F484619

General Info

Members Datasets Scaffolds Average Seq Length
884 325 884 311

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100028406|Ga0070680_1000284064
Length 351
Sequence MRTGGRSPRRGVWSIDDGRHAGARAAHPCRTAAEAAMSLLALKIDVDTLRGTREGVPALLDLLRRHQVGATFLFSVGPDHTGRAIKRIFRPGFFSKVRRTSVVHHYGVTTLLYGTALPGPDIGRRAADTMRAVRDEGFETGLHCWDHVKWQDGVAGADADWTARQMRRACERYTEVFKEPPRVHGAAGWQMNVDALRQTQVLGFDYCSDGRGTHPHLPVWNAELIRCPQLPTTLPTLDELIGIGGATADDAAARLLALTAPPETDGPLPSHVFTLHAELEGLRLAPTLELLLNGWKAQGYRLSSLRRLYETFEPMALPRCEVGLDPVPGRSGTLLCQRREFLGDVDLVRAA

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
186 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
211 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
219 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
233 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
234 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
235 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
274 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
282 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
300 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
301 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
305 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
320 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
321 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
322 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
323 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 2.83
Rhizosphere 95.25
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10116233 3300005293 Bacteria 2387
2 Ga0065707_10082407 3300005295 Bacteria 15525
3 Ga0070658_10032537 3300005327 Bacteria 4192
4 Ga0070658_10035028 3300005327 Bacteria 4042
5 Ga0070658_10107589 3300005327 Bacteria 2308
6 Ga0070658_10150425 3300005327 Bacteria 1949
7 Ga0070658_10279917 3300005327 Bacteria 1420
8 Ga0070676_10004721 3300005328 Bacteria 7201
9 Ga0070676_10027813 3300005328 Bacteria 3210
10 Ga0070676_10068314 3300005328 Bacteria 2127
11 Ga0070676_10272219 3300005328 Bacteria 1138
12 Ga0070683_100009335 3300005329 Bacteria 8383
13 Ga0070683_100094423 3300005329 Bacteria 2811
14 Ga0070690_100010995 3300005330 Bacteria 5284
15 Ga0070690_100149440 3300005330 Bacteria 1593
16 Ga0070670_100003022 3300005331 Bacteria 13909
17 Ga0070670_100008816 3300005331 Bacteria 8608
18 Ga0070670_100016066 3300005331 Bacteria 6424
19 Ga0070670_100018840 3300005331 Bacteria 5919
20 Ga0070670_100058387 3300005331 Bacteria 3313
21 Ga0070670_100136518 3300005331 Bacteria 2119
22 Ga0070670_100232640 3300005331 Bacteria 1604
23 Ga0068869_100004739 3300005334 Bacteria 8485
24 Ga0068869_100017352 3300005334 Bacteria 4877
25 Ga0068869_100072865 3300005334 Bacteria 2546
26 Ga0070666_10015504 3300005335 Bacteria 4862
27 Ga0070666_10105763 3300005335 Bacteria 1944
28 Ga0070680_100028406 3300005336 Bacteria 4486
29 Ga0070680_100093295 3300005336 Bacteria 2494
30 Ga0070680_100113380 3300005336 Bacteria 2258
31 Ga0070680_100196864 3300005336 Bacteria 1699
32 Ga0070682_100013039 3300005337 Bacteria 4772
33 Ga0070682_100022407 3300005337 Bacteria 3741
34 Ga0068868_100023464 3300005338 Bacteria 4670
35 Ga0068868_100103782 3300005338 Bacteria 2303
36 Ga0070660_100000724 3300005339 Bacteria 21893
37 Ga0070660_100046204 3300005339 Bacteria 3337
38 Ga0070660_100091271 3300005339 Bacteria 2402
39 Ga0070660_100140313 3300005339 Bacteria 1938
40 Ga0070660_100182922 3300005339 Bacteria 1696
41 Ga0070689_100005389 3300005340 Bacteria 8727
42 Ga0070689_100148884 3300005340 Bacteria 1887
43 Ga0070691_10040216 3300005341 Bacteria 2210
44 Ga0070687_100146759 3300005343 Bacteria 1380
45 Ga0070661_100005119 3300005344 Bacteria 9037
46 Ga0070661_100007598 3300005344 Bacteria 7477
47 Ga0070661_100022620 3300005344 Bacteria 4501
48 Ga0070661_100163491 3300005344 Bacteria 1687
49 Ga0070661_100214918 3300005344 Bacteria 1473
50 Ga0070661_100348177 3300005344 Bacteria 1162
51 Ga0070692_10033452 3300005345 Bacteria 2590
52 Ga0070668_100046878 3300005347 Bacteria 3322
53 Ga0070668_100105961 3300005347 Bacteria 2233
54 Ga0070668_100118729 3300005347 Bacteria 2111
55 Ga0070668_100197707 3300005347 Bacteria 1649
56 Ga0070668_100202278 3300005347 Bacteria 1631
57 Ga0070669_100002694 3300005353 Bacteria 12804
58 Ga0070669_100007605 3300005353 Bacteria 7747
59 Ga0070669_100012251 3300005353 Bacteria 6085
60 Ga0070675_100019261 3300005354 Bacteria 5436
61 Ga0070675_100020262 3300005354 Bacteria 5305
62 Ga0070675_100057957 3300005354 Bacteria 3194
63 Ga0070675_100094290 3300005354 Bacteria 2511
64 Ga0070675_100111503 3300005354 Bacteria 2315
65 Ga0070675_100156214 3300005354 Unclassified 1959
66 Ga0070675_100364342 3300005354 Bacteria 1284
67 Ga0070671_100002660 3300005355 Bacteria 13841
68 Ga0070671_100021571 3300005355 Bacteria 5261
69 Ga0070671_100049314 3300005355 Bacteria 3503
70 Ga0070671_100224776 3300005355 Bacteria 1593
71 Ga0070671_100396199 3300005355 Bacteria 1181
72 Ga0070674_100017868 3300005356 Bacteria 4470
73 Ga0070674_100031410 3300005356 Bacteria 3519
74 Ga0070674_100375787 3300005356 Bacteria 1155
75 Ga0070674_100401020 3300005356 Bacteria 1121
76 Ga0070673_100000781 3300005364 Bacteria 17709
77 Ga0070673_100002674 3300005364 Bacteria 10908
78 Ga0070688_100002928 3300005365 Bacteria 8705
79 Ga0070688_100011341 3300005365 Bacteria 4951
80 Ga0070659_100004500 3300005366 Bacteria 9957
81 Ga0070659_100009887 3300005366 Bacteria 7016
82 Ga0070659_100051079 3300005366 Bacteria 3250
83 Ga0070667_100006019 3300005367 Bacteria 10080
84 Ga0070667_100029920 3300005367 Bacteria 4540
85 Ga0070667_100030235 3300005367 Bacteria 4517
86 Ga0070667_100048324 3300005367 Bacteria 3581
87 Ga0070667_100150958 3300005367 Bacteria 2041
88 Ga0070709_10046145 3300005434 Bacteria 2708
89 Ga0070709_10055690 3300005434 Bacteria 2498
90 Ga0070714_100007199 3300005435 Bacteria 8635
91 Ga0070714_100128714 3300005435 Bacteria 2261
92 Ga0070714_100519007 3300005435 Bacteria 1138
93 Ga0070713_100000182 3300005436 Bacteria 41753
94 Ga0070713_100003229 3300005436 Bacteria 10739
95 Ga0070713_100167543 3300005436 Bacteria 1965
96 Ga0070710_10020640 3300005437 Bacteria 3421
97 Ga0070701_10031766 3300005438 Bacteria 2622
98 Ga0070701_10057766 3300005438 Bacteria 2035
99 Ga0070711_100057321 3300005439 Bacteria 2697
100 Ga0070711_100259675 3300005439 Bacteria 1366
101 Ga0070711_100292887 3300005439 Bacteria 1291
102 Ga0070705_100009362 3300005440 Bacteria 4868
103 Ga0070705_100143361 3300005440 Bacteria 1575
104 Ga0070700_100205572 3300005441 Bacteria 1386
105 Ga0070694_100037288 3300005444 Bacteria 3224
106 Ga0070708_100000207 3300005445 Bacteria 43511
107 Ga0070708_100013833 3300005445 Bacteria 6624
108 Ga0070708_100157507 3300005445 Bacteria 2115
109 Ga0070663_100004359 3300005455 Bacteria 8301
110 Ga0070663_100085310 3300005455 Bacteria 2330
111 Ga0070663_100179948 3300005455 Bacteria 1639
112 Ga0070663_100215697 3300005455 Bacteria 1505
113 Ga0070678_100015662 3300005456 Bacteria 4827
114 Ga0070678_100042143 3300005456 Bacteria 3242
115 Ga0070678_100073926 3300005456 Bacteria 2560
116 Ga0070662_100001938 3300005457 Bacteria 12719
117 Ga0070662_100105418 3300005457 Bacteria 2140
118 Ga0070681_10029133 3300005458 Bacteria 5543
119 Ga0070681_10032263 3300005458 Bacteria 5256
120 Ga0070681_10039473 3300005458 Bacteria 4732
121 Ga0070681_10162783 3300005458 Bacteria 2155
122 Ga0070681_10187022 3300005458 Bacteria 1991
123 Ga0068867_100001219 3300005459 Bacteria 17696
124 Ga0068867_100017647 3300005459 Bacteria 5068
125 Ga0068867_100032888 3300005459 Bacteria 3752
126 Ga0068867_100069617 3300005459 Bacteria 2628
127 Ga0068867_100071110 3300005459 Bacteria 2602
128 Ga0068867_100092869 3300005459 Bacteria 2292
129 Ga0070685_10023375 3300005466 Bacteria 3384
130 Ga0070685_10033508 3300005466 Bacteria 2886
131 Ga0070685_10124569 3300005466 Bacteria 1604
132 Ga0070706_100012233 3300005467 Bacteria 7954
133 Ga0070706_100014759 3300005467 Bacteria 7217
134 Ga0070706_100021479 3300005467 Bacteria 5944
135 Ga0070706_100089454 3300005467 Bacteria 2855
136 Ga0070706_100303711 3300005467 Bacteria 1489
137 Ga0070706_100445499 3300005467 Bacteria 1205
138 Ga0070707_100053719 3300005468 Bacteria 3863
139 Ga0070707_100228470 3300005468 Bacteria 1812
140 Ga0070698_100160694 3300005471 Bacteria 2190
141 Ga0070699_100016446 3300005518 Bacteria 6353
142 Ga0070699_100065339 3300005518 Bacteria 3157
143 Ga0070679_100009410 3300005530 Bacteria 9241
144 Ga0070679_100017521 3300005530 Bacteria 6933
145 Ga0070679_100027131 3300005530 Bacteria 5633
146 Ga0070679_100095712 3300005530 Bacteria 2957
147 Ga0070679_100171380 3300005530 Bacteria 2143
148 Ga0070679_100442781 3300005530 Bacteria 1244
149 Ga0070684_100004038 3300005535 Bacteria 11107
150 Ga0070684_100008621 3300005535 Bacteria 7985
151 Ga0070684_100077446 3300005535 Bacteria 2937
152 Ga0070697_100030789 3300005536 Bacteria 4312
153 Ga0070697_100137959 3300005536 Bacteria 2049
154 Ga0068853_100006566 3300005539 Bacteria 9266
155 Ga0068853_100017260 3300005539 Bacteria 5957
156 Ga0068853_100051686 3300005539 Bacteria 3538
157 Ga0068853_100300166 3300005539 Bacteria 1484
158 Ga0068853_100385458 3300005539 Bacteria 1309
159 Ga0068853_100410378 3300005539 Bacteria 1269
160 Ga0068853_100482296 3300005539 Bacteria 1169
161 Ga0070672_100003013 3300005543 Bacteria 10851
162 Ga0070672_100008331 3300005543 Bacteria 7084
163 Ga0070672_100128537 3300005543 Bacteria 2080
164 Ga0070672_100267940 3300005543 Bacteria 1441
165 Ga0070686_100109860 3300005544 Bacteria 1877
166 Ga0070695_100125609 3300005545 Bacteria 1761
167 Ga0070695_100184426 3300005545 Bacteria 1481
168 Ga0070695_100292465 3300005545 Bacteria 1201
169 Ga0070696_100016471 3300005546 Bacteria 4978
170 Ga0070696_100057085 3300005546 Bacteria 2724
171 Ga0070696_100065250 3300005546 Bacteria 2552
172 Ga0070696_100096392 3300005546 Bacteria 2114
173 Ga0070693_100000167 3300005547 Bacteria 30641
174 Ga0070693_100021456 3300005547 Bacteria 3422
175 Ga0070665_100086087 3300005548 Bacteria 3149
176 Ga0070665_100100363 3300005548 Bacteria 2898
177 Ga0070665_100164869 3300005548 Unclassified 2218
178 Ga0070665_100168298 3300005548 Bacteria 2193
179 Ga0070704_100211460 3300005549 Bacteria 1572
180 Ga0070704_100252825 3300005549 Bacteria 1448
181 Ga0068855_100001160 3300005563 Bacteria 32655
182 Ga0068855_100012552 3300005563 Bacteria 10226
183 Ga0068855_100081055 3300005563 Bacteria 3762
184 Ga0068855_100114999 3300005563 Bacteria 3084
185 Ga0068855_100178555 3300005563 Bacteria 2401
186 Ga0068855_100231263 3300005563 Bacteria 2070
187 Ga0068855_100285350 3300005563 Bacteria 1832
188 Ga0068855_100390756 3300005563 Bacteria 1526
189 Ga0070664_100000955 3300005564 Bacteria 22600
190 Ga0070664_100001452 3300005564 Bacteria 18888
191 Ga0070664_100039893 3300005564 Bacteria 3958
192 Ga0070664_100044446 3300005564 Bacteria 3750
193 Ga0070664_100245147 3300005564 Bacteria 1609
194 Ga0068857_100001623 3300005577 Bacteria 18065
195 Ga0068857_100001739 3300005577 Bacteria 17512
196 Ga0068857_100230592 3300005577 Bacteria 1693
197 Ga0068854_100002132 3300005578 Bacteria 12146
198 Ga0068854_100002439 3300005578 Bacteria 11499
199 Ga0068854_100047083 3300005578 Bacteria 3072
200 Ga0068854_100089368 3300005578 Bacteria 2289
201 Ga0068854_100106183 3300005578 Bacteria 2112
202 Ga0068856_100001343 3300005614 Bacteria 25881
203 Ga0068856_100006138 3300005614 Bacteria 11793
204 Ga0068856_100020687 3300005614 Bacteria 6392
205 Ga0068856_100213730 3300005614 Bacteria 1944
206 Ga0068856_100456762 3300005614 Bacteria 1298
207 Ga0070702_100055567 3300005615 Bacteria 2283
208 Ga0070702_100082392 3300005615 Bacteria 1930
209 Ga0068852_100001471 3300005616 Bacteria 15936
210 Ga0068852_100015543 3300005616 Bacteria 5908
211 Ga0068852_100039410 3300005616 Bacteria 3977
212 Ga0068852_100074021 3300005616 Bacteria 2998
213 Ga0068852_100307024 3300005616 Bacteria 1537
214 Ga0068859_100001484 3300005617 Bacteria 23877
215 Ga0068859_100005749 3300005617 Bacteria 12613
216 Ga0068859_100009886 3300005617 Bacteria 9634
217 Ga0068859_100171956 3300005617 Bacteria 2248
218 Ga0068859_100273439 3300005617 Bacteria 1782
219 Ga0068859_100296865 3300005617 Bacteria 1709
220 Ga0068859_100382569 3300005617 Bacteria 1503
221 Ga0068864_100000938 3300005618 Bacteria 24407
222 Ga0068864_100002372 3300005618 Bacteria 15584
223 Ga0068864_100009418 3300005618 Bacteria 8058
224 Ga0068864_100012050 3300005618 Bacteria 7141
225 Ga0068864_100057543 3300005618 Bacteria 3359
226 Ga0068864_100080267 3300005618 Bacteria 2858
227 Ga0068864_100288362 3300005618 Bacteria 1534
228 Ga0068866_10004687 3300005718 Bacteria 5612
229 Ga0068866_10008728 3300005718 Bacteria 4284
230 Ga0068861_100000187 3300005719 Bacteria 33035
231 Ga0068861_100032868 3300005719 Bacteria 3823
232 Ga0068861_100033322 3300005719 Bacteria 3799
233 Ga0068861_100084993 3300005719 Bacteria 2485
234 Ga0068861_100119890 3300005719 Bacteria 2120
235 Ga0068861_100218927 3300005719 Bacteria 1608
236 Ga0068861_100285235 3300005719 Bacteria 1423
237 Ga0068861_100387977 3300005719 Bacteria 1236
238 Ga0068851_10000960 3300005834 Bacteria 12483
239 Ga0068851_10085303 3300005834 Bacteria 1655
240 Ga0068870_10002579 3300005840 Bacteria 7580
241 Ga0068870_10036417 3300005840 Bacteria 2532
242 Ga0068863_100001021 3300005841 Bacteria 28037
243 Ga0068863_100006037 3300005841 Bacteria 11882
244 Ga0068863_100017026 3300005841 Bacteria 6971
245 Ga0068863_100067668 3300005841 Bacteria 3378
246 Ga0068863_100089366 3300005841 Bacteria 2921
247 Ga0068863_100105364 3300005841 Bacteria 2682
248 Ga0068863_100187956 3300005841 Bacteria 1985
249 Ga0068858_100018888 3300005842 Bacteria 6450
250 Ga0068858_100037266 3300005842 Bacteria 4509
251 Ga0068858_100059857 3300005842 Bacteria 3520
252 Ga0068860_100002049 3300005843 Bacteria 21245
253 Ga0068860_100011724 3300005843 Bacteria 8639
254 Ga0068860_100015024 3300005843 Bacteria 7566
255 Ga0068860_100037387 3300005843 Bacteria 4648
256 Ga0068860_100053521 3300005843 Bacteria 3838
257 Ga0068860_100080420 3300005843 Bacteria 3099
258 Ga0068860_100490388 3300005843 Unclassified 1225
259 Ga0068862_100005987 3300005844 Bacteria 10125
260 Ga0068862_100032015 3300005844 Bacteria 4442
261 Ga0068862_100061523 3300005844 Bacteria 3228
262 Ga0068862_100133897 3300005844 Bacteria 2195
263 Ga0068862_100190539 3300005844 Bacteria 1845
264 Ga0081539_10016545 3300005985 Bacteria 5254
265 Ga0070712_100057002 3300006175 Bacteria 2742
266 Ga0097621_100000972 3300006237 Bacteria 20078
267 Ga0097621_100059498 3300006237 Bacteria 3128
268 Ga0097621_100185151 3300006237 Bacteria 1801
269 Ga0068871_100004641 3300006358 Bacteria 9598
270 Ga0068871_100025386 3300006358 Bacteria 4610
271 Ga0068871_100026390 3300006358 Bacteria 4533
272 Ga0068871_100038217 3300006358 Bacteria 3832
273 Ga0075428_100392606 3300006844 Bacteria 1487
274 Ga0075433_10089796 3300006852 Bacteria 2716
275 Ga0075433_10279420 3300006852 Bacteria 1479
276 Ga0075433_10417054 3300006852 Bacteria 1184
277 Ga0075434_100007305 3300006871 Bacteria 10224
278 Ga0075434_100037226 3300006871 Bacteria 4817
279 Ga0075434_100099450 3300006871 Bacteria 2914
280 Ga0075434_100102280 3300006871 Bacteria 2873
281 Ga0075434_100132442 3300006871 Bacteria 2513
282 Ga0075434_100166946 3300006871 Bacteria 2221
283 Ga0068865_100003642 3300006881 Bacteria 9258
284 Ga0068865_100129330 3300006881 Bacteria 1890
285 Ga0068865_100184963 3300006881 Bacteria 1607
286 Ga0068865_100195936 3300006881 Bacteria 1566
287 Ga0075436_100029805 3300006914 Bacteria 3753
288 Ga0075436_100063727 3300006914 Bacteria 2547
289 Ga0075436_100089270 3300006914 Bacteria 2142
290 Ga0075436_100202891 3300006914 Bacteria 1405
291 Ga0075436_100251542 3300006914 Bacteria 1258
292 Ga0097620_100001484 3300006931 Bacteria 23877
293 Ga0097620_100005749 3300006931 Bacteria 12613
294 Ga0097620_100009886 3300006931 Bacteria 9634
295 Ga0097620_100171954 3300006931 Bacteria 2248
296 Ga0097620_100273455 3300006931 Bacteria 1782
297 Ga0097620_100296861 3300006931 Bacteria 1709
298 Ga0097620_100382578 3300006931 Bacteria 1503
299 Ga0075435_100017481 3300007076 Bacteria 5431
300 Ga0075435_100104729 3300007076 Bacteria 2347
301 Ga0075435_100136381 3300007076 Bacteria 2056
302 Ga0075435_100146547 3300007076 Bacteria 1983
303 Ga0075435_100147197 3300007076 Bacteria 1978
304 Ga0105240_10002731 3300009093 Bacteria 27994
305 Ga0105240_10044396 3300009093 Bacteria 5647
306 Ga0105240_10118858 3300009093 Bacteria 3185
307 Ga0105240_10137030 3300009093 Bacteria 2931
308 Ga0105240_10149417 3300009093 Bacteria 2784
309 Ga0105240_10155105 3300009093 Bacteria 2724
310 Ga0105240_10438741 3300009093 Bacteria 1464
311 Ga0105245_10012549 3300009098 Bacteria 7374
312 Ga0105245_10097497 3300009098 Bacteria 2715
313 Ga0105245_10110179 3300009098 Bacteria 2559
314 Ga0105245_10144969 3300009098 Bacteria 2240
315 Ga0105245_10158716 3300009098 Bacteria 2144
316 Ga0105245_10179197 3300009098 Bacteria 2023
317 Ga0105247_10012360 3300009101 Bacteria 5127
318 Ga0114129_10134553 3300009147 Bacteria 3392
319 Ga0114129_11054854 3300009147 Bacteria 1020
320 Ga0105243_10140005 3300009148 Bacteria 2063
321 Ga0105241_10074841 3300009174 Bacteria 2638
322 Ga0105241_10157905 3300009174 Bacteria 1861
323 Ga0105242_10000164 3300009176 Bacteria 49988
324 Ga0105242_10058443 3300009176 Bacteria 3161
325 Ga0105242_10059563 3300009176 Bacteria 3133
326 Ga0105242_10148976 3300009176 Bacteria 2039
327 Ga0105242_10585788 3300009176 Bacteria 1075
328 Ga0105248_10010030 3300009177 Bacteria 10430
329 Ga0105248_10051808 3300009177 Bacteria 4605
330 Ga0105248_10174036 3300009177 Bacteria 2427
331 Ga0105248_10187291 3300009177 Bacteria 2332
332 Ga0105248_10472094 3300009177 Bacteria 1414
333 Ga0105237_10000784 3300009545 Bacteria 43457
334 Ga0105237_10094826 3300009545 Bacteria 2973
335 Ga0105237_10132236 3300009545 Bacteria 2489
336 Ga0105238_10005552 3300009551 Bacteria 12457
337 Ga0105238_10007592 3300009551 Bacteria 10864
338 Ga0105238_10052151 3300009551 Bacteria 4113
339 Ga0105238_10098449 3300009551 Bacteria 2908
340 Ga0105238_10160067 3300009551 Bacteria 2227
341 Ga0105249_10021927 3300009553 Bacteria 5721
342 Ga0105249_10241456 3300009553 Bacteria 1786
343 Ga0105239_10001759 3300010375 Bacteria 28533
344 Ga0105239_10085915 3300010375 Bacteria 3468
345 Ga0105239_10105346 3300010375 Bacteria 3123
346 Ga0157373_10000447 3300013100 Bacteria 32642
347 Ga0157373_10002952 3300013100 Bacteria 12886
348 Ga0157373_10043899 3300013100 Bacteria 3192
349 Ga0157371_10001482 3300013102 Bacteria 24271
350 Ga0157370_10003331 3300013104 Bacteria 18930
351 Ga0157370_10008356 3300013104 Bacteria 11165
352 Ga0157370_10022125 3300013104 Bacteria 6328
353 Ga0157370_10026443 3300013104 Bacteria 5730
354 Ga0157370_10070211 3300013104 Bacteria 3307
355 Ga0157370_10093375 3300013104 Bacteria 2824
356 Ga0157370_10154989 3300013104 Bacteria 2131
357 Ga0157369_10000733 3300013105 Bacteria 42321
358 Ga0157369_10014458 3300013105 Bacteria 8911
359 Ga0157369_10046834 3300013105 Bacteria 4698
360 Ga0157369_10073010 3300013105 Bacteria 3681
361 Ga0157369_10210252 3300013105 Bacteria 2039
362 Ga0157369_10477747 3300013105 Bacteria 1290
363 Ga0157374_10000770 3300013296 Bacteria 28021
364 Ga0157374_10021298 3300013296 Bacteria 5766
365 Ga0157374_10324897 3300013296 Bacteria 1525
366 Ga0157378_10008577 3300013297 Bacteria 8897
367 Ga0157378_10022887 3300013297 Bacteria 5500
368 Ga0157378_10023714 3300013297 Bacteria 5398
369 Ga0157378_10136278 3300013297 Bacteria 2276
370 Ga0157378_10143373 3300013297 Bacteria 2220
371 Ga0163162_10002232 3300013306 Bacteria 18196
372 Ga0163162_10011501 3300013306 Bacteria 8631
373 Ga0163162_10048032 3300013306 Bacteria 4276
374 Ga0163162_10113072 3300013306 Bacteria 2813
375 Ga0163162_10170868 3300013306 Bacteria 2299
376 Ga0157372_10001652 3300013307 Bacteria 24215
377 Ga0157372_10004508 3300013307 Bacteria 14858
378 Ga0157372_10008051 3300013307 Bacteria 11210
379 Ga0157372_10090554 3300013307 Bacteria 3478
380 Ga0157372_10114167 3300013307 Bacteria 3096
381 Ga0157372_10251019 3300013307 Bacteria 2053
382 Ga0157372_10358940 3300013307 Bacteria 1698
383 Ga0157375_10002885 3300013308 Bacteria 14912
384 Ga0157375_10007037 3300013308 Bacteria 9826
385 Ga0157375_10009095 3300013308 Bacteria 8701
386 Ga0157375_10127714 3300013308 Bacteria 2659
387 Ga0157375_10200422 3300013308 Bacteria 2152
388 Ga0157375_10250873 3300013308 Bacteria 1930
389 Ga0163163_10006684 3300014325 Bacteria 10104
390 Ga0163163_10014090 3300014325 Bacteria 7341
391 Ga0163163_10154655 3300014325 Bacteria 2337
392 Ga0163163_10281184 3300014325 Bacteria 1715
393 Ga0157380_10003032 3300014326 Bacteria 11438
394 Ga0157380_10065644 3300014326 Bacteria 2917
395 Ga0157380_10096019 3300014326 Bacteria 2457
396 Ga0157380_10344040 3300014326 Bacteria 1392
397 Ga0182008_10090446 3300014497 Bacteria 1509
398 Ga0157377_10014176 3300014745 Bacteria 4051
399 Ga0157379_10001106 3300014968 Bacteria 22048
400 Ga0157379_10002047 3300014968 Bacteria 16745
401 Ga0157379_10004185 3300014968 Bacteria 12322
402 Ga0157379_10040901 3300014968 Bacteria 4138
403 Ga0157379_10053702 3300014968 Bacteria 3600
404 Ga0157379_10125381 3300014968 Bacteria 2311
405 Ga0157379_10237701 3300014968 Bacteria 1652
406 Ga0157376_10010457 3300014969 Bacteria 6788
407 Ga0157376_10122392 3300014969 Bacteria 2308
408 Ga0163161_10012234 3300017792 Bacteria 5953
409 Ga0163161_10022874 3300017792 Bacteria 4403
410 Ga0163161_10040274 3300017792 Bacteria 3356
411 Ga0206353_11406765 3300020082 Bacteria 1212
412 Ga0213876_10050192 3300021384 Bacteria 2204
413 Ga0213876_10138151 3300021384 Bacteria 1296
414 Ga0213876_10186792 3300021384 Bacteria 1102
415 Ga0213871_10008652 3300021441 Bacteria 2255
416 Ga0207697_10009495 3300025315 Bacteria 4200
417 Ga0207697_10012374 3300025315 Bacteria 3578
418 Ga0207697_10028498 3300025315 Bacteria 2284
419 Ga0207656_10011621 3300025321 Bacteria 3332
420 Ga0207653_10051330 3300025885 Bacteria 1373
421 Ga0207682_10022780 3300025893 Bacteria 2470
422 Ga0207692_10016570 3300025898 Bacteria 3268
423 Ga0207642_10002368 3300025899 Bacteria 5867
424 Ga0207642_10019622 3300025899 Bacteria 2621
425 Ga0207680_10128919 3300025903 Bacteria 1665
426 Ga0207685_10005968 3300025905 Bacteria 3270
427 Ga0207699_10212859 3300025906 Bacteria 1315
428 Ga0207645_10001058 3300025907 Bacteria 22793
429 Ga0207705_10017704 3300025909 Bacteria 5097
430 Ga0207705_10073050 3300025909 Bacteria 2488
431 Ga0207705_10093645 3300025909 Bacteria 2203
432 Ga0207705_10136169 3300025909 Bacteria 1831
433 Ga0207705_10155202 3300025909 Bacteria 1717
434 Ga0207684_10027046 3300025910 Bacteria 4892
435 Ga0207684_10120923 3300025910 Bacteria 2245
436 Ga0207684_10272337 3300025910 Bacteria 1461
437 Ga0207684_10289887 3300025910 Bacteria 1411
438 Ga0207684_10321317 3300025910 Bacteria 1334
439 Ga0207654_10013552 3300025911 Bacteria 4195
440 Ga0207707_10002855 3300025912 Bacteria 15431
441 Ga0207707_10008732 3300025912 Bacteria 8793
442 Ga0207707_10059921 3300025912 Bacteria 3312
443 Ga0207695_10007386 3300025913 Bacteria 14020
444 Ga0207695_10012077 3300025913 Bacteria 10382
445 Ga0207695_10025748 3300025913 Bacteria 6578
446 Ga0207695_10107882 3300025913 Bacteria 2769
447 Ga0207695_10479509 3300025913 Bacteria 1126
448 Ga0207671_10009892 3300025914 Bacteria 7927
449 Ga0207693_10002176 3300025915 Bacteria 17081
450 Ga0207693_10012772 3300025915 Bacteria 6777
451 Ga0207660_10016190 3300025917 Bacteria 4932
452 Ga0207660_10095663 3300025917 Bacteria 2210
453 Ga0207662_10055572 3300025918 Bacteria 2363
454 Ga0207662_10112600 3300025918 Bacteria 1698
455 Ga0207657_10000371 3300025919 Bacteria 47425
456 Ga0207657_10002834 3300025919 Bacteria 18618
457 Ga0207657_10016447 3300025919 Bacteria 7135
458 Ga0207657_10021571 3300025919 Bacteria 6057
459 Ga0207657_10046523 3300025919 Bacteria 3799
460 Ga0207649_10006699 3300025920 Bacteria 6260
461 Ga0207649_10018879 3300025920 Bacteria 3932
462 Ga0207649_10031690 3300025920 Bacteria 3145
463 Ga0207649_10073901 3300025920 Bacteria 2186
464 Ga0207652_10007499 3300025921 Bacteria 8784
465 Ga0207652_10019068 3300025921 Bacteria 5635
466 Ga0207652_10027029 3300025921 Bacteria 4781
467 Ga0207652_10032211 3300025921 Bacteria 4404
468 Ga0207652_10062293 3300025921 Bacteria 3223
469 Ga0207652_10101618 3300025921 Bacteria 2540
470 Ga0207652_10468517 3300025921 Bacteria 1135
471 Ga0207681_10003039 3300025923 Bacteria 10548
472 Ga0207681_10007075 3300025923 Bacteria 6881
473 Ga0207681_10059152 3300025923 Bacteria 2626
474 Ga0207694_10007179 3300025924 Bacteria 8458
475 Ga0207694_10015526 3300025924 Bacteria 5742
476 Ga0207694_10028502 3300025924 Bacteria 4258
477 Ga0207694_10147422 3300025924 Bacteria 1895
478 Ga0207694_10234747 3300025924 Bacteria 1498
479 Ga0207650_10005168 3300025925 Bacteria 8905
480 Ga0207650_10025039 3300025925 Bacteria 4249
481 Ga0207650_10050810 3300025925 Bacteria 3067
482 Ga0207650_10078797 3300025925 Bacteria 2493
483 Ga0207650_10086907 3300025925 Bacteria 2381
484 Ga0207650_10117475 3300025925 Bacteria 2067
485 Ga0207650_10134836 3300025925 Bacteria 1936
486 Ga0207650_10135378 3300025925 Bacteria 1932
487 Ga0207650_10348937 3300025925 Bacteria 1217
488 Ga0207659_10002989 3300025926 Bacteria 10076
489 Ga0207659_10039362 3300025926 Bacteria 3297
490 Ga0207659_10042751 3300025926 Bacteria 3179
491 Ga0207659_10087319 3300025926 Bacteria 2321
492 Ga0207659_10312555 3300025926 Bacteria 1294
493 Ga0207687_10001668 3300025927 Bacteria 15313
494 Ga0207687_10022739 3300025927 Bacteria 4175
495 Ga0207687_10079934 3300025927 Bacteria 2358
496 Ga0207687_10137867 3300025927 Bacteria 1847
497 Ga0207700_10000031 3300025928 Bacteria 130086
498 Ga0207700_10004520 3300025928 Bacteria 8216
499 Ga0207700_10347522 3300025928 Bacteria 1291
500 Ga0207664_10001654 3300025929 Bacteria 14676
501 Ga0207664_10014392 3300025929 Bacteria 5712
502 Ga0207644_10005084 3300025931 Bacteria 8591
503 Ga0207644_10014130 3300025931 Bacteria 5341
504 Ga0207644_10018467 3300025931 Bacteria 4718
505 Ga0207644_10034668 3300025931 Bacteria 3533
506 Ga0207644_10163062 3300025931 Bacteria 1734
507 Ga0207644_10172667 3300025931 Bacteria 1689
508 Ga0207644_10203741 3300025931 Bacteria 1561
509 Ga0207690_10004056 3300025932 Bacteria 8653
510 Ga0207690_10013641 3300025932 Bacteria 4887
511 Ga0207706_10003193 3300025933 Bacteria 15731
512 Ga0207706_10079309 3300025933 Bacteria 2887
513 Ga0207706_10111896 3300025933 Bacteria 2402
514 Ga0207706_10112050 3300025933 Bacteria 2400
515 Ga0207686_10000198 3300025934 Bacteria 46402
516 Ga0207686_10004958 3300025934 Bacteria 7163
517 Ga0207686_10119143 3300025934 Bacteria 1794
518 Ga0207709_10048377 3300025935 Bacteria 2591
519 Ga0207709_10098015 3300025935 Bacteria 1932
520 Ga0207670_10053128 3300025936 Bacteria 2728
521 Ga0207670_10069615 3300025936 Bacteria 2428
522 Ga0207669_10013482 3300025937 Bacteria 4061
523 Ga0207669_10311747 3300025937 Bacteria 1200
524 Ga0207704_10009976 3300025938 Bacteria 4610
525 Ga0207704_10080526 3300025938 Bacteria 2103
526 Ga0207704_10216624 3300025938 Bacteria 1413
527 Ga0207665_10014015 3300025939 Bacteria 5274
528 Ga0207665_10043053 3300025939 Bacteria 3018
529 Ga0207691_10000041 3300025940 Bacteria 106275
530 Ga0207691_10003579 3300025940 Bacteria 15124
531 Ga0207691_10004159 3300025940 Bacteria 14058
532 Ga0207691_10009490 3300025940 Bacteria 9343
533 Ga0207691_10129154 3300025940 Bacteria 2234
534 Ga0207691_10176499 3300025940 Bacteria 1868
535 Ga0207691_10223429 3300025940 Bacteria 1632
536 Ga0207711_10003428 3300025941 Bacteria 13714
537 Ga0207711_10124989 3300025941 Bacteria 2300
538 Ga0207711_10141164 3300025941 Bacteria 2167
539 Ga0207711_10342706 3300025941 Bacteria 1383
540 Ga0207689_10005585 3300025942 Bacteria 11211
541 Ga0207689_10027083 3300025942 Bacteria 4799
542 Ga0207689_10040648 3300025942 Bacteria 3848
543 Ga0207689_10055328 3300025942 Bacteria 3266
544 Ga0207661_10007655 3300025944 Bacteria 7684
545 Ga0207661_10040053 3300025944 Bacteria 3681
546 Ga0207661_10342499 3300025944 Bacteria 1347
547 Ga0207679_10001683 3300025945 Bacteria 13764
548 Ga0207679_10015724 3300025945 Bacteria 5009
549 Ga0207679_10115313 3300025945 Bacteria 2128
550 Ga0207679_10277827 3300025945 Bacteria 1435
551 Ga0207667_10003619 3300025949 Bacteria 19070
552 Ga0207667_10009435 3300025949 Bacteria 11491
553 Ga0207667_10014732 3300025949 Bacteria 8898
554 Ga0207667_10045468 3300025949 Bacteria 4650
555 Ga0207667_10195073 3300025949 Bacteria 2078
556 Ga0207667_10221978 3300025949 Bacteria 1936
557 Ga0207667_10345781 3300025949 Bacteria 1517
558 Ga0207651_10001393 3300025960 Bacteria 10955
559 Ga0207651_10028614 3300025960 Bacteria 3518
560 Ga0207668_10001997 3300025972 Bacteria 11916
561 Ga0207668_10009587 3300025972 Bacteria 5812
562 Ga0207668_10037112 3300025972 Bacteria 3259
563 Ga0207668_10043006 3300025972 Bacteria 3062
564 Ga0207668_10150037 3300025972 Bacteria 1803
565 Ga0207640_10055900 3300025981 Bacteria 2588
566 Ga0207658_10002334 3300025986 Bacteria 13938
567 Ga0207658_10006384 3300025986 Bacteria 8050
568 Ga0207658_10051451 3300025986 Bacteria 3036
569 Ga0207658_10061091 3300025986 Bacteria 2814
570 Ga0207658_10132864 3300025986 Bacteria 2002
571 Ga0207658_10245612 3300025986 Bacteria 1519
572 Ga0207677_10000799 3300026023 Bacteria 18068
573 Ga0207677_10011028 3300026023 Bacteria 5135
574 Ga0207677_10109751 3300026023 Bacteria 2052
575 Ga0207677_10149734 3300026023 Bacteria 1798
576 Ga0207677_10194732 3300026023 Bacteria 1606
577 Ga0207703_10000143 3300026035 Bacteria 84508
578 Ga0207703_10009453 3300026035 Bacteria 7655
579 Ga0207703_10092928 3300026035 Bacteria 2540
580 Ga0207703_10109175 3300026035 Bacteria 2357
581 Ga0207703_10125813 3300026035 Bacteria 2206
582 Ga0207639_10024584 3300026041 Bacteria 4362
583 Ga0207639_10118313 3300026041 Bacteria 2173
584 Ga0207639_10178421 3300026041 Bacteria 1805
585 Ga0207639_10394692 3300026041 Bacteria 1245
586 Ga0207678_10003847 3300026067 Bacteria 13501
587 Ga0207678_10034156 3300026067 Bacteria 4430
588 Ga0207702_10003083 3300026078 Bacteria 15461
589 Ga0207702_10006720 3300026078 Bacteria 9883
590 Ga0207702_10021819 3300026078 Bacteria 5302
591 Ga0207702_10303351 3300026078 Bacteria 1516
592 Ga0207641_10007742 3300026088 Bacteria 8928
593 Ga0207641_10008173 3300026088 Bacteria 8657
594 Ga0207641_10009450 3300026088 Bacteria 8034
595 Ga0207641_10023159 3300026088 Bacteria 5117
596 Ga0207641_10119853 3300026088 Bacteria 2346
597 Ga0207641_10204402 3300026088 Bacteria 1823
598 Ga0207641_10232239 3300026088 Bacteria 1715
599 Ga0207641_10263971 3300026088 Bacteria 1613
600 Ga0207648_10000601 3300026089 Bacteria 40481
601 Ga0207648_10002730 3300026089 Bacteria 18749
602 Ga0207648_10010928 3300026089 Bacteria 8579
603 Ga0207648_10050141 3300026089 Bacteria 3650
604 Ga0207648_10055564 3300026089 Bacteria 3456
605 Ga0207648_10065770 3300026089 Bacteria 3161
606 Ga0207648_10098558 3300026089 Bacteria 2559
607 Ga0207648_10143825 3300026089 Bacteria 2103
608 Ga0207676_10000837 3300026095 Bacteria 23871
609 Ga0207676_10003209 3300026095 Bacteria 11650
610 Ga0207676_10004178 3300026095 Bacteria 10207
611 Ga0207676_10211577 3300026095 Bacteria 1720
612 Ga0207676_10406325 3300026095 Bacteria 1274
613 Ga0207674_10000049 3300026116 Bacteria 118784
614 Ga0207674_10001272 3300026116 Bacteria 32948
615 Ga0207674_10003466 3300026116 Bacteria 19294
616 Ga0207674_10022069 3300026116 Bacteria 6844
617 Ga0207674_10101320 3300026116 Bacteria 2861
618 Ga0207675_100000517 3300026118 Bacteria 37526
619 Ga0207675_100011791 3300026118 Bacteria 8171
620 Ga0207675_100016774 3300026118 Bacteria 6841
621 Ga0207675_100017152 3300026118 Bacteria 6762
622 Ga0207675_100096111 3300026118 Bacteria 2789
623 Ga0207675_100100218 3300026118 Bacteria 2728
624 Ga0207675_100236629 3300026118 Bacteria 1763
625 Ga0207683_10000011 3300026121 Bacteria 140261
626 Ga0207683_10009881 3300026121 Bacteria 8137
627 Ga0207683_10022316 3300026121 Bacteria 5432
628 Ga0207683_10060834 3300026121 Bacteria 3321
629 Ga0207683_10199082 3300026121 Bacteria 1820
630 Ga0207683_10302087 3300026121 Bacteria 1464
631 Ga0207698_10008826 3300026142 Bacteria 6389
632 Ga0207698_10010183 3300026142 Bacteria 6026
633 Ga0207698_10040284 3300026142 Bacteria 3469
634 Ga0207698_10049530 3300026142 Bacteria 3198
635 Ga0207698_10071607 3300026142 Bacteria 2751
636 Ga0209983_1015175 3300027665 Bacteria 1588
637 Ga0209971_1005384 3300027682 Bacteria 3043
638 Ga0268266_10032521 3300028379 Bacteria 4431
639 Ga0268266_10060826 3300028379 Bacteria 3256
640 Ga0268266_10096595 3300028379 Unclassified 2597
641 Ga0268266_10133826 3300028379 Bacteria 2219
642 Ga0268266_10171313 3300028379 Bacteria 1970
643 Ga0268266_10175235 3300028379 Bacteria 1949
644 Ga0268265_10015632 3300028380 Bacteria 5197
645 Ga0268265_10019444 3300028380 Bacteria 4721
646 Ga0268265_10131196 3300028380 Bacteria 2082
647 Ga0268265_10157048 3300028380 Bacteria 1926
648 Ga0268265_10410493 3300028380 Bacteria 1254
649 Ga0268264_10000641 3300028381 Bacteria 41364
650 Ga0268264_10003919 3300028381 Bacteria 12743
651 Ga0268264_10020018 3300028381 Bacteria 5467
652 Ga0268264_10025067 3300028381 Bacteria 4874
653 Ga0268264_10045620 3300028381 Bacteria 3639
654 Ga0268264_10167479 3300028381 Bacteria 1985
655 Ga0268264_10167528 3300028381 Bacteria 1984
656 Ga0307517_10100353 3300028786 Bacteria 2287
657 Ga0265338_10410831 3300028800 Unclassified 963
658 Ga0265330_10010054 3300031235 Bacteria 4471
659 Ga0265332_10001333 3300031238 Bacteria 14001
660 Ga0265325_10000877 3300031241 Bacteria 21725
661 Ga0265340_10002744 3300031247 Bacteria 10027
662 Ga0265339_10064615 3300031249 Bacteria 1963
663 Ga0265331_10000310 3300031250 Bacteria 53265
664 Ga0265331_10118728 3300031250 Bacteria 1210
665 Ga0265327_10002920 3300031251 Bacteria 17116
666 Ga0265316_10052062 3300031344 Bacteria 3213
667 Ga0307509_10000033 3300031507 Bacteria 194363
668 Ga0307408_100004310 3300031548 Bacteria 9653
669 Ga0307408_100005363 3300031548 Bacteria 8591
670 Ga0265313_10058399 3300031595 Bacteria 1818
671 Ga0265314_10003412 3300031711 Bacteria 15382
672 Ga0307405_10001375 3300031731 Bacteria 10202
673 Ga0307413_10007333 3300031824 Bacteria 5113
674 Ga0307413_10013300 3300031824 Bacteria 4132
675 Ga0307410_10005872 3300031852 Bacteria 6555
676 Ga0307410_10008880 3300031852 Bacteria 5606
677 Ga0307406_10025843 3300031901 Bacteria 3519
678 Ga0307407_10006793 3300031903 Bacteria 5125
679 Ga0307407_10010883 3300031903 Bacteria 4309
680 Ga0307412_10030015 3300031911 Bacteria 3418
681 Ga0307412_10044277 3300031911 Bacteria 2903
682 Ga0307409_100007270 3300031995 Bacteria 6607
683 Ga0307409_100012433 3300031995 Bacteria 5424
684 Ga0307416_100010652 3300032002 Bacteria 6087
685 Ga0307414_10056839 3300032004 Bacteria 2747
686 Ga0307411_10000280 3300032005 Bacteria 16974
687 Ga0307411_10020842 3300032005 Bacteria 3822
688 Ga0307415_100020252 3300032126 Bacteria 4058
689 Ga0307415_100030087 3300032126 Bacteria 3479
690 Ga0316583_10000196 3300032133 Bacteria 15776
691 Ga0373926_0035913 3300035083 Bacteria 1759
692 Ga0373929_0022575 3300035085 Bacteria 1286
693 Ga0373934_0001656 3300035086 Bacteria 8167
694 Ga0373934_0037290 3300035086 Bacteria 1914
695 Ga0373923_0092285 3300035111 Bacteria 1326
696 Ga0373954_0000024 3300035118 Bacteria 57545
697 Ga0373954_0002047 3300035118 Bacteria 8380
698 Ga0373956_0000371 3300035119 Bacteria 18327
699 Ga0373956_0018705 3300035119 Bacteria 2935
700 Ga0373956_0027005 3300035119 Bacteria 2489
701 Ga0373960_0051176 3300035121 Bacteria 1226
702 Ga0373943_0040108 3300035170 Bacteria 2259
703 Ga0373946_0038180 3300035171 Bacteria 1955
704 Ga0373961_0019449 3300035241 Bacteria 1784
705 Ga0373924_0005481 3300035410 Bacteria 4497
706 Ga0373924_0053614 3300035410 Bacteria 1675
707 Ga0373931_0018659 3300035691 Bacteria 3451
708 Ga0373931_0047147 3300035691 Bacteria 2280
709 Ga0373931_0070837 3300035691 Bacteria 1903
710 Ga0373935_0056925 3300035692 Bacteria 2493
711 Ga0373935_0140824 3300035692 Bacteria 1629
712 Ga0373927_0009964 3300035695 Bacteria 6368
713 Ga0373927_0065625 3300035695 Bacteria 2348
714 Ga0373933_0002506 3300035724 Bacteria 10323
715 Ga0373933_0046747 3300035724 Bacteria 2571
716 Ga0373933_0054708 3300035724 Bacteria 2392
717 Ga0373933_0128305 3300035724 Bacteria 1593
718 Ga0373947_0034332 3300035725 Bacteria 2999
719 Ga0373947_0144067 3300035725 Bacteria 1530
720 Ga0373937_0004381 3300036401 Bacteria 11988
721 Ga0373937_0005790 3300036401 Bacteria 10621
722 Ga0373937_0025706 3300036401 Bacteria 5317
723 Ga0373937_0036018 3300036401 Bacteria 4508
724 Ga0373937_0136086 3300036401 Bacteria 2297
725 Ga0373937_0170311 3300036401 Bacteria 2043
726 Ga0373925_0027934 3300037068 Bacteria 4131
727 Ga0373925_0037859 3300037068 Bacteria 3562
728 Ga0373925_0203955 3300037068 Bacteria 1573
729 Ga0373925_0237920 3300037068 Bacteria 1457
730 Ga0395900_0017004 3300037418 Bacteria 7424
731 Ga0395905_0029937 3300037471 Bacteria 5132
732 Ga0395905_0196359 3300037471 Bacteria 1892
733 Ga0395901_0031022 3300038443 Bacteria 5510
734 Ga0400488_49857 3300038741 Bacteria 1981
735 Ga0436365_0145813 3300039437 Bacteria 1466
736 Ga0436365_0608769 3300039437 Bacteria 3641
737 Ga0436365_1551353 3300039437 Bacteria 2383
738 Ga0436360_0511108 3300039438 Bacteria 3731
739 Ga0436362_1100797 3300039453 Bacteria 3140
740 Ga0439441_017770 3300042001 Bacteria 1281
741 Ga0439448_0015880 3300042005 Bacteria 2286
742 Ga0451577_0000384 3300042876 Bacteria 82022
743 Ga0451577_0010249 3300042876 Bacteria 8975
744 Ga0451577_0137884 3300042876 Bacteria 2191
745 Ga0451577_0183588 3300042876 Bacteria 1886
746 Ga0451577_0247110 3300042876 Bacteria 1615
747 Ga0466961_0000955 3300044693 Bacteria 17875
748 Ga0466963_0037905 3300044694 Bacteria 3151
749 Ga0453684_0000005 3300044712 Bacteria 1431632
750 Ga0453684_0000292 3300044712 Bacteria 213050
751 Ga0453684_0003022 3300044712 Bacteria 39115
752 Ga0466959_0006078 3300045049 Bacteria 8331
753 Ga0451576_0171487 3300045051 Bacteria 2265
754 Ga0451576_0217368 3300045051 Bacteria 1996
755 Ga0466967_0060125 3300045976 Bacteria 3366
756 Ga0495592_0001143 3300046454 Bacteria 18460
757 Ga0495603_0032134 3300046455 Bacteria 3159
758 Ga0495629_0008490 3300046459 Bacteria 7563
759 Ga0495580_0025942 3300046472 Bacteria 4277
760 Ga0495580_0134757 3300046472 Bacteria 1713
761 Ga0495580_0135755 3300046472 Bacteria 1706
762 Ga0495582_0033204 3300046473 Bacteria 2836
763 Ga0495582_0035265 3300046473 Bacteria 2751
764 Ga0495639_0010739 3300046475 Bacteria 3940
765 Ga0495662_0012744 3300046476 Bacteria 4100
766 Ga0495664_0206648 3300046477 Bacteria 1189
767 Ga0495594_0133825 3300046499 Bacteria 1404
768 Ga0495608_0000766 3300046511 Bacteria 22480
769 Ga0495608_0099632 3300046511 Bacteria 1874
770 Ga0495618_0019941 3300046514 Bacteria 4127
771 Ga0495628_0006004 3300046516 Bacteria 10624
772 Ga0495628_0240187 3300046516 Bacteria 1355
773 Ga0495630_0158089 3300046517 Bacteria 1725
774 Ga0495630_0166857 3300046517 Bacteria 1676
775 Ga0495666_0021113 3300046526 Bacteria 3224
776 Ga0495666_0072732 3300046526 Bacteria 1632
777 Ga0495652_0093914 3300046529 Bacteria 2448
778 Ga0495640_0000384 3300046533 Bacteria 31361
779 Ga0495640_0016426 3300046533 Bacteria 5536
780 Ga0495586_0000938 3300046535 Bacteria 16544
781 Ga0495587_0052496 3300046536 Bacteria 2405
782 Ga0495621_0011723 3300046539 Bacteria 2721
783 Ga0495621_0038213 3300046539 Bacteria 1674
784 Ga0495645_0009637 3300046543 Bacteria 6753
785 Ga0495645_0088405 3300046543 Bacteria 2216
786 Ga0495667_0003921 3300046559 Bacteria 9985
787 Ga0495667_0048450 3300046559 Bacteria 2806
788 Ga0495634_0169122 3300046642 Bacteria 1374
789 Ga0495625_0005191 3300046660 Bacteria 12004
790 Ga0495635_0013544 3300046663 Bacteria 5708
791 Ga0495635_0035566 3300046663 Bacteria 3453
792 Ga0495588_0153647 3300046674 Bacteria 1216
793 Ga0495657_0143940 3300046675 Bacteria 1484
794 Ga0495599_0003110 3300046678 Bacteria 9670
795 Ga0495599_0110823 3300046678 Bacteria 1710
796 Ga0495623_0053021 3300046679 Bacteria 2562
797 Ga0495647_0008144 3300046681 Bacteria 3522
798 Ga0495658_0025439 3300046683 Bacteria 3163
799 Ga0495613_0005741 3300046689 Bacteria 9297
800 Ga0495624_0156371 3300046690 Bacteria 1393
801 Ga0495600_0012682 3300046809 Bacteria 5276
802 Ga0495581_0001341 3300047315 Bacteria 13603
803 Ga0495604_0008259 3300047317 Bacteria 8235
804 Ga0495674_0105678 3300047319 Bacteria 2392
805 Ga0495680_0001589 3300047322 Bacteria 24279
806 Ga0495680_0037627 3300047322 Bacteria 3875
807 Ga0495680_0084404 3300047322 Bacteria 2393
808 Ga0495684_0068442 3300047471 Bacteria 2699
809 Ga0495593_0026218 3300047673 Bacteria 3220
810 Ga0495593_0089540 3300047673 Bacteria 1585
811 Ga0495614_0018592 3300048089 Bacteria 3011
812 Ga0496100_0063644 3300048903 Bacteria 2438
813 Ga0496101_0150811 3300048904 Bacteria 1778
814 Ga0496102_0004733 3300048905 Bacteria 11528
815 Ga0496102_0049371 3300048905 Bacteria 3828
816 Ga0496102_0061780 3300048905 Bacteria 3430
817 Ga0496103_0063096 3300048906 Bacteria 2307
818 Ga0496103_0105565 3300048906 Bacteria 1786
819 Ga0496104_0008261 3300048907 Bacteria 9243
820 Ga0496104_0165794 3300048907 Bacteria 2119
821 Ga0496105_0043192 3300048908 Bacteria 3717
822 Ga0496106_0000409 3300048909 Bacteria 30485
823 Ga0496106_0250476 3300048909 Bacteria 1416
824 Ga0496106_0261029 3300048909 Bacteria 1386
825 Ga0496107_0001779 3300048910 Bacteria 13578
826 Ga0496107_0154722 3300048910 Bacteria 1697
827 Ga0496108_0117995 3300048911 Bacteria 2274
828 Ga0496108_0264210 3300048911 Bacteria 1498
829 Ga0496109_0058897 3300048912 Bacteria 3509
830 Ga0496109_0107524 3300048912 Bacteria 2591
831 Ga0496109_0133532 3300048912 Bacteria 2318
832 Ga0496110_0106413 3300048913 Bacteria 2517
833 Ga0496112_0002525 3300048915 Bacteria 14775
834 Ga0496112_0017345 3300048915 Bacteria 6763
835 Ga0496112_0108435 3300048915 Bacteria 2747
836 Ga0496114_0066614 3300048917 Bacteria 3020
837 Ga0496118_0102617 3300048921 Bacteria 1927
838 Ga0501042_0144648 3300049578 Bacteria 1714
839 Ga0501047_0003041 3300049581 Bacteria 15910
840 Ga0501047_0188544 3300049581 Bacteria 1927
841 Ga0501047_0307849 3300049581 Bacteria 1425
842 Ga0501067_0057846 3300049583 Bacteria 2147
843 Ga0501067_0073234 3300049583 Bacteria 1898
844 Ga0501068_0006943 3300049584 Bacteria 6263
845 Ga0501069_0000613 3300049585 Bacteria 16520
846 Ga0501069_0045255 3300049585 Bacteria 2438
847 Ga0501070_0006738 3300049586 Bacteria 9783
848 Ga0501072_0059746 3300049588 Bacteria 3006
849 Ga0501073_0009180 3300049589 Bacteria 7295
850 Ga0501074_0010752 3300049590 Bacteria 6649
851 Ga0501079_0012357 3300049741 Bacteria 6516
852 Ga0501035_0130693 3300049822 Bacteria 2189
853 Ga0501035_0407026 3300049822 Bacteria 1131
854 Ga0501044_0224710 3300049823 Bacteria 1827
855 nmdc:mga0k408_171499_c1 3300050493 Bacteria 1293
856 nmdc:mga0k408_41636_c1 3300050493 Bacteria 2645
857 nmdc:mga05p37_80753_c1 3300050507 Bacteria 4005
858 nmdc:mga0n895_102946_c1 3300050512 Bacteria 2866
859 nmdc:mga0n895_13377_c1 3300050512 Bacteria 7400
860 nmdc:mga0n895_27445_c1 3300050512 Bacteria 5408
861 nmdc:mga0n895_72957_c1 3300050512 Bacteria 3407
862 nmdc:mga0n895_84373_c1 3300050512 Bacteria 3169
863 nmdc:mga0rr50_11310_c1 3300050513 Bacteria 5707
864 nmdc:mga0rr50_182232_c1 3300050513 Bacteria 1717
865 nmdc:mga0rr50_29161_c2 3300050513 Bacteria 1989
866 nmdc:mga08x19_375_c1 3300050514 Bacteria 31351
867 nmdc:mga08x19_77126_c1 3300050514 Bacteria 2182
868 nmdc:mga08x19_87903_c1 3300050514 Bacteria 2048
869 nmdc:mga0a205_175785_c1 3300050515 Bacteria 2036
870 nmdc:mga0a205_402882_c1 3300050515 Bacteria 1232
871 Ga0495601_0013611 3300053077 Bacteria 4894
872 Ga0495612_0071855 3300053078 Bacteria 1444
873 Ga0495595_0021137 3300053084 Bacteria 2840
874 Ga0495595_0058488 3300053084 Bacteria 1800
875 Ga0495595_0090214 3300053084 Bacteria 1470
876 Ga0495619_0040676 3300053085 Bacteria 3038
877 Ga0495619_0108009 3300053085 Bacteria 1899
878 Ga0500588_0017696 3300053146 Bacteria 1865
879 Ga0500616_0089438 3300053153 Unclassified 1528
880 Ga0500636_0000406 3300053177 Bacteria 23697
881 Ga0500637_0002477 3300053178 Bacteria 8220
882 Ga0500625_030665 3300053729 Bacteria 2551
883 Ga0501084_0069796 3300054114 Bacteria 2942
884 Ga0501082_0065815 3300060353 Bacteria 3121

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100094423 Ga0070683_1000944232 271
2 3300005336 Ga0070680_100113380 Ga0070680_1001133802 271
3 3300005339 Ga0070660_100140313 Ga0070660_1001403132 271
4 3300005344 Ga0070661_100007598 Ga0070661_1000075983 271
5 3300005435 Ga0070714_100007199 Ga0070714_1000071993 271
6 3300005530 Ga0070679_100017521 Ga0070679_1000175217 271
7 3300005535 Ga0070684_100004038 Ga0070684_1000040385 271
8 3300005547 Ga0070693_100021456 Ga0070693_1000214563 271
9 3300005563 Ga0068855_100012552 Ga0068855_1000125527 271
10 3300005564 Ga0070664_100001452 Ga0070664_10000145214 271
11 3300005577 Ga0068857_100001739 Ga0068857_1000017397 271
12 3300005578 Ga0068854_100089368 Ga0068854_1000893682 271
13 3300005614 Ga0068856_100006138 Ga0068856_1000061389 271
14 3300005616 Ga0068852_100001471 Ga0068852_10000147116 271
15 3300005834 Ga0068851_10085303 Ga0068851_100853032 271
16 3300009093 Ga0105240_10002731 Ga0105240_1000273128 271
17 3300009551 Ga0105238_10007592 Ga0105238_100075929 271
18 3300013104 Ga0157370_10008356 Ga0157370_100083567 271
19 3300013105 Ga0157369_10014458 Ga0157369_100144582 271
20 3300013307 Ga0157372_10008051 Ga0157372_100080519 271
21 3300014497 Ga0182008_10090446 Ga0182008_100904462 271
22 3300025913 Ga0207695_10025748 Ga0207695_100257487 271
23 3300025919 Ga0207657_10016447 Ga0207657_100164475 271
24 3300025920 Ga0207649_10018879 Ga0207649_100188793 271
25 3300025921 Ga0207652_10468517 Ga0207652_104685172 271
26 3300025924 Ga0207694_10007179 Ga0207694_100071792 271
27 3300025929 Ga0207664_10014392 Ga0207664_100143925 271
28 3300025944 Ga0207661_10040053 Ga0207661_100400533 271
29 3300025949 Ga0207667_10009435 Ga0207667_100094353 271
30 3300025981 Ga0207640_10055900 Ga0207640_100559003 271
31 3300026041 Ga0207639_10118313 Ga0207639_101183132 271
32 3300026078 Ga0207702_10006720 Ga0207702_100067205 271
33 3300026116 Ga0207674_10000049 Ga0207674_1000004921 271
34 3300053153 Ga0500616_0089438 Ga0500616_0089438_648_1490 274
35 3300049578 Ga0501042_0144648 Ga0501042_0144648_248_1102 276
36 3300005549 Ga0070704_100211460 Ga0070704_1002114602 279
37 3300009147 Ga0114129_11054854 Ga0114129_110548541 279
38 3300005341 Ga0070691_10040216 Ga0070691_100402163 287
39 3300005546 Ga0070696_100057085 Ga0070696_1000570852 287
40 3300005458 Ga0070681_10039473 Ga0070681_100394732 290
41 3300005467 Ga0070706_100089454 Ga0070706_1000894543 290
42 3300005530 Ga0070679_100009410 Ga0070679_1000094109 290
43 3300005545 Ga0070695_100184426 Ga0070695_1001844262 290
44 3300005546 Ga0070696_100065250 Ga0070696_1000652502 290
45 3300006914 Ga0075436_100029805 Ga0075436_1000298054 290
46 3300006914 Ga0075436_100202891 Ga0075436_1002028912 290
47 3300025910 Ga0207684_10289887 Ga0207684_102898872 290
48 3300025912 Ga0207707_10002855 Ga0207707_100028553 290
49 3300025921 Ga0207652_10007499 Ga0207652_100074999 290
50 3300035085 Ga0373929_0022575 Ga0373929_0022575_379_1257 290
51 3300035121 Ga0373960_0051176 Ga0373960_0051176_243_1121 290
52 3300035241 Ga0373961_0019449 Ga0373961_0019449_868_1746 290
53 3300035691 Ga0373931_0018659 Ga0373931_0018659_831_1709 290
54 3300048911 Ga0496108_0264210 Ga0496108_0264210_40_915 290
55 3300049583 Ga0501067_0057846 Ga0501067_0057846_768_1646 290
56 3300049585 Ga0501069_0045255 Ga0501069_0045255_723_1601 290
57 3300050514 nmdc:mga08x19_87903_c1 nmdc:mga08x19_87903_c1_796_1674 290
58 3300005467 Ga0070706_100445499 Ga0070706_1004454991 291
59 3300005544 Ga0070686_100109860 Ga0070686_1001098602 291
60 3300006852 Ga0075433_10417054 Ga0075433_104170541 291
61 3300006871 Ga0075434_100007305 Ga0075434_1000073058 291
62 3300006871 Ga0075434_100037226 Ga0075434_1000372265 291
63 3300006914 Ga0075436_100089270 Ga0075436_1000892702 291
64 3300007076 Ga0075435_100017481 Ga0075435_1000174815 291
65 3300009098 Ga0105245_10144969 Ga0105245_101449693 291
66 3300025910 Ga0207684_10321317 Ga0207684_103213172 291
67 3300036401 Ga0373937_0036018 Ga0373937_0036018_911_1795 291
68 3300046454 Ga0495592_0001143 Ga0495592_0001143_13780_14664 291
69 3300046473 Ga0495582_0035265 Ga0495582_0035265_1758_2642 291
70 3300046511 Ga0495608_0000766 Ga0495608_0000766_13735_14619 291
71 3300046514 Ga0495618_0019941 Ga0495618_0019941_1024_1908 291
72 3300046516 Ga0495628_0006004 Ga0495628_0006004_2988_3872 291
73 3300046517 Ga0495630_0158089 Ga0495630_0158089_83_967 291
74 3300046526 Ga0495666_0021113 Ga0495666_0021113_1616_2500 291
75 3300046529 Ga0495652_0093914 Ga0495652_0093914_1185_2069 291
76 3300046533 Ga0495640_0000384 Ga0495640_0000384_8127_9011 291
77 3300046535 Ga0495586_0000938 Ga0495586_0000938_1394_2278 291
78 3300046536 Ga0495587_0052496 Ga0495587_0052496_430_1314 291
79 3300046559 Ga0495667_0003921 Ga0495667_0003921_3404_4288 291
80 3300046642 Ga0495634_0169122 Ga0495634_0169122_477_1361 291
81 3300046663 Ga0495635_0013544 Ga0495635_0013544_2388_3272 291
82 3300046678 Ga0495599_0003110 Ga0495599_0003110_212_1096 291
83 3300046683 Ga0495658_0025439 Ga0495658_0025439_1033_1917 291
84 3300046689 Ga0495613_0005741 Ga0495613_0005741_2993_3877 291
85 3300046690 Ga0495624_0156371 Ga0495624_0156371_172_1056 291
86 3300047317 Ga0495604_0008259 Ga0495604_0008259_5976_6860 291
87 3300047322 Ga0495680_0001589 Ga0495680_0001589_22248_23132 291
88 3300047673 Ga0495593_0089540 Ga0495593_0089540_380_1264 291
89 3300050512 nmdc:mga0n895_13377_c1 nmdc:mga0n895_13377_c1_291_1172 291
90 3300050512 nmdc:mga0n895_72957_c1 nmdc:mga0n895_72957_c1_401_1285 291
91 3300050513 nmdc:mga0rr50_11310_c1 nmdc:mga0rr50_11310_c1_2386_3267 291
92 3300050514 nmdc:mga08x19_77126_c1 nmdc:mga08x19_77126_c1_1117_1998 291
93 3300050515 nmdc:mga0a205_175785_c1 nmdc:mga0a205_175785_c1_810_1694 291
94 3300050515 nmdc:mga0a205_402882_c1 nmdc:mga0a205_402882_c1_92_973 291
95 3300053077 Ga0495601_0013611 Ga0495601_0013611_2752_3636 291
96 3300053084 Ga0495595_0058488 Ga0495595_0058488_605_1489 291
97 3300053085 Ga0495619_0108009 Ga0495619_0108009_476_1360 291
98 3300009093 Ga0105240_10155105 Ga0105240_101551052 292
99 3300009545 Ga0105237_10000784 Ga0105237_1000078416 292
100 3300009551 Ga0105238_10005552 Ga0105238_100055529 292
101 3300010375 Ga0105239_10001759 Ga0105239_1000175930 292
102 3300021384 Ga0213876_10138151 Ga0213876_101381511 292
103 3300025913 Ga0207695_10107882 Ga0207695_101078822 292
104 3300025914 Ga0207671_10009892 Ga0207671_100098923 292
105 3300025924 Ga0207694_10015526 Ga0207694_100155263 292
106 3300039437 Ga0436365_0145813 Ga0436365_0145813_484_1416 292
107 3300035086 Ga0373934_0037290 Ga0373934_0037290_808_1701 294
108 3300035111 Ga0373923_0092285 Ga0373923_0092285_41_934 294
109 3300035118 Ga0373954_0000024 Ga0373954_0000024_1332_2225 294
110 3300035724 Ga0373933_0054708 Ga0373933_0054708_113_1006 294
111 3300036401 Ga0373937_0005790 Ga0373937_0005790_7044_7937 294
112 3300046511 Ga0495608_0099632 Ga0495608_0099632_474_1367 294
113 3300046675 Ga0495657_0143940 Ga0495657_0143940_569_1462 294
114 3300038741 Ga0400488_49857 Ga0400488_49857_93_1007 295
115 3300005295 Ga0065707_10082407 Ga0065707_1008240710 296
116 3300005719 Ga0068861_100033322 Ga0068861_1000333223 296
117 3300014326 Ga0157380_10003032 Ga0157380_1000303210 296
118 3300021384 Ga0213876_10186792 Ga0213876_101867921 296
119 3300026118 Ga0207675_100011791 Ga0207675_1000117916 296
120 3300039437 Ga0436365_0608769 Ga0436365_0608769_2585_3481 296
121 3300039453 Ga0436362_1100797 Ga0436362_1100797_328_1224 296
122 3300042876 Ga0451577_0137884 Ga0451577_0137884_280_1176 296
123 3300044712 Ga0453684_0003022 Ga0453684_0003022_35236_36132 296
124 3300046660 Ga0495625_0005191 Ga0495625_0005191_823_1716 296
125 3300048921 Ga0496118_0102617 Ga0496118_0102617_257_1150 296
126 3300053146 Ga0500588_0017696 Ga0500588_0017696_784_1677 296
127 3300005336 Ga0070680_100093295 Ga0070680_1000932953 297
128 3300025917 Ga0207660_10095663 Ga0207660_100956633 297
129 3300005458 Ga0070681_10029133 Ga0070681_100291333 298
130 3300005458 Ga0070681_10187022 Ga0070681_101870221 299
131 3300007076 Ga0075435_100136381 Ga0075435_1001363813 299
132 3300021441 Ga0213871_10008652 Ga0213871_100086522 299
133 3300028800 Ga0265338_10410831 Ga0265338_104108311 299
134 3300039438 Ga0436360_0511108 Ga0436360_0511108_320_1222 299
135 3300050513 nmdc:mga0rr50_182232_c1 nmdc:mga0rr50_182232_c1_177_1079 299
136 3300005719 Ga0068861_100387977 Ga0068861_1003879772 300
137 3300025893 Ga0207682_10022780 Ga0207682_100227803 300
138 3300025918 Ga0207662_10055572 Ga0207662_100555722 300
139 3300031507 Ga0307509_10000033 Ga0307509_1000003345 300
140 3300035410 Ga0373924_0005481 Ga0373924_0005481_3422_4330 300
141 3300044693 Ga0466961_0000955 Ga0466961_0000955_16318_17226 300
142 3300045049 Ga0466959_0006078 Ga0466959_0006078_6669_7577 300
143 3300046539 Ga0495621_0011723 Ga0495621_0011723_1000_1905 300
144 3300047322 Ga0495680_0037627 Ga0495680_0037627_511_1416 300
145 3300005344 Ga0070661_100348177 Ga0070661_1003481771 301
146 3300005356 Ga0070674_100401020 Ga0070674_1004010201 301
147 3300005435 Ga0070714_100128714 Ga0070714_1001287142 301
148 3300005456 Ga0070678_100073926 Ga0070678_1000739263 301
149 3300005458 Ga0070681_10162783 Ga0070681_101627831 301
150 3300005459 Ga0068867_100017647 Ga0068867_1000176474 301
151 3300005530 Ga0070679_100442781 Ga0070679_1004427812 301
152 3300005539 Ga0068853_100051686 Ga0068853_1000516862 301
153 3300005563 Ga0068855_100114999 Ga0068855_1001149992 301
154 3300005614 Ga0068856_100213730 Ga0068856_1002137302 301
155 3300005842 Ga0068858_100037266 Ga0068858_1000372665 301
156 3300009093 Ga0105240_10044396 Ga0105240_100443965 301
157 3300009093 Ga0105240_10118858 Ga0105240_101188584 301
158 3300009174 Ga0105241_10074841 Ga0105241_100748413 301
159 3300009176 Ga0105242_10148976 Ga0105242_101489762 301
160 3300009551 Ga0105238_10052151 Ga0105238_100521512 301
161 3300013105 Ga0157369_10073010 Ga0157369_100730102 301
162 3300013105 Ga0157369_10477747 Ga0157369_104777471 301
163 3300013297 Ga0157378_10143373 Ga0157378_101433733 301
164 3300013307 Ga0157372_10114167 Ga0157372_101141672 301
165 3300014325 Ga0163163_10014090 Ga0163163_100140904 301
166 3300014968 Ga0157379_10053702 Ga0157379_100537023 301
167 3300017792 Ga0163161_10012234 Ga0163161_100122341 301
168 3300025911 Ga0207654_10013552 Ga0207654_100135523 301
169 3300025913 Ga0207695_10007386 Ga0207695_100073866 301
170 3300025924 Ga0207694_10234747 Ga0207694_102347472 301
171 3300025928 Ga0207700_10347522 Ga0207700_103475221 301
172 3300025944 Ga0207661_10342499 Ga0207661_103424992 301
173 3300025949 Ga0207667_10045468 Ga0207667_100454682 301
174 3300026035 Ga0207703_10125813 Ga0207703_101258131 301
175 3300026041 Ga0207639_10178421 Ga0207639_101784212 301
176 3300026078 Ga0207702_10303351 Ga0207702_103033512 301
177 3300026089 Ga0207648_10098558 Ga0207648_100985582 301
178 3300026121 Ga0207683_10009881 Ga0207683_100098818 301
179 3300026121 Ga0207683_10302087 Ga0207683_103020871 301
180 3300028381 Ga0268264_10167479 Ga0268264_101674793 301
181 3300035086 Ga0373934_0001656 Ga0373934_0001656_4068_4976 301
182 3300035118 Ga0373954_0002047 Ga0373954_0002047_3440_4360 301
183 3300035119 Ga0373956_0000371 Ga0373956_0000371_9969_10877 301
184 3300035724 Ga0373933_0002506 Ga0373933_0002506_7193_8101 301
185 3300036401 Ga0373937_0004381 Ga0373937_0004381_7602_8510 301
186 3300049590 Ga0501074_0010752 Ga0501074_0010752_2170_3078 301
187 3300005539 Ga0068853_100300166 Ga0068853_1003001662 302
188 3300006852 Ga0075433_10089796 Ga0075433_100897963 302
189 3300006871 Ga0075434_100102280 Ga0075434_1001022802 302
190 3300009098 Ga0105245_10158716 Ga0105245_101587162 302
191 3300009176 Ga0105242_10059563 Ga0105242_100595633 302
192 3300013296 Ga0157374_10000770 Ga0157374_1000077015 302
193 3300014326 Ga0157380_10344040 Ga0157380_103440402 302
194 3300025927 Ga0207687_10079934 Ga0207687_100799342 302
195 3300028786 Ga0307517_10100353 Ga0307517_101003532 302
196 3300050512 nmdc:mga0n895_27445_c1 nmdc:mga0n895_27445_c1_3708_4619 302
197 3300005327 Ga0070658_10107589 Ga0070658_101075893 303
198 3300005441 Ga0070700_100205572 Ga0070700_1002055722 303
199 3300005459 Ga0068867_100092869 Ga0068867_1000928692 303
200 3300005719 Ga0068861_100285235 Ga0068861_1002852352 303
201 3300005985 Ga0081539_10016545 Ga0081539_100165454 303
202 3300006881 Ga0068865_100195936 Ga0068865_1001959363 303
203 3300009148 Ga0105243_10140005 Ga0105243_101400051 303
204 3300009176 Ga0105242_10000164 Ga0105242_1000016430 303
205 3300009177 Ga0105248_10051808 Ga0105248_100518083 303
206 3300009551 Ga0105238_10160067 Ga0105238_101600672 303
207 3300014968 Ga0157379_10040901 Ga0157379_100409014 303
208 3300025909 Ga0207705_10073050 Ga0207705_100730503 303
209 3300025924 Ga0207694_10028502 Ga0207694_100285022 303
210 3300025924 Ga0207694_10147422 Ga0207694_101474221 303
211 3300025934 Ga0207686_10004958 Ga0207686_100049584 303
212 3300025935 Ga0207709_10048377 Ga0207709_100483773 303
213 3300025941 Ga0207711_10124989 Ga0207711_101249892 303
214 3300026035 Ga0207703_10092928 Ga0207703_100929283 303
215 3300026089 Ga0207648_10055564 Ga0207648_100555642 303
216 3300026121 Ga0207683_10060834 Ga0207683_100608343 303
217 3300050493 nmdc:mga0k408_171499_c1 nmdc:mga0k408_171499_c1_309_1223 303
218 3300005343 Ga0070687_100146759 Ga0070687_1001467592 304
219 3300005354 Ga0070675_100156214 Ga0070675_1001562142 304
220 3300005434 Ga0070709_10055690 Ga0070709_100556902 304
221 3300005436 Ga0070713_100003229 Ga0070713_1000032293 304
222 3300005438 Ga0070701_10057766 Ga0070701_100577662 304
223 3300005617 Ga0068859_100296865 Ga0068859_1002968651 304
224 3300005719 Ga0068861_100218927 Ga0068861_1002189272 304
225 3300006914 Ga0075436_100063727 Ga0075436_1000637271 304
226 3300006931 Ga0097620_100296861 Ga0097620_1002968611 304
227 3300025906 Ga0207699_10212859 Ga0207699_102128592 304
228 3300025918 Ga0207662_10112600 Ga0207662_101126002 304
229 3300025928 Ga0207700_10004520 Ga0207700_100045203 304
230 3300026118 Ga0207675_100236629 Ga0207675_1002366292 304
231 3300032133 Ga0316583_10000196 Ga0316583_1000019610 304
232 3300049822 Ga0501035_0407026 Ga0501035_0407026_133_1056 304
233 3300053177 Ga0500636_0000406 Ga0500636_0000406_17723_18643 304
234 3300053178 Ga0500637_0002477 Ga0500637_0002477_2778_3698 304
235 3300053729 Ga0500625_030665 Ga0500625_030665_206_1126 304
236 3300005327 Ga0070658_10032537 Ga0070658_100325374 305
237 3300005327 Ga0070658_10150425 Ga0070658_101504252 305
238 3300005327 Ga0070658_10279917 Ga0070658_102799171 305
239 3300005436 Ga0070713_100000182 Ga0070713_10000018226 305
240 3300005518 Ga0070699_100016446 Ga0070699_1000164466 305
241 3300005530 Ga0070679_100027131 Ga0070679_1000271311 305
242 3300005539 Ga0068853_100410378 Ga0068853_1004103781 305
243 3300005546 Ga0070696_100016471 Ga0070696_1000164714 305
244 3300005548 Ga0070665_100164869 Ga0070665_1001648693 305
245 3300005563 Ga0068855_100081055 Ga0068855_1000810553 305
246 3300005563 Ga0068855_100178555 Ga0068855_1001785553 305
247 3300005563 Ga0068855_100285350 Ga0068855_1002853501 305
248 3300005578 Ga0068854_100106183 Ga0068854_1001061832 305
249 3300005614 Ga0068856_100456762 Ga0068856_1004567622 305
250 3300005616 Ga0068852_100015543 Ga0068852_1000155432 305
251 3300005616 Ga0068852_100039410 Ga0068852_1000394103 305
252 3300005616 Ga0068852_100074021 Ga0068852_1000740213 305
253 3300009093 Ga0105240_10137030 Ga0105240_101370303 305
254 3300009093 Ga0105240_10438741 Ga0105240_104387412 305
255 3300013104 Ga0157370_10070211 Ga0157370_100702112 305
256 3300013104 Ga0157370_10154989 Ga0157370_101549892 305
257 3300013105 Ga0157369_10000733 Ga0157369_1000073325 305
258 3300013307 Ga0157372_10001652 Ga0157372_100016528 305
259 3300021384 Ga0213876_10050192 Ga0213876_100501923 305
260 3300025909 Ga0207705_10093645 Ga0207705_100936452 305
261 3300025909 Ga0207705_10136169 Ga0207705_101361692 305
262 3300025909 Ga0207705_10155202 Ga0207705_101552022 305
263 3300025913 Ga0207695_10479509 Ga0207695_104795091 305
264 3300025921 Ga0207652_10027029 Ga0207652_100270293 305
265 3300025928 Ga0207700_10000031 Ga0207700_1000003129 305
266 3300025949 Ga0207667_10221978 Ga0207667_102219782 305
267 3300026142 Ga0207698_10010183 Ga0207698_100101831 305
268 3300026142 Ga0207698_10040284 Ga0207698_100402842 305
269 3300026142 Ga0207698_10049530 Ga0207698_100495303 305
270 3300028379 Ga0268266_10096595 Ga0268266_100965952 305
271 3300031548 Ga0307408_100005363 Ga0307408_1000053637 305
272 3300031824 Ga0307413_10007333 Ga0307413_100073332 305
273 3300031852 Ga0307410_10005872 Ga0307410_100058727 305
274 3300031903 Ga0307407_10006793 Ga0307407_100067935 305
275 3300031911 Ga0307412_10044277 Ga0307412_100442772 305
276 3300031995 Ga0307409_100007270 Ga0307409_1000072705 305
277 3300032005 Ga0307411_10020842 Ga0307411_100208423 305
278 3300032126 Ga0307415_100020252 Ga0307415_1000202522 305
279 3300037418 Ga0395900_0017004 Ga0395900_0017004_5787_6707 305
280 3300037471 Ga0395905_0029937 Ga0395905_0029937_2437_3357 305
281 3300038443 Ga0395901_0031022 Ga0395901_0031022_2920_3840 305
282 3300039437 Ga0436365_1551353 Ga0436365_1551353_588_1553 305
283 3300049581 Ga0501047_0003041 Ga0501047_0003041_14917_15837 305
284 3300049581 Ga0501047_0188544 Ga0501047_0188544_934_1854 305
285 3300049581 Ga0501047_0307849 Ga0501047_0307849_247_1194 305
286 3300049583 Ga0501067_0073234 Ga0501067_0073234_962_1882 305
287 3300049584 Ga0501068_0006943 Ga0501068_0006943_2680_3600 305
288 3300049585 Ga0501069_0000613 Ga0501069_0000613_1953_2873 305
289 3300049741 Ga0501079_0012357 Ga0501079_0012357_4757_5677 305
290 3300049823 Ga0501044_0224710 Ga0501044_0224710_221_1141 305
291 3300054114 Ga0501084_0069796 Ga0501084_0069796_405_1325 305
292 3300060353 Ga0501082_0065815 Ga0501082_0065815_642_1562 305
293 3300005334 Ga0068869_100072865 Ga0068869_1000728652 306
294 3300005344 Ga0070661_100163491 Ga0070661_1001634912 306
295 3300005347 Ga0070668_100046878 Ga0070668_1000468782 306
296 3300005354 Ga0070675_100094290 Ga0070675_1000942903 306
297 3300005719 Ga0068861_100084993 Ga0068861_1000849932 306
298 3300005834 Ga0068851_10000960 Ga0068851_1000096011 306
299 3300005844 Ga0068862_100190539 Ga0068862_1001905392 306
300 3300006358 Ga0068871_100026390 Ga0068871_1000263905 306
301 3300006871 Ga0075434_100132442 Ga0075434_1001324422 306
302 3300007076 Ga0075435_100104729 Ga0075435_1001047292 306
303 3300013296 Ga0157374_10324897 Ga0157374_103248972 306
304 3300014326 Ga0157380_10065644 Ga0157380_100656443 306
305 3300025926 Ga0207659_10087319 Ga0207659_100873192 306
306 3300025942 Ga0207689_10055328 Ga0207689_100553283 306
307 3300025972 Ga0207668_10043006 Ga0207668_100430062 306
308 3300026116 Ga0207674_10101320 Ga0207674_101013202 306
309 3300028380 Ga0268265_10157048 Ga0268265_101570482 306
310 3300031241 Ga0265325_10000877 Ga0265325_1000087710 306
311 3300031247 Ga0265340_10002744 Ga0265340_100027449 306
312 3300031250 Ga0265331_10118728 Ga0265331_101187281 306
313 3300031595 Ga0265313_10058399 Ga0265313_100583992 306
314 3300037068 Ga0373925_0203955 Ga0373925_0203955_622_1545 306
315 3300042876 Ga0451577_0000384 Ga0451577_0000384_50893_51816 306
316 3300042876 Ga0451577_0010249 Ga0451577_0010249_7792_8721 306
317 3300044712 Ga0453684_0000005 Ga0453684_0000005_912093_913016 306
318 3300044712 Ga0453684_0000292 Ga0453684_0000292_185344_186267 306
319 3300045051 Ga0451576_0171487 Ga0451576_0171487_558_1487 306
320 3300045051 Ga0451576_0217368 Ga0451576_0217368_1006_1929 306
321 3300050493 nmdc:mga0k408_41636_c1 nmdc:mga0k408_41636_c1_1433_2377 306
322 3300050512 nmdc:mga0n895_102946_c1 nmdc:mga0n895_102946_c1_1102_2055 306
323 3300050514 nmdc:mga08x19_375_c1 nmdc:mga08x19_375_c1_11674_12627 306
324 3300005327 Ga0070658_10035028 Ga0070658_100350282 307
325 3300005329 Ga0070683_100009335 Ga0070683_1000093355 307
326 3300005337 Ga0070682_100022407 Ga0070682_1000224073 307
327 3300005339 Ga0070660_100182922 Ga0070660_1001829222 307
328 3300005366 Ga0070659_100009887 Ga0070659_1000098872 307
329 3300005439 Ga0070711_100259675 Ga0070711_1002596751 307
330 3300005455 Ga0070663_100179948 Ga0070663_1001799482 307
331 3300005467 Ga0070706_100012233 Ga0070706_1000122336 307
332 3300005535 Ga0070684_100008621 Ga0070684_1000086216 307
333 3300005536 Ga0070697_100030789 Ga0070697_1000307894 307
334 3300005539 Ga0068853_100017260 Ga0068853_1000172603 307
335 3300005545 Ga0070695_100125609 Ga0070695_1001256092 307
336 3300005564 Ga0070664_100044446 Ga0070664_1000444462 307
337 3300005577 Ga0068857_100230592 Ga0068857_1002305922 307
338 3300005578 Ga0068854_100002439 Ga0068854_1000024394 307
339 3300005614 Ga0068856_100020687 Ga0068856_1000206875 307
340 3300005616 Ga0068852_100307024 Ga0068852_1003070242 307
341 3300006852 Ga0075433_10279420 Ga0075433_102794202 307
342 3300006871 Ga0075434_100166946 Ga0075434_1001669462 307
343 3300007076 Ga0075435_100146547 Ga0075435_1001465472 307
344 3300009093 Ga0105240_10149417 Ga0105240_101494172 307
345 3300009147 Ga0114129_10134553 Ga0114129_101345533 307
346 3300009174 Ga0105241_10157905 Ga0105241_101579052 307
347 3300009545 Ga0105237_10094826 Ga0105237_100948262 307
348 3300009551 Ga0105238_10098449 Ga0105238_100984493 307
349 3300010375 Ga0105239_10085915 Ga0105239_100859152 307
350 3300013100 Ga0157373_10002952 Ga0157373_100029526 307
351 3300020082 Ga0206353_11406765 Ga0206353_114067652 307
352 3300025315 Ga0207697_10028498 Ga0207697_100284982 307
353 3300025321 Ga0207656_10011621 Ga0207656_100116213 307
354 3300025909 Ga0207705_10017704 Ga0207705_100177042 307
355 3300025912 Ga0207707_10008732 Ga0207707_100087329 307
356 3300025913 Ga0207695_10012077 Ga0207695_100120776 307
357 3300025917 Ga0207660_10016190 Ga0207660_100161903 307
358 3300025919 Ga0207657_10002834 Ga0207657_1000283411 307
359 3300025920 Ga0207649_10006699 Ga0207649_100066996 307
360 3300025921 Ga0207652_10032211 Ga0207652_100322112 307
361 3300025932 Ga0207690_10013641 Ga0207690_100136415 307
362 3300025944 Ga0207661_10007655 Ga0207661_100076554 307
363 3300025945 Ga0207679_10015724 Ga0207679_100157245 307
364 3300025949 Ga0207667_10014732 Ga0207667_100147322 307
365 3300026067 Ga0207678_10003847 Ga0207678_100038479 307
366 3300026078 Ga0207702_10021819 Ga0207702_100218193 307
367 3300026116 Ga0207674_10001272 Ga0207674_100012729 307
368 3300026142 Ga0207698_10008826 Ga0207698_100088265 307
369 3300037471 Ga0395905_0196359 Ga0395905_0196359_555_1481 307
370 3300050507 nmdc:mga05p37_80753_c1 nmdc:mga05p37_80753_c1_1612_2544 307
371 3300050512 nmdc:mga0n895_84373_c1 nmdc:mga0n895_84373_c1_787_1719 307
372 3300050513 nmdc:mga0rr50_29161_c2 nmdc:mga0rr50_29161_c2_197_1129 307
373 3300005328 Ga0070676_10068314 Ga0070676_100683142 308
374 3300005328 Ga0070676_10272219 Ga0070676_102722191 308
375 3300005330 Ga0070690_100149440 Ga0070690_1001494402 308
376 3300005331 Ga0070670_100008816 Ga0070670_1000088168 308
377 3300005331 Ga0070670_100016066 Ga0070670_1000160663 308
378 3300005331 Ga0070670_100136518 Ga0070670_1001365183 308
379 3300005334 Ga0068869_100004739 Ga0068869_1000047393 308
380 3300005335 Ga0070666_10105763 Ga0070666_101057632 308
381 3300005336 Ga0070680_100196864 Ga0070680_1001968641 308
382 3300005339 Ga0070660_100046204 Ga0070660_1000462043 308
383 3300005344 Ga0070661_100022620 Ga0070661_1000226202 308
384 3300005344 Ga0070661_100214918 Ga0070661_1002149182 308
385 3300005347 Ga0070668_100197707 Ga0070668_1001977072 308
386 3300005347 Ga0070668_100202278 Ga0070668_1002022781 308
387 3300005353 Ga0070669_100012251 Ga0070669_1000122515 308
388 3300005354 Ga0070675_100019261 Ga0070675_1000192614 308
389 3300005354 Ga0070675_100020262 Ga0070675_1000202624 308
390 3300005355 Ga0070671_100049314 Ga0070671_1000493143 308
391 3300005355 Ga0070671_100224776 Ga0070671_1002247762 308
392 3300005364 Ga0070673_100002674 Ga0070673_1000026749 308
393 3300005365 Ga0070688_100011341 Ga0070688_1000113412 308
394 3300005367 Ga0070667_100030235 Ga0070667_1000302354 308
395 3300005456 Ga0070678_100042143 Ga0070678_1000421433 308
396 3300005466 Ga0070685_10023375 Ga0070685_100233753 308
397 3300005539 Ga0068853_100482296 Ga0068853_1004822961 308
398 3300005543 Ga0070672_100003013 Ga0070672_1000030138 308
399 3300005543 Ga0070672_100128537 Ga0070672_1001285372 308
400 3300005617 Ga0068859_100273439 Ga0068859_1002734392 308
401 3300005618 Ga0068864_100000938 Ga0068864_1000009383 308
402 3300005618 Ga0068864_100057543 Ga0068864_1000575432 308
403 3300005618 Ga0068864_100080267 Ga0068864_1000802674 308
404 3300005718 Ga0068866_10008728 Ga0068866_100087283 308
405 3300005719 Ga0068861_100119890 Ga0068861_1001198902 308
406 3300005841 Ga0068863_100001021 Ga0068863_10000102118 308
407 3300005841 Ga0068863_100187956 Ga0068863_1001879562 308
408 3300005843 Ga0068860_100053521 Ga0068860_1000535213 308
409 3300005844 Ga0068862_100005987 Ga0068862_10000598710 308
410 3300006237 Ga0097621_100059498 Ga0097621_1000594982 308
411 3300006358 Ga0068871_100004641 Ga0068871_1000046416 308
412 3300006358 Ga0068871_100025386 Ga0068871_1000253864 308
413 3300006844 Ga0075428_100392606 Ga0075428_1003926062 308
414 3300006881 Ga0068865_100003642 Ga0068865_1000036427 308
415 3300006931 Ga0097620_100273455 Ga0097620_1002734552 308
416 3300009098 Ga0105245_10110179 Ga0105245_101101791 308
417 3300009176 Ga0105242_10058443 Ga0105242_100584433 308
418 3300009177 Ga0105248_10174036 Ga0105248_101740362 308
419 3300009177 Ga0105248_10187291 Ga0105248_101872911 308
420 3300009553 Ga0105249_10021927 Ga0105249_100219272 308
421 3300009553 Ga0105249_10241456 Ga0105249_102414562 308
422 3300013100 Ga0157373_10043899 Ga0157373_100438992 308
423 3300013104 Ga0157370_10022125 Ga0157370_100221255 308
424 3300013104 Ga0157370_10026443 Ga0157370_100264434 308
425 3300013306 Ga0163162_10048032 Ga0163162_100480323 308
426 3300013306 Ga0163162_10113072 Ga0163162_101130722 308
427 3300013307 Ga0157372_10090554 Ga0157372_100905542 308
428 3300013307 Ga0157372_10251019 Ga0157372_102510192 308
429 3300013308 Ga0157375_10002885 Ga0157375_100028852 308
430 3300014325 Ga0163163_10154655 Ga0163163_101546552 308
431 3300014326 Ga0157380_10096019 Ga0157380_100960192 308
432 3300014968 Ga0157379_10125381 Ga0157379_101253811 308
433 3300017792 Ga0163161_10022874 Ga0163161_100228742 308
434 3300017792 Ga0163161_10040274 Ga0163161_100402743 308
435 3300025899 Ga0207642_10019622 Ga0207642_100196223 308
436 3300025903 Ga0207680_10128919 Ga0207680_101289192 308
437 3300025912 Ga0207707_10059921 Ga0207707_100599213 308
438 3300025919 Ga0207657_10046523 Ga0207657_100465235 308
439 3300025920 Ga0207649_10031690 Ga0207649_100316902 308
440 3300025921 Ga0207652_10019068 Ga0207652_100190684 308
441 3300025923 Ga0207681_10059152 Ga0207681_100591522 308
442 3300025925 Ga0207650_10005168 Ga0207650_100051688 308
443 3300025925 Ga0207650_10025039 Ga0207650_100250392 308
444 3300025925 Ga0207650_10117475 Ga0207650_101174752 308
445 3300025925 Ga0207650_10135378 Ga0207650_101353782 308
446 3300025926 Ga0207659_10312555 Ga0207659_103125552 308
447 3300025931 Ga0207644_10034668 Ga0207644_100346683 308
448 3300025931 Ga0207644_10172667 Ga0207644_101726672 308
449 3300025934 Ga0207686_10119143 Ga0207686_101191432 308
450 3300025937 Ga0207669_10013482 Ga0207669_100134823 308
451 3300025938 Ga0207704_10009976 Ga0207704_100099762 308
452 3300025940 Ga0207691_10003579 Ga0207691_1000357913 308
453 3300025940 Ga0207691_10004159 Ga0207691_100041596 308
454 3300025942 Ga0207689_10005585 Ga0207689_1000558511 308
455 3300025960 Ga0207651_10028614 Ga0207651_100286143 308
456 3300025972 Ga0207668_10037112 Ga0207668_100371122 308
457 3300025986 Ga0207658_10051451 Ga0207658_100514513 308
458 3300026035 Ga0207703_10109175 Ga0207703_101091753 308
459 3300026088 Ga0207641_10023159 Ga0207641_100231594 308
460 3300026088 Ga0207641_10204402 Ga0207641_102044023 308
461 3300026089 Ga0207648_10010928 Ga0207648_100109285 308
462 3300026089 Ga0207648_10050141 Ga0207648_100501414 308
463 3300026095 Ga0207676_10003209 Ga0207676_100032099 308
464 3300026095 Ga0207676_10211577 Ga0207676_102115771 308
465 3300026116 Ga0207674_10022069 Ga0207674_100220694 308
466 3300026118 Ga0207675_100017152 Ga0207675_1000171524 308
467 3300026118 Ga0207675_100096111 Ga0207675_1000961112 308
468 3300026121 Ga0207683_10022316 Ga0207683_100223163 308
469 3300028379 Ga0268266_10175235 Ga0268266_101752352 308
470 3300028380 Ga0268265_10131196 Ga0268265_101311962 308
471 3300042001 Ga0439441_017770 Ga0439441_017770_201_1247 308
472 3300048915 Ga0496112_0108435 Ga0496112_0108435_1566_2576 308
473 3300049586 Ga0501070_0006738 Ga0501070_0006738_1902_2867 308
474 3300049588 Ga0501072_0059746 Ga0501072_0059746_201_1166 308
475 3300049589 Ga0501073_0009180 Ga0501073_0009180_2646_3611 308
476 3300049822 Ga0501035_0130693 Ga0501035_0130693_1107_2072 308
477 3300005293 Ga0065715_10116233 Ga0065715_101162332 309
478 3300005328 Ga0070676_10004721 Ga0070676_100047212 309
479 3300005328 Ga0070676_10027813 Ga0070676_100278132 309
480 3300005330 Ga0070690_100010995 Ga0070690_1000109954 309
481 3300005331 Ga0070670_100003022 Ga0070670_1000030222 309
482 3300005331 Ga0070670_100018840 Ga0070670_1000188403 309
483 3300005331 Ga0070670_100058387 Ga0070670_1000583873 309
484 3300005331 Ga0070670_100232640 Ga0070670_1002326401 309
485 3300005334 Ga0068869_100017352 Ga0068869_1000173522 309
486 3300005335 Ga0070666_10015504 Ga0070666_100155043 309
487 3300005336 Ga0070680_100028406 Ga0070680_1000284064 309
488 3300005337 Ga0070682_100013039 Ga0070682_1000130392 309
489 3300005338 Ga0068868_100023464 Ga0068868_1000234645 309
490 3300005338 Ga0068868_100103782 Ga0068868_1001037822 309
491 3300005339 Ga0070660_100000724 Ga0070660_1000007243 309
492 3300005339 Ga0070660_100091271 Ga0070660_1000912712 309
493 3300005340 Ga0070689_100005389 Ga0070689_1000053893 309
494 3300005340 Ga0070689_100148884 Ga0070689_1001488841 309
495 3300005344 Ga0070661_100005119 Ga0070661_1000051198 309
496 3300005345 Ga0070692_10033452 Ga0070692_100334522 309
497 3300005347 Ga0070668_100105961 Ga0070668_1001059612 309
498 3300005347 Ga0070668_100118729 Ga0070668_1001187292 309
499 3300005353 Ga0070669_100002694 Ga0070669_1000026949 309
500 3300005353 Ga0070669_100007605 Ga0070669_1000076053 309
501 3300005354 Ga0070675_100057957 Ga0070675_1000579573 309
502 3300005354 Ga0070675_100111503 Ga0070675_1001115032 309
503 3300005354 Ga0070675_100364342 Ga0070675_1003643422 309
504 3300005355 Ga0070671_100002660 Ga0070671_1000026609 309
505 3300005355 Ga0070671_100021571 Ga0070671_1000215715 309
506 3300005355 Ga0070671_100396199 Ga0070671_1003961991 309
507 3300005356 Ga0070674_100017868 Ga0070674_1000178683 309
508 3300005356 Ga0070674_100031410 Ga0070674_1000314101 309
509 3300005356 Ga0070674_100375787 Ga0070674_1003757871 309
510 3300005364 Ga0070673_100000781 Ga0070673_1000007819 309
511 3300005365 Ga0070688_100002928 Ga0070688_1000029283 309
512 3300005366 Ga0070659_100004500 Ga0070659_10000450010 309
513 3300005366 Ga0070659_100051079 Ga0070659_1000510791 309
514 3300005367 Ga0070667_100006019 Ga0070667_1000060198 309
515 3300005367 Ga0070667_100029920 Ga0070667_1000299203 309
516 3300005367 Ga0070667_100048324 Ga0070667_1000483243 309
517 3300005367 Ga0070667_100150958 Ga0070667_1001509582 309
518 3300005434 Ga0070709_10046145 Ga0070709_100461452 309
519 3300005435 Ga0070714_100519007 Ga0070714_1005190072 309
520 3300005436 Ga0070713_100167543 Ga0070713_1001675431 309
521 3300005437 Ga0070710_10020640 Ga0070710_100206401 309
522 3300005438 Ga0070701_10031766 Ga0070701_100317662 309
523 3300005439 Ga0070711_100057321 Ga0070711_1000573213 309
524 3300005439 Ga0070711_100292887 Ga0070711_1002928871 309
525 3300005440 Ga0070705_100009362 Ga0070705_1000093625 309
526 3300005440 Ga0070705_100143361 Ga0070705_1001433612 309
527 3300005444 Ga0070694_100037288 Ga0070694_1000372883 309
528 3300005445 Ga0070708_100000207 Ga0070708_10000020723 309
529 3300005445 Ga0070708_100013833 Ga0070708_1000138332 309
530 3300005445 Ga0070708_100157507 Ga0070708_1001575073 309
531 3300005455 Ga0070663_100004359 Ga0070663_1000043594 309
532 3300005455 Ga0070663_100085310 Ga0070663_1000853102 309
533 3300005455 Ga0070663_100215697 Ga0070663_1002156972 309
534 3300005456 Ga0070678_100015662 Ga0070678_1000156623 309
535 3300005457 Ga0070662_100001938 Ga0070662_1000019385 309
536 3300005457 Ga0070662_100105418 Ga0070662_1001054184 309
537 3300005458 Ga0070681_10032263 Ga0070681_100322634 309
538 3300005459 Ga0068867_100001219 Ga0068867_10000121912 309
539 3300005459 Ga0068867_100032888 Ga0068867_1000328883 309
540 3300005459 Ga0068867_100069617 Ga0068867_1000696173 309
541 3300005459 Ga0068867_100071110 Ga0068867_1000711103 309
542 3300005466 Ga0070685_10033508 Ga0070685_100335083 309
543 3300005466 Ga0070685_10124569 Ga0070685_101245691 309
544 3300005467 Ga0070706_100014759 Ga0070706_1000147595 309
545 3300005467 Ga0070706_100021479 Ga0070706_1000214795 309
546 3300005467 Ga0070706_100303711 Ga0070706_1003037112 309
547 3300005468 Ga0070707_100053719 Ga0070707_1000537193 309
548 3300005468 Ga0070707_100228470 Ga0070707_1002284701 309
549 3300005471 Ga0070698_100160694 Ga0070698_1001606942 309
550 3300005518 Ga0070699_100065339 Ga0070699_1000653392 309
551 3300005530 Ga0070679_100095712 Ga0070679_1000957123 309
552 3300005530 Ga0070679_100171380 Ga0070679_1001713802 309
553 3300005535 Ga0070684_100077446 Ga0070684_1000774463 309
554 3300005536 Ga0070697_100137959 Ga0070697_1001379591 309
555 3300005539 Ga0068853_100006566 Ga0068853_1000065662 309
556 3300005539 Ga0068853_100385458 Ga0068853_1003854582 309
557 3300005543 Ga0070672_100008331 Ga0070672_1000083318 309
558 3300005543 Ga0070672_100267940 Ga0070672_1002679402 309
559 3300005545 Ga0070695_100292465 Ga0070695_1002924651 309
560 3300005546 Ga0070696_100096392 Ga0070696_1000963922 309
561 3300005547 Ga0070693_100000167 Ga0070693_1000001675 309
562 3300005548 Ga0070665_100086087 Ga0070665_1000860874 309
563 3300005548 Ga0070665_100100363 Ga0070665_1001003633 309
564 3300005548 Ga0070665_100168298 Ga0070665_1001682982 309
565 3300005549 Ga0070704_100252825 Ga0070704_1002528252 309
566 3300005563 Ga0068855_100001160 Ga0068855_10000116022 309
567 3300005563 Ga0068855_100231263 Ga0068855_1002312632 309
568 3300005563 Ga0068855_100390756 Ga0068855_1003907562 309
569 3300005564 Ga0070664_100000955 Ga0070664_10000095515 309
570 3300005564 Ga0070664_100039893 Ga0070664_1000398933 309
571 3300005564 Ga0070664_100245147 Ga0070664_1002451471 309
572 3300005577 Ga0068857_100001623 Ga0068857_1000016239 309
573 3300005578 Ga0068854_100002132 Ga0068854_1000021323 309
574 3300005578 Ga0068854_100047083 Ga0068854_1000470833 309
575 3300005614 Ga0068856_100001343 Ga0068856_10000134322 309
576 3300005615 Ga0070702_100055567 Ga0070702_1000555672 309
577 3300005615 Ga0070702_100082392 Ga0070702_1000823922 309
578 3300005617 Ga0068859_100001484 Ga0068859_10000148416 309
579 3300005617 Ga0068859_100005749 Ga0068859_10000574912 309
580 3300005617 Ga0068859_100009886 Ga0068859_1000098865 309
581 3300005617 Ga0068859_100171956 Ga0068859_1001719562 309
582 3300005617 Ga0068859_100382569 Ga0068859_1003825692 309
583 3300005618 Ga0068864_100002372 Ga0068864_1000023728 309
584 3300005618 Ga0068864_100009418 Ga0068864_1000094185 309
585 3300005618 Ga0068864_100012050 Ga0068864_1000120505 309
586 3300005618 Ga0068864_100288362 Ga0068864_1002883622 309
587 3300005718 Ga0068866_10004687 Ga0068866_100046873 309
588 3300005719 Ga0068861_100000187 Ga0068861_1000001876 309
589 3300005719 Ga0068861_100032868 Ga0068861_1000328682 309
590 3300005840 Ga0068870_10002579 Ga0068870_100025792 309
591 3300005840 Ga0068870_10036417 Ga0068870_100364172 309
592 3300005841 Ga0068863_100006037 Ga0068863_10000603710 309
593 3300005841 Ga0068863_100017026 Ga0068863_1000170267 309
594 3300005841 Ga0068863_100067668 Ga0068863_1000676682 309
595 3300005841 Ga0068863_100089366 Ga0068863_1000893663 309
596 3300005841 Ga0068863_100105364 Ga0068863_1001053643 309
597 3300005842 Ga0068858_100018888 Ga0068858_1000188888 309
598 3300005842 Ga0068858_100059857 Ga0068858_1000598573 309
599 3300005843 Ga0068860_100002049 Ga0068860_10000204912 309
600 3300005843 Ga0068860_100011724 Ga0068860_1000117248 309
601 3300005843 Ga0068860_100015024 Ga0068860_1000150245 309
602 3300005843 Ga0068860_100037387 Ga0068860_1000373873 309
603 3300005843 Ga0068860_100080420 Ga0068860_1000804203 309
604 3300005843 Ga0068860_100490388 Ga0068860_1004903881 309
605 3300005844 Ga0068862_100032015 Ga0068862_1000320155 309
606 3300005844 Ga0068862_100061523 Ga0068862_1000615233 309
607 3300005844 Ga0068862_100133897 Ga0068862_1001338973 309
608 3300006175 Ga0070712_100057002 Ga0070712_1000570022 309
609 3300006237 Ga0097621_100000972 Ga0097621_1000009729 309
610 3300006237 Ga0097621_100185151 Ga0097621_1001851512 309
611 3300006358 Ga0068871_100038217 Ga0068871_1000382172 309
612 3300006871 Ga0075434_100099450 Ga0075434_1000994503 309
613 3300006881 Ga0068865_100129330 Ga0068865_1001293302 309
614 3300006881 Ga0068865_100184963 Ga0068865_1001849632 309
615 3300006914 Ga0075436_100251542 Ga0075436_1002515422 309
616 3300006931 Ga0097620_100001484 Ga0097620_1000014848 309
617 3300006931 Ga0097620_100005749 Ga0097620_10000574912 309
618 3300006931 Ga0097620_100009886 Ga0097620_1000098865 309
619 3300006931 Ga0097620_100171954 Ga0097620_1001719542 309
620 3300006931 Ga0097620_100382578 Ga0097620_1003825782 309
621 3300007076 Ga0075435_100147197 Ga0075435_1001471972 309
622 3300009098 Ga0105245_10012549 Ga0105245_100125493 309
623 3300009098 Ga0105245_10097497 Ga0105245_100974973 309
624 3300009098 Ga0105245_10179197 Ga0105245_101791971 309
625 3300009101 Ga0105247_10012360 Ga0105247_100123603 309
626 3300009176 Ga0105242_10585788 Ga0105242_105857881 309
627 3300009177 Ga0105248_10010030 Ga0105248_100100304 309
628 3300009177 Ga0105248_10472094 Ga0105248_104720942 309
629 3300009545 Ga0105237_10132236 Ga0105237_101322362 309
630 3300010375 Ga0105239_10105346 Ga0105239_101053462 309
631 3300013100 Ga0157373_10000447 Ga0157373_1000044717 309
632 3300013102 Ga0157371_10001482 Ga0157371_1000148217 309
633 3300013104 Ga0157370_10003331 Ga0157370_1000333118 309
634 3300013104 Ga0157370_10093375 Ga0157370_100933752 309
635 3300013105 Ga0157369_10046834 Ga0157369_100468342 309
636 3300013105 Ga0157369_10210252 Ga0157369_102102522 309
637 3300013296 Ga0157374_10021298 Ga0157374_100212985 309
638 3300013297 Ga0157378_10008577 Ga0157378_100085774 309
639 3300013297 Ga0157378_10022887 Ga0157378_100228875 309
640 3300013297 Ga0157378_10023714 Ga0157378_100237143 309
641 3300013297 Ga0157378_10136278 Ga0157378_101362783 309
642 3300013306 Ga0163162_10002232 Ga0163162_1000223210 309
643 3300013306 Ga0163162_10011501 Ga0163162_100115013 309
644 3300013306 Ga0163162_10170868 Ga0163162_101708683 309
645 3300013307 Ga0157372_10004508 Ga0157372_100045087 309
646 3300013307 Ga0157372_10358940 Ga0157372_103589402 309
647 3300013308 Ga0157375_10007037 Ga0157375_100070375 309
648 3300013308 Ga0157375_10009095 Ga0157375_100090952 309
649 3300013308 Ga0157375_10127714 Ga0157375_101277143 309
650 3300013308 Ga0157375_10200422 Ga0157375_102004222 309
651 3300013308 Ga0157375_10250873 Ga0157375_102508733 309
652 3300014325 Ga0163163_10006684 Ga0163163_100066843 309
653 3300014325 Ga0163163_10281184 Ga0163163_102811842 309
654 3300014745 Ga0157377_10014176 Ga0157377_100141762 309
655 3300014968 Ga0157379_10001106 Ga0157379_1000110614 309
656 3300014968 Ga0157379_10002047 Ga0157379_100020472 309
657 3300014968 Ga0157379_10004185 Ga0157379_1000418510 309
658 3300014968 Ga0157379_10237701 Ga0157379_102377012 309
659 3300014969 Ga0157376_10010457 Ga0157376_100104571 309
660 3300014969 Ga0157376_10122392 Ga0157376_101223923 309
661 3300025315 Ga0207697_10009495 Ga0207697_100094955 309
662 3300025315 Ga0207697_10012374 Ga0207697_100123743 309
663 3300025885 Ga0207653_10051330 Ga0207653_100513302 309
664 3300025898 Ga0207692_10016570 Ga0207692_100165704 309
665 3300025899 Ga0207642_10002368 Ga0207642_100023686 309
666 3300025905 Ga0207685_10005968 Ga0207685_100059682 309
667 3300025907 Ga0207645_10001058 Ga0207645_100010588 309
668 3300025910 Ga0207684_10027046 Ga0207684_100270464 309
669 3300025910 Ga0207684_10120923 Ga0207684_101209231 309
670 3300025910 Ga0207684_10272337 Ga0207684_102723372 309
671 3300025915 Ga0207693_10002176 Ga0207693_100021764 309
672 3300025915 Ga0207693_10012772 Ga0207693_100127723 309
673 3300025919 Ga0207657_10000371 Ga0207657_1000037142 309
674 3300025919 Ga0207657_10021571 Ga0207657_100215712 309
675 3300025920 Ga0207649_10073901 Ga0207649_100739012 309
676 3300025921 Ga0207652_10062293 Ga0207652_100622933 309
677 3300025921 Ga0207652_10101618 Ga0207652_101016182 309
678 3300025923 Ga0207681_10003039 Ga0207681_100030395 309
679 3300025923 Ga0207681_10007075 Ga0207681_100070753 309
680 3300025925 Ga0207650_10050810 Ga0207650_100508103 309
681 3300025925 Ga0207650_10078797 Ga0207650_100787972 309
682 3300025925 Ga0207650_10086907 Ga0207650_100869073 309
683 3300025925 Ga0207650_10134836 Ga0207650_101348362 309
684 3300025925 Ga0207650_10348937 Ga0207650_103489371 309
685 3300025926 Ga0207659_10002989 Ga0207659_100029898 309
686 3300025926 Ga0207659_10039362 Ga0207659_100393624 309
687 3300025926 Ga0207659_10042751 Ga0207659_100427512 309
688 3300025927 Ga0207687_10001668 Ga0207687_100016686 309
689 3300025927 Ga0207687_10022739 Ga0207687_100227394 309
690 3300025927 Ga0207687_10137867 Ga0207687_101378671 309
691 3300025929 Ga0207664_10001654 Ga0207664_100016546 309
692 3300025931 Ga0207644_10005084 Ga0207644_100050844 309
693 3300025931 Ga0207644_10014130 Ga0207644_100141303 309
694 3300025931 Ga0207644_10018467 Ga0207644_100184674 309
695 3300025931 Ga0207644_10163062 Ga0207644_101630622 309
696 3300025931 Ga0207644_10203741 Ga0207644_102037412 309
697 3300025932 Ga0207690_10004056 Ga0207690_100040565 309
698 3300025933 Ga0207706_10003193 Ga0207706_100031939 309
699 3300025933 Ga0207706_10079309 Ga0207706_100793092 309
700 3300025933 Ga0207706_10111896 Ga0207706_101118963 309
701 3300025933 Ga0207706_10112050 Ga0207706_101120504 309
702 3300025934 Ga0207686_10000198 Ga0207686_1000019810 309
703 3300025935 Ga0207709_10098015 Ga0207709_100980152 309
704 3300025936 Ga0207670_10053128 Ga0207670_100531283 309
705 3300025936 Ga0207670_10069615 Ga0207670_100696153 309
706 3300025937 Ga0207669_10311747 Ga0207669_103117472 309
707 3300025938 Ga0207704_10080526 Ga0207704_100805262 309
708 3300025938 Ga0207704_10216624 Ga0207704_102166242 309
709 3300025939 Ga0207665_10014015 Ga0207665_100140153 309
710 3300025939 Ga0207665_10043053 Ga0207665_100430533 309
711 3300025940 Ga0207691_10000041 Ga0207691_1000004180 309
712 3300025940 Ga0207691_10009490 Ga0207691_100094907 309
713 3300025940 Ga0207691_10129154 Ga0207691_101291542 309
714 3300025940 Ga0207691_10176499 Ga0207691_101764992 309
715 3300025940 Ga0207691_10223429 Ga0207691_102234291 309
716 3300025941 Ga0207711_10003428 Ga0207711_1000342812 309
717 3300025941 Ga0207711_10141164 Ga0207711_101411642 309
718 3300025941 Ga0207711_10342706 Ga0207711_103427062 309
719 3300025942 Ga0207689_10027083 Ga0207689_100270834 309
720 3300025942 Ga0207689_10040648 Ga0207689_100406482 309
721 3300025945 Ga0207679_10001683 Ga0207679_100016835 309
722 3300025945 Ga0207679_10115313 Ga0207679_101153133 309
723 3300025945 Ga0207679_10277827 Ga0207679_102778271 309
724 3300025949 Ga0207667_10003619 Ga0207667_100036197 309
725 3300025949 Ga0207667_10195073 Ga0207667_101950732 309
726 3300025949 Ga0207667_10345781 Ga0207667_103457812 309
727 3300025960 Ga0207651_10001393 Ga0207651_100013933 309
728 3300025972 Ga0207668_10001997 Ga0207668_100019977 309
729 3300025972 Ga0207668_10009587 Ga0207668_100095874 309
730 3300025972 Ga0207668_10150037 Ga0207668_101500372 309
731 3300025986 Ga0207658_10002334 Ga0207658_100023349 309
732 3300025986 Ga0207658_10006384 Ga0207658_100063848 309
733 3300025986 Ga0207658_10061091 Ga0207658_100610914 309
734 3300025986 Ga0207658_10132864 Ga0207658_101328643 309
735 3300025986 Ga0207658_10245612 Ga0207658_102456122 309
736 3300026023 Ga0207677_10000799 Ga0207677_100007998 309
737 3300026023 Ga0207677_10011028 Ga0207677_100110282 309
738 3300026023 Ga0207677_10109751 Ga0207677_101097512 309
739 3300026023 Ga0207677_10149734 Ga0207677_101497342 309
740 3300026023 Ga0207677_10194732 Ga0207677_101947322 309
741 3300026035 Ga0207703_10000143 Ga0207703_100001438 309
742 3300026035 Ga0207703_10009453 Ga0207703_100094533 309
743 3300026041 Ga0207639_10024584 Ga0207639_100245843 309
744 3300026041 Ga0207639_10394692 Ga0207639_103946922 309
745 3300026067 Ga0207678_10034156 Ga0207678_100341563 309
746 3300026078 Ga0207702_10003083 Ga0207702_100030839 309
747 3300026088 Ga0207641_10007742 Ga0207641_100077427 309
748 3300026088 Ga0207641_10008173 Ga0207641_100081739 309
749 3300026088 Ga0207641_10009450 Ga0207641_100094503 309
750 3300026088 Ga0207641_10119853 Ga0207641_101198533 309
751 3300026088 Ga0207641_10232239 Ga0207641_102322392 309
752 3300026088 Ga0207641_10263971 Ga0207641_102639712 309
753 3300026089 Ga0207648_10000601 Ga0207648_1000060127 309
754 3300026089 Ga0207648_10002730 Ga0207648_1000273017 309
755 3300026089 Ga0207648_10065770 Ga0207648_100657703 309
756 3300026089 Ga0207648_10143825 Ga0207648_101438252 309
757 3300026095 Ga0207676_10000837 Ga0207676_1000083710 309
758 3300026095 Ga0207676_10004178 Ga0207676_100041788 309
759 3300026095 Ga0207676_10406325 Ga0207676_104063252 309
760 3300026116 Ga0207674_10003466 Ga0207674_1000346611 309
761 3300026118 Ga0207675_100000517 Ga0207675_10000051721 309
762 3300026118 Ga0207675_100016774 Ga0207675_1000167743 309
763 3300026118 Ga0207675_100100218 Ga0207675_1001002183 309
764 3300026121 Ga0207683_10000011 Ga0207683_1000001137 309
765 3300026121 Ga0207683_10199082 Ga0207683_101990822 309
766 3300026142 Ga0207698_10071607 Ga0207698_100716072 309
767 3300027665 Ga0209983_1015175 Ga0209983_10151752 309
768 3300027682 Ga0209971_1005384 Ga0209971_10053843 309
769 3300028379 Ga0268266_10032521 Ga0268266_100325214 309
770 3300028379 Ga0268266_10060826 Ga0268266_100608262 309
771 3300028379 Ga0268266_10133826 Ga0268266_101338262 309
772 3300028379 Ga0268266_10171313 Ga0268266_101713133 309
773 3300028380 Ga0268265_10015632 Ga0268265_100156324 309
774 3300028380 Ga0268265_10019444 Ga0268265_100194445 309
775 3300028380 Ga0268265_10410493 Ga0268265_104104932 309
776 3300028381 Ga0268264_10000641 Ga0268264_1000064117 309
777 3300028381 Ga0268264_10003919 Ga0268264_100039199 309
778 3300028381 Ga0268264_10020018 Ga0268264_100200182 309
779 3300028381 Ga0268264_10025067 Ga0268264_100250674 309
780 3300028381 Ga0268264_10045620 Ga0268264_100456203 309
781 3300028381 Ga0268264_10167528 Ga0268264_101675282 309
782 3300031235 Ga0265330_10010054 Ga0265330_100100542 309
783 3300031238 Ga0265332_10001333 Ga0265332_100013335 309
784 3300031249 Ga0265339_10064615 Ga0265339_100646152 309
785 3300031250 Ga0265331_10000310 Ga0265331_1000031031 309
786 3300031251 Ga0265327_10002920 Ga0265327_100029205 309
787 3300031344 Ga0265316_10052062 Ga0265316_100520622 309
788 3300031548 Ga0307408_100004310 Ga0307408_1000043103 309
789 3300031711 Ga0265314_10003412 Ga0265314_100034124 309
790 3300031731 Ga0307405_10001375 Ga0307405_100013752 309
791 3300031824 Ga0307413_10013300 Ga0307413_100133002 309
792 3300031852 Ga0307410_10008880 Ga0307410_100088803 309
793 3300031901 Ga0307406_10025843 Ga0307406_100258433 309
794 3300031903 Ga0307407_10010883 Ga0307407_100108832 309
795 3300031911 Ga0307412_10030015 Ga0307412_100300151 309
796 3300031995 Ga0307409_100012433 Ga0307409_1000124333 309
797 3300032002 Ga0307416_100010652 Ga0307416_1000106522 309
798 3300032004 Ga0307414_10056839 Ga0307414_100568393 309
799 3300032005 Ga0307411_10000280 Ga0307411_100002807 309
800 3300032126 Ga0307415_100030087 Ga0307415_1000300872 309
801 3300035083 Ga0373926_0035913 Ga0373926_0035913_289_1236 309
802 3300035119 Ga0373956_0018705 Ga0373956_0018705_1754_2701 309
803 3300035119 Ga0373956_0027005 Ga0373956_0027005_1118_2065 309
804 3300035170 Ga0373943_0040108 Ga0373943_0040108_451_1398 309
805 3300035171 Ga0373946_0038180 Ga0373946_0038180_249_1196 309
806 3300035410 Ga0373924_0053614 Ga0373924_0053614_229_1176 309
807 3300035691 Ga0373931_0047147 Ga0373931_0047147_390_1322 309
808 3300035691 Ga0373931_0070837 Ga0373931_0070837_815_1753 309
809 3300035692 Ga0373935_0056925 Ga0373935_0056925_800_1747 309
810 3300035692 Ga0373935_0140824 Ga0373935_0140824_604_1539 309
811 3300035695 Ga0373927_0009964 Ga0373927_0009964_4242_5189 309
812 3300035695 Ga0373927_0065625 Ga0373927_0065625_92_1036 309
813 3300035724 Ga0373933_0046747 Ga0373933_0046747_783_1730 309
814 3300035724 Ga0373933_0128305 Ga0373933_0128305_147_1079 309
815 3300035725 Ga0373947_0034332 Ga0373947_0034332_1113_2060 309
816 3300035725 Ga0373947_0144067 Ga0373947_0144067_459_1406 309
817 3300036401 Ga0373937_0025706 Ga0373937_0025706_723_1670 309
818 3300036401 Ga0373937_0136086 Ga0373937_0136086_223_1170 309
819 3300036401 Ga0373937_0170311 Ga0373937_0170311_800_1747 309
820 3300037068 Ga0373925_0027934 Ga0373925_0027934_1828_2763 309
821 3300037068 Ga0373925_0037859 Ga0373925_0037859_770_1717 309
822 3300037068 Ga0373925_0237920 Ga0373925_0237920_364_1311 309
823 3300042005 Ga0439448_0015880 Ga0439448_0015880_552_1499 309
824 3300042876 Ga0451577_0183588 Ga0451577_0183588_909_1841 309
825 3300042876 Ga0451577_0247110 Ga0451577_0247110_509_1444 309
826 3300044694 Ga0466963_0037905 Ga0466963_0037905_977_1942 309
827 3300045976 Ga0466967_0060125 Ga0466967_0060125_491_1456 309
828 3300046455 Ga0495603_0032134 Ga0495603_0032134_579_1526 309
829 3300046459 Ga0495629_0008490 Ga0495629_0008490_1442_2389 309
830 3300046472 Ga0495580_0025942 Ga0495580_0025942_2559_3506 309
831 3300046472 Ga0495580_0134757 Ga0495580_0134757_412_1353 309
832 3300046472 Ga0495580_0135755 Ga0495580_0135755_82_1026 309
833 3300046473 Ga0495582_0033204 Ga0495582_0033204_716_1663 309
834 3300046475 Ga0495639_0010739 Ga0495639_0010739_2356_3303 309
835 3300046476 Ga0495662_0012744 Ga0495662_0012744_650_1597 309
836 3300046477 Ga0495664_0206648 Ga0495664_0206648_27_974 309
837 3300046499 Ga0495594_0133825 Ga0495594_0133825_85_1032 309
838 3300046516 Ga0495628_0240187 Ga0495628_0240187_154_1101 309
839 3300046517 Ga0495630_0166857 Ga0495630_0166857_442_1389 309
840 3300046526 Ga0495666_0072732 Ga0495666_0072732_132_1079 309
841 3300046533 Ga0495640_0016426 Ga0495640_0016426_4295_5242 309
842 3300046539 Ga0495621_0038213 Ga0495621_0038213_387_1334 309
843 3300046543 Ga0495645_0009637 Ga0495645_0009637_538_1485 309
844 3300046543 Ga0495645_0088405 Ga0495645_0088405_384_1331 309
845 3300046559 Ga0495667_0048450 Ga0495667_0048450_1728_2675 309
846 3300046663 Ga0495635_0035566 Ga0495635_0035566_800_1747 309
847 3300046674 Ga0495588_0153647 Ga0495588_0153647_217_1164 309
848 3300046678 Ga0495599_0110823 Ga0495599_0110823_210_1157 309
849 3300046679 Ga0495623_0053021 Ga0495623_0053021_1356_2303 309
850 3300046681 Ga0495647_0008144 Ga0495647_0008144_1559_2506 309
851 3300046809 Ga0495600_0012682 Ga0495600_0012682_1252_2199 309
852 3300047315 Ga0495581_0001341 Ga0495581_0001341_11252_12199 309
853 3300047319 Ga0495674_0105678 Ga0495674_0105678_904_1851 309
854 3300047322 Ga0495680_0084404 Ga0495680_0084404_1086_2033 309
855 3300047471 Ga0495684_0068442 Ga0495684_0068442_350_1297 309
856 3300047673 Ga0495593_0026218 Ga0495593_0026218_1805_2752 309
857 3300048089 Ga0495614_0018592 Ga0495614_0018592_431_1378 309
858 3300048903 Ga0496100_0063644 Ga0496100_0063644_833_1780 309
859 3300048904 Ga0496101_0150811 Ga0496101_0150811_249_1196 309
860 3300048905 Ga0496102_0004733 Ga0496102_0004733_2414_3352 309
861 3300048905 Ga0496102_0049371 Ga0496102_0049371_1759_2814 309
862 3300048905 Ga0496102_0061780 Ga0496102_0061780_60_992 309
863 3300048906 Ga0496103_0063096 Ga0496103_0063096_883_1821 309
864 3300048906 Ga0496103_0105565 Ga0496103_0105565_214_1146 309
865 3300048907 Ga0496104_0008261 Ga0496104_0008261_7043_7990 309
866 3300048907 Ga0496104_0165794 Ga0496104_0165794_708_1637 309
867 3300048908 Ga0496105_0043192 Ga0496105_0043192_1426_2373 309
868 3300048909 Ga0496106_0000409 Ga0496106_0000409_16560_17498 309
869 3300048909 Ga0496106_0250476 Ga0496106_0250476_36_968 309
870 3300048909 Ga0496106_0261029 Ga0496106_0261029_404_1351 309
871 3300048910 Ga0496107_0001779 Ga0496107_0001779_492_1430 309
872 3300048910 Ga0496107_0154722 Ga0496107_0154722_227_1174 309
873 3300048911 Ga0496108_0117995 Ga0496108_0117995_49_996 309
874 3300048912 Ga0496109_0058897 Ga0496109_0058897_1814_2746 309
875 3300048912 Ga0496109_0107524 Ga0496109_0107524_1300_2247 309
876 3300048912 Ga0496109_0133532 Ga0496109_0133532_1354_2286 309
877 3300048913 Ga0496110_0106413 Ga0496110_0106413_841_1773 309
878 3300048915 Ga0496112_0002525 Ga0496112_0002525_3459_4400 309
879 3300048915 Ga0496112_0017345 Ga0496112_0017345_4034_4981 309
880 3300048917 Ga0496114_0066614 Ga0496114_0066614_1001_1948 309
881 3300053078 Ga0495612_0071855 Ga0495612_0071855_279_1226 309
882 3300053084 Ga0495595_0021137 Ga0495595_0021137_1751_2698 309
883 3300053084 Ga0495595_0090214 Ga0495595_0090214_331_1263 309
884 3300053085 Ga0495619_0040676 Ga0495619_0040676_1610_2557 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

39

207

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8k9g-assembly1.cif.gz_A cryo-em structure of crt-sparta-grna-tdna dimer (conformation-1) 0.9618 120 149
8t0j-assembly1.cif.gz_A salmonella typhimurium arnd 0.9219 1 299
8t0j-assembly1.cif.gz_A salmonella typhimurium arnd 0.9187 1 299
4m1b-assembly2.cif.gz_B structural determination of ba0150, a polysaccharide deacetylase from bacillus anthracis 0.8405 2 270
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.828 2 267
ID Description Score Start End Superfamily
af_P76472_1_267_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.864 1 266 3.30.70.260
af_P76472_1_267_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8553 1 266 3.30.70.260
4m1bB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8405 2 270 3.20.20.370
4l1gD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8176 2 268 3.20.20.370
5lgcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8147 2 271 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A7Y8JB32-F1-model_v4 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase 0.9687 2 304 GO:0005975
GO:0016810
AF-A0A084XY50-F1-model_v4 Putative 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD (EC 3.5.1.-) 0.9669 93 300 GO:0005975
GO:0016810
AF-A0A7V5XDF1-F1-model_v4 NodB homology domain-containing protein 0.9647 93 299 GO:0005975
GO:0016810
AF-G2FBZ7-F1-model_v4 Polymyxin resistance protein PmrJ 0.9613 85 299 GO:0005975
AF-A0A365VMQ7-F1-model_v4 deleted 0.9593 113 251

Feature Viewer

pLDDT pTM Quality
89.4 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map