
359 Ga0400483_086418 3300039062 Bacteria 4191
360 Ga0436365_0862990 3300039437 Bacteria 14031
361 Ga0436363_1480026 3300039450 Bacteria 16321
362 Ga0436363_1487883 3300039450 Bacteria 10937
363 Ga0436362_0413279 3300039453 Bacteria 4306
364 Ga0466969_0007732 3300044656 Bacteria 5715
365 Ga0466972_0000172 3300044658 Bacteria 50564
366 Ga0466972_0025282 3300044658 Bacteria 2944
367 Ga0466966_0000128 3300044684 Bacteria 48511
368 Ga0466961_0000236 3300044693 Bacteria 37237
369 Ga0466963_0164241 3300044694 Bacteria 1546
370 Ga0466968_0023471 3300044735 Bacteria 2513
371 Ga0466957_0047062 3300044842 Bacteria 2620
372 Ga0466960_0025406 3300044901 Bacteria 2680
373 Ga0466960_0026031 3300044901 Bacteria 2653
374 Ga0466959_0001099 3300045049 Bacteria 16214
375 Ga0466959_0017193 3300045049 Bacteria 5297
376 Ga0466967_0033446 3300045976 Bacteria 4353
377 Ga0466967_0193005 3300045976 Bacteria 1926
378 Ga0495627_000642 3300046453 Bacteria 27306
379 Ga0495592_0013200 3300046454 Bacteria 6288
380 Ga0495592_0036667 3300046454 Bacteria 3691
381 Ga0495592_0060346 3300046454 Bacteria 2790
382 Ga0495603_0000217 3300046455 Bacteria 29788
383 Ga0495603_0015187 3300046455 Bacteria 4659
384 Ga0495603_0025667 3300046455 Bacteria 3563
385 Ga0495603_0034107 3300046455 Bacteria 3062
386 Ga0495629_0000862 3300046459 Bacteria 24478
387 Ga0495629_0053128 3300046459 Bacteria 2835
388 Ga0495638_0005277 3300046460 Bacteria 9656
389 Ga0495638_0007591 3300046460 Bacteria 7759
390 Ga0495641_0003672 3300046461 Bacteria 11330
391 Ga0495653_0002374 3300046463 Bacteria 14971
392 Ga0495653_0036154 3300046463 Bacteria 3892
393 Ga0495580_0005364 3300046472 Bacteria 10616
394 Ga0495580_0006588 3300046472 Bacteria 9437
395 Ga0495582_0000990 3300046473 Bacteria 15910
396 Ga0495582_0010745 3300046473 Bacteria 5037
397 Ga0495639_0000544 3300046475 Bacteria 17562
398 Ga0495662_0001589 3300046476 Bacteria 11287
399 Ga0495664_0001505 3300046477 Bacteria 12344
400 Ga0495664_0028129 3300046477 Bacteria 3282
401 Ga0495584_0025028 3300046491 Bacteria 3026
402 Ga0495585_0024148 3300046492 Bacteria 3487
403 Ga0495594_0000128 3300046499 Bacteria 35750
404 Ga0495606_0021320 3300046507 Bacteria 4747
405 Ga0495608_0002876 3300046511 Bacteria 12326
406 Ga0495608_0039619 3300046511 Bacteria 3157
407 Ga0495618_0009642 3300046514 Bacteria 5830
408 Ga0495628_0040736 3300046516 Bacteria 3710
409 Ga0495630_0018933 3300046517 Bacteria 5060
410 Ga0495630_0162802 3300046517 Bacteria 1698
411 Ga0495637_0000328 3300046520 Bacteria 36941
412 Ga0495643_0079997 3300046522 Bacteria 1702
413 Ga0495648_0000936 3300046524 Bacteria 30292
414 Ga0495648_0021356 3300046524 Unclassified 4485
415 Ga0495648_0054832 3300046524 Bacteria 2406
416 Ga0495652_0167087 3300046529 Bacteria 1702
417 Ga0495665_0006186 3300046531 Bacteria 6465
418 Ga0495640_0002595 3300046533 Bacteria 14526
419 Ga0495640_0038605 3300046533 Bacteria 3358
420 Ga0495587_0004571 3300046536 Bacteria 9088
421 Ga0495587_0035375 3300046536 Bacteria 3008
422 Ga0495587_0056120 3300046536 Bacteria 2318
423 Ga0495645_0013557 3300046543 Bacteria 5768
424 Ga0495622_0014846 3300046557 Bacteria 3620
425 Ga0495667_0017811 3300046559 Bacteria 4799
426 Ga0495667_0042318 3300046559 Bacteria 3020
427 Ga0495667_0093450 3300046559 Bacteria 1947
428 Ga0495634_0001583 3300046642 Bacteria 19998
429 Ga0495625_0021621 3300046660 Bacteria 4948
430 Ga0495635_0000436 3300046663 Bacteria 26341
431 Ga0495635_0015088 3300046663 Bacteria 5404
432 Ga0495635_0018594 3300046663 Bacteria 4847
433 Ga0495635_0041063 3300046663 Bacteria 3196
434 Ga0495588_0002049 3300046674 Bacteria 8621
435 Ga0495657_0019591 3300046675 Bacteria 4879
436 Ga0495599_0019045 3300046678 Bacteria 4280
437 Ga0495599_0063533 3300046678 Bacteria 2307
438 Ga0495623_0015025 3300046679 Bacteria 5005
439 Ga0495623_0052805 3300046679 Bacteria 2568
440 Ga0495646_0005491 3300046680 Bacteria 8015
441 Ga0495646_0013510 3300046680 Bacteria 5190
442 Ga0495646_0014776 3300046680 Bacteria 4962
443 Ga0495647_0000394 3300046681 Bacteria 12460
444 Ga0495658_0003203 3300046683 Bacteria 8153
445 Ga0495658_0010677 3300046683 Bacteria 4599
446 Ga0495669_0000650 3300046684 Bacteria 15146
447 Ga0495669_0064047 3300046684 Bacteria 1668
448 Ga0495613_0017135 3300046689 Bacteria 5394
449 Ga0495613_0098186 3300046689 Bacteria 2116
450 Ga0495624_0021243 3300046690 Bacteria 4308
451 Ga0495624_0024480 3300046690 Bacteria 3972
452 Ga0495624_0044115 3300046690 Bacteria 2843
453 Ga0495600_0034678 3300046809 Bacteria 3277
454 Ga0495600_0121999 3300046809 Bacteria 1695
455 Ga0495581_0003127 3300047315 Bacteria 9472
456 Ga0495581_0029014 3300047315 Bacteria 3208
457 Ga0495581_0060277 3300047315 Bacteria 2193
458 Ga0495581_0074093 3300047315 Bacteria 1970
459 Ga0495674_0007898 3300047319 Bacteria 10159
460 Ga0495674_0008903 3300047319 Bacteria 9546
461 Ga0495674_0020170 3300047319 Bacteria 6174
462 Ga0495674_0041495 3300047319 Bacteria 4110
463 Ga0495672_0006488 3300047320 Bacteria 9047
464 Ga0495672_0042578 3300047320 Bacteria 2737
465 Ga0495676_0028303 3300047321 Bacteria 4787
466 Ga0495680_0001711 3300047322 Bacteria 23324
467 Ga0495675_0005291 3300047444 Bacteria 7859
468 Ga0495684_0022668 3300047471 Bacteria 4830
469 Ga0495684_0024888 3300047471 Bacteria 4604
470 Ga0495684_0039304 3300047471 Bacteria 3626
471 Ga0495684_0082746 3300047471 Bacteria 2434
472 Ga0495686_0007775 3300047472 Bacteria 7981
473 Ga0495593_0000439 3300047673 Bacteria 23237
474 Ga0495602_0009113 3300048088 Bacteria 10332
475 Ga0496100_0043018 3300048903 Bacteria 2887
476 Ga0496100_0053587 3300048903 Bacteria 2627
477 Ga0496101_0031035 3300048904 Bacteria 3753
478 Ga0496101_0133023 3300048904 Bacteria 1890
479 Ga0496102_0001771 3300048905 Bacteria 18745
480 Ga0496102_0085244 3300048905 Bacteria 2916
481 Ga0496102_0114203 3300048905 Bacteria 2520
482 Ga0496102_0177997 3300048905 Bacteria 2003
483 Ga0496103_0052678 3300048906 Bacteria 2520
484 Ga0496104_0011101 3300048907 Bacteria 8061
485 Ga0496104_0015144 3300048907 Bacteria 6978
486 Ga0496104_0058723 3300048907 Bacteria 3641
487 Ga0496104_0070856 3300048907 Bacteria 3315
488 Ga0496104_0087081 3300048907 Bacteria 2982
489 Ga0496104_0159382 3300048907 Bacteria 2165
490 Ga0496105_0003099 3300048908 Bacteria 12229
491 Ga0496105_0048124 3300048908 Bacteria 3519
492 Ga0496105_0069984 3300048908 Bacteria 2900
493 Ga0496105_0127461 3300048908 Bacteria 2098
494 Ga0496106_0009997 3300048909 Bacteria 7007
495 Ga0496107_0005793 3300048910 Bacteria 8456
496 Ga0496107_0009818 3300048910 Bacteria 6638
497 Ga0496107_0115098 3300048910 Bacteria 1979
498 Ga0496108_0003885 3300048911 Bacteria 11996
499 Ga0496108_0019931 3300048911 Bacteria 5508
500 Ga0496108_0022937 3300048911 Bacteria 5136
501 Ga0496109_0016029 3300048912 Bacteria 6550
502 Ga0496109_0135498 3300048912 Bacteria 2300
503 Ga0496109_0143471 3300048912 Bacteria 2233
504 Ga0496110_0013689 3300048913 Bacteria 6719
505 Ga0496110_0014333 3300048913 Bacteria 6577
506 Ga0496110_0017906 3300048913 Bacteria 5931
507 Ga0496110_0070692 3300048913 Bacteria 3093
508 Ga0496111_0013221 3300048914 Bacteria 5611
509 Ga0496111_0023874 3300048914 Bacteria 4297
510 Ga0496111_0027477 3300048914 Bacteria 4025
511 Ga0496111_0039869 3300048914 Bacteria 3370
512 Ga0496112_0000017 3300048915 Bacteria 191284
513 Ga0496112_0019263 3300048915 Bacteria 6437
514 Ga0496112_0023520 3300048915 Bacteria 5888
515 Ga0496112_0108292 3300048915 Bacteria 2749
516 Ga0496112_0141386 3300048915 Bacteria 2376
517 Ga0496112_0189591 3300048915 Bacteria 2018
518 Ga0496113_0006361 3300048916 Bacteria 7474
519 Ga0496113_0013216 3300048916 Bacteria 5582
520 Ga0496113_0043065 3300048916 Bacteria 3338
521 Ga0496113_0043185 3300048916 Bacteria 3335
522 Ga0496114_0249115 3300048917 Bacteria 1563
523 Ga0496115_0002841 3300048918 Bacteria 12459
524 Ga0496115_0020774 3300048918 Bacteria 5066
525 Ga0496115_0039864 3300048918 Bacteria 3732
526 Ga0496115_0039874 3300048918 Bacteria 3732
527 Ga0496115_0088101 3300048918 Unclassified 2534
528 Ga0496116_0000588 3300048919 Bacteria 48678
529 Ga0496116_0003125 3300048919 Bacteria 16633
530 Ga0496116_0018009 3300048919 Bacteria 5461
531 Ga0496117_0008313 3300048920 Bacteria 9876
532 Ga0496117_0091650 3300048920 Bacteria 1954
533 Ga0496118_0000781 3300048921 Bacteria 51011
534 Ga0496118_0003407 3300048921 Bacteria 20095
535 Ga0496119_0034548 3300048922 Bacteria 3326
536 Ga0496120_0047967 3300048923 Bacteria 2460
537 Ga0496121_0000230 3300048924 Bacteria 120616
538 Ga0496121_0000359 3300048924 Bacteria 93676
539 Ga0496121_0004694 3300048924 Bacteria 18101
540 Ga0496121_0008031 3300048924 Bacteria 12580
541 Ga0496121_0010422 3300048924 Bacteria 10487
542 Ga0496121_0017764 3300048924 Bacteria 7233
543 Ga0496121_0038181 3300048924 Bacteria 4257
544 Ga0496121_0048525 3300048924 Bacteria 3611
545 Ga0496121_0066502 3300048924 Bacteria 2926
546 Ga0496122_0114335 3300048925 Bacteria 1761
547 Ga0496125_0000040 3300048928 Bacteria 314478
548 Ga0496125_0004755 3300048928 Bacteria 15477
549 Ga0496125_0022192 3300048928 Bacteria 5899
550 Ga0496125_0043840 3300048928 Bacteria 3791
551 Ga0496126_0000065 3300048929 Bacteria 252549
552 Ga0496126_0002483 3300048929 Bacteria 24817
553 Ga0496126_0003684 3300048929 Bacteria 19137
554 Ga0496126_0012513 3300048929 Bacteria 8686
555 Ga0496126_0022270 3300048929 Bacteria 6169
556 Ga0496126_0026298 3300048929 Bacteria 5582
557 Ga0496126_0029779 3300048929 Bacteria 5182
558 Ga0496126_0048948 3300048929 Bacteria 3860
559 Ga0496126_0054002 3300048929 Bacteria 3642
560 Ga0496126_0078303 3300048929 Bacteria 2929
561 Ga0496126_0079880 3300048929 Bacteria 2895
562 Ga0496126_0091610 3300048929 Bacteria 2672
563 Ga0496126_0143002 3300048929 Bacteria 2057
564 Ga0496126_0145053 3300048929 Bacteria 2040
565 Ga0496126_0180376 3300048929 Bacteria 1794
566 Ga0495678_001313 3300049459 Bacteria 20022
567 Ga0501031_0006214 3300049568 Bacteria 7792
568 Ga0501031_0008668 3300049568 Bacteria 6613
569 Ga0501032_0000189 3300049569 Bacteria 50924
570 Ga0501032_0000769 3300049569 Bacteria 26023
571 Ga0501033_0000311 3300049570 Bacteria 46039
572 Ga0501033_0001037 3300049570 Bacteria 25294
573 Ga0501034_0000039 3300049571 Bacteria 237357
574 Ga0501034_0007343 3300049571 Bacteria 11740
575 Ga0501034_0016524 3300049571 Bacteria 7570
576 Ga0501034_0043788 3300049571 Bacteria 4528
577 Ga0501036_0000127 3300049572 Bacteria 48559
578 Ga0501036_0000134 3300049572 Bacteria 47683
579 Ga0501037_0000025 3300049573 Bacteria 143276
580 Ga0501037_0002272 3300049573 Bacteria 13880
581 Ga0501038_0000342 3300049574 Bacteria 40148
582 Ga0501038_0000929 3300049574 Bacteria 26055
583 Ga0501039_0000840 3300049575 Bacteria 22181
584 Ga0501039_0002379 3300049575 Bacteria 14002
585 Ga0501043_0000120 3300049579 Bacteria 72670
586 Ga0501043_0002576 3300049579 Bacteria 15337
587 Ga0501046_0000359 3300049580 Bacteria 45929
588 Ga0501046_0034847 3300049580 Bacteria 4060
589 Ga0501047_0000379 3300049581 Bacteria 50147
590 Ga0501047_0000866 3300049581 Bacteria 30920
591 Ga0501047_0011773 3300049581 Bacteria 8273
592 Ga0501047_0012334 3300049581 Bacteria 8090
593 Ga0501047_0017605 3300049581 Bacteria 6847
594 Ga0501048_0000352 3300049582 Bacteria 31854
595 Ga0501067_0000025 3300049583 Bacteria 91481
596 Ga0501068_0003851 3300049584 Bacteria 8144
597 Ga0501069_0001694 3300049585 Bacteria 10972
598 Ga0501069_0005415 3300049585 Bacteria 6637
599 Ga0501070_0002185 3300049586 Bacteria 17207
600 Ga0501070_0003638 3300049586 Bacteria 13324
601 Ga0501070_0047009 3300049586 Bacteria 3589
602 Ga0501072_0003699 3300049588 Bacteria 11536
603 Ga0501072_0080205 3300049588 Bacteria 2585
604 Ga0501073_0000091 3300049589 Bacteria 57029
605 Ga0501073_0008652 3300049589 Bacteria 7542
606 Ga0501073_0054577 3300049589 Bacteria 2797
607 Ga0501074_0000489 3300049590 Bacteria 24170
608 Ga0501074_0003064 3300049590 Bacteria 11785
609 Ga0501077_0039792 3300049593 Bacteria 2995
610 Ga0501079_0004084 3300049741 Bacteria 10807
611 Ga0501080_0000200 3300049742 Bacteria 44051
612 Ga0501080_0000321 3300049742 Bacteria 36637
613 Ga0501080_0013729 3300049742 Bacteria 7457
614 Ga0501083_0000284 3300049744 Bacteria 32169
615 Ga0501035_0000598 3300049822 Bacteria 39723
616 Ga0501035_0001251 3300049822 Bacteria 26410
617 Ga0501044_0000274 3300049823 Bacteria 65668
618 Ga0501044_0000887 3300049823 Bacteria 36069
619 Ga0501044_0020320 3300049823 Bacteria 7089
620 Ga0501044_0147435 3300049823 Bacteria 2337
621 Ga0501045_0040862 3300049824 Bacteria 3373
622 nmdc:mga06z11_22778_c1 3300050494 Bacteria 2931
623 nmdc:mga07m45_745_c1 3300050496 Bacteria 13914
624 nmdc:mga05p37_203976_c1 3300050507 Bacteria 2393
625 nmdc:mga0rr50_31297_c1 3300050513 Bacteria 3777
626 nmdc:mga0a205_1736_c2 3300050515 Bacteria 7483
627 nmdc:mga0a205_8002_c1 3300050515 Bacteria 9605
628 Ga0495601_0021098 3300053077 Bacteria 3986
629 Ga0495601_0027072 3300053077 Bacteria 3543
630 Ga0495612_0018136 3300053078 Bacteria 2817
631 Ga0495612_0033510 3300053078 Bacteria 2078
632 Ga0500635_0002485 3300053080 Bacteria 4573
633 Ga0500635_0002838 3300053080 Bacteria 4307
634 Ga0495595_0003433 3300053084 Bacteria 6283
635 Ga0495619_0046179 3300053085 Bacteria 2863
636 Ga0500643_000456 3300053087 Bacteria 30270
637 Ga0500651_0004914 3300053093 Bacteria 7562
638 Ga0500566_0000043 3300053094 Bacteria 62755
639 Ga0500566_0000370 3300053094 Bacteria 24642
640 Ga0500566_0001762 3300053094 Bacteria 12726
641 Ga0500640_005288 3300053095 Bacteria 4795
642 Ga0500641_0010815 3300053096 Bacteria 3306
643 Ga0500641_0039111 3300053096 Bacteria 1909
644 Ga0500650_0000365 3300053098 Bacteria 10988
645 Ga0500556_0000468 3300053104 Bacteria 28502
646 Ga0500562_006967 3300053108 Bacteria 2850
647 Ga0500572_000024 3300053111 Bacteria 47391
648 Ga0500572_000704 3300053111 Bacteria 10837
649 Ga0500592_002667 3300053116 Bacteria 2870
650 Ga0500595_002343 3300053119 Bacteria 9470
651 Ga0500595_003301 3300053119 Bacteria 7598
652 Ga0500595_016164 3300053119 Bacteria 2784
653 Ga0500608_001300 3300053122 Bacteria 8888
654 Ga0500614_001091 3300053123 Bacteria 6714
655 Ga0500642_0000019 3300053130 Bacteria 159944
656 Ga0500642_0000252 3300053130 Bacteria 20158
657 Ga0500658_0017676 3300053134 Bacteria 2666
658 Ga0500559_0001011 3300053136 Bacteria 17309
659 Ga0500559_0001379 3300053136 Bacteria 13865
660 Ga0500559_0004998 3300053136 Bacteria 6157
661 Ga0500559_0011705 3300053136 Bacteria 3741
662 Ga0500568_0001665 3300053139 Bacteria 13926
663 Ga0500568_0018981 3300053139 Bacteria 3000
664 Ga0500568_0027575 3300053139 Bacteria 2373
665 Ga0500577_0003874 3300053142 Bacteria 3909
666 Ga0500577_0011877 3300053142 Bacteria 2614
667 Ga0500586_000414 3300053145 Bacteria 8543
668 Ga0500590_068324 3300053148 Bacteria 1771
669 Ga0500603_000391 3300053150 Bacteria 11472
670 Ga0500603_000801 3300053150 Bacteria 7516
671 Ga0500604_0001275 3300053151 Bacteria 7050
672 Ga0500616_0000041 3300053153 Bacteria 359328
673 Ga0500616_0000104 3300053153 Bacteria 159954
674 Ga0500622_0002498 3300053156 Bacteria 13232
675 Ga0500630_000112 3300053159 Bacteria 26672
676 Ga0500638_001152 3300053162 Bacteria 7931
677 Ga0500639_000040 3300053163 Bacteria 63516
678 Ga0500636_0000365 3300053177 Bacteria 24884
679 Ga0500636_0012982 3300053177 Bacteria 4887
680 Ga0500637_0000042 3300053178 Bacteria 46215
681 Ga0500637_0002167 3300053178 Bacteria 8637
682 Ga0500656_001811 3300053732 Bacteria 1882
683 Ga0500601_000203 3300053737 Bacteria 12048
684 Ga0501084_0027916 3300054114 Bacteria 4716
685 Ga0500661_000056 3300055283 Bacteria 17736
686 Ga0501082_0007446 3300060353 Bacteria 9446
687 Ga0501082_0059100 3300060353 Bacteria 3304

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053732 Ga0500656_001811 Ga0500656_001811_504_1838 436
2 3300035410 Ga0373924_0037068 Ga0373924_0037068_602_1945 446
3 3300048917 Ga0496114_0249115 Ga0496114_0249115_21_1415 446
4 3300048904 Ga0496101_0133023 Ga0496101_0133023_482_1879 448
5 iso_pu_bacteria 8016622563 8016625629 451
6 3300037853 Ga0436364_0899751 Ga0436364_0899751_560_1933 455
7 3300046455 Ga0495603_0025667 Ga0495603_0025667_23_1447 458
8 3300044901 Ga0466960_0026031 Ga0466960_0026031_859_2265 460
9 3300048910 Ga0496107_0009818 Ga0496107_0009818_5186_6613 462
10 3300046663 Ga0495635_0015088 Ga0495635_0015088_3956_5377 465
11 3300046529 Ga0495652_0167087 Ga0495652_0167087_200_1669 467
12 3300048912 Ga0496109_0135498 Ga0496109_0135498_24_1484 472
13 3300005563 Ga0068855_100031608 Ga0068855_1000316087 473
14 3300046684 Ga0495669_0064047 Ga0495669_0064047_211_1638 473
15 3300048905 Ga0496102_0114203 Ga0496102_0114203_42_1493 482
16 iso_pu_bacteria 8019530166 8019533652 482
17 3300044694 Ga0466963_0164241 Ga0466963_0164241_12_1472 486
18 3300039062 Ga0400483_068219 Ga0400483_068219_4886_6538 491
19 3300005617 Ga0068859_100001045 Ga0068859_1000010452 495
20 3300005842 Ga0068858_100008148 Ga0068858_1000081484 495
21 3300006931 Ga0097620_100001045 Ga0097620_10000104522 495
22 3300026035 Ga0207703_10032019 Ga0207703_100320191 495
23 3300021388 Ga0213875_10000880 Ga0213875_1000088015 496
24 3300037853 Ga0436364_1001517 Ga0436364_1001517_12214_13845 496
25 3300039062 Ga0400483_086418 Ga0400483_086418_1711_3324 497
26 3300048924 Ga0496121_0000359 Ga0496121_0000359_68398_70074 498
27 3300048929 Ga0496126_0003684 Ga0496126_0003684_9310_10986 498
28 3300049593 Ga0501077_0039792 Ga0501077_0039792_589_2160 498
29 3300009094 Ga0111539_10015429 Ga0111539_100154292 500
30 3300053078 Ga0495612_0033510 Ga0495612_0033510_14_1516 500
31 3300048929 Ga0496126_0079880 Ga0496126_0079880_102_1700 501
32 3300050513 nmdc:mga0rr50_31297_c1 nmdc:mga0rr50_31297_c1_1137_2783 502
33 3300050515 nmdc:mga0a205_1736_c2 nmdc:mga0a205_1736_c2_5136_6782 502
34 3300006852 Ga0075433_10010163 Ga0075433_100101637 503
35 3300007076 Ga0075435_100019518 Ga0075435_1000195184 503
36 3300027907 Ga0207428_10017652 Ga0207428_100176522 503
37 3300009094 Ga0111539_10014859 Ga0111539_100148592 505
38 3300026088 Ga0207641_10000503 Ga0207641_1000050316 505
39 3300006846 Ga0075430_100041932 Ga0075430_1000419324 506
40 3300025272 Ga0209455_1004280 Ga0209455_10042804 506
41 3300046460 Ga0495638_0007591 Ga0495638_0007591_413_2002 506
42 3300005455 Ga0070663_100001485 Ga0070663_10000148512 508
43 3300026067 Ga0207678_10000089 Ga0207678_1000008951 508
44 3300035092 Ga0373952_0010982 Ga0373952_0010982_13_1659 508
45 3300035691 Ga0373931_0000972 Ga0373931_0000972_5123_6769 508
46 3300049581 Ga0501047_0012334 Ga0501047_0012334_978_2573 508
47 3300033179 Ga0307507_10012617 Ga0307507_100126171 511
48 3300044684 Ga0466966_0000128 Ga0466966_0000128_19233_20858 511
49 3300044693 Ga0466961_0000236 Ga0466961_0000236_18503_20128 511
50 3300045049 Ga0466959_0001099 Ga0466959_0001099_13546_15171 511
51 3300046559 Ga0495667_0017811 Ga0495667_0017811_888_2507 512
52 3300046683 Ga0495658_0010677 Ga0495658_0010677_2004_3623 512
53 3300047319 Ga0495674_0020170 Ga0495674_0020170_3203_4822 512
54 3300048929 Ga0496126_0000065 Ga0496126_0000065_210192_211844 512
55 iso_pu_bacteria 2917736166 2917742546 513
56 3300005841 Ga0068863_100000126 Ga0068863_10000012654 514
57 3300049588 Ga0501072_0080205 Ga0501072_0080205_88_1707 514
58 3300003792 Ga0055540_1000098 Ga0055540_100009875 515
59 3300003792 Ga0055540_1000450 Ga0055540_100045023 515
60 3300005435 Ga0070714_100002121 Ga0070714_1000021213 515
61 3300005548 Ga0070665_100127191 Ga0070665_1001271912 515
62 3300006028 Ga0070717_10026341 Ga0070717_100263413 515
63 3300006844 Ga0075428_100251938 Ga0075428_1002519382 515
64 3300025273 Ga0209673_1000206 Ga0209673_100020620 515
65 3300025298 Ga0209050_1005280 Ga0209050_10052803 515
66 3300025303 Ga0209051_1000359 Ga0209051_100035955 515
67 3300025304 Ga0209257_1002263 Ga0209257_10022639 515
68 3300025929 Ga0207664_10000425 Ga0207664_1000042510 515
69 3300028379 Ga0268266_10071038 Ga0268266_100710382 515
70 3300035083 Ga0373926_0018702 Ga0373926_0018702_555_2183 515
71 3300035695 Ga0373927_0021108 Ga0373927_0021108_2086_3714 515
72 3300035725 Ga0373947_0036931 Ga0373947_0036931_271_1899 515
73 3300036401 Ga0373937_0102341 Ga0373937_0102341_216_1844 515
74 3300046472 Ga0495580_0006588 Ga0495580_0006588_4717_6345 515
75 3300046473 Ga0495582_0010745 Ga0495582_0010745_2063_3691 515
76 3300046517 Ga0495630_0162802 Ga0495630_0162802_39_1667 515
77 3300046536 Ga0495587_0056120 Ga0495587_0056120_657_2282 515
78 3300046679 Ga0495623_0052805 Ga0495623_0052805_141_1769 515
79 3300046690 Ga0495624_0021243 Ga0495624_0021243_51_1679 515
80 3300047315 Ga0495581_0029014 Ga0495581_0029014_181_1809 515
81 3300047471 Ga0495684_0024888 Ga0495684_0024888_2634_4262 515
82 3300053177 Ga0500636_0000365 Ga0500636_0000365_7559_9184 515
83 3300025939 Ga0207665_10061672 Ga0207665_100616722 517
84 3300046453 Ga0495627_000642 Ga0495627_000642_5311_6924 517
85 3300021377 Ga0213874_10003719 Ga0213874_100037192 518
86 3300035691 Ga0373931_0000333 Ga0373931_0000333_5772_7409 518
87 3300036401 Ga0373937_0075826 Ga0373937_0075826_509_2140 518
88 3300048924 Ga0496121_0038181 Ga0496121_0038181_2116_3732 518
89 3300048929 Ga0496126_0180376 Ga0496126_0180376_64_1680 518
90 3300005563 Ga0068855_100000283 Ga0068855_1000002834 519
91 3300005577 Ga0068857_100021668 Ga0068857_1000216684 519
92 3300009093 Ga0105240_10037447 Ga0105240_100374472 519
93 3300009551 Ga0105238_10137354 Ga0105238_101373542 519
94 3300026116 Ga0207674_10034375 Ga0207674_100343753 519
95 3300037466 Ga0395898_0036427 Ga0395898_0036427_3079_4719 519
96 3300037471 Ga0395905_0091429 Ga0395905_0091429_566_2206 519
97 3300037853 Ga0436364_1222257 Ga0436364_1222257_915_2537 519
98 3300038443 Ga0395901_0104867 Ga0395901_0104867_238_1878 519
99 3300039450 Ga0436363_1487883 Ga0436363_1487883_6493_8136 519
100 3300053119 Ga0500595_003301 Ga0500595_003301_2968_4605 519
101 3300005455 Ga0070663_100115250 Ga0070663_1001152501 520
102 3300009545 Ga0105237_10158498 Ga0105237_101584982 520
103 3300035691 Ga0373931_0009359 Ga0373931_0009359_2598_4223 520
104 3300047319 Ga0495674_0007898 Ga0495674_0007898_4672_6456 520
105 3300048913 Ga0496110_0070692 Ga0496110_0070692_483_2108 520
106 3300053080 Ga0500635_0002485 Ga0500635_0002485_2996_4558 520
107 3300009093 Ga0105240_10114967 Ga0105240_101149673 521
108 3300025913 Ga0207695_10077014 Ga0207695_100770142 521
109 3300053093 Ga0500651_0004914 Ga0500651_0004914_5098_6711 521
110 3300005458 Ga0070681_10003273 Ga0070681_100032739 522
111 3300005530 Ga0070679_100019456 Ga0070679_1000194562 522
112 3300009093 Ga0105240_10034709 Ga0105240_100347096 522
113 3300013105 Ga0157369_10012270 Ga0157369_100122705 522
114 3300025912 Ga0207707_10000419 Ga0207707_1000041929 522
115 3300037466 Ga0395898_0015307 Ga0395898_0015307_6108_7724 522
116 3300038443 Ga0395901_0143373 Ga0395901_0143373_516_2132 522
117 3300006852 Ga0075433_10057133 Ga0075433_100571334 523
118 3300014325 Ga0163163_10011315 Ga0163163_100113152 523
119 3300048915 Ga0496112_0019263 Ga0496112_0019263_2689_4314 523
120 3300048923 Ga0496120_0047967 Ga0496120_0047967_165_1790 523
121 3300050515 nmdc:mga0a205_8002_c1 nmdc:mga0a205_8002_c1_5453_7129 523
122 iso_pu_bacteria 2510917026 2511172029 523
123 iso_pu_bacteria 2585427633 2585992505 523
124 iso_pu_bacteria 2585427634 2586003261 523
125 iso_pu_bacteria 2919171160 2919174148 523
126 3300005338 Ga0068868_100171781 Ga0068868_1001717812 525
127 3300005438 Ga0070701_10047203 Ga0070701_100472032 525
128 3300005577 Ga0068857_100001551 Ga0068857_10000155116 525
129 3300005937 Ga0081455_10028177 Ga0081455_100281775 525
130 3300005983 Ga0081540_1014480 Ga0081540_10144802 525
131 3300005983 Ga0081540_1023084 Ga0081540_10230842 525
132 3300014325 Ga0163163_10150767 Ga0163163_101507672 525
133 3300025901 Ga0207688_10049164 Ga0207688_100491642 525
134 3300025915 Ga0207693_10019720 Ga0207693_100197202 525
135 3300025920 Ga0207649_10059216 Ga0207649_100592162 525
136 3300025942 Ga0207689_10017224 Ga0207689_100172242 525
137 3300025945 Ga0207679_10031497 Ga0207679_100314972 525
138 3300026075 Ga0207708_10051448 Ga0207708_100514481 525
139 3300026095 Ga0207676_10022448 Ga0207676_100224482 525
140 3300026116 Ga0207674_10165888 Ga0207674_101658882 525
141 3300031507 Ga0307509_10000840 Ga0307509_1000084022 525
142 3300032002 Ga0307416_100105720 Ga0307416_1001057202 525
143 3300046491 Ga0495584_0025028 Ga0495584_0025028_459_2081 525
144 3300048909 Ga0496106_0009997 Ga0496106_0009997_588_2216 525
145 3300048911 Ga0496108_0022937 Ga0496108_0022937_2622_4244 525
146 3300048912 Ga0496109_0016029 Ga0496109_0016029_2853_4475 525
147 3300048913 Ga0496110_0013689 Ga0496110_0013689_966_2588 525
148 3300048914 Ga0496111_0013221 Ga0496111_0013221_2321_3943 525
149 3300053119 Ga0500595_002343 Ga0500595_002343_7169_8797 525
150 3300053162 Ga0500638_001152 Ga0500638_001152_5715_7343 525
151 3300053178 Ga0500637_0000042 Ga0500637_0000042_14153_15781 525
152 3300055283 Ga0500661_000056 Ga0500661_000056_2166_3794 525
153 3300003203 JGI25406J46586_10011772 JGI25406J46586_100117722 526
154 3300003659 JGI25404J52841_10005921 JGI25404J52841_100059213 526
155 3300005338 Ga0068868_100022399 Ga0068868_1000223993 526
156 3300005455 Ga0070663_100060541 Ga0070663_1000605412 526
157 3300005618 Ga0068864_100184021 Ga0068864_1001840211 526
158 3300005983 Ga0081540_1015123 Ga0081540_10151235 526
159 3300005985 Ga0081539_10001470 Ga0081539_100014706 526
160 3300009094 Ga0111539_10037482 Ga0111539_100374822 526
161 3300009147 Ga0114129_10078597 Ga0114129_100785974 526
162 3300009177 Ga0105248_10039794 Ga0105248_100397943 526
163 3300013105 Ga0157369_10056186 Ga0157369_100561863 526
164 3300014325 Ga0163163_10001576 Ga0163163_1000157610 526
165 3300025294 Ga0209025_1002646 Ga0209025_10026463 526
166 3300025901 Ga0207688_10043415 Ga0207688_100434152 526
167 3300025915 Ga0207693_10088222 Ga0207693_100882222 526
168 3300026067 Ga0207678_10013434 Ga0207678_100134342 526
169 3300026121 Ga0207683_10102624 Ga0207683_101026242 526
170 3300028794 Ga0307515_10006012 Ga0307515_1000601210 526
171 3300031249 Ga0265339_10004321 Ga0265339_100043219 526
172 3300044842 Ga0466957_0047062 Ga0466957_0047062_515_2131 526
173 3300047315 Ga0495581_0060277 Ga0495581_0060277_400_2040 526
174 3300048903 Ga0496100_0043018 Ga0496100_0043018_936_2564 526
175 3300048905 Ga0496102_0001771 Ga0496102_0001771_4113_5741 526
176 3300048907 Ga0496104_0015144 Ga0496104_0015144_2875_4512 526
177 3300048907 Ga0496104_0087081 Ga0496104_0087081_420_2048 526
178 3300048910 Ga0496107_0005793 Ga0496107_0005793_119_1747 526
179 3300048911 Ga0496108_0003885 Ga0496108_0003885_9907_11544 526
180 3300048911 Ga0496108_0019931 Ga0496108_0019931_1567_3195 526
181 3300048912 Ga0496109_0143471 Ga0496109_0143471_441_2069 526
182 3300048913 Ga0496110_0017906 Ga0496110_0017906_3005_4642 526
183 3300048914 Ga0496111_0023874 Ga0496111_0023874_1763_3400 526
184 3300048916 Ga0496113_0006361 Ga0496113_0006361_799_2427 526
185 3300048918 Ga0496115_0039864 Ga0496115_0039864_904_2553 526
186 3300050507 nmdc:mga05p37_203976_c1 nmdc:mga05p37_203976_c1_757_2382 526
187 3300053085 Ga0495619_0046179 Ga0495619_0046179_16_1644 526
188 3300003215 JGI25153J46596_10011211 JGI25153J46596_100112113 527
189 3300003781 Ga0055536_1002776 Ga0055536_10027769 527
190 3300003792 Ga0055540_1001832 Ga0055540_10018329 527
191 3300003794 Ga0055531_10000635 Ga0055531_1000063513 527
192 3300005436 Ga0070713_100012830 Ga0070713_1000128304 527
193 3300006028 Ga0070717_10141457 Ga0070717_101414572 527
194 3300025297 Ga0209758_1000115 Ga0209758_1000115182 527
195 3300025303 Ga0209051_1024810 Ga0209051_10248101 527
196 3300025304 Ga0209257_1001808 Ga0209257_100180816 527
197 3300025928 Ga0207700_10009160 Ga0207700_100091604 527
198 3300048916 Ga0496113_0013216 Ga0496113_0013216_452_2089 527
199 3300053153 Ga0500616_0000104 Ga0500616_0000104_13083_14681 527
200 3300005937 Ga0081455_10013417 Ga0081455_100134175 528
201 3300031247 Ga0265340_10027705 Ga0265340_100277051 528
202 3300031616 Ga0307508_10042188 Ga0307508_100421883 528
203 3300005530 Ga0070679_100013810 Ga0070679_1000138101 529
204 3300025297 Ga0209758_1008059 Ga0209758_10080596 529
205 3300025912 Ga0207707_10018343 Ga0207707_100183435 529
206 3300035724 Ga0373933_0000182 Ga0373933_0000182_16121_17746 529
207 3300005439 Ga0070711_100041758 Ga0070711_1000417583 530
208 3300006173 Ga0070716_100036351 Ga0070716_1000363512 530
209 3300009545 Ga0105237_10098524 Ga0105237_100985242 530
210 3300010375 Ga0105239_10091133 Ga0105239_100911333 530
211 3300025916 Ga0207663_10017003 Ga0207663_100170033 530
212 3300025931 Ga0207644_10035487 Ga0207644_100354873 530
213 3300026142 Ga0207698_10048930 Ga0207698_100489303 530
214 3300031235 Ga0265330_10018111 Ga0265330_100181113 530
215 3300035691 Ga0373931_0003529 Ga0373931_0003529_455_2098 530
216 3300039437 Ga0436365_0862990 Ga0436365_0862990_7603_9399 530
217 3300039450 Ga0436363_1480026 Ga0436363_1480026_2850_4646 530
218 3300048903 Ga0496100_0053587 Ga0496100_0053587_637_2280 530
219 3300048904 Ga0496101_0031035 Ga0496101_0031035_2090_3733 530
220 3300048905 Ga0496102_0085244 Ga0496102_0085244_1081_2724 530
221 3300048907 Ga0496104_0058723 Ga0496104_0058723_1799_3442 530
222 3300048908 Ga0496105_0048124 Ga0496105_0048124_460_2100 530
223 3300048908 Ga0496105_0069984 Ga0496105_0069984_178_1821 530
224 3300048913 Ga0496110_0014333 Ga0496110_0014333_4637_6280 530
225 3300048914 Ga0496111_0027477 Ga0496111_0027477_604_2235 530
226 3300048915 Ga0496112_0023520 Ga0496112_0023520_56_1687 530
227 3300048916 Ga0496113_0043065 Ga0496113_0043065_1525_3168 530
228 3300048918 Ga0496115_0002841 Ga0496115_0002841_3513_5156 530
229 3300048918 Ga0496115_0088101 Ga0496115_0088101_718_2358 530
230 3300049571 Ga0501034_0043788 Ga0501034_0043788_757_2391 530
231 3300049589 Ga0501073_0054577 Ga0501073_0054577_257_1882 530
232 3300060353 Ga0501082_0059100 Ga0501082_0059100_430_2064 530
233 3300028794 Ga0307515_10022923 Ga0307515_1002292311 531
234 3300049586 Ga0501070_0047009 Ga0501070_0047009_109_1734 531
235 3300049742 Ga0501080_0013729 Ga0501080_0013729_259_1884 531
236 3300053094 Ga0500566_0001762 Ga0500566_0001762_11069_12694 531
237 3300053136 Ga0500559_0001379 Ga0500559_0001379_7518_9146 531
238 3300005340 Ga0070689_100070593 Ga0070689_1000705932 532
239 3300005840 Ga0068870_10032793 Ga0068870_100327932 532
240 3300005842 Ga0068858_100106470 Ga0068858_1001064702 532
241 3300005937 Ga0081455_10015026 Ga0081455_100150265 532
242 3300005981 Ga0081538_10071250 Ga0081538_100712502 532
243 3300009098 Ga0105245_10058514 Ga0105245_100585143 532
244 3300009553 Ga0105249_10067353 Ga0105249_100673532 532
245 3300014969 Ga0157376_10080530 Ga0157376_100805302 532
246 3300025937 Ga0207669_10014394 Ga0207669_100143943 532
247 3300025938 Ga0207704_10015826 Ga0207704_100158262 532
248 3300025961 Ga0207712_10021041 Ga0207712_100210412 532
249 3300025972 Ga0207668_10018860 Ga0207668_100188603 532
250 3300026067 Ga0207678_10119968 Ga0207678_101199682 532
251 3300026075 Ga0207708_10028255 Ga0207708_100282551 532
252 3300026089 Ga0207648_10095735 Ga0207648_100957352 532
253 3300026118 Ga0207675_100022726 Ga0207675_1000227265 532
254 3300026118 Ga0207675_100152562 Ga0207675_1001525622 532
255 3300031616 Ga0307508_10026534 Ga0307508_100265343 532
256 3300031995 Ga0307409_100050246 Ga0307409_1000502463 532
257 3300032005 Ga0307411_10092001 Ga0307411_100920012 532
258 3300046684 Ga0495669_0000650 Ga0495669_0000650_56_1687 532
259 3300048905 Ga0496102_0177997 Ga0496102_0177997_116_1744 532
260 3300048910 Ga0496107_0115098 Ga0496107_0115098_240_1868 532
261 3300048929 Ga0496126_0145053 Ga0496126_0145053_94_1731 532
262 3300049571 Ga0501034_0016524 Ga0501034_0016524_5077_6708 532
263 3300049581 Ga0501047_0011773 Ga0501047_0011773_320_1951 532
264 3300053096 Ga0500641_0010815 Ga0500641_0010815_1598_3229 532
265 iso_pu_bacteria 2739367653 2739604431 532
266 iso_pu_bacteria 2857727296 2857728810 532
267 3300003354 JGI25160J50197_1015299 JGI25160J50197_10152992 533
268 3300004625 Ga0055543_1003833 Ga0055543_10038332 533
269 3300005262 Ga0065165_1002220 Ga0065165_100222012 533
270 3300005347 Ga0070668_100072015 Ga0070668_1000720152 533
271 3300005530 Ga0070679_100024100 Ga0070679_1000241003 533
272 3300005535 Ga0070684_100009975 Ga0070684_1000099751 533
273 3300006028 Ga0070717_10082336 Ga0070717_100823362 533
274 3300009174 Ga0105241_10021246 Ga0105241_100212464 533
275 3300009545 Ga0105237_10023096 Ga0105237_100230963 533
276 3300009551 Ga0105238_10132830 Ga0105238_101328302 533
277 3300021320 Ga0214544_1001813 Ga0214544_100181319 533
278 3300021321 Ga0214542_1001236 Ga0214542_100123620 533
279 3300021324 Ga0214545_1000924 Ga0214545_100092425 533
280 3300021327 Ga0214543_1003531 Ga0214543_100353119 533
281 3300021327 Ga0214543_1024471 Ga0214543_10244713 533
282 3300025297 Ga0209758_1001210 Ga0209758_100121022 533
283 3300025913 Ga0207695_10000008 Ga0207695_10000008789 533
284 3300025914 Ga0207671_10005294 Ga0207671_1000529410 533
285 3300025944 Ga0207661_10001270 Ga0207661_1000127010 533
286 3300028786 Ga0307517_10000634 Ga0307517_1000063442 533
287 3300031507 Ga0307509_10005537 Ga0307509_1000553710 533
288 3300031548 Ga0307408_100044133 Ga0307408_1000441332 533
289 3300031730 Ga0307516_10010247 Ga0307516_1001024711 533
290 3300033179 Ga0307507_10140766 Ga0307507_101407661 533
291 3300033180 Ga0307510_10023885 Ga0307510_100238856 533
292 3300046477 Ga0495664_0028129 Ga0495664_0028129_124_1776 533
293 3300046516 Ga0495628_0040736 Ga0495628_0040736_1118_2743 533
294 3300046536 Ga0495587_0035375 Ga0495587_0035375_245_1870 533
295 3300046543 Ga0495645_0013557 Ga0495645_0013557_1579_3204 533
296 3300046559 Ga0495667_0042318 Ga0495667_0042318_754_2379 533
297 3300046675 Ga0495657_0019591 Ga0495657_0019591_205_1830 533
298 3300046678 Ga0495599_0019045 Ga0495599_0019045_1688_3313 533
299 3300046678 Ga0495599_0063533 Ga0495599_0063533_209_1861 533
300 3300046809 Ga0495600_0034678 Ga0495600_0034678_779_2404 533
301 3300046809 Ga0495600_0121999 Ga0495600_0121999_22_1650 533
302 3300047319 Ga0495674_0041495 Ga0495674_0041495_1680_3305 533
303 3300047320 Ga0495672_0006488 Ga0495672_0006488_321_1949 533
304 3300047322 Ga0495680_0001711 Ga0495680_0001711_3223_4848 533
305 3300047444 Ga0495675_0005291 Ga0495675_0005291_3999_5624 533
306 3300048918 Ga0496115_0039874 Ga0496115_0039874_1839_3464 533
307 3300048919 Ga0496116_0000588 Ga0496116_0000588_39518_41233 533
308 3300048920 Ga0496117_0008313 Ga0496117_0008313_3490_5205 533
309 3300048921 Ga0496118_0000781 Ga0496118_0000781_9285_11000 533
310 3300053078 Ga0495612_0018136 Ga0495612_0018136_890_2518 533
311 3300053119 Ga0500595_016164 Ga0500595_016164_740_2368 533
312 iso_pu_bacteria 8002784119 8002788881 533
313 3300003203 JGI25406J46586_10013111 JGI25406J46586_100131113 534
314 3300005341 Ga0070691_10045166 Ga0070691_100451661 534
315 3300005438 Ga0070701_10005782 Ga0070701_100057825 534
316 3300005545 Ga0070695_100067456 Ga0070695_1000674562 534
317 3300005937 Ga0081455_10000730 Ga0081455_100007304 534
318 3300005985 Ga0081539_10000058 Ga0081539_10000058201 534
319 3300014326 Ga0157380_10088443 Ga0157380_100884433 534
320 3300025230 Ga0209563_104010 Ga0209563_1040102 534
321 3300026075 Ga0207708_10021169 Ga0207708_100211694 534
322 3300026118 Ga0207675_100016194 Ga0207675_1000161942 534
323 3300031456 Ga0307513_10082153 Ga0307513_100821533 534
324 3300031507 Ga0307509_10120250 Ga0307509_101202503 534
325 3300031824 Ga0307413_10036229 Ga0307413_100362292 534
326 3300035113 Ga0373936_0009069 Ga0373936_0009069_1151_2824 534
327 3300035116 Ga0373945_0014977 Ga0373945_0014977_873_2546 534
328 3300035170 Ga0373943_0008899 Ga0373943_0008899_2593_4266 534
329 3300035171 Ga0373946_0004997 Ga0373946_0004997_2781_4409 534
330 3300035695 Ga0373927_0002882 Ga0373927_0002882_2551_4224 534
331 3300037068 Ga0373925_0023291 Ga0373925_0023291_1985_3658 534
332 3300044658 Ga0466972_0025282 Ga0466972_0025282_1168_2793 534
333 3300044735 Ga0466968_0023471 Ga0466968_0023471_326_1951 534
334 3300044901 Ga0466960_0025406 Ga0466960_0025406_972_2597 534
335 3300046454 Ga0495592_0013200 Ga0495592_0013200_1093_2766 534
336 3300046455 Ga0495603_0000217 Ga0495603_0000217_24040_25713 534
337 3300046459 Ga0495629_0000862 Ga0495629_0000862_13264_14937 534
338 3300046461 Ga0495641_0003672 Ga0495641_0003672_2041_3714 534
339 3300046472 Ga0495580_0005364 Ga0495580_0005364_7124_8797 534
340 3300046473 Ga0495582_0000990 Ga0495582_0000990_12555_14228 534
341 3300046475 Ga0495639_0000544 Ga0495639_0000544_8201_9874 534
342 3300046476 Ga0495662_0001589 Ga0495662_0001589_8092_9765 534
343 3300046477 Ga0495664_0001505 Ga0495664_0001505_4003_5676 534
344 3300046499 Ga0495594_0000128 Ga0495594_0000128_32396_34069 534
345 3300046517 Ga0495630_0018933 Ga0495630_0018933_1965_3638 534
346 3300046524 Ga0495648_0054832 Ga0495648_0054832_521_2146 534
347 3300046531 Ga0495665_0006186 Ga0495665_0006186_1984_3657 534
348 3300046533 Ga0495640_0002595 Ga0495640_0002595_5996_7669 534
349 3300046557 Ga0495622_0014846 Ga0495622_0014846_992_2620 534
350 3300046642 Ga0495634_0001583 Ga0495634_0001583_3570_5243 534
351 3300046663 Ga0495635_0000436 Ga0495635_0000436_7387_9060 534
352 3300046680 Ga0495646_0013510 Ga0495646_0013510_2038_3711 534
353 3300046681 Ga0495647_0000394 Ga0495647_0000394_8221_9894 534
354 3300046683 Ga0495658_0003203 Ga0495658_0003203_2170_3843 534
355 3300046689 Ga0495613_0017135 Ga0495613_0017135_3435_5063 534
356 3300046690 Ga0495624_0044115 Ga0495624_0044115_288_1961 534
357 3300047315 Ga0495581_0003127 Ga0495581_0003127_3691_5364 534
358 3300047319 Ga0495674_0008903 Ga0495674_0008903_7173_8846 534
359 3300047471 Ga0495684_0022668 Ga0495684_0022668_595_2268 534
360 3300047673 Ga0495593_0000439 Ga0495593_0000439_4042_5715 534
361 3300053139 Ga0500568_0018981 Ga0500568_0018981_859_2532 534
362 iso_pu_bacteria 2919034639 2919037945 534
363 3300003856 Ga0058692_1008427 Ga0058692_10084271 535
364 3300005548 Ga0070665_100000229 Ga0070665_10000022941 535
365 3300005985 Ga0081539_10007479 Ga0081539_1000747910 535
366 3300026067 Ga0207678_10033534 Ga0207678_100335342 535
367 3300027312 Ga0209371_1000741 Ga0209371_100074118 535
368 3300028379 Ga0268266_10006018 Ga0268266_100060185 535
369 3300030500 Ga0268256_1001268 Ga0268256_100126811 535
370 iso_pu_bacteria 2517572101 2517764493 535
371 3300005262 Ga0065165_1000048 Ga0065165_100004880 536
372 3300005329 Ga0070683_100231605 Ga0070683_1002316051 536
373 3300005339 Ga0070660_100135869 Ga0070660_1001358691 536
374 3300005354 Ga0070675_100114799 Ga0070675_1001147991 536
375 3300005436 Ga0070713_100010384 Ga0070713_1000103844 536
376 3300005439 Ga0070711_100059731 Ga0070711_1000597312 536
377 3300005458 Ga0070681_10069475 Ga0070681_100694752 536
378 3300005539 Ga0068853_100016892 Ga0068853_1000168923 536
379 3300005543 Ga0070672_100151133 Ga0070672_1001511332 536
380 3300005547 Ga0070693_100041241 Ga0070693_1000412412 536
381 3300009093 Ga0105240_10000944 Ga0105240_1000094431 536
382 3300009093 Ga0105240_10017034 Ga0105240_100170345 536
383 3300009093 Ga0105240_10184829 Ga0105240_101848291 536
384 3300009174 Ga0105241_10007759 Ga0105241_100077593 536
385 3300009174 Ga0105241_10041064 Ga0105241_100410643 536
386 3300009545 Ga0105237_10016720 Ga0105237_100167203 536
387 3300009545 Ga0105237_10018952 Ga0105237_100189523 536
388 3300009545 Ga0105237_10084676 Ga0105237_100846762 536
389 3300009551 Ga0105238_10021930 Ga0105238_100219302 536
390 3300009551 Ga0105238_10025577 Ga0105238_100255773 536
391 3300010375 Ga0105239_10051695 Ga0105239_100516952 536
392 3300013105 Ga0157369_10160148 Ga0157369_101601482 536
393 3300013297 Ga0157378_10009041 Ga0157378_100090415 536
394 3300025284 Ga0209130_1000071 Ga0209130_100007162 536
395 3300025911 Ga0207654_10014803 Ga0207654_100148032 536
396 3300025913 Ga0207695_10008914 Ga0207695_100089144 536
397 3300025914 Ga0207671_10016590 Ga0207671_100165902 536
398 3300026041 Ga0207639_10018667 Ga0207639_100186672 536
399 3300026116 Ga0207674_10024654 Ga0207674_100246541 536
400 3300026116 Ga0207674_10030004 Ga0207674_100300042 536
401 3300033179 Ga0307507_10011278 Ga0307507_100112786 536
402 3300044656 Ga0466969_0007732 Ga0466969_0007732_2547_4175 536
403 3300045049 Ga0466959_0017193 Ga0466959_0017193_873_2501 536
404 3300047321 Ga0495676_0028303 Ga0495676_0028303_2920_4545 536
405 iso_pu_bacteria 2513237096 2513654074 536
406 iso_pu_bacteria 2513237145 2513918414 536
407 iso_pu_bacteria 2523231067 2523467281 536
408 iso_pu_bacteria 2643221651 2644288726 536
409 iso_pu_bacteria 2738543031 2739347785 536
410 iso_pu_bacteria 2841760612 2841766401 536
411 iso_pu_bacteria 2844104063 2844106168 536
412 iso_pu_bacteria 2851182111 2851186669 536
413 iso_pu_bacteria 2851246043 2851246524 536
414 iso_pu_bacteria 8016522445 8016528702 536
415 iso_pu_bacteria 8057529695 8057531282 536
416 3300005434 Ga0070709_10040280 Ga0070709_100402802 537
417 3300028800 Ga0265338_10006948 Ga0265338_1000694810 537
418 iso_pu_bacteria 2507262055 2507507678 537
419 iso_pu_bacteria 2508501009 2508541794 537
420 iso_pu_bacteria 2508501042 2508692658 537
421 iso_pu_bacteria 2508501128 2509149315 537
422 iso_pu_bacteria 2511231028 2511400926 537
423 iso_pu_bacteria 2513237092 2513628415 537
424 iso_pu_bacteria 2513237094 2513642972 537
425 iso_pu_bacteria 2513237095 2513647499 537
426 iso_pu_bacteria 2513237104 2513719467 537
427 iso_pu_bacteria 2513237137 2513856826 537
428 iso_pu_bacteria 2513237141 2513891267 537
429 iso_pu_bacteria 2515154112 2515626064 537
430 iso_pu_bacteria 2517093001 2517104144 537
431 iso_pu_bacteria 2517572143 2517891352 537
432 iso_pu_bacteria 2524023205 2524436292 537
433 iso_pu_bacteria 2524023210 2524468465 537
434 iso_pu_bacteria 2528768022 2528848996 537
435 iso_pu_bacteria 2602042107 2603860913 537
436 iso_pu_bacteria 2617270741 2617372713 537
437 iso_pu_bacteria 2667528175 2671118868 537
438 iso_pu_bacteria 2721755755 2723843699 537
439 iso_pu_bacteria 2728368998 2728750064 537
440 iso_pu_bacteria 2744054633 2745080753 537
441 iso_pu_bacteria 2791355197 2793066720 537
442 iso_pu_bacteria 2791355199 2793080656 537
443 iso_pu_bacteria 2816332527 2818236536 537
444 iso_pu_bacteria 2824661429 2824666472 537
445 iso_pu_bacteria 2824704595 2824710245 537
446 iso_pu_bacteria 2824732956 2824735844 537
447 iso_pu_bacteria 2824746037 2824750091 537
448 iso_pu_bacteria 2824753945 2824755967 537
449 iso_pu_bacteria 2824763712 2824767505 537
450 iso_pu_bacteria 2824773399 2824775140 537
451 iso_pu_bacteria 2841957949 2841959706 537
452 iso_pu_bacteria 2844315083 2844320007 537
453 iso_pu_bacteria 2857509624 2857512785 537
454 iso_pu_bacteria 2857524615 2857524635 537
455 iso_pu_bacteria 2874590934 2874598788 537
456 iso_pu_bacteria 2874604998 2874607392 537
457 iso_pu_bacteria 2874628541 2874635021 537
458 iso_pu_bacteria 2874645413 2874652244 537
459 iso_pu_bacteria 2876761206 2876766226 537
460 iso_pu_bacteria 2876771140 2876778827 537
461 iso_pu_bacteria 2876808645 2876814621 537
462 iso_pu_bacteria 2876818435 2876824278 537
463 iso_pu_bacteria 2879074833 2879082620 537
464 iso_pu_bacteria 2879099564 2879107117 537
465 iso_pu_bacteria 2879110137 2879114702 537
466 iso_pu_bacteria 2879127579 2879131537 537
467 iso_pu_bacteria 2879142872 2879147983 537
468 iso_pu_bacteria 2885383462 2885384045 537
469 iso_pu_bacteria 2885409591 2885410278 537
470 iso_pu_bacteria 2888378607 2888385436 537
471 iso_pu_bacteria 2888388044 2888392797 537
472 iso_pu_bacteria 2889033259 2889038031 537
473 iso_pu_bacteria 2893066018 2893069156 537
474 iso_pu_bacteria 2903727486 2903730318 537
475 iso_pu_bacteria 2903748898 2903755313 537
476 iso_pu_bacteria 2903768456 2903769713 537
477 iso_pu_bacteria 2904690495 2904691220 537
478 iso_pu_bacteria 2904699407 2904701306 537
479 iso_pu_bacteria 2904711408 2904711988 537
480 iso_pu_bacteria 2906602504 2906604747 537
481 iso_pu_bacteria 2906610324 2906616538 537
482 iso_pu_bacteria 2906635258 2906635311 537
483 iso_pu_bacteria 2906643746 2906643928 537
484 iso_pu_bacteria 2906660503 2906666856 537
485 iso_pu_bacteria 2908739725 2908741706 537
486 iso_pu_bacteria 2908756301 2908759139 537
487 iso_pu_bacteria 2908775508 2908781156 537
488 iso_pu_bacteria 2919073203 2919078517 537
489 iso_pu_bacteria 2922361189 2922366030 537
490 iso_pu_bacteria 2922368715 2922372422 537
491 iso_pu_bacteria 2922386360 2922387365 537
492 iso_pu_bacteria 2922425934 2922431442 537
493 iso_pu_bacteria 2929615660 2929621008 537
494 iso_pu_bacteria 2929624759 2929626161 537
495 iso_pu_bacteria 2932784394 2932784960 537
496 iso_pu_bacteria 2932794094 2932795162 537
497 iso_pu_bacteria 2932801729 2932805690 537
498 iso_pu_bacteria 2932809354 2932809992 537
499 iso_pu_bacteria 2932818245 2932818265 537
500 iso_pu_bacteria 2932828146 2932828797 537
501 iso_pu_bacteria 2933577622 2933583122 537
502 iso_pu_bacteria 2935608549 2935609812 537
503 iso_pu_bacteria 2935616580 2935619783 537
504 iso_pu_bacteria 2935630451 2935634038 537
505 iso_pu_bacteria 2935638405 2935638764 537
506 iso_pu_bacteria 2935648319 2935652158 537
507 iso_pu_bacteria 2935656913 2935659869 537
508 iso_pu_bacteria 2935665750 2935666385 537
509 iso_pu_bacteria 2935675223 2935676569 537
510 iso_pu_bacteria 2935684952 2935684952 537
511 iso_pu_bacteria 2935694250 2935694649 537
512 iso_pu_bacteria 2935703347 2935703770 537
513 iso_pu_bacteria 2935713505 2935713505 537
514 iso_pu_bacteria 2935722832 2935724125 537
515 iso_pu_bacteria 2935732158 2935733517 537
516 iso_pu_bacteria 2935741537 2935742896 537
517 iso_pu_bacteria 2935750917 2935750917 537
518 iso_pu_bacteria 2935760218 2935760552 537
519 iso_pu_bacteria 2935769743 2935771958 537
520 iso_pu_bacteria 2935777560 2935784326 537
521 iso_pu_bacteria 2935785616 2935787654 537
522 iso_pu_bacteria 2935793552 2935796286 537
523 iso_pu_bacteria 2935801545 2935801907 537
524 iso_pu_bacteria 2935810662 2935810678 537
525 iso_pu_bacteria 2935819856 2935822973 537
526 iso_pu_bacteria 2935827899 2935828258 537
527 iso_pu_bacteria 2935837841 2935842462 537
528 iso_pu_bacteria 2935847175 2935848555 537
529 iso_pu_bacteria 2935855204 2935857902 537
530 iso_pu_bacteria 2935864058 2935868756 537
531 iso_pu_bacteria 2935873716 2935874171 537
532 iso_pu_bacteria 2935883170 2935883940 537
533 iso_pu_bacteria 2935908558 2935909637 537
534 iso_pu_bacteria 2935916978 2935917362 537
535 iso_pu_bacteria 2935926038 2935927118 537
536 iso_pu_bacteria 2935934488 2935937038 537
537 iso_pu_bacteria 2935942939 2935944659 537
538 iso_pu_bacteria 2935951376 2935953096 537
539 iso_pu_bacteria 2935959822 2935966597 537
540 iso_pu_bacteria 2935967501 2935969936 537
541 iso_pu_bacteria 2935975950 2935980227 537
542 iso_pu_bacteria 2935984226 2935987013 537
543 iso_pu_bacteria 2935992306 2935992904 537
544 iso_pu_bacteria 2936002035 2936002817 537
545 iso_pu_bacteria 2936011229 2936014285 537
546 iso_pu_bacteria 2936019824 2936023875 537
547 iso_pu_bacteria 2936028420 2936031518 537
548 iso_pu_bacteria 2936037263 2936037902 537
549 iso_pu_bacteria 2936046547 2936049391 537
550 iso_pu_bacteria 2936055302 2936062141 537
551 iso_pu_bacteria 2940556831 2940558280 537
552 iso_pu_bacteria 2941507105 2941510659 537
553 iso_pu_bacteria 2941515067 2941518043 537
554 iso_pu_bacteria 2941523033 2941527086 537
555 iso_pu_bacteria 2941531003 2941531192 537
556 iso_pu_bacteria 2941538514 2941542511 537
557 iso_pu_bacteria 3005474847 3005481235 537
558 iso_pu_bacteria 3005594810 3005600298 537
559 iso_pu_bacteria 3005710791 3005715792 537
560 iso_pu_bacteria 3005718088 3005723148 537
561 iso_pu_bacteria 8006926726 8006927957 537
562 iso_pu_bacteria 8006933436 8006939474 537
563 iso_pu_bacteria 8006964411 8006972132 537
564 iso_pu_bacteria 8006973647 8006979224 537
565 iso_pu_bacteria 8006984368 8006984413 537
566 iso_pu_bacteria 8006994254 8007001347 537
567 iso_pu_bacteria 8016511872 8016520676 537
568 iso_pu_bacteria 8016548790 8016555016 537
569 iso_pu_bacteria 8016566248 8016572219 537
570 iso_pu_bacteria 8016575299 8016576408 537
571 iso_pu_bacteria 8016595262 8016601136 537
572 iso_pu_bacteria 8016613128 8016615592 537
573 iso_pu_bacteria 8016630954 8016639196 537
574 iso_pu_bacteria 8017057580 8017064906 537
575 iso_pu_bacteria 8019547302 8019552707 537
576 iso_pu_bacteria 8019555841 8019565352 537
577 iso_pu_bacteria 8019565922 8019575452 537
578 iso_pu_bacteria 8019576017 8019584282 537
579 iso_pu_bacteria 8019586578 8019592050 537
580 iso_pu_bacteria 8019597564 8019599233 537
581 iso_pu_bacteria 8019608314 8019609125 537
582 iso_pu_bacteria 8019619141 8019619798 537
583 iso_pu_bacteria 8019629233 8019633317 537
584 iso_pu_bacteria 8019638758 8019646583 537
585 iso_pu_bacteria 8019648815 8019649353 537
586 iso_pu_bacteria 8019659431 8019661191 537
587 iso_pu_bacteria 8019668869 8019670742 537
588 iso_pu_bacteria 8019678201 8019685462 537
589 iso_pu_bacteria 8019687851 8019691052 537
590 iso_pu_bacteria 8055742211 8055745129 537
591 iso_pu_bacteria 8056673599 8056681091 537
592 iso_pu_bacteria 8056681323 8056684738 537
593 iso_pu_bacteria 8056967851 8056975086 537
594 3300005548 Ga0070665_100004434 Ga0070665_1000044344 538
595 3300009093 Ga0105240_10165503 Ga0105240_101655032 538
596 3300037466 Ga0395898_0022553 Ga0395898_0022553_1955_3571 538
597 3300039453 Ga0436362_0413279 Ga0436362_0413279_739_2355 538
598 3300046520 Ga0495637_0000328 Ga0495637_0000328_27445_29103 538
599 3300046524 Ga0495648_0021356 Ga0495648_0021356_1524_3191 538
600 3300047472 Ga0495686_0007775 Ga0495686_0007775_3299_4957 538
601 3300049459 Ga0495678_001313 Ga0495678_001313_5006_6673 538
602 3300005327 Ga0070658_10036019 Ga0070658_100360192 539
603 3300005336 Ga0070680_100007991 Ga0070680_1000079912 539
604 3300005434 Ga0070709_10036894 Ga0070709_100368941 539
605 3300005614 Ga0068856_100083462 Ga0068856_1000834622 539
606 3300010375 Ga0105239_10011360 Ga0105239_100113606 539
607 3300025898 Ga0207692_10088948 Ga0207692_100889481 539
608 3300025906 Ga0207699_10008564 Ga0207699_100085644 539
609 3300025909 Ga0207705_10043989 Ga0207705_100439892 539
610 3300025912 Ga0207707_10066929 Ga0207707_100669292 539
611 3300025914 Ga0207671_10045059 Ga0207671_100450593 539
612 3300025915 Ga0207693_10006974 Ga0207693_1000697410 539
613 3300026078 Ga0207702_10205565 Ga0207702_102055652 539
614 3300031250 Ga0265331_10013135 Ga0265331_100131352 539
615 3300048921 Ga0496118_0003407 Ga0496118_0003407_15563_17182 539
616 3300048924 Ga0496121_0010422 Ga0496121_0010422_721_2343 539
617 3300048928 Ga0496125_0000040 Ga0496125_0000040_13699_15363 539
618 3300048928 Ga0496125_0004755 Ga0496125_0004755_7567_9228 539
619 3300048929 Ga0496126_0143002 Ga0496126_0143002_156_1775 539
620 3300053142 Ga0500577_0003874 Ga0500577_0003874_1299_2921 539
621 3300025919 Ga0207657_10001672 Ga0207657_1000167217 540
622 3300049568 Ga0501031_0006214 Ga0501031_0006214_4387_6015 540
623 3300049569 Ga0501032_0000189 Ga0501032_0000189_1995_3761 540
624 3300049570 Ga0501033_0001037 Ga0501033_0001037_23610_25247 540
625 3300049571 Ga0501034_0007343 Ga0501034_0007343_8581_10347 540
626 3300049572 Ga0501036_0000134 Ga0501036_0000134_22102_23868 540
627 3300049573 Ga0501037_0002272 Ga0501037_0002272_7116_8882 540
628 3300049574 Ga0501038_0000929 Ga0501038_0000929_346_2112 540
629 3300049575 Ga0501039_0002379 Ga0501039_0002379_352_2118 540
630 3300049579 Ga0501043_0002576 Ga0501043_0002576_7964_9730 540
631 3300049580 Ga0501046_0034847 Ga0501046_0034847_888_2654 540
632 3300049581 Ga0501047_0000866 Ga0501047_0000866_28088_29854 540
633 3300049581 Ga0501047_0017605 Ga0501047_0017605_3224_4849 540
634 3300049584 Ga0501068_0003851 Ga0501068_0003851_4856_6622 540
635 3300049585 Ga0501069_0005415 Ga0501069_0005415_4768_6534 540
636 3300049586 Ga0501070_0003638 Ga0501070_0003638_3077_4843 540
637 3300049589 Ga0501073_0008652 Ga0501073_0008652_3498_5264 540
638 3300049590 Ga0501074_0003064 Ga0501074_0003064_2662_4428 540
639 3300049742 Ga0501080_0000200 Ga0501080_0000200_14699_16465 540
640 3300049822 Ga0501035_0000598 Ga0501035_0000598_36891_38657 540
641 3300049823 Ga0501044_0000887 Ga0501044_0000887_31469_33235 540
642 3300049823 Ga0501044_0020320 Ga0501044_0020320_5424_7046 540
643 3300049823 Ga0501044_0147435 Ga0501044_0147435_505_2127 540
644 3300053145 Ga0500586_000414 Ga0500586_000414_6223_7890 540
645 3300003203 JGI25406J46586_10000214 JGI25406J46586_1000021416 541
646 3300003215 JGI25153J46596_10005616 JGI25153J46596_100056164 541
647 3300005329 Ga0070683_100142289 Ga0070683_1001422892 541
648 3300005336 Ga0070680_100012621 Ga0070680_1000126217 541
649 3300005339 Ga0070660_100003001 Ga0070660_1000030013 541
650 3300005347 Ga0070668_100120141 Ga0070668_1001201412 541
651 3300005434 Ga0070709_10000203 Ga0070709_1000020326 541
652 3300005434 Ga0070709_10004227 Ga0070709_100042272 541
653 3300005435 Ga0070714_100009406 Ga0070714_1000094062 541
654 3300005436 Ga0070713_100001761 Ga0070713_1000017617 541
655 3300005436 Ga0070713_100016592 Ga0070713_1000165924 541
656 3300005437 Ga0070710_10001622 Ga0070710_1000162210 541
657 3300005439 Ga0070711_100006659 Ga0070711_1000066595 541
658 3300005439 Ga0070711_100019115 Ga0070711_1000191153 541
659 3300005455 Ga0070663_100136246 Ga0070663_1001362461 541
660 3300005467 Ga0070706_100148505 Ga0070706_1001485052 541
661 3300005563 Ga0068855_100020164 Ga0068855_1000201642 541
662 3300005563 Ga0068855_100191175 Ga0068855_1001911752 541
663 3300005578 Ga0068854_100140792 Ga0068854_1001407921 541
664 3300005614 Ga0068856_100003347 Ga0068856_1000033471 541
665 3300005843 Ga0068860_100000081 Ga0068860_10000008189 541
666 3300005937 Ga0081455_10001734 Ga0081455_100017345 541
667 3300005983 Ga0081540_1003965 Ga0081540_10039658 541
668 3300005983 Ga0081540_1018499 Ga0081540_10184992 541
669 3300005985 Ga0081539_10000768 Ga0081539_1000076836 541
670 3300006028 Ga0070717_10001267 Ga0070717_100012678 541
671 3300006173 Ga0070716_100014285 Ga0070716_1000142853 541
672 3300006175 Ga0070712_100006733 Ga0070712_1000067335 541
673 3300006353 Ga0075370_10014516 Ga0075370_100145163 541
674 3300006942 Ga0099824_1007408 Ga0099824_100740811 541
675 3300006943 Ga0099822_1018218 Ga0099822_10182185 541
676 3300009093 Ga0105240_10034221 Ga0105240_100342216 541
677 3300009093 Ga0105240_10170691 Ga0105240_101706912 541
678 3300009147 Ga0114129_10411862 Ga0114129_104118622 541
679 3300009545 Ga0105237_10046497 Ga0105237_100464974 541
680 3300013105 Ga0157369_10021190 Ga0157369_100211901 541
681 3300021377 Ga0213874_10013879 Ga0213874_100138792 541
682 3300021384 Ga0213876_10008410 Ga0213876_100084103 541
683 3300025254 Ga0209148_1000180 Ga0209148_100018098 541
684 3300025261 Ga0209233_1001700 Ga0209233_10017007 541
685 3300025261 Ga0209233_1011023 Ga0209233_10110232 541
686 3300025272 Ga0209455_1001704 Ga0209455_10017049 541
687 3300025295 Ga0209564_1000385 Ga0209564_100038569 541
688 3300025297 Ga0209758_1004569 Ga0209758_100456911 541
689 3300025302 Ga0207426_1000572 Ga0207426_100057226 541
690 3300025898 Ga0207692_10003008 Ga0207692_100030082 541
691 3300025898 Ga0207692_10015388 Ga0207692_100153883 541
692 3300025906 Ga0207699_10020956 Ga0207699_100209563 541
693 3300025912 Ga0207707_10002705 Ga0207707_100027058 541
694 3300025913 Ga0207695_10136750 Ga0207695_101367502 541
695 3300025915 Ga0207693_10014354 Ga0207693_100143545 541
696 3300025915 Ga0207693_10037039 Ga0207693_100370393 541
697 3300025915 Ga0207693_10081201 Ga0207693_100812012 541
698 3300025916 Ga0207663_10001473 Ga0207663_100014732 541
699 3300025916 Ga0207663_10002050 Ga0207663_100020506 541
700 3300025916 Ga0207663_10088244 Ga0207663_100882442 541
701 3300025917 Ga0207660_10034957 Ga0207660_100349571 541
702 3300025917 Ga0207660_10055477 Ga0207660_100554772 541
703 3300025919 Ga0207657_10006890 Ga0207657_100068903 541
704 3300025921 Ga0207652_10001690 Ga0207652_1000169011 541
705 3300025924 Ga0207694_10005031 Ga0207694_1000503111 541
706 3300025928 Ga0207700_10026155 Ga0207700_100261553 541
707 3300025929 Ga0207664_10002721 Ga0207664_1000272112 541
708 3300025939 Ga0207665_10001320 Ga0207665_1000132014 541
709 3300025939 Ga0207665_10001972 Ga0207665_100019727 541
710 3300025942 Ga0207689_10073542 Ga0207689_100735422 541
711 3300025945 Ga0207679_10024233 Ga0207679_100242334 541
712 3300025949 Ga0207667_10002017 Ga0207667_1000201714 541
713 3300025981 Ga0207640_10116625 Ga0207640_101166252 541
714 3300026078 Ga0207702_10000548 Ga0207702_1000054834 541
715 3300026089 Ga0207648_10129840 Ga0207648_101298402 541
716 3300027357 Ga0209589_1000014 Ga0209589_1000014171 541
717 3300027361 Ga0209489_100014 Ga0209489_100014171 541
718 3300027363 Ga0209700_100024 Ga0209700_100024171 541
719 3300028379 Ga0268266_10008590 Ga0268266_100085907 541
720 3300028380 Ga0268265_10072621 Ga0268265_100726212 541
721 3300028381 Ga0268264_10000048 Ga0268264_1000004884 541
722 3300028573 Ga0265334_10001696 Ga0265334_100016967 541
723 3300028573 Ga0265334_10008302 Ga0265334_100083023 541
724 3300028654 Ga0265322_10001590 Ga0265322_100015906 541
725 3300028666 Ga0265336_10000135 Ga0265336_1000013530 541
726 3300028794 Ga0307515_10102563 Ga0307515_101025632 541
727 3300028800 Ga0265338_10000034 Ga0265338_10000034176 541
728 3300029957 Ga0265324_10016573 Ga0265324_100165732 541
729 3300031238 Ga0265332_10033695 Ga0265332_100336952 541
730 3300031250 Ga0265331_10008950 Ga0265331_100089502 541
731 3300031616 Ga0307508_10000032 Ga0307508_1000003274 541
732 3300031711 Ga0265314_10004266 Ga0265314_100042661 541
733 3300031712 Ga0265342_10020228 Ga0265342_100202283 541
734 3300031730 Ga0307516_10005934 Ga0307516_100059348 541
735 3300031730 Ga0307516_10082192 Ga0307516_100821922 541
736 3300033442 Ga0315911_1000002 Ga0315911_1000002149 541
737 3300035086 Ga0373934_0005355 Ga0373934_0005355_2492_4120 541
738 3300035111 Ga0373923_0021021 Ga0373923_0021021_696_2324 541
739 3300035117 Ga0373953_0000604 Ga0373953_0000604_1630_3258 541
740 3300035117 Ga0373953_0025139 Ga0373953_0025139_304_1929 541
741 3300035118 Ga0373954_0008754 Ga0373954_0008754_1579_3207 541
742 3300035118 Ga0373954_0025683 Ga0373954_0025683_29_1654 541
743 3300035119 Ga0373956_0001292 Ga0373956_0001292_119_1747 541
744 3300035120 Ga0373957_0015911 Ga0373957_0015911_346_1974 541
745 3300035172 Ga0373955_0020984 Ga0373955_0020984_620_2248 541
746 3300035695 Ga0373927_0013220 Ga0373927_0013220_1122_2747 541
747 3300035695 Ga0373927_0082950 Ga0373927_0082950_114_1739 541
748 3300035724 Ga0373933_0013111 Ga0373933_0013111_1263_2891 541
749 3300035724 Ga0373933_0067748 Ga0373933_0067748_125_1756 541
750 3300036401 Ga0373937_0028281 Ga0373937_0028281_464_2098 541
751 3300036401 Ga0373937_0031478 Ga0373937_0031478_1440_3065 541
752 3300044658 Ga0466972_0000172 Ga0466972_0000172_46707_48332 541
753 3300045976 Ga0466967_0033446 Ga0466967_0033446_1262_2887 541
754 3300045976 Ga0466967_0193005 Ga0466967_0193005_190_1815 541
755 3300046454 Ga0495592_0036667 Ga0495592_0036667_363_1988 541
756 3300046454 Ga0495592_0060346 Ga0495592_0060346_633_2261 541
757 3300046455 Ga0495603_0015187 Ga0495603_0015187_1018_2646 541
758 3300046455 Ga0495603_0034107 Ga0495603_0034107_1194_2819 541
759 3300046459 Ga0495629_0053128 Ga0495629_0053128_867_2492 541
760 3300046460 Ga0495638_0005277 Ga0495638_0005277_2514_4142 541
761 3300046463 Ga0495653_0002374 Ga0495653_0002374_12440_14068 541
762 3300046463 Ga0495653_0036154 Ga0495653_0036154_709_2334 541
763 3300046492 Ga0495585_0024148 Ga0495585_0024148_1832_3460 541
764 3300046507 Ga0495606_0021320 Ga0495606_0021320_1744_3369 541
765 3300046511 Ga0495608_0002876 Ga0495608_0002876_6866_8494 541
766 3300046511 Ga0495608_0039619 Ga0495608_0039619_1391_3016 541
767 3300046514 Ga0495618_0009642 Ga0495618_0009642_3253_4878 541
768 3300046522 Ga0495643_0079997 Ga0495643_0079997_34_1662 541
769 3300046524 Ga0495648_0000936 Ga0495648_0000936_27071_28705 541
770 3300046533 Ga0495640_0038605 Ga0495640_0038605_658_2286 541
771 3300046536 Ga0495587_0004571 Ga0495587_0004571_6902_8530 541
772 3300046559 Ga0495667_0093450 Ga0495667_0093450_184_1809 541
773 3300046660 Ga0495625_0021621 Ga0495625_0021621_1240_2865 541
774 3300046663 Ga0495635_0018594 Ga0495635_0018594_1957_3585 541
775 3300046663 Ga0495635_0041063 Ga0495635_0041063_186_1811 541
776 3300046674 Ga0495588_0002049 Ga0495588_0002049_5379_7004 541
777 3300046679 Ga0495623_0015025 Ga0495623_0015025_826_2451 541
778 3300046680 Ga0495646_0005491 Ga0495646_0005491_210_1838 541
779 3300046680 Ga0495646_0014776 Ga0495646_0014776_1766_3391 541
780 3300046689 Ga0495613_0098186 Ga0495613_0098186_146_1771 541
781 3300046690 Ga0495624_0024480 Ga0495624_0024480_1795_3420 541
782 3300047315 Ga0495581_0074093 Ga0495581_0074093_283_1908 541
783 3300047320 Ga0495672_0042578 Ga0495672_0042578_420_2048 541
784 3300047471 Ga0495684_0039304 Ga0495684_0039304_306_1931 541
785 3300047471 Ga0495684_0082746 Ga0495684_0082746_602_2230 541
786 3300048088 Ga0495602_0009113 Ga0495602_0009113_7029_8654 541
787 3300048906 Ga0496103_0052678 Ga0496103_0052678_573_2198 541
788 3300048907 Ga0496104_0011101 Ga0496104_0011101_5000_6625 541
789 3300048907 Ga0496104_0070856 Ga0496104_0070856_933_2564 541
790 3300048907 Ga0496104_0159382 Ga0496104_0159382_448_2073 541
791 3300048908 Ga0496105_0003099 Ga0496105_0003099_10585_12210 541
792 3300048908 Ga0496105_0127461 Ga0496105_0127461_82_1707 541
793 3300048914 Ga0496111_0039869 Ga0496111_0039869_1350_2975 541
794 3300048915 Ga0496112_0000017 Ga0496112_0000017_136828_138453 541
795 3300048915 Ga0496112_0108292 Ga0496112_0108292_160_1785 541
796 3300048915 Ga0496112_0141386 Ga0496112_0141386_220_1845 541
797 3300048915 Ga0496112_0189591 Ga0496112_0189591_102_1727 541
798 3300048916 Ga0496113_0043185 Ga0496113_0043185_17_1642 541
799 3300048918 Ga0496115_0020774 Ga0496115_0020774_1422_3059 541
800 3300048919 Ga0496116_0003125 Ga0496116_0003125_12976_14604 541
801 3300048919 Ga0496116_0018009 Ga0496116_0018009_975_2600 541
802 3300048920 Ga0496117_0091650 Ga0496117_0091650_19_1692 541
803 3300048922 Ga0496119_0034548 Ga0496119_0034548_1503_3128 541
804 3300048924 Ga0496121_0000230 Ga0496121_0000230_70253_71881 541
805 3300048924 Ga0496121_0004694 Ga0496121_0004694_12591_14219 541
806 3300048924 Ga0496121_0008031 Ga0496121_0008031_10262_11887 541
807 3300048924 Ga0496121_0017764 Ga0496121_0017764_2332_3957 541
808 3300048924 Ga0496121_0048525 Ga0496121_0048525_1917_3542 541
809 3300048924 Ga0496121_0066502 Ga0496121_0066502_774_2402 541
810 3300048925 Ga0496122_0114335 Ga0496122_0114335_65_1693 541
811 3300048928 Ga0496125_0022192 Ga0496125_0022192_116_1744 541
812 3300048928 Ga0496125_0043840 Ga0496125_0043840_1301_2926 541
813 3300048929 Ga0496126_0002483 Ga0496126_0002483_210_1838 541
814 3300048929 Ga0496126_0012513 Ga0496126_0012513_2833_4470 541
815 3300048929 Ga0496126_0022270 Ga0496126_0022270_1165_2790 541
816 3300048929 Ga0496126_0026298 Ga0496126_0026298_1742_3367 541
817 3300048929 Ga0496126_0029779 Ga0496126_0029779_2585_4222 541
818 3300048929 Ga0496126_0048948 Ga0496126_0048948_129_1781 541
819 3300048929 Ga0496126_0054002 Ga0496126_0054002_1452_3077 541
820 3300048929 Ga0496126_0078303 Ga0496126_0078303_450_2090 541
821 3300048929 Ga0496126_0091610 Ga0496126_0091610_979_2604 541
822 3300049568 Ga0501031_0008668 Ga0501031_0008668_1575_3200 541
823 3300049569 Ga0501032_0000769 Ga0501032_0000769_22487_24112 541
824 3300049570 Ga0501033_0000311 Ga0501033_0000311_13799_15424 541
825 3300049571 Ga0501034_0000039 Ga0501034_0000039_220231_221856 541
826 3300049572 Ga0501036_0000127 Ga0501036_0000127_15633_17258 541
827 3300049573 Ga0501037_0000025 Ga0501037_0000025_122800_124425 541
828 3300049574 Ga0501038_0000342 Ga0501038_0000342_36735_38360 541
829 3300049575 Ga0501039_0000840 Ga0501039_0000840_7756_9381 541
830 3300049579 Ga0501043_0000120 Ga0501043_0000120_28603_30228 541
831 3300049580 Ga0501046_0000359 Ga0501046_0000359_15652_17277 541
832 3300049581 Ga0501047_0000379 Ga0501047_0000379_5588_7213 541
833 3300049582 Ga0501048_0000352 Ga0501048_0000352_18779_20404 541
834 3300049583 Ga0501067_0000025 Ga0501067_0000025_14215_15840 541
835 3300049585 Ga0501069_0001694 Ga0501069_0001694_6782_8407 541
836 3300049586 Ga0501070_0002185 Ga0501070_0002185_8432_10057 541
837 3300049588 Ga0501072_0003699 Ga0501072_0003699_2089_3714 541
838 3300049589 Ga0501073_0000091 Ga0501073_0000091_9978_11603 541
839 3300049590 Ga0501074_0000489 Ga0501074_0000489_13918_15543 541
840 3300049741 Ga0501079_0004084 Ga0501079_0004084_1780_3405 541
841 3300049742 Ga0501080_0000321 Ga0501080_0000321_26791_28416 541
842 3300049744 Ga0501083_0000284 Ga0501083_0000284_21197_22822 541
843 3300049822 Ga0501035_0001251 Ga0501035_0001251_20407_22032 541
844 3300049823 Ga0501044_0000274 Ga0501044_0000274_50173_51798 541
845 3300049824 Ga0501045_0040862 Ga0501045_0040862_1094_2719 541
846 3300050494 nmdc:mga06z11_22778_c1 nmdc:mga06z11_22778_c1_225_1856 541
847 3300050496 nmdc:mga07m45_745_c1 nmdc:mga07m45_745_c1_9945_11576 541
848 3300053077 Ga0495601_0021098 Ga0495601_0021098_2300_3928 541
849 3300053077 Ga0495601_0027072 Ga0495601_0027072_256_1881 541
850 3300053080 Ga0500635_0002838 Ga0500635_0002838_58_1686 541
851 3300053084 Ga0495595_0003433 Ga0495595_0003433_1263_2891 541
852 3300053087 Ga0500643_000456 Ga0500643_000456_12402_14027 541
853 3300053094 Ga0500566_0000043 Ga0500566_0000043_58738_60366 541
854 3300053094 Ga0500566_0000370 Ga0500566_0000370_11589_13214 541
855 3300053095 Ga0500640_005288 Ga0500640_005288_929_2557 541
856 3300053096 Ga0500641_0039111 Ga0500641_0039111_236_1861 541
857 3300053098 Ga0500650_0000365 Ga0500650_0000365_4582_6207 541
858 3300053104 Ga0500556_0000468 Ga0500556_0000468_14445_16073 541
859 3300053108 Ga0500562_006967 Ga0500562_006967_45_1673 541
860 3300053111 Ga0500572_000024 Ga0500572_000024_9678_11306 541
861 3300053111 Ga0500572_000704 Ga0500572_000704_8130_9758 541
862 3300053116 Ga0500592_002667 Ga0500592_002667_358_1986 541
863 3300053122 Ga0500608_001300 Ga0500608_001300_7037_8665 541
864 3300053123 Ga0500614_001091 Ga0500614_001091_1935_3563 541
865 3300053130 Ga0500642_0000019 Ga0500642_0000019_138573_140201 541
866 3300053130 Ga0500642_0000252 Ga0500642_0000252_11502_13127 541
867 3300053134 Ga0500658_0017676 Ga0500658_0017676_88_1713 541
868 3300053136 Ga0500559_0001011 Ga0500559_0001011_8803_10428 541
869 3300053136 Ga0500559_0004998 Ga0500559_0004998_370_1995 541
870 3300053136 Ga0500559_0011705 Ga0500559_0011705_1125_2753 541
871 3300053139 Ga0500568_0001665 Ga0500568_0001665_2521_4146 541
872 3300053139 Ga0500568_0027575 Ga0500568_0027575_622_2247 541
873 3300053142 Ga0500577_0011877 Ga0500577_0011877_680_2305 541
874 3300053148 Ga0500590_068324 Ga0500590_068324_48_1673 541
875 3300053150 Ga0500603_000391 Ga0500603_000391_2797_4422 541
876 3300053150 Ga0500603_000801 Ga0500603_000801_70_1698 541
877 3300053151 Ga0500604_0001275 Ga0500604_0001275_3189_4814 541
878 3300053153 Ga0500616_0000041 Ga0500616_0000041_12599_14227 541
879 3300053156 Ga0500622_0002498 Ga0500622_0002498_25_1653 541
880 3300053159 Ga0500630_000112 Ga0500630_000112_12020_13648 541
881 3300053163 Ga0500639_000040 Ga0500639_000040_32843_34471 541
882 3300053177 Ga0500636_0012982 Ga0500636_0012982_1170_2795 541
883 3300053178 Ga0500637_0002167 Ga0500637_0002167_4174_5799 541
884 3300053737 Ga0500601_000203 Ga0500601_000203_3445_5070 541
885 3300054114 Ga0501084_0027916 Ga0501084_0027916_1095_2720 541
886 3300060353 Ga0501082_0007446 Ga0501082_0007446_1136_2761 541
887 iso_pu_bacteria 2513237098 2513679254 541
888 iso_pu_bacteria 2513237101 2513698089 541

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02776

TPP_enzyme_N

Thiamine pyrophosphate enzyme, N-terminal TPP binding domain

4

123

0.97

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

358

503

0.95

PF00205

TPP_enzyme_M

Thiamine pyrophosphate enzyme, central domain

185

311

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qpz-assembly2.cif.gz_F crystal structure of the formolase fls_v2 in space group p 21 0.9227 2 527
4qq8-assembly1.cif.gz_B crystal structure of the formolase fls in space group p 43 21 2 0.9216 2 527
2q28-assembly1.cif.gz_A crystal structure of oxalyl-coa decarboxylase from escherichia coli in complex with adenosine-5`-diphosphate 0.9182 1 531
7b2e-assembly2.cif.gz_D quadruple mutant of oxalyl-coa decarboxylase from methylorubrum extorquens with bound tpp and adp 0.9176 1 531
6lpi-assembly4.cif.gz_D crystal structure of ahas holo-enzyme 0.9174 2 529
ID Description Score Start End Superfamily
af_P0DP89_1_170_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9646 4 175 3.40.50.970
af_P9WG39_1_179_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9573 2 172 3.40.50.970
af_B0G117_40_223_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9542 4 170 3.40.50.970
af_P0DP89_1_170_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9537 4 175 3.40.50.970
af_Q9Y7M1_1_173_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9498 2 173 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A522ZEN2-F1-model_v4 TPP-binding protein 0.977 1 540 GO:0000287
GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660
AF-A0A845DIY8-F1-model_v4 Thiamine pyrophosphate-binding protein 0.9729 387 525 GO:0000287
GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660
AF-A0A530Z970-F1-model_v4 Thiamine pyrophosphate enzyme N-terminal TPP-binding domain-containing protein 0.9665 7 108 GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660
AF-A0A3N5UJ56-F1-model_v4 Thiamine pyrophosphate-binding protein 0.9648 2 172 GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660
AF-A0A7R9H3J0-F1-model_v4 Thiamine pyrophosphate enzyme N-terminal TPP-binding domain-containing protein 0.9647 4 170 GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660

Feature Viewer

pLDDT pTM Quality
96.88 0.95 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map