F484619
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 884 | 325 | 884 | 311 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100028406|Ga0070680_1000284064 |
| Length | 351 |
| Sequence | MRTGGRSPRRGVWSIDDGRHAGARAAHPCRTAAEAAMSLLALKIDVDTLRGTREGVPALLDLLRRHQVGATFLFSVGPDHTGRAIKRIFRPGFFSKVRRTSVVHHYGVTTLLYGTALPGPDIGRRAADTMRAVRDEGFETGLHCWDHVKWQDGVAGADADWTARQMRRACERYTEVFKEPPRVHGAAGWQMNVDALRQTQVLGFDYCSDGRGTHPHLPVWNAELIRCPQLPTTLPTLDELIGIGGATADDAAARLLALTAPPETDGPLPSHVFTLHAELEGLRLAPTLELLLNGWKAQGYRLSSLRRLYETFEPMALPRCEVGLDPVPGRSGTLLCQRREFLGDVDLVRAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 184 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 189 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 209 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 210 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 211 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 233 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 234 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 235 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 236 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 237 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 243 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 287 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 288 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 297 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 310 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 320 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 322 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 323 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 324 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.79 |
| Nodule | 0 |
| Rhizoplane | 2.83 |
| Rhizosphere | 95.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10116233 | 3300005293 | Bacteria | 2387 |
| 2 | Ga0065707_10082407 | 3300005295 | Bacteria | 15525 |
| 3 | Ga0070658_10032537 | 3300005327 | Bacteria | 4192 |
| 4 | Ga0070658_10035028 | 3300005327 | Bacteria | 4042 |
| 5 | Ga0070658_10107589 | 3300005327 | Bacteria | 2308 |
| 6 | Ga0070658_10150425 | 3300005327 | Bacteria | 1949 |
| 7 | Ga0070658_10279917 | 3300005327 | Bacteria | 1420 |
| 8 | Ga0070676_10004721 | 3300005328 | Bacteria | 7201 |
| 9 | Ga0070676_10027813 | 3300005328 | Bacteria | 3210 |
| 10 | Ga0070676_10068314 | 3300005328 | Bacteria | 2127 |
| 11 | Ga0070676_10272219 | 3300005328 | Bacteria | 1138 |
| 12 | Ga0070683_100009335 | 3300005329 | Bacteria | 8383 |
| 13 | Ga0070683_100094423 | 3300005329 | Bacteria | 2811 |
| 14 | Ga0070690_100010995 | 3300005330 | Bacteria | 5284 |
| 15 | Ga0070690_100149440 | 3300005330 | Bacteria | 1593 |
| 16 | Ga0070670_100003022 | 3300005331 | Bacteria | 13909 |
| 17 | Ga0070670_100008816 | 3300005331 | Bacteria | 8608 |
| 18 | Ga0070670_100016066 | 3300005331 | Bacteria | 6424 |
| 19 | Ga0070670_100018840 | 3300005331 | Bacteria | 5919 |
| 20 | Ga0070670_100058387 | 3300005331 | Bacteria | 3313 |
| 21 | Ga0070670_100136518 | 3300005331 | Bacteria | 2119 |
| 22 | Ga0070670_100232640 | 3300005331 | Bacteria | 1604 |
| 23 | Ga0068869_100004739 | 3300005334 | Bacteria | 8485 |
| 24 | Ga0068869_100017352 | 3300005334 | Bacteria | 4877 |
| 25 | Ga0068869_100072865 | 3300005334 | Bacteria | 2546 |
| 26 | Ga0070666_10015504 | 3300005335 | Bacteria | 4862 |
| 27 | Ga0070666_10105763 | 3300005335 | Bacteria | 1944 |
| 28 | Ga0070680_100028406 | 3300005336 | Bacteria | 4486 |
| 29 | Ga0070680_100093295 | 3300005336 | Bacteria | 2494 |
| 30 | Ga0070680_100113380 | 3300005336 | Bacteria | 2258 |
| 31 | Ga0070680_100196864 | 3300005336 | Bacteria | 1699 |
| 32 | Ga0070682_100013039 | 3300005337 | Bacteria | 4772 |
| 33 | Ga0070682_100022407 | 3300005337 | Bacteria | 3741 |
| 34 | Ga0068868_100023464 | 3300005338 | Bacteria | 4670 |
| 35 | Ga0068868_100103782 | 3300005338 | Bacteria | 2303 |
| 36 | Ga0070660_100000724 | 3300005339 | Bacteria | 21893 |
| 37 | Ga0070660_100046204 | 3300005339 | Bacteria | 3337 |
| 38 | Ga0070660_100091271 | 3300005339 | Bacteria | 2402 |
| 39 | Ga0070660_100140313 | 3300005339 | Bacteria | 1938 |
| 40 | Ga0070660_100182922 | 3300005339 | Bacteria | 1696 |
| 41 | Ga0070689_100005389 | 3300005340 | Bacteria | 8727 |
| 42 | Ga0070689_100148884 | 3300005340 | Bacteria | 1887 |
| 43 | Ga0070691_10040216 | 3300005341 | Bacteria | 2210 |
| 44 | Ga0070687_100146759 | 3300005343 | Bacteria | 1380 |
| 45 | Ga0070661_100005119 | 3300005344 | Bacteria | 9037 |
| 46 | Ga0070661_100007598 | 3300005344 | Bacteria | 7477 |
| 47 | Ga0070661_100022620 | 3300005344 | Bacteria | 4501 |
| 48 | Ga0070661_100163491 | 3300005344 | Bacteria | 1687 |
| 49 | Ga0070661_100214918 | 3300005344 | Bacteria | 1473 |
| 50 | Ga0070661_100348177 | 3300005344 | Bacteria | 1162 |
| 51 | Ga0070692_10033452 | 3300005345 | Bacteria | 2590 |
| 52 | Ga0070668_100046878 | 3300005347 | Bacteria | 3322 |
| 53 | Ga0070668_100105961 | 3300005347 | Bacteria | 2233 |
| 54 | Ga0070668_100118729 | 3300005347 | Bacteria | 2111 |
| 55 | Ga0070668_100197707 | 3300005347 | Bacteria | 1649 |
| 56 | Ga0070668_100202278 | 3300005347 | Bacteria | 1631 |
| 57 | Ga0070669_100002694 | 3300005353 | Bacteria | 12804 |
| 58 | Ga0070669_100007605 | 3300005353 | Bacteria | 7747 |
| 59 | Ga0070669_100012251 | 3300005353 | Bacteria | 6085 |
| 60 | Ga0070675_100019261 | 3300005354 | Bacteria | 5436 |
| 61 | Ga0070675_100020262 | 3300005354 | Bacteria | 5305 |
| 62 | Ga0070675_100057957 | 3300005354 | Bacteria | 3194 |
| 63 | Ga0070675_100094290 | 3300005354 | Bacteria | 2511 |
| 64 | Ga0070675_100111503 | 3300005354 | Bacteria | 2315 |
| 65 | Ga0070675_100156214 | 3300005354 | Unclassified | 1959 |
| 66 | Ga0070675_100364342 | 3300005354 | Bacteria | 1284 |
| 67 | Ga0070671_100002660 | 3300005355 | Bacteria | 13841 |
| 68 | Ga0070671_100021571 | 3300005355 | Bacteria | 5261 |
| 69 | Ga0070671_100049314 | 3300005355 | Bacteria | 3503 |
| 70 | Ga0070671_100224776 | 3300005355 | Bacteria | 1593 |
| 71 | Ga0070671_100396199 | 3300005355 | Bacteria | 1181 |
| 72 | Ga0070674_100017868 | 3300005356 | Bacteria | 4470 |
| 73 | Ga0070674_100031410 | 3300005356 | Bacteria | 3519 |
| 74 | Ga0070674_100375787 | 3300005356 | Bacteria | 1155 |
| 75 | Ga0070674_100401020 | 3300005356 | Bacteria | 1121 |
| 76 | Ga0070673_100000781 | 3300005364 | Bacteria | 17709 |
| 77 | Ga0070673_100002674 | 3300005364 | Bacteria | 10908 |
| 78 | Ga0070688_100002928 | 3300005365 | Bacteria | 8705 |
| 79 | Ga0070688_100011341 | 3300005365 | Bacteria | 4951 |
| 80 | Ga0070659_100004500 | 3300005366 | Bacteria | 9957 |
| 81 | Ga0070659_100009887 | 3300005366 | Bacteria | 7016 |
| 82 | Ga0070659_100051079 | 3300005366 | Bacteria | 3250 |
| 83 | Ga0070667_100006019 | 3300005367 | Bacteria | 10080 |
| 84 | Ga0070667_100029920 | 3300005367 | Bacteria | 4540 |
| 85 | Ga0070667_100030235 | 3300005367 | Bacteria | 4517 |
| 86 | Ga0070667_100048324 | 3300005367 | Bacteria | 3581 |
| 87 | Ga0070667_100150958 | 3300005367 | Bacteria | 2041 |
| 88 | Ga0070709_10046145 | 3300005434 | Bacteria | 2708 |
| 89 | Ga0070709_10055690 | 3300005434 | Bacteria | 2498 |
| 90 | Ga0070714_100007199 | 3300005435 | Bacteria | 8635 |
| 91 | Ga0070714_100128714 | 3300005435 | Bacteria | 2261 |
| 92 | Ga0070714_100519007 | 3300005435 | Bacteria | 1138 |
| 93 | Ga0070713_100000182 | 3300005436 | Bacteria | 41753 |
| 94 | Ga0070713_100003229 | 3300005436 | Bacteria | 10739 |
| 95 | Ga0070713_100167543 | 3300005436 | Bacteria | 1965 |
| 96 | Ga0070710_10020640 | 3300005437 | Bacteria | 3421 |
| 97 | Ga0070701_10031766 | 3300005438 | Bacteria | 2622 |
| 98 | Ga0070701_10057766 | 3300005438 | Bacteria | 2035 |
| 99 | Ga0070711_100057321 | 3300005439 | Bacteria | 2697 |
| 100 | Ga0070711_100259675 | 3300005439 | Bacteria | 1366 |
| 101 | Ga0070711_100292887 | 3300005439 | Bacteria | 1291 |
| 102 | Ga0070705_100009362 | 3300005440 | Bacteria | 4868 |
| 103 | Ga0070705_100143361 | 3300005440 | Bacteria | 1575 |
| 104 | Ga0070700_100205572 | 3300005441 | Bacteria | 1386 |
| 105 | Ga0070694_100037288 | 3300005444 | Bacteria | 3224 |
| 106 | Ga0070708_100000207 | 3300005445 | Bacteria | 43511 |
| 107 | Ga0070708_100013833 | 3300005445 | Bacteria | 6624 |
| 108 | Ga0070708_100157507 | 3300005445 | Bacteria | 2115 |
| 109 | Ga0070663_100004359 | 3300005455 | Bacteria | 8301 |
| 110 | Ga0070663_100085310 | 3300005455 | Bacteria | 2330 |
| 111 | Ga0070663_100179948 | 3300005455 | Bacteria | 1639 |
| 112 | Ga0070663_100215697 | 3300005455 | Bacteria | 1505 |
| 113 | Ga0070678_100015662 | 3300005456 | Bacteria | 4827 |
| 114 | Ga0070678_100042143 | 3300005456 | Bacteria | 3242 |
| 115 | Ga0070678_100073926 | 3300005456 | Bacteria | 2560 |
| 116 | Ga0070662_100001938 | 3300005457 | Bacteria | 12719 |
| 117 | Ga0070662_100105418 | 3300005457 | Bacteria | 2140 |
| 118 | Ga0070681_10029133 | 3300005458 | Bacteria | 5543 |
| 119 | Ga0070681_10032263 | 3300005458 | Bacteria | 5256 |
| 120 | Ga0070681_10039473 | 3300005458 | Bacteria | 4732 |
| 121 | Ga0070681_10162783 | 3300005458 | Bacteria | 2155 |
| 122 | Ga0070681_10187022 | 3300005458 | Bacteria | 1991 |
| 123 | Ga0068867_100001219 | 3300005459 | Bacteria | 17696 |
| 124 | Ga0068867_100017647 | 3300005459 | Bacteria | 5068 |
| 125 | Ga0068867_100032888 | 3300005459 | Bacteria | 3752 |
| 126 | Ga0068867_100069617 | 3300005459 | Bacteria | 2628 |
| 127 | Ga0068867_100071110 | 3300005459 | Bacteria | 2602 |
| 128 | Ga0068867_100092869 | 3300005459 | Bacteria | 2292 |
| 129 | Ga0070685_10023375 | 3300005466 | Bacteria | 3384 |
| 130 | Ga0070685_10033508 | 3300005466 | Bacteria | 2886 |
| 131 | Ga0070685_10124569 | 3300005466 | Bacteria | 1604 |
| 132 | Ga0070706_100012233 | 3300005467 | Bacteria | 7954 |
| 133 | Ga0070706_100014759 | 3300005467 | Bacteria | 7217 |
| 134 | Ga0070706_100021479 | 3300005467 | Bacteria | 5944 |
| 135 | Ga0070706_100089454 | 3300005467 | Bacteria | 2855 |
| 136 | Ga0070706_100303711 | 3300005467 | Bacteria | 1489 |
| 137 | Ga0070706_100445499 | 3300005467 | Bacteria | 1205 |
| 138 | Ga0070707_100053719 | 3300005468 | Bacteria | 3863 |
| 139 | Ga0070707_100228470 | 3300005468 | Bacteria | 1812 |
| 140 | Ga0070698_100160694 | 3300005471 | Bacteria | 2190 |
| 141 | Ga0070699_100016446 | 3300005518 | Bacteria | 6353 |
| 142 | Ga0070699_100065339 | 3300005518 | Bacteria | 3157 |
| 143 | Ga0070679_100009410 | 3300005530 | Bacteria | 9241 |
| 144 | Ga0070679_100017521 | 3300005530 | Bacteria | 6933 |
| 145 | Ga0070679_100027131 | 3300005530 | Bacteria | 5633 |
| 146 | Ga0070679_100095712 | 3300005530 | Bacteria | 2957 |
| 147 | Ga0070679_100171380 | 3300005530 | Bacteria | 2143 |
| 148 | Ga0070679_100442781 | 3300005530 | Bacteria | 1244 |
| 149 | Ga0070684_100004038 | 3300005535 | Bacteria | 11107 |
| 150 | Ga0070684_100008621 | 3300005535 | Bacteria | 7985 |
| 151 | Ga0070684_100077446 | 3300005535 | Bacteria | 2937 |
| 152 | Ga0070697_100030789 | 3300005536 | Bacteria | 4312 |
| 153 | Ga0070697_100137959 | 3300005536 | Bacteria | 2049 |
| 154 | Ga0068853_100006566 | 3300005539 | Bacteria | 9266 |
| 155 | Ga0068853_100017260 | 3300005539 | Bacteria | 5957 |
| 156 | Ga0068853_100051686 | 3300005539 | Bacteria | 3538 |
| 157 | Ga0068853_100300166 | 3300005539 | Bacteria | 1484 |
| 158 | Ga0068853_100385458 | 3300005539 | Bacteria | 1309 |
| 159 | Ga0068853_100410378 | 3300005539 | Bacteria | 1269 |
| 160 | Ga0068853_100482296 | 3300005539 | Bacteria | 1169 |
| 161 | Ga0070672_100003013 | 3300005543 | Bacteria | 10851 |
| 162 | Ga0070672_100008331 | 3300005543 | Bacteria | 7084 |
| 163 | Ga0070672_100128537 | 3300005543 | Bacteria | 2080 |
| 164 | Ga0070672_100267940 | 3300005543 | Bacteria | 1441 |
| 165 | Ga0070686_100109860 | 3300005544 | Bacteria | 1877 |
| 166 | Ga0070695_100125609 | 3300005545 | Bacteria | 1761 |
| 167 | Ga0070695_100184426 | 3300005545 | Bacteria | 1481 |
| 168 | Ga0070695_100292465 | 3300005545 | Bacteria | 1201 |
| 169 | Ga0070696_100016471 | 3300005546 | Bacteria | 4978 |
| 170 | Ga0070696_100057085 | 3300005546 | Bacteria | 2724 |
| 171 | Ga0070696_100065250 | 3300005546 | Bacteria | 2552 |
| 172 | Ga0070696_100096392 | 3300005546 | Bacteria | 2114 |
| 173 | Ga0070693_100000167 | 3300005547 | Bacteria | 30641 |
| 174 | Ga0070693_100021456 | 3300005547 | Bacteria | 3422 |
| 175 | Ga0070665_100086087 | 3300005548 | Bacteria | 3149 |
| 176 | Ga0070665_100100363 | 3300005548 | Bacteria | 2898 |
| 177 | Ga0070665_100164869 | 3300005548 | Unclassified | 2218 |
| 178 | Ga0070665_100168298 | 3300005548 | Bacteria | 2193 |
| 179 | Ga0070704_100211460 | 3300005549 | Bacteria | 1572 |
| 180 | Ga0070704_100252825 | 3300005549 | Bacteria | 1448 |
| 181 | Ga0068855_100001160 | 3300005563 | Bacteria | 32655 |
| 182 | Ga0068855_100012552 | 3300005563 | Bacteria | 10226 |
| 183 | Ga0068855_100081055 | 3300005563 | Bacteria | 3762 |
| 184 | Ga0068855_100114999 | 3300005563 | Bacteria | 3084 |
| 185 | Ga0068855_100178555 | 3300005563 | Bacteria | 2401 |
| 186 | Ga0068855_100231263 | 3300005563 | Bacteria | 2070 |
| 187 | Ga0068855_100285350 | 3300005563 | Bacteria | 1832 |
| 188 | Ga0068855_100390756 | 3300005563 | Bacteria | 1526 |
| 189 | Ga0070664_100000955 | 3300005564 | Bacteria | 22600 |
| 190 | Ga0070664_100001452 | 3300005564 | Bacteria | 18888 |
| 191 | Ga0070664_100039893 | 3300005564 | Bacteria | 3958 |
| 192 | Ga0070664_100044446 | 3300005564 | Bacteria | 3750 |
| 193 | Ga0070664_100245147 | 3300005564 | Bacteria | 1609 |
| 194 | Ga0068857_100001623 | 3300005577 | Bacteria | 18065 |
| 195 | Ga0068857_100001739 | 3300005577 | Bacteria | 17512 |
| 196 | Ga0068857_100230592 | 3300005577 | Bacteria | 1693 |
| 197 | Ga0068854_100002132 | 3300005578 | Bacteria | 12146 |
| 198 | Ga0068854_100002439 | 3300005578 | Bacteria | 11499 |
| 199 | Ga0068854_100047083 | 3300005578 | Bacteria | 3072 |
| 200 | Ga0068854_100089368 | 3300005578 | Bacteria | 2289 |
| 201 | Ga0068854_100106183 | 3300005578 | Bacteria | 2112 |
| 202 | Ga0068856_100001343 | 3300005614 | Bacteria | 25881 |
| 203 | Ga0068856_100006138 | 3300005614 | Bacteria | 11793 |
| 204 | Ga0068856_100020687 | 3300005614 | Bacteria | 6392 |
| 205 | Ga0068856_100213730 | 3300005614 | Bacteria | 1944 |
| 206 | Ga0068856_100456762 | 3300005614 | Bacteria | 1298 |
| 207 | Ga0070702_100055567 | 3300005615 | Bacteria | 2283 |
| 208 | Ga0070702_100082392 | 3300005615 | Bacteria | 1930 |
| 209 | Ga0068852_100001471 | 3300005616 | Bacteria | 15936 |
| 210 | Ga0068852_100015543 | 3300005616 | Bacteria | 5908 |
| 211 | Ga0068852_100039410 | 3300005616 | Bacteria | 3977 |
| 212 | Ga0068852_100074021 | 3300005616 | Bacteria | 2998 |
| 213 | Ga0068852_100307024 | 3300005616 | Bacteria | 1537 |
| 214 | Ga0068859_100001484 | 3300005617 | Bacteria | 23877 |
| 215 | Ga0068859_100005749 | 3300005617 | Bacteria | 12613 |
| 216 | Ga0068859_100009886 | 3300005617 | Bacteria | 9634 |
| 217 | Ga0068859_100171956 | 3300005617 | Bacteria | 2248 |
| 218 | Ga0068859_100273439 | 3300005617 | Bacteria | 1782 |
| 219 | Ga0068859_100296865 | 3300005617 | Bacteria | 1709 |
| 220 | Ga0068859_100382569 | 3300005617 | Bacteria | 1503 |
| 221 | Ga0068864_100000938 | 3300005618 | Bacteria | 24407 |
| 222 | Ga0068864_100002372 | 3300005618 | Bacteria | 15584 |
| 223 | Ga0068864_100009418 | 3300005618 | Bacteria | 8058 |
| 224 | Ga0068864_100012050 | 3300005618 | Bacteria | 7141 |
| 225 | Ga0068864_100057543 | 3300005618 | Bacteria | 3359 |
| 226 | Ga0068864_100080267 | 3300005618 | Bacteria | 2858 |
| 227 | Ga0068864_100288362 | 3300005618 | Bacteria | 1534 |
| 228 | Ga0068866_10004687 | 3300005718 | Bacteria | 5612 |
| 229 | Ga0068866_10008728 | 3300005718 | Bacteria | 4284 |
| 230 | Ga0068861_100000187 | 3300005719 | Bacteria | 33035 |
| 231 | Ga0068861_100032868 | 3300005719 | Bacteria | 3823 |
| 232 | Ga0068861_100033322 | 3300005719 | Bacteria | 3799 |
| 233 | Ga0068861_100084993 | 3300005719 | Bacteria | 2485 |
| 234 | Ga0068861_100119890 | 3300005719 | Bacteria | 2120 |
| 235 | Ga0068861_100218927 | 3300005719 | Bacteria | 1608 |
| 236 | Ga0068861_100285235 | 3300005719 | Bacteria | 1423 |
| 237 | Ga0068861_100387977 | 3300005719 | Bacteria | 1236 |
| 238 | Ga0068851_10000960 | 3300005834 | Bacteria | 12483 |
| 239 | Ga0068851_10085303 | 3300005834 | Bacteria | 1655 |
| 240 | Ga0068870_10002579 | 3300005840 | Bacteria | 7580 |
| 241 | Ga0068870_10036417 | 3300005840 | Bacteria | 2532 |
| 242 | Ga0068863_100001021 | 3300005841 | Bacteria | 28037 |
| 243 | Ga0068863_100006037 | 3300005841 | Bacteria | 11882 |
| 244 | Ga0068863_100017026 | 3300005841 | Bacteria | 6971 |
| 245 | Ga0068863_100067668 | 3300005841 | Bacteria | 3378 |
| 246 | Ga0068863_100089366 | 3300005841 | Bacteria | 2921 |
| 247 | Ga0068863_100105364 | 3300005841 | Bacteria | 2682 |
| 248 | Ga0068863_100187956 | 3300005841 | Bacteria | 1985 |
| 249 | Ga0068858_100018888 | 3300005842 | Bacteria | 6450 |
| 250 | Ga0068858_100037266 | 3300005842 | Bacteria | 4509 |
| 251 | Ga0068858_100059857 | 3300005842 | Bacteria | 3520 |
| 252 | Ga0068860_100002049 | 3300005843 | Bacteria | 21245 |
| 253 | Ga0068860_100011724 | 3300005843 | Bacteria | 8639 |
| 254 | Ga0068860_100015024 | 3300005843 | Bacteria | 7566 |
| 255 | Ga0068860_100037387 | 3300005843 | Bacteria | 4648 |
| 256 | Ga0068860_100053521 | 3300005843 | Bacteria | 3838 |
| 257 | Ga0068860_100080420 | 3300005843 | Bacteria | 3099 |
| 258 | Ga0068860_100490388 | 3300005843 | Unclassified | 1225 |
| 259 | Ga0068862_100005987 | 3300005844 | Bacteria | 10125 |
| 260 | Ga0068862_100032015 | 3300005844 | Bacteria | 4442 |
| 261 | Ga0068862_100061523 | 3300005844 | Bacteria | 3228 |
| 262 | Ga0068862_100133897 | 3300005844 | Bacteria | 2195 |
| 263 | Ga0068862_100190539 | 3300005844 | Bacteria | 1845 |
| 264 | Ga0081539_10016545 | 3300005985 | Bacteria | 5254 |
| 265 | Ga0070712_100057002 | 3300006175 | Bacteria | 2742 |
| 266 | Ga0097621_100000972 | 3300006237 | Bacteria | 20078 |
| 267 | Ga0097621_100059498 | 3300006237 | Bacteria | 3128 |
| 268 | Ga0097621_100185151 | 3300006237 | Bacteria | 1801 |
| 269 | Ga0068871_100004641 | 3300006358 | Bacteria | 9598 |
| 270 | Ga0068871_100025386 | 3300006358 | Bacteria | 4610 |
| 271 | Ga0068871_100026390 | 3300006358 | Bacteria | 4533 |
| 272 | Ga0068871_100038217 | 3300006358 | Bacteria | 3832 |
| 273 | Ga0075428_100392606 | 3300006844 | Bacteria | 1487 |
| 274 | Ga0075433_10089796 | 3300006852 | Bacteria | 2716 |
| 275 | Ga0075433_10279420 | 3300006852 | Bacteria | 1479 |
| 276 | Ga0075433_10417054 | 3300006852 | Bacteria | 1184 |
| 277 | Ga0075434_100007305 | 3300006871 | Bacteria | 10224 |
| 278 | Ga0075434_100037226 | 3300006871 | Bacteria | 4817 |
| 279 | Ga0075434_100099450 | 3300006871 | Bacteria | 2914 |
| 280 | Ga0075434_100102280 | 3300006871 | Bacteria | 2873 |
| 281 | Ga0075434_100132442 | 3300006871 | Bacteria | 2513 |
| 282 | Ga0075434_100166946 | 3300006871 | Bacteria | 2221 |
| 283 | Ga0068865_100003642 | 3300006881 | Bacteria | 9258 |
| 284 | Ga0068865_100129330 | 3300006881 | Bacteria | 1890 |
| 285 | Ga0068865_100184963 | 3300006881 | Bacteria | 1607 |
| 286 | Ga0068865_100195936 | 3300006881 | Bacteria | 1566 |
| 287 | Ga0075436_100029805 | 3300006914 | Bacteria | 3753 |
| 288 | Ga0075436_100063727 | 3300006914 | Bacteria | 2547 |
| 289 | Ga0075436_100089270 | 3300006914 | Bacteria | 2142 |
| 290 | Ga0075436_100202891 | 3300006914 | Bacteria | 1405 |
| 291 | Ga0075436_100251542 | 3300006914 | Bacteria | 1258 |
| 292 | Ga0097620_100001484 | 3300006931 | Bacteria | 23877 |
| 293 | Ga0097620_100005749 | 3300006931 | Bacteria | 12613 |
| 294 | Ga0097620_100009886 | 3300006931 | Bacteria | 9634 |
| 295 | Ga0097620_100171954 | 3300006931 | Bacteria | 2248 |
| 296 | Ga0097620_100273455 | 3300006931 | Bacteria | 1782 |
| 297 | Ga0097620_100296861 | 3300006931 | Bacteria | 1709 |
| 298 | Ga0097620_100382578 | 3300006931 | Bacteria | 1503 |
| 299 | Ga0075435_100017481 | 3300007076 | Bacteria | 5431 |
| 300 | Ga0075435_100104729 | 3300007076 | Bacteria | 2347 |
| 301 | Ga0075435_100136381 | 3300007076 | Bacteria | 2056 |
| 302 | Ga0075435_100146547 | 3300007076 | Bacteria | 1983 |
| 303 | Ga0075435_100147197 | 3300007076 | Bacteria | 1978 |
| 304 | Ga0105240_10002731 | 3300009093 | Bacteria | 27994 |
| 305 | Ga0105240_10044396 | 3300009093 | Bacteria | 5647 |
| 306 | Ga0105240_10118858 | 3300009093 | Bacteria | 3185 |
| 307 | Ga0105240_10137030 | 3300009093 | Bacteria | 2931 |
| 308 | Ga0105240_10149417 | 3300009093 | Bacteria | 2784 |
| 309 | Ga0105240_10155105 | 3300009093 | Bacteria | 2724 |
| 310 | Ga0105240_10438741 | 3300009093 | Bacteria | 1464 |
| 311 | Ga0105245_10012549 | 3300009098 | Bacteria | 7374 |
| 312 | Ga0105245_10097497 | 3300009098 | Bacteria | 2715 |
| 313 | Ga0105245_10110179 | 3300009098 | Bacteria | 2559 |
| 314 | Ga0105245_10144969 | 3300009098 | Bacteria | 2240 |
| 315 | Ga0105245_10158716 | 3300009098 | Bacteria | 2144 |
| 316 | Ga0105245_10179197 | 3300009098 | Bacteria | 2023 |
| 317 | Ga0105247_10012360 | 3300009101 | Bacteria | 5127 |
| 318 | Ga0114129_10134553 | 3300009147 | Bacteria | 3392 |
| 319 | Ga0114129_11054854 | 3300009147 | Bacteria | 1020 |
| 320 | Ga0105243_10140005 | 3300009148 | Bacteria | 2063 |
| 321 | Ga0105241_10074841 | 3300009174 | Bacteria | 2638 |
| 322 | Ga0105241_10157905 | 3300009174 | Bacteria | 1861 |
| 323 | Ga0105242_10000164 | 3300009176 | Bacteria | 49988 |
| 324 | Ga0105242_10058443 | 3300009176 | Bacteria | 3161 |
| 325 | Ga0105242_10059563 | 3300009176 | Bacteria | 3133 |
| 326 | Ga0105242_10148976 | 3300009176 | Bacteria | 2039 |
| 327 | Ga0105242_10585788 | 3300009176 | Bacteria | 1075 |
| 328 | Ga0105248_10010030 | 3300009177 | Bacteria | 10430 |
| 329 | Ga0105248_10051808 | 3300009177 | Bacteria | 4605 |
| 330 | Ga0105248_10174036 | 3300009177 | Bacteria | 2427 |
| 331 | Ga0105248_10187291 | 3300009177 | Bacteria | 2332 |
| 332 | Ga0105248_10472094 | 3300009177 | Bacteria | 1414 |
| 333 | Ga0105237_10000784 | 3300009545 | Bacteria | 43457 |
| 334 | Ga0105237_10094826 | 3300009545 | Bacteria | 2973 |
| 335 | Ga0105237_10132236 | 3300009545 | Bacteria | 2489 |
| 336 | Ga0105238_10005552 | 3300009551 | Bacteria | 12457 |
| 337 | Ga0105238_10007592 | 3300009551 | Bacteria | 10864 |
| 338 | Ga0105238_10052151 | 3300009551 | Bacteria | 4113 |
| 339 | Ga0105238_10098449 | 3300009551 | Bacteria | 2908 |
| 340 | Ga0105238_10160067 | 3300009551 | Bacteria | 2227 |
| 341 | Ga0105249_10021927 | 3300009553 | Bacteria | 5721 |
| 342 | Ga0105249_10241456 | 3300009553 | Bacteria | 1786 |
| 343 | Ga0105239_10001759 | 3300010375 | Bacteria | 28533 |
| 344 | Ga0105239_10085915 | 3300010375 | Bacteria | 3468 |
| 345 | Ga0105239_10105346 | 3300010375 | Bacteria | 3123 |
| 346 | Ga0157373_10000447 | 3300013100 | Bacteria | 32642 |
| 347 | Ga0157373_10002952 | 3300013100 | Bacteria | 12886 |
| 348 | Ga0157373_10043899 | 3300013100 | Bacteria | 3192 |
| 349 | Ga0157371_10001482 | 3300013102 | Bacteria | 24271 |
| 350 | Ga0157370_10003331 | 3300013104 | Bacteria | 18930 |
| 351 | Ga0157370_10008356 | 3300013104 | Bacteria | 11165 |
| 352 | Ga0157370_10022125 | 3300013104 | Bacteria | 6328 |
| 353 | Ga0157370_10026443 | 3300013104 | Bacteria | 5730 |
| 354 | Ga0157370_10070211 | 3300013104 | Bacteria | 3307 |
| 355 | Ga0157370_10093375 | 3300013104 | Bacteria | 2824 |
| 356 | Ga0157370_10154989 | 3300013104 | Bacteria | 2131 |
| 357 | Ga0157369_10000733 | 3300013105 | Bacteria | 42321 |
| 358 | Ga0157369_10014458 | 3300013105 | Bacteria | 8911 |
| 359 | Ga0157369_10046834 | 3300013105 | Bacteria | 4698 |
| 360 | Ga0157369_10073010 | 3300013105 | Bacteria | 3681 |
| 361 | Ga0157369_10210252 | 3300013105 | Bacteria | 2039 |
| 362 | Ga0157369_10477747 | 3300013105 | Bacteria | 1290 |
| 363 | Ga0157374_10000770 | 3300013296 | Bacteria | 28021 |
| 364 | Ga0157374_10021298 | 3300013296 | Bacteria | 5766 |
| 365 | Ga0157374_10324897 | 3300013296 | Bacteria | 1525 |
| 366 | Ga0157378_10008577 | 3300013297 | Bacteria | 8897 |
| 367 | Ga0157378_10022887 | 3300013297 | Bacteria | 5500 |
| 368 | Ga0157378_10023714 | 3300013297 | Bacteria | 5398 |
| 369 | Ga0157378_10136278 | 3300013297 | Bacteria | 2276 |
| 370 | Ga0157378_10143373 | 3300013297 | Bacteria | 2220 |
| 371 | Ga0163162_10002232 | 3300013306 | Bacteria | 18196 |
| 372 | Ga0163162_10011501 | 3300013306 | Bacteria | 8631 |
| 373 | Ga0163162_10048032 | 3300013306 | Bacteria | 4276 |
| 374 | Ga0163162_10113072 | 3300013306 | Bacteria | 2813 |
| 375 | Ga0163162_10170868 | 3300013306 | Bacteria | 2299 |
| 376 | Ga0157372_10001652 | 3300013307 | Bacteria | 24215 |
| 377 | Ga0157372_10004508 | 3300013307 | Bacteria | 14858 |
| 378 | Ga0157372_10008051 | 3300013307 | Bacteria | 11210 |
| 379 | Ga0157372_10090554 | 3300013307 | Bacteria | 3478 |
| 380 | Ga0157372_10114167 | 3300013307 | Bacteria | 3096 |
| 381 | Ga0157372_10251019 | 3300013307 | Bacteria | 2053 |
| 382 | Ga0157372_10358940 | 3300013307 | Bacteria | 1698 |
| 383 | Ga0157375_10002885 | 3300013308 | Bacteria | 14912 |
| 384 | Ga0157375_10007037 | 3300013308 | Bacteria | 9826 |
| 385 | Ga0157375_10009095 | 3300013308 | Bacteria | 8701 |
| 386 | Ga0157375_10127714 | 3300013308 | Bacteria | 2659 |
| 387 | Ga0157375_10200422 | 3300013308 | Bacteria | 2152 |
| 388 | Ga0157375_10250873 | 3300013308 | Bacteria | 1930 |
| 389 | Ga0163163_10006684 | 3300014325 | Bacteria | 10104 |
| 390 | Ga0163163_10014090 | 3300014325 | Bacteria | 7341 |
| 391 | Ga0163163_10154655 | 3300014325 | Bacteria | 2337 |
| 392 | Ga0163163_10281184 | 3300014325 | Bacteria | 1715 |
| 393 | Ga0157380_10003032 | 3300014326 | Bacteria | 11438 |
| 394 | Ga0157380_10065644 | 3300014326 | Bacteria | 2917 |
| 395 | Ga0157380_10096019 | 3300014326 | Bacteria | 2457 |
| 396 | Ga0157380_10344040 | 3300014326 | Bacteria | 1392 |
| 397 | Ga0182008_10090446 | 3300014497 | Bacteria | 1509 |
| 398 | Ga0157377_10014176 | 3300014745 | Bacteria | 4051 |
| 399 | Ga0157379_10001106 | 3300014968 | Bacteria | 22048 |
| 400 | Ga0157379_10002047 | 3300014968 | Bacteria | 16745 |
| 401 | Ga0157379_10004185 | 3300014968 | Bacteria | 12322 |
| 402 | Ga0157379_10040901 | 3300014968 | Bacteria | 4138 |
| 403 | Ga0157379_10053702 | 3300014968 | Bacteria | 3600 |
| 404 | Ga0157379_10125381 | 3300014968 | Bacteria | 2311 |
| 405 | Ga0157379_10237701 | 3300014968 | Bacteria | 1652 |
| 406 | Ga0157376_10010457 | 3300014969 | Bacteria | 6788 |
| 407 | Ga0157376_10122392 | 3300014969 | Bacteria | 2308 |
| 408 | Ga0163161_10012234 | 3300017792 | Bacteria | 5953 |
| 409 | Ga0163161_10022874 | 3300017792 | Bacteria | 4403 |
| 410 | Ga0163161_10040274 | 3300017792 | Bacteria | 3356 |
| 411 | Ga0206353_11406765 | 3300020082 | Bacteria | 1212 |
| 412 | Ga0213876_10050192 | 3300021384 | Bacteria | 2204 |
| 413 | Ga0213876_10138151 | 3300021384 | Bacteria | 1296 |
| 414 | Ga0213876_10186792 | 3300021384 | Bacteria | 1102 |
| 415 | Ga0213871_10008652 | 3300021441 | Bacteria | 2255 |
| 416 | Ga0207697_10009495 | 3300025315 | Bacteria | 4200 |
| 417 | Ga0207697_10012374 | 3300025315 | Bacteria | 3578 |
| 418 | Ga0207697_10028498 | 3300025315 | Bacteria | 2284 |
| 419 | Ga0207656_10011621 | 3300025321 | Bacteria | 3332 |
| 420 | Ga0207653_10051330 | 3300025885 | Bacteria | 1373 |
| 421 | Ga0207682_10022780 | 3300025893 | Bacteria | 2470 |
| 422 | Ga0207692_10016570 | 3300025898 | Bacteria | 3268 |
| 423 | Ga0207642_10002368 | 3300025899 | Bacteria | 5867 |
| 424 | Ga0207642_10019622 | 3300025899 | Bacteria | 2621 |
| 425 | Ga0207680_10128919 | 3300025903 | Bacteria | 1665 |
| 426 | Ga0207685_10005968 | 3300025905 | Bacteria | 3270 |
| 427 | Ga0207699_10212859 | 3300025906 | Bacteria | 1315 |
| 428 | Ga0207645_10001058 | 3300025907 | Bacteria | 22793 |
| 429 | Ga0207705_10017704 | 3300025909 | Bacteria | 5097 |
| 430 | Ga0207705_10073050 | 3300025909 | Bacteria | 2488 |
| 431 | Ga0207705_10093645 | 3300025909 | Bacteria | 2203 |
| 432 | Ga0207705_10136169 | 3300025909 | Bacteria | 1831 |
| 433 | Ga0207705_10155202 | 3300025909 | Bacteria | 1717 |
| 434 | Ga0207684_10027046 | 3300025910 | Bacteria | 4892 |
| 435 | Ga0207684_10120923 | 3300025910 | Bacteria | 2245 |
| 436 | Ga0207684_10272337 | 3300025910 | Bacteria | 1461 |
| 437 | Ga0207684_10289887 | 3300025910 | Bacteria | 1411 |
| 438 | Ga0207684_10321317 | 3300025910 | Bacteria | 1334 |
| 439 | Ga0207654_10013552 | 3300025911 | Bacteria | 4195 |
| 440 | Ga0207707_10002855 | 3300025912 | Bacteria | 15431 |
| 441 | Ga0207707_10008732 | 3300025912 | Bacteria | 8793 |
| 442 | Ga0207707_10059921 | 3300025912 | Bacteria | 3312 |
| 443 | Ga0207695_10007386 | 3300025913 | Bacteria | 14020 |
| 444 | Ga0207695_10012077 | 3300025913 | Bacteria | 10382 |
| 445 | Ga0207695_10025748 | 3300025913 | Bacteria | 6578 |
| 446 | Ga0207695_10107882 | 3300025913 | Bacteria | 2769 |
| 447 | Ga0207695_10479509 | 3300025913 | Bacteria | 1126 |
| 448 | Ga0207671_10009892 | 3300025914 | Bacteria | 7927 |
| 449 | Ga0207693_10002176 | 3300025915 | Bacteria | 17081 |
| 450 | Ga0207693_10012772 | 3300025915 | Bacteria | 6777 |
| 451 | Ga0207660_10016190 | 3300025917 | Bacteria | 4932 |
| 452 | Ga0207660_10095663 | 3300025917 | Bacteria | 2210 |
| 453 | Ga0207662_10055572 | 3300025918 | Bacteria | 2363 |
| 454 | Ga0207662_10112600 | 3300025918 | Bacteria | 1698 |
| 455 | Ga0207657_10000371 | 3300025919 | Bacteria | 47425 |
| 456 | Ga0207657_10002834 | 3300025919 | Bacteria | 18618 |
| 457 | Ga0207657_10016447 | 3300025919 | Bacteria | 7135 |
| 458 | Ga0207657_10021571 | 3300025919 | Bacteria | 6057 |
| 459 | Ga0207657_10046523 | 3300025919 | Bacteria | 3799 |
| 460 | Ga0207649_10006699 | 3300025920 | Bacteria | 6260 |
| 461 | Ga0207649_10018879 | 3300025920 | Bacteria | 3932 |
| 462 | Ga0207649_10031690 | 3300025920 | Bacteria | 3145 |
| 463 | Ga0207649_10073901 | 3300025920 | Bacteria | 2186 |
| 464 | Ga0207652_10007499 | 3300025921 | Bacteria | 8784 |
| 465 | Ga0207652_10019068 | 3300025921 | Bacteria | 5635 |
| 466 | Ga0207652_10027029 | 3300025921 | Bacteria | 4781 |
| 467 | Ga0207652_10032211 | 3300025921 | Bacteria | 4404 |
| 468 | Ga0207652_10062293 | 3300025921 | Bacteria | 3223 |
| 469 | Ga0207652_10101618 | 3300025921 | Bacteria | 2540 |
| 470 | Ga0207652_10468517 | 3300025921 | Bacteria | 1135 |
| 471 | Ga0207681_10003039 | 3300025923 | Bacteria | 10548 |
| 472 | Ga0207681_10007075 | 3300025923 | Bacteria | 6881 |
| 473 | Ga0207681_10059152 | 3300025923 | Bacteria | 2626 |
| 474 | Ga0207694_10007179 | 3300025924 | Bacteria | 8458 |
| 475 | Ga0207694_10015526 | 3300025924 | Bacteria | 5742 |
| 476 | Ga0207694_10028502 | 3300025924 | Bacteria | 4258 |
| 477 | Ga0207694_10147422 | 3300025924 | Bacteria | 1895 |
| 478 | Ga0207694_10234747 | 3300025924 | Bacteria | 1498 |
| 479 | Ga0207650_10005168 | 3300025925 | Bacteria | 8905 |
| 480 | Ga0207650_10025039 | 3300025925 | Bacteria | 4249 |
| 481 | Ga0207650_10050810 | 3300025925 | Bacteria | 3067 |
| 482 | Ga0207650_10078797 | 3300025925 | Bacteria | 2493 |
| 483 | Ga0207650_10086907 | 3300025925 | Bacteria | 2381 |
| 484 | Ga0207650_10117475 | 3300025925 | Bacteria | 2067 |
| 485 | Ga0207650_10134836 | 3300025925 | Bacteria | 1936 |
| 486 | Ga0207650_10135378 | 3300025925 | Bacteria | 1932 |
| 487 | Ga0207650_10348937 | 3300025925 | Bacteria | 1217 |
| 488 | Ga0207659_10002989 | 3300025926 | Bacteria | 10076 |
| 489 | Ga0207659_10039362 | 3300025926 | Bacteria | 3297 |
| 490 | Ga0207659_10042751 | 3300025926 | Bacteria | 3179 |
| 491 | Ga0207659_10087319 | 3300025926 | Bacteria | 2321 |
| 492 | Ga0207659_10312555 | 3300025926 | Bacteria | 1294 |
| 493 | Ga0207687_10001668 | 3300025927 | Bacteria | 15313 |
| 494 | Ga0207687_10022739 | 3300025927 | Bacteria | 4175 |
| 495 | Ga0207687_10079934 | 3300025927 | Bacteria | 2358 |
| 496 | Ga0207687_10137867 | 3300025927 | Bacteria | 1847 |
| 497 | Ga0207700_10000031 | 3300025928 | Bacteria | 130086 |
| 498 | Ga0207700_10004520 | 3300025928 | Bacteria | 8216 |
| 499 | Ga0207700_10347522 | 3300025928 | Bacteria | 1291 |
| 500 | Ga0207664_10001654 | 3300025929 | Bacteria | 14676 |
| 501 | Ga0207664_10014392 | 3300025929 | Bacteria | 5712 |
| 502 | Ga0207644_10005084 | 3300025931 | Bacteria | 8591 |
| 503 | Ga0207644_10014130 | 3300025931 | Bacteria | 5341 |
| 504 | Ga0207644_10018467 | 3300025931 | Bacteria | 4718 |
| 505 | Ga0207644_10034668 | 3300025931 | Bacteria | 3533 |
| 506 | Ga0207644_10163062 | 3300025931 | Bacteria | 1734 |
| 507 | Ga0207644_10172667 | 3300025931 | Bacteria | 1689 |
| 508 | Ga0207644_10203741 | 3300025931 | Bacteria | 1561 |
| 509 | Ga0207690_10004056 | 3300025932 | Bacteria | 8653 |
| 510 | Ga0207690_10013641 | 3300025932 | Bacteria | 4887 |
| 511 | Ga0207706_10003193 | 3300025933 | Bacteria | 15731 |
| 512 | Ga0207706_10079309 | 3300025933 | Bacteria | 2887 |
| 513 | Ga0207706_10111896 | 3300025933 | Bacteria | 2402 |
| 514 | Ga0207706_10112050 | 3300025933 | Bacteria | 2400 |
| 515 | Ga0207686_10000198 | 3300025934 | Bacteria | 46402 |
| 516 | Ga0207686_10004958 | 3300025934 | Bacteria | 7163 |
| 517 | Ga0207686_10119143 | 3300025934 | Bacteria | 1794 |
| 518 | Ga0207709_10048377 | 3300025935 | Bacteria | 2591 |
| 519 | Ga0207709_10098015 | 3300025935 | Bacteria | 1932 |
| 520 | Ga0207670_10053128 | 3300025936 | Bacteria | 2728 |
| 521 | Ga0207670_10069615 | 3300025936 | Bacteria | 2428 |
| 522 | Ga0207669_10013482 | 3300025937 | Bacteria | 4061 |
| 523 | Ga0207669_10311747 | 3300025937 | Bacteria | 1200 |
| 524 | Ga0207704_10009976 | 3300025938 | Bacteria | 4610 |
| 525 | Ga0207704_10080526 | 3300025938 | Bacteria | 2103 |
| 526 | Ga0207704_10216624 | 3300025938 | Bacteria | 1413 |
| 527 | Ga0207665_10014015 | 3300025939 | Bacteria | 5274 |
| 528 | Ga0207665_10043053 | 3300025939 | Bacteria | 3018 |
| 529 | Ga0207691_10000041 | 3300025940 | Bacteria | 106275 |
| 530 | Ga0207691_10003579 | 3300025940 | Bacteria | 15124 |
| 531 | Ga0207691_10004159 | 3300025940 | Bacteria | 14058 |
| 532 | Ga0207691_10009490 | 3300025940 | Bacteria | 9343 |
| 533 | Ga0207691_10129154 | 3300025940 | Bacteria | 2234 |
| 534 | Ga0207691_10176499 | 3300025940 | Bacteria | 1868 |
| 535 | Ga0207691_10223429 | 3300025940 | Bacteria | 1632 |
| 536 | Ga0207711_10003428 | 3300025941 | Bacteria | 13714 |
| 537 | Ga0207711_10124989 | 3300025941 | Bacteria | 2300 |
| 538 | Ga0207711_10141164 | 3300025941 | Bacteria | 2167 |
| 539 | Ga0207711_10342706 | 3300025941 | Bacteria | 1383 |
| 540 | Ga0207689_10005585 | 3300025942 | Bacteria | 11211 |
| 541 | Ga0207689_10027083 | 3300025942 | Bacteria | 4799 |
| 542 | Ga0207689_10040648 | 3300025942 | Bacteria | 3848 |
| 543 | Ga0207689_10055328 | 3300025942 | Bacteria | 3266 |
| 544 | Ga0207661_10007655 | 3300025944 | Bacteria | 7684 |
| 545 | Ga0207661_10040053 | 3300025944 | Bacteria | 3681 |
| 546 | Ga0207661_10342499 | 3300025944 | Bacteria | 1347 |
| 547 | Ga0207679_10001683 | 3300025945 | Bacteria | 13764 |
| 548 | Ga0207679_10015724 | 3300025945 | Bacteria | 5009 |
| 549 | Ga0207679_10115313 | 3300025945 | Bacteria | 2128 |
| 550 | Ga0207679_10277827 | 3300025945 | Bacteria | 1435 |
| 551 | Ga0207667_10003619 | 3300025949 | Bacteria | 19070 |
| 552 | Ga0207667_10009435 | 3300025949 | Bacteria | 11491 |
| 553 | Ga0207667_10014732 | 3300025949 | Bacteria | 8898 |
| 554 | Ga0207667_10045468 | 3300025949 | Bacteria | 4650 |
| 555 | Ga0207667_10195073 | 3300025949 | Bacteria | 2078 |
| 556 | Ga0207667_10221978 | 3300025949 | Bacteria | 1936 |
| 557 | Ga0207667_10345781 | 3300025949 | Bacteria | 1517 |
| 558 | Ga0207651_10001393 | 3300025960 | Bacteria | 10955 |
| 559 | Ga0207651_10028614 | 3300025960 | Bacteria | 3518 |
| 560 | Ga0207668_10001997 | 3300025972 | Bacteria | 11916 |
| 561 | Ga0207668_10009587 | 3300025972 | Bacteria | 5812 |
| 562 | Ga0207668_10037112 | 3300025972 | Bacteria | 3259 |
| 563 | Ga0207668_10043006 | 3300025972 | Bacteria | 3062 |
| 564 | Ga0207668_10150037 | 3300025972 | Bacteria | 1803 |
| 565 | Ga0207640_10055900 | 3300025981 | Bacteria | 2588 |
| 566 | Ga0207658_10002334 | 3300025986 | Bacteria | 13938 |
| 567 | Ga0207658_10006384 | 3300025986 | Bacteria | 8050 |
| 568 | Ga0207658_10051451 | 3300025986 | Bacteria | 3036 |
| 569 | Ga0207658_10061091 | 3300025986 | Bacteria | 2814 |
| 570 | Ga0207658_10132864 | 3300025986 | Bacteria | 2002 |
| 571 | Ga0207658_10245612 | 3300025986 | Bacteria | 1519 |
| 572 | Ga0207677_10000799 | 3300026023 | Bacteria | 18068 |
| 573 | Ga0207677_10011028 | 3300026023 | Bacteria | 5135 |
| 574 | Ga0207677_10109751 | 3300026023 | Bacteria | 2052 |
| 575 | Ga0207677_10149734 | 3300026023 | Bacteria | 1798 |
| 576 | Ga0207677_10194732 | 3300026023 | Bacteria | 1606 |
| 577 | Ga0207703_10000143 | 3300026035 | Bacteria | 84508 |
| 578 | Ga0207703_10009453 | 3300026035 | Bacteria | 7655 |
| 579 | Ga0207703_10092928 | 3300026035 | Bacteria | 2540 |
| 580 | Ga0207703_10109175 | 3300026035 | Bacteria | 2357 |
| 581 | Ga0207703_10125813 | 3300026035 | Bacteria | 2206 |
| 582 | Ga0207639_10024584 | 3300026041 | Bacteria | 4362 |
| 583 | Ga0207639_10118313 | 3300026041 | Bacteria | 2173 |
| 584 | Ga0207639_10178421 | 3300026041 | Bacteria | 1805 |
| 585 | Ga0207639_10394692 | 3300026041 | Bacteria | 1245 |
| 586 | Ga0207678_10003847 | 3300026067 | Bacteria | 13501 |
| 587 | Ga0207678_10034156 | 3300026067 | Bacteria | 4430 |
| 588 | Ga0207702_10003083 | 3300026078 | Bacteria | 15461 |
| 589 | Ga0207702_10006720 | 3300026078 | Bacteria | 9883 |
| 590 | Ga0207702_10021819 | 3300026078 | Bacteria | 5302 |
| 591 | Ga0207702_10303351 | 3300026078 | Bacteria | 1516 |
| 592 | Ga0207641_10007742 | 3300026088 | Bacteria | 8928 |
| 593 | Ga0207641_10008173 | 3300026088 | Bacteria | 8657 |
| 594 | Ga0207641_10009450 | 3300026088 | Bacteria | 8034 |
| 595 | Ga0207641_10023159 | 3300026088 | Bacteria | 5117 |
| 596 | Ga0207641_10119853 | 3300026088 | Bacteria | 2346 |
| 597 | Ga0207641_10204402 | 3300026088 | Bacteria | 1823 |
| 598 | Ga0207641_10232239 | 3300026088 | Bacteria | 1715 |
| 599 | Ga0207641_10263971 | 3300026088 | Bacteria | 1613 |
| 600 | Ga0207648_10000601 | 3300026089 | Bacteria | 40481 |
| 601 | Ga0207648_10002730 | 3300026089 | Bacteria | 18749 |
| 602 | Ga0207648_10010928 | 3300026089 | Bacteria | 8579 |
| 603 | Ga0207648_10050141 | 3300026089 | Bacteria | 3650 |
| 604 | Ga0207648_10055564 | 3300026089 | Bacteria | 3456 |
| 605 | Ga0207648_10065770 | 3300026089 | Bacteria | 3161 |
| 606 | Ga0207648_10098558 | 3300026089 | Bacteria | 2559 |
| 607 | Ga0207648_10143825 | 3300026089 | Bacteria | 2103 |
| 608 | Ga0207676_10000837 | 3300026095 | Bacteria | 23871 |
| 609 | Ga0207676_10003209 | 3300026095 | Bacteria | 11650 |
| 610 | Ga0207676_10004178 | 3300026095 | Bacteria | 10207 |
| 611 | Ga0207676_10211577 | 3300026095 | Bacteria | 1720 |
| 612 | Ga0207676_10406325 | 3300026095 | Bacteria | 1274 |
| 613 | Ga0207674_10000049 | 3300026116 | Bacteria | 118784 |
| 614 | Ga0207674_10001272 | 3300026116 | Bacteria | 32948 |
| 615 | Ga0207674_10003466 | 3300026116 | Bacteria | 19294 |
| 616 | Ga0207674_10022069 | 3300026116 | Bacteria | 6844 |
| 617 | Ga0207674_10101320 | 3300026116 | Bacteria | 2861 |
| 618 | Ga0207675_100000517 | 3300026118 | Bacteria | 37526 |
| 619 | Ga0207675_100011791 | 3300026118 | Bacteria | 8171 |
| 620 | Ga0207675_100016774 | 3300026118 | Bacteria | 6841 |
| 621 | Ga0207675_100017152 | 3300026118 | Bacteria | 6762 |
| 622 | Ga0207675_100096111 | 3300026118 | Bacteria | 2789 |
| 623 | Ga0207675_100100218 | 3300026118 | Bacteria | 2728 |
| 624 | Ga0207675_100236629 | 3300026118 | Bacteria | 1763 |
| 625 | Ga0207683_10000011 | 3300026121 | Bacteria | 140261 |
| 626 | Ga0207683_10009881 | 3300026121 | Bacteria | 8137 |
| 627 | Ga0207683_10022316 | 3300026121 | Bacteria | 5432 |
| 628 | Ga0207683_10060834 | 3300026121 | Bacteria | 3321 |
| 629 | Ga0207683_10199082 | 3300026121 | Bacteria | 1820 |
| 630 | Ga0207683_10302087 | 3300026121 | Bacteria | 1464 |
| 631 | Ga0207698_10008826 | 3300026142 | Bacteria | 6389 |
| 632 | Ga0207698_10010183 | 3300026142 | Bacteria | 6026 |
| 633 | Ga0207698_10040284 | 3300026142 | Bacteria | 3469 |
| 634 | Ga0207698_10049530 | 3300026142 | Bacteria | 3198 |
| 635 | Ga0207698_10071607 | 3300026142 | Bacteria | 2751 |
| 636 | Ga0209983_1015175 | 3300027665 | Bacteria | 1588 |
| 637 | Ga0209971_1005384 | 3300027682 | Bacteria | 3043 |
| 638 | Ga0268266_10032521 | 3300028379 | Bacteria | 4431 |
| 639 | Ga0268266_10060826 | 3300028379 | Bacteria | 3256 |
| 640 | Ga0268266_10096595 | 3300028379 | Unclassified | 2597 |
| 641 | Ga0268266_10133826 | 3300028379 | Bacteria | 2219 |
| 642 | Ga0268266_10171313 | 3300028379 | Bacteria | 1970 |
| 643 | Ga0268266_10175235 | 3300028379 | Bacteria | 1949 |
| 644 | Ga0268265_10015632 | 3300028380 | Bacteria | 5197 |
| 645 | Ga0268265_10019444 | 3300028380 | Bacteria | 4721 |
| 646 | Ga0268265_10131196 | 3300028380 | Bacteria | 2082 |
| 647 | Ga0268265_10157048 | 3300028380 | Bacteria | 1926 |
| 648 | Ga0268265_10410493 | 3300028380 | Bacteria | 1254 |
| 649 | Ga0268264_10000641 | 3300028381 | Bacteria | 41364 |
| 650 | Ga0268264_10003919 | 3300028381 | Bacteria | 12743 |
| 651 | Ga0268264_10020018 | 3300028381 | Bacteria | 5467 |
| 652 | Ga0268264_10025067 | 3300028381 | Bacteria | 4874 |
| 653 | Ga0268264_10045620 | 3300028381 | Bacteria | 3639 |
| 654 | Ga0268264_10167479 | 3300028381 | Bacteria | 1985 |
| 655 | Ga0268264_10167528 | 3300028381 | Bacteria | 1984 |
| 656 | Ga0307517_10100353 | 3300028786 | Bacteria | 2287 |
| 657 | Ga0265338_10410831 | 3300028800 | Unclassified | 963 |
| 658 | Ga0265330_10010054 | 3300031235 | Bacteria | 4471 |
| 659 | Ga0265332_10001333 | 3300031238 | Bacteria | 14001 |
| 660 | Ga0265325_10000877 | 3300031241 | Bacteria | 21725 |
| 661 | Ga0265340_10002744 | 3300031247 | Bacteria | 10027 |
| 662 | Ga0265339_10064615 | 3300031249 | Bacteria | 1963 |
| 663 | Ga0265331_10000310 | 3300031250 | Bacteria | 53265 |
| 664 | Ga0265331_10118728 | 3300031250 | Bacteria | 1210 |
| 665 | Ga0265327_10002920 | 3300031251 | Bacteria | 17116 |
| 666 | Ga0265316_10052062 | 3300031344 | Bacteria | 3213 |
| 667 | Ga0307509_10000033 | 3300031507 | Bacteria | 194363 |
| 668 | Ga0307408_100004310 | 3300031548 | Bacteria | 9653 |
| 669 | Ga0307408_100005363 | 3300031548 | Bacteria | 8591 |
| 670 | Ga0265313_10058399 | 3300031595 | Bacteria | 1818 |
| 671 | Ga0265314_10003412 | 3300031711 | Bacteria | 15382 |
| 672 | Ga0307405_10001375 | 3300031731 | Bacteria | 10202 |
| 673 | Ga0307413_10007333 | 3300031824 | Bacteria | 5113 |
| 674 | Ga0307413_10013300 | 3300031824 | Bacteria | 4132 |
| 675 | Ga0307410_10005872 | 3300031852 | Bacteria | 6555 |
| 676 | Ga0307410_10008880 | 3300031852 | Bacteria | 5606 |
| 677 | Ga0307406_10025843 | 3300031901 | Bacteria | 3519 |
| 678 | Ga0307407_10006793 | 3300031903 | Bacteria | 5125 |
| 679 | Ga0307407_10010883 | 3300031903 | Bacteria | 4309 |
| 680 | Ga0307412_10030015 | 3300031911 | Bacteria | 3418 |
| 681 | Ga0307412_10044277 | 3300031911 | Bacteria | 2903 |
| 682 | Ga0307409_100007270 | 3300031995 | Bacteria | 6607 |
| 683 | Ga0307409_100012433 | 3300031995 | Bacteria | 5424 |
| 684 | Ga0307416_100010652 | 3300032002 | Bacteria | 6087 |
| 685 | Ga0307414_10056839 | 3300032004 | Bacteria | 2747 |
| 686 | Ga0307411_10000280 | 3300032005 | Bacteria | 16974 |
| 687 | Ga0307411_10020842 | 3300032005 | Bacteria | 3822 |
| 688 | Ga0307415_100020252 | 3300032126 | Bacteria | 4058 |
| 689 | Ga0307415_100030087 | 3300032126 | Bacteria | 3479 |
| 690 | Ga0316583_10000196 | 3300032133 | Bacteria | 15776 |
| 691 | Ga0373926_0035913 | 3300035083 | Bacteria | 1759 |
| 692 | Ga0373929_0022575 | 3300035085 | Bacteria | 1286 |
| 693 | Ga0373934_0001656 | 3300035086 | Bacteria | 8167 |
| 694 | Ga0373934_0037290 | 3300035086 | Bacteria | 1914 |
| 695 | Ga0373923_0092285 | 3300035111 | Bacteria | 1326 |
| 696 | Ga0373954_0000024 | 3300035118 | Bacteria | 57545 |
| 697 | Ga0373954_0002047 | 3300035118 | Bacteria | 8380 |
| 698 | Ga0373956_0000371 | 3300035119 | Bacteria | 18327 |
| 699 | Ga0373956_0018705 | 3300035119 | Bacteria | 2935 |
| 700 | Ga0373956_0027005 | 3300035119 | Bacteria | 2489 |
| 701 | Ga0373960_0051176 | 3300035121 | Bacteria | 1226 |
| 702 | Ga0373943_0040108 | 3300035170 | Bacteria | 2259 |
| 703 | Ga0373946_0038180 | 3300035171 | Bacteria | 1955 |
| 704 | Ga0373961_0019449 | 3300035241 | Bacteria | 1784 |
| 705 | Ga0373924_0005481 | 3300035410 | Bacteria | 4497 |
| 706 | Ga0373924_0053614 | 3300035410 | Bacteria | 1675 |
| 707 | Ga0373931_0018659 | 3300035691 | Bacteria | 3451 |
| 708 | Ga0373931_0047147 | 3300035691 | Bacteria | 2280 |
| 709 | Ga0373931_0070837 | 3300035691 | Bacteria | 1903 |
| 710 | Ga0373935_0056925 | 3300035692 | Bacteria | 2493 |
| 711 | Ga0373935_0140824 | 3300035692 | Bacteria | 1629 |
| 712 | Ga0373927_0009964 | 3300035695 | Bacteria | 6368 |
| 713 | Ga0373927_0065625 | 3300035695 | Bacteria | 2348 |
| 714 | Ga0373933_0002506 | 3300035724 | Bacteria | 10323 |
| 715 | Ga0373933_0046747 | 3300035724 | Bacteria | 2571 |
| 716 | Ga0373933_0054708 | 3300035724 | Bacteria | 2392 |
| 717 | Ga0373933_0128305 | 3300035724 | Bacteria | 1593 |
| 718 | Ga0373947_0034332 | 3300035725 | Bacteria | 2999 |
| 719 | Ga0373947_0144067 | 3300035725 | Bacteria | 1530 |
| 720 | Ga0373937_0004381 | 3300036401 | Bacteria | 11988 |
| 721 | Ga0373937_0005790 | 3300036401 | Bacteria | 10621 |
| 722 | Ga0373937_0025706 | 3300036401 | Bacteria | 5317 |
| 723 | Ga0373937_0036018 | 3300036401 | Bacteria | 4508 |
| 724 | Ga0373937_0136086 | 3300036401 | Bacteria | 2297 |
| 725 | Ga0373937_0170311 | 3300036401 | Bacteria | 2043 |
| 726 | Ga0373925_0027934 | 3300037068 | Bacteria | 4131 |
| 727 | Ga0373925_0037859 | 3300037068 | Bacteria | 3562 |
| 728 | Ga0373925_0203955 | 3300037068 | Bacteria | 1573 |
| 729 | Ga0373925_0237920 | 3300037068 | Bacteria | 1457 |
| 730 | Ga0395900_0017004 | 3300037418 | Bacteria | 7424 |
| 731 | Ga0395905_0029937 | 3300037471 | Bacteria | 5132 |
| 732 | Ga0395905_0196359 | 3300037471 | Bacteria | 1892 |
| 733 | Ga0395901_0031022 | 3300038443 | Bacteria | 5510 |
| 734 | Ga0400488_49857 | 3300038741 | Bacteria | 1981 |
| 735 | Ga0436365_0145813 | 3300039437 | Bacteria | 1466 |
| 736 | Ga0436365_0608769 | 3300039437 | Bacteria | 3641 |
| 737 | Ga0436365_1551353 | 3300039437 | Bacteria | 2383 |
| 738 | Ga0436360_0511108 | 3300039438 | Bacteria | 3731 |
| 739 | Ga0436362_1100797 | 3300039453 | Bacteria | 3140 |
| 740 | Ga0439441_017770 | 3300042001 | Bacteria | 1281 |
| 741 | Ga0439448_0015880 | 3300042005 | Bacteria | 2286 |
| 742 | Ga0451577_0000384 | 3300042876 | Bacteria | 82022 |
| 743 | Ga0451577_0010249 | 3300042876 | Bacteria | 8975 |
| 744 | Ga0451577_0137884 | 3300042876 | Bacteria | 2191 |
| 745 | Ga0451577_0183588 | 3300042876 | Bacteria | 1886 |
| 746 | Ga0451577_0247110 | 3300042876 | Bacteria | 1615 |
| 747 | Ga0466961_0000955 | 3300044693 | Bacteria | 17875 |
| 748 | Ga0466963_0037905 | 3300044694 | Bacteria | 3151 |
| 749 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 750 | Ga0453684_0000292 | 3300044712 | Bacteria | 213050 |
| 751 | Ga0453684_0003022 | 3300044712 | Bacteria | 39115 |
| 752 | Ga0466959_0006078 | 3300045049 | Bacteria | 8331 |
| 753 | Ga0451576_0171487 | 3300045051 | Bacteria | 2265 |
| 754 | Ga0451576_0217368 | 3300045051 | Bacteria | 1996 |
| 755 | Ga0466967_0060125 | 3300045976 | Bacteria | 3366 |
| 756 | Ga0495592_0001143 | 3300046454 | Bacteria | 18460 |
| 757 | Ga0495603_0032134 | 3300046455 | Bacteria | 3159 |
| 758 | Ga0495629_0008490 | 3300046459 | Bacteria | 7563 |
| 759 | Ga0495580_0025942 | 3300046472 | Bacteria | 4277 |
| 760 | Ga0495580_0134757 | 3300046472 | Bacteria | 1713 |
| 761 | Ga0495580_0135755 | 3300046472 | Bacteria | 1706 |
| 762 | Ga0495582_0033204 | 3300046473 | Bacteria | 2836 |
| 763 | Ga0495582_0035265 | 3300046473 | Bacteria | 2751 |
| 764 | Ga0495639_0010739 | 3300046475 | Bacteria | 3940 |
| 765 | Ga0495662_0012744 | 3300046476 | Bacteria | 4100 |
| 766 | Ga0495664_0206648 | 3300046477 | Bacteria | 1189 |
| 767 | Ga0495594_0133825 | 3300046499 | Bacteria | 1404 |
| 768 | Ga0495608_0000766 | 3300046511 | Bacteria | 22480 |
| 769 | Ga0495608_0099632 | 3300046511 | Bacteria | 1874 |
| 770 | Ga0495618_0019941 | 3300046514 | Bacteria | 4127 |
| 771 | Ga0495628_0006004 | 3300046516 | Bacteria | 10624 |
| 772 | Ga0495628_0240187 | 3300046516 | Bacteria | 1355 |
| 773 | Ga0495630_0158089 | 3300046517 | Bacteria | 1725 |
| 774 | Ga0495630_0166857 | 3300046517 | Bacteria | 1676 |
| 775 | Ga0495666_0021113 | 3300046526 | Bacteria | 3224 |
| 776 | Ga0495666_0072732 | 3300046526 | Bacteria | 1632 |
| 777 | Ga0495652_0093914 | 3300046529 | Bacteria | 2448 |
| 778 | Ga0495640_0000384 | 3300046533 | Bacteria | 31361 |
| 779 | Ga0495640_0016426 | 3300046533 | Bacteria | 5536 |
| 780 | Ga0495586_0000938 | 3300046535 | Bacteria | 16544 |
| 781 | Ga0495587_0052496 | 3300046536 | Bacteria | 2405 |
| 782 | Ga0495621_0011723 | 3300046539 | Bacteria | 2721 |
| 783 | Ga0495621_0038213 | 3300046539 | Bacteria | 1674 |
| 784 | Ga0495645_0009637 | 3300046543 | Bacteria | 6753 |
| 785 | Ga0495645_0088405 | 3300046543 | Bacteria | 2216 |
| 786 | Ga0495667_0003921 | 3300046559 | Bacteria | 9985 |
| 787 | Ga0495667_0048450 | 3300046559 | Bacteria | 2806 |
| 788 | Ga0495634_0169122 | 3300046642 | Bacteria | 1374 |
| 789 | Ga0495625_0005191 | 3300046660 | Bacteria | 12004 |
| 790 | Ga0495635_0013544 | 3300046663 | Bacteria | 5708 |
| 791 | Ga0495635_0035566 | 3300046663 | Bacteria | 3453 |
| 792 | Ga0495588_0153647 | 3300046674 | Bacteria | 1216 |
| 793 | Ga0495657_0143940 | 3300046675 | Bacteria | 1484 |
| 794 | Ga0495599_0003110 | 3300046678 | Bacteria | 9670 |
| 795 | Ga0495599_0110823 | 3300046678 | Bacteria | 1710 |
| 796 | Ga0495623_0053021 | 3300046679 | Bacteria | 2562 |
| 797 | Ga0495647_0008144 | 3300046681 | Bacteria | 3522 |
| 798 | Ga0495658_0025439 | 3300046683 | Bacteria | 3163 |
| 799 | Ga0495613_0005741 | 3300046689 | Bacteria | 9297 |
| 800 | Ga0495624_0156371 | 3300046690 | Bacteria | 1393 |
| 801 | Ga0495600_0012682 | 3300046809 | Bacteria | 5276 |
| 802 | Ga0495581_0001341 | 3300047315 | Bacteria | 13603 |
| 803 | Ga0495604_0008259 | 3300047317 | Bacteria | 8235 |
| 804 | Ga0495674_0105678 | 3300047319 | Bacteria | 2392 |
| 805 | Ga0495680_0001589 | 3300047322 | Bacteria | 24279 |
| 806 | Ga0495680_0037627 | 3300047322 | Bacteria | 3875 |
| 807 | Ga0495680_0084404 | 3300047322 | Bacteria | 2393 |
| 808 | Ga0495684_0068442 | 3300047471 | Bacteria | 2699 |
| 809 | Ga0495593_0026218 | 3300047673 | Bacteria | 3220 |
| 810 | Ga0495593_0089540 | 3300047673 | Bacteria | 1585 |
| 811 | Ga0495614_0018592 | 3300048089 | Bacteria | 3011 |
| 812 | Ga0496100_0063644 | 3300048903 | Bacteria | 2438 |
| 813 | Ga0496101_0150811 | 3300048904 | Bacteria | 1778 |
| 814 | Ga0496102_0004733 | 3300048905 | Bacteria | 11528 |
| 815 | Ga0496102_0049371 | 3300048905 | Bacteria | 3828 |
| 816 | Ga0496102_0061780 | 3300048905 | Bacteria | 3430 |
| 817 | Ga0496103_0063096 | 3300048906 | Bacteria | 2307 |
| 818 | Ga0496103_0105565 | 3300048906 | Bacteria | 1786 |
| 819 | Ga0496104_0008261 | 3300048907 | Bacteria | 9243 |
| 820 | Ga0496104_0165794 | 3300048907 | Bacteria | 2119 |
| 821 | Ga0496105_0043192 | 3300048908 | Bacteria | 3717 |
| 822 | Ga0496106_0000409 | 3300048909 | Bacteria | 30485 |
| 823 | Ga0496106_0250476 | 3300048909 | Bacteria | 1416 |
| 824 | Ga0496106_0261029 | 3300048909 | Bacteria | 1386 |
| 825 | Ga0496107_0001779 | 3300048910 | Bacteria | 13578 |
| 826 | Ga0496107_0154722 | 3300048910 | Bacteria | 1697 |
| 827 | Ga0496108_0117995 | 3300048911 | Bacteria | 2274 |
| 828 | Ga0496108_0264210 | 3300048911 | Bacteria | 1498 |
| 829 | Ga0496109_0058897 | 3300048912 | Bacteria | 3509 |
| 830 | Ga0496109_0107524 | 3300048912 | Bacteria | 2591 |
| 831 | Ga0496109_0133532 | 3300048912 | Bacteria | 2318 |
| 832 | Ga0496110_0106413 | 3300048913 | Bacteria | 2517 |
| 833 | Ga0496112_0002525 | 3300048915 | Bacteria | 14775 |
| 834 | Ga0496112_0017345 | 3300048915 | Bacteria | 6763 |
| 835 | Ga0496112_0108435 | 3300048915 | Bacteria | 2747 |
| 836 | Ga0496114_0066614 | 3300048917 | Bacteria | 3020 |
| 837 | Ga0496118_0102617 | 3300048921 | Bacteria | 1927 |
| 838 | Ga0501042_0144648 | 3300049578 | Bacteria | 1714 |
| 839 | Ga0501047_0003041 | 3300049581 | Bacteria | 15910 |
| 840 | Ga0501047_0188544 | 3300049581 | Bacteria | 1927 |
| 841 | Ga0501047_0307849 | 3300049581 | Bacteria | 1425 |
| 842 | Ga0501067_0057846 | 3300049583 | Bacteria | 2147 |
| 843 | Ga0501067_0073234 | 3300049583 | Bacteria | 1898 |
| 844 | Ga0501068_0006943 | 3300049584 | Bacteria | 6263 |
| 845 | Ga0501069_0000613 | 3300049585 | Bacteria | 16520 |
| 846 | Ga0501069_0045255 | 3300049585 | Bacteria | 2438 |
| 847 | Ga0501070_0006738 | 3300049586 | Bacteria | 9783 |
| 848 | Ga0501072_0059746 | 3300049588 | Bacteria | 3006 |
| 849 | Ga0501073_0009180 | 3300049589 | Bacteria | 7295 |
| 850 | Ga0501074_0010752 | 3300049590 | Bacteria | 6649 |
| 851 | Ga0501079_0012357 | 3300049741 | Bacteria | 6516 |
| 852 | Ga0501035_0130693 | 3300049822 | Bacteria | 2189 |
| 853 | Ga0501035_0407026 | 3300049822 | Bacteria | 1131 |
| 854 | Ga0501044_0224710 | 3300049823 | Bacteria | 1827 |
| 855 | nmdc:mga0k408_171499_c1 | 3300050493 | Bacteria | 1293 |
| 856 | nmdc:mga0k408_41636_c1 | 3300050493 | Bacteria | 2645 |
| 857 | nmdc:mga05p37_80753_c1 | 3300050507 | Bacteria | 4005 |
| 858 | nmdc:mga0n895_102946_c1 | 3300050512 | Bacteria | 2866 |
| 859 | nmdc:mga0n895_13377_c1 | 3300050512 | Bacteria | 7400 |
| 860 | nmdc:mga0n895_27445_c1 | 3300050512 | Bacteria | 5408 |
| 861 | nmdc:mga0n895_72957_c1 | 3300050512 | Bacteria | 3407 |
| 862 | nmdc:mga0n895_84373_c1 | 3300050512 | Bacteria | 3169 |
| 863 | nmdc:mga0rr50_11310_c1 | 3300050513 | Bacteria | 5707 |
| 864 | nmdc:mga0rr50_182232_c1 | 3300050513 | Bacteria | 1717 |
| 865 | nmdc:mga0rr50_29161_c2 | 3300050513 | Bacteria | 1989 |
| 866 | nmdc:mga08x19_375_c1 | 3300050514 | Bacteria | 31351 |
| 867 | nmdc:mga08x19_77126_c1 | 3300050514 | Bacteria | 2182 |
| 868 | nmdc:mga08x19_87903_c1 | 3300050514 | Bacteria | 2048 |
| 869 | nmdc:mga0a205_175785_c1 | 3300050515 | Bacteria | 2036 |
| 870 | nmdc:mga0a205_402882_c1 | 3300050515 | Bacteria | 1232 |
| 871 | Ga0495601_0013611 | 3300053077 | Bacteria | 4894 |
| 872 | Ga0495612_0071855 | 3300053078 | Bacteria | 1444 |
| 873 | Ga0495595_0021137 | 3300053084 | Bacteria | 2840 |
| 874 | Ga0495595_0058488 | 3300053084 | Bacteria | 1800 |
| 875 | Ga0495595_0090214 | 3300053084 | Bacteria | 1470 |
| 876 | Ga0495619_0040676 | 3300053085 | Bacteria | 3038 |
| 877 | Ga0495619_0108009 | 3300053085 | Bacteria | 1899 |
| 878 | Ga0500588_0017696 | 3300053146 | Bacteria | 1865 |
| 879 | Ga0500616_0089438 | 3300053153 | Unclassified | 1528 |
| 880 | Ga0500636_0000406 | 3300053177 | Bacteria | 23697 |
| 881 | Ga0500637_0002477 | 3300053178 | Bacteria | 8220 |
| 882 | Ga0500625_030665 | 3300053729 | Bacteria | 2551 |
| 883 | Ga0501084_0069796 | 3300054114 | Bacteria | 2942 |
| 884 | Ga0501082_0065815 | 3300060353 | Bacteria | 3121 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005329 | Ga0070683_100094423 | Ga0070683_1000944232 | 271 |
| 2 | 3300005336 | Ga0070680_100113380 | Ga0070680_1001133802 | 271 |
| 3 | 3300005339 | Ga0070660_100140313 | Ga0070660_1001403132 | 271 |
| 4 | 3300005344 | Ga0070661_100007598 | Ga0070661_1000075983 | 271 |
| 5 | 3300005435 | Ga0070714_100007199 | Ga0070714_1000071993 | 271 |
| 6 | 3300005530 | Ga0070679_100017521 | Ga0070679_1000175217 | 271 |
| 7 | 3300005535 | Ga0070684_100004038 | Ga0070684_1000040385 | 271 |
| 8 | 3300005547 | Ga0070693_100021456 | Ga0070693_1000214563 | 271 |
| 9 | 3300005563 | Ga0068855_100012552 | Ga0068855_1000125527 | 271 |
| 10 | 3300005564 | Ga0070664_100001452 | Ga0070664_10000145214 | 271 |
| 11 | 3300005577 | Ga0068857_100001739 | Ga0068857_1000017397 | 271 |
| 12 | 3300005578 | Ga0068854_100089368 | Ga0068854_1000893682 | 271 |
| 13 | 3300005614 | Ga0068856_100006138 | Ga0068856_1000061389 | 271 |
| 14 | 3300005616 | Ga0068852_100001471 | Ga0068852_10000147116 | 271 |
| 15 | 3300005834 | Ga0068851_10085303 | Ga0068851_100853032 | 271 |
| 16 | 3300009093 | Ga0105240_10002731 | Ga0105240_1000273128 | 271 |
| 17 | 3300009551 | Ga0105238_10007592 | Ga0105238_100075929 | 271 |
| 18 | 3300013104 | Ga0157370_10008356 | Ga0157370_100083567 | 271 |
| 19 | 3300013105 | Ga0157369_10014458 | Ga0157369_100144582 | 271 |
| 20 | 3300013307 | Ga0157372_10008051 | Ga0157372_100080519 | 271 |
| 21 | 3300014497 | Ga0182008_10090446 | Ga0182008_100904462 | 271 |
| 22 | 3300025913 | Ga0207695_10025748 | Ga0207695_100257487 | 271 |
| 23 | 3300025919 | Ga0207657_10016447 | Ga0207657_100164475 | 271 |
| 24 | 3300025920 | Ga0207649_10018879 | Ga0207649_100188793 | 271 |
| 25 | 3300025921 | Ga0207652_10468517 | Ga0207652_104685172 | 271 |
| 26 | 3300025924 | Ga0207694_10007179 | Ga0207694_100071792 | 271 |
| 27 | 3300025929 | Ga0207664_10014392 | Ga0207664_100143925 | 271 |
| 28 | 3300025944 | Ga0207661_10040053 | Ga0207661_100400533 | 271 |
| 29 | 3300025949 | Ga0207667_10009435 | Ga0207667_100094353 | 271 |
| 30 | 3300025981 | Ga0207640_10055900 | Ga0207640_100559003 | 271 |
| 31 | 3300026041 | Ga0207639_10118313 | Ga0207639_101183132 | 271 |
| 32 | 3300026078 | Ga0207702_10006720 | Ga0207702_100067205 | 271 |
| 33 | 3300026116 | Ga0207674_10000049 | Ga0207674_1000004921 | 271 |
| 34 | 3300053153 | Ga0500616_0089438 | Ga0500616_0089438_648_1490 | 274 |
| 35 | 3300049578 | Ga0501042_0144648 | Ga0501042_0144648_248_1102 | 276 |
| 36 | 3300005549 | Ga0070704_100211460 | Ga0070704_1002114602 | 279 |
| 37 | 3300009147 | Ga0114129_11054854 | Ga0114129_110548541 | 279 |
| 38 | 3300005341 | Ga0070691_10040216 | Ga0070691_100402163 | 287 |
| 39 | 3300005546 | Ga0070696_100057085 | Ga0070696_1000570852 | 287 |
| 40 | 3300005458 | Ga0070681_10039473 | Ga0070681_100394732 | 290 |
| 41 | 3300005467 | Ga0070706_100089454 | Ga0070706_1000894543 | 290 |
| 42 | 3300005530 | Ga0070679_100009410 | Ga0070679_1000094109 | 290 |
| 43 | 3300005545 | Ga0070695_100184426 | Ga0070695_1001844262 | 290 |
| 44 | 3300005546 | Ga0070696_100065250 | Ga0070696_1000652502 | 290 |
| 45 | 3300006914 | Ga0075436_100029805 | Ga0075436_1000298054 | 290 |
| 46 | 3300006914 | Ga0075436_100202891 | Ga0075436_1002028912 | 290 |
| 47 | 3300025910 | Ga0207684_10289887 | Ga0207684_102898872 | 290 |
| 48 | 3300025912 | Ga0207707_10002855 | Ga0207707_100028553 | 290 |
| 49 | 3300025921 | Ga0207652_10007499 | Ga0207652_100074999 | 290 |
| 50 | 3300035085 | Ga0373929_0022575 | Ga0373929_0022575_379_1257 | 290 |
| 51 | 3300035121 | Ga0373960_0051176 | Ga0373960_0051176_243_1121 | 290 |
| 52 | 3300035241 | Ga0373961_0019449 | Ga0373961_0019449_868_1746 | 290 |
| 53 | 3300035691 | Ga0373931_0018659 | Ga0373931_0018659_831_1709 | 290 |
| 54 | 3300048911 | Ga0496108_0264210 | Ga0496108_0264210_40_915 | 290 |
| 55 | 3300049583 | Ga0501067_0057846 | Ga0501067_0057846_768_1646 | 290 |
| 56 | 3300049585 | Ga0501069_0045255 | Ga0501069_0045255_723_1601 | 290 |
| 57 | 3300050514 | nmdc:mga08x19_87903_c1 | nmdc:mga08x19_87903_c1_796_1674 | 290 |
| 58 | 3300005467 | Ga0070706_100445499 | Ga0070706_1004454991 | 291 |
| 59 | 3300005544 | Ga0070686_100109860 | Ga0070686_1001098602 | 291 |
| 60 | 3300006852 | Ga0075433_10417054 | Ga0075433_104170541 | 291 |
| 61 | 3300006871 | Ga0075434_100007305 | Ga0075434_1000073058 | 291 |
| 62 | 3300006871 | Ga0075434_100037226 | Ga0075434_1000372265 | 291 |
| 63 | 3300006914 | Ga0075436_100089270 | Ga0075436_1000892702 | 291 |
| 64 | 3300007076 | Ga0075435_100017481 | Ga0075435_1000174815 | 291 |
| 65 | 3300009098 | Ga0105245_10144969 | Ga0105245_101449693 | 291 |
| 66 | 3300025910 | Ga0207684_10321317 | Ga0207684_103213172 | 291 |
| 67 | 3300036401 | Ga0373937_0036018 | Ga0373937_0036018_911_1795 | 291 |
| 68 | 3300046454 | Ga0495592_0001143 | Ga0495592_0001143_13780_14664 | 291 |
| 69 | 3300046473 | Ga0495582_0035265 | Ga0495582_0035265_1758_2642 | 291 |
| 70 | 3300046511 | Ga0495608_0000766 | Ga0495608_0000766_13735_14619 | 291 |
| 71 | 3300046514 | Ga0495618_0019941 | Ga0495618_0019941_1024_1908 | 291 |
| 72 | 3300046516 | Ga0495628_0006004 | Ga0495628_0006004_2988_3872 | 291 |
| 73 | 3300046517 | Ga0495630_0158089 | Ga0495630_0158089_83_967 | 291 |
| 74 | 3300046526 | Ga0495666_0021113 | Ga0495666_0021113_1616_2500 | 291 |
| 75 | 3300046529 | Ga0495652_0093914 | Ga0495652_0093914_1185_2069 | 291 |
| 76 | 3300046533 | Ga0495640_0000384 | Ga0495640_0000384_8127_9011 | 291 |
| 77 | 3300046535 | Ga0495586_0000938 | Ga0495586_0000938_1394_2278 | 291 |
| 78 | 3300046536 | Ga0495587_0052496 | Ga0495587_0052496_430_1314 | 291 |
| 79 | 3300046559 | Ga0495667_0003921 | Ga0495667_0003921_3404_4288 | 291 |
| 80 | 3300046642 | Ga0495634_0169122 | Ga0495634_0169122_477_1361 | 291 |
| 81 | 3300046663 | Ga0495635_0013544 | Ga0495635_0013544_2388_3272 | 291 |
| 82 | 3300046678 | Ga0495599_0003110 | Ga0495599_0003110_212_1096 | 291 |
| 83 | 3300046683 | Ga0495658_0025439 | Ga0495658_0025439_1033_1917 | 291 |
| 84 | 3300046689 | Ga0495613_0005741 | Ga0495613_0005741_2993_3877 | 291 |
| 85 | 3300046690 | Ga0495624_0156371 | Ga0495624_0156371_172_1056 | 291 |
| 86 | 3300047317 | Ga0495604_0008259 | Ga0495604_0008259_5976_6860 | 291 |
| 87 | 3300047322 | Ga0495680_0001589 | Ga0495680_0001589_22248_23132 | 291 |
| 88 | 3300047673 | Ga0495593_0089540 | Ga0495593_0089540_380_1264 | 291 |
| 89 | 3300050512 | nmdc:mga0n895_13377_c1 | nmdc:mga0n895_13377_c1_291_1172 | 291 |
| 90 | 3300050512 | nmdc:mga0n895_72957_c1 | nmdc:mga0n895_72957_c1_401_1285 | 291 |
| 91 | 3300050513 | nmdc:mga0rr50_11310_c1 | nmdc:mga0rr50_11310_c1_2386_3267 | 291 |
| 92 | 3300050514 | nmdc:mga08x19_77126_c1 | nmdc:mga08x19_77126_c1_1117_1998 | 291 |
| 93 | 3300050515 | nmdc:mga0a205_175785_c1 | nmdc:mga0a205_175785_c1_810_1694 | 291 |
| 94 | 3300050515 | nmdc:mga0a205_402882_c1 | nmdc:mga0a205_402882_c1_92_973 | 291 |
| 95 | 3300053077 | Ga0495601_0013611 | Ga0495601_0013611_2752_3636 | 291 |
| 96 | 3300053084 | Ga0495595_0058488 | Ga0495595_0058488_605_1489 | 291 |
| 97 | 3300053085 | Ga0495619_0108009 | Ga0495619_0108009_476_1360 | 291 |
| 98 | 3300009093 | Ga0105240_10155105 | Ga0105240_101551052 | 292 |
| 99 | 3300009545 | Ga0105237_10000784 | Ga0105237_1000078416 | 292 |
| 100 | 3300009551 | Ga0105238_10005552 | Ga0105238_100055529 | 292 |
| 101 | 3300010375 | Ga0105239_10001759 | Ga0105239_1000175930 | 292 |
| 102 | 3300021384 | Ga0213876_10138151 | Ga0213876_101381511 | 292 |
| 103 | 3300025913 | Ga0207695_10107882 | Ga0207695_101078822 | 292 |
| 104 | 3300025914 | Ga0207671_10009892 | Ga0207671_100098923 | 292 |
| 105 | 3300025924 | Ga0207694_10015526 | Ga0207694_100155263 | 292 |
| 106 | 3300039437 | Ga0436365_0145813 | Ga0436365_0145813_484_1416 | 292 |
| 107 | 3300035086 | Ga0373934_0037290 | Ga0373934_0037290_808_1701 | 294 |
| 108 | 3300035111 | Ga0373923_0092285 | Ga0373923_0092285_41_934 | 294 |
| 109 | 3300035118 | Ga0373954_0000024 | Ga0373954_0000024_1332_2225 | 294 |
| 110 | 3300035724 | Ga0373933_0054708 | Ga0373933_0054708_113_1006 | 294 |
| 111 | 3300036401 | Ga0373937_0005790 | Ga0373937_0005790_7044_7937 | 294 |
| 112 | 3300046511 | Ga0495608_0099632 | Ga0495608_0099632_474_1367 | 294 |
| 113 | 3300046675 | Ga0495657_0143940 | Ga0495657_0143940_569_1462 | 294 |
| 114 | 3300038741 | Ga0400488_49857 | Ga0400488_49857_93_1007 | 295 |
| 115 | 3300005295 | Ga0065707_10082407 | Ga0065707_1008240710 | 296 |
| 116 | 3300005719 | Ga0068861_100033322 | Ga0068861_1000333223 | 296 |
| 117 | 3300014326 | Ga0157380_10003032 | Ga0157380_1000303210 | 296 |
| 118 | 3300021384 | Ga0213876_10186792 | Ga0213876_101867921 | 296 |
| 119 | 3300026118 | Ga0207675_100011791 | Ga0207675_1000117916 | 296 |
| 120 | 3300039437 | Ga0436365_0608769 | Ga0436365_0608769_2585_3481 | 296 |
| 121 | 3300039453 | Ga0436362_1100797 | Ga0436362_1100797_328_1224 | 296 |
| 122 | 3300042876 | Ga0451577_0137884 | Ga0451577_0137884_280_1176 | 296 |
| 123 | 3300044712 | Ga0453684_0003022 | Ga0453684_0003022_35236_36132 | 296 |
| 124 | 3300046660 | Ga0495625_0005191 | Ga0495625_0005191_823_1716 | 296 |
| 125 | 3300048921 | Ga0496118_0102617 | Ga0496118_0102617_257_1150 | 296 |
| 126 | 3300053146 | Ga0500588_0017696 | Ga0500588_0017696_784_1677 | 296 |
| 127 | 3300005336 | Ga0070680_100093295 | Ga0070680_1000932953 | 297 |
| 128 | 3300025917 | Ga0207660_10095663 | Ga0207660_100956633 | 297 |
| 129 | 3300005458 | Ga0070681_10029133 | Ga0070681_100291333 | 298 |
| 130 | 3300005458 | Ga0070681_10187022 | Ga0070681_101870221 | 299 |
| 131 | 3300007076 | Ga0075435_100136381 | Ga0075435_1001363813 | 299 |
| 132 | 3300021441 | Ga0213871_10008652 | Ga0213871_100086522 | 299 |
| 133 | 3300028800 | Ga0265338_10410831 | Ga0265338_104108311 | 299 |
| 134 | 3300039438 | Ga0436360_0511108 | Ga0436360_0511108_320_1222 | 299 |
| 135 | 3300050513 | nmdc:mga0rr50_182232_c1 | nmdc:mga0rr50_182232_c1_177_1079 | 299 |
| 136 | 3300005719 | Ga0068861_100387977 | Ga0068861_1003879772 | 300 |
| 137 | 3300025893 | Ga0207682_10022780 | Ga0207682_100227803 | 300 |
| 138 | 3300025918 | Ga0207662_10055572 | Ga0207662_100555722 | 300 |
| 139 | 3300031507 | Ga0307509_10000033 | Ga0307509_1000003345 | 300 |
| 140 | 3300035410 | Ga0373924_0005481 | Ga0373924_0005481_3422_4330 | 300 |
| 141 | 3300044693 | Ga0466961_0000955 | Ga0466961_0000955_16318_17226 | 300 |
| 142 | 3300045049 | Ga0466959_0006078 | Ga0466959_0006078_6669_7577 | 300 |
| 143 | 3300046539 | Ga0495621_0011723 | Ga0495621_0011723_1000_1905 | 300 |
| 144 | 3300047322 | Ga0495680_0037627 | Ga0495680_0037627_511_1416 | 300 |
| 145 | 3300005344 | Ga0070661_100348177 | Ga0070661_1003481771 | 301 |
| 146 | 3300005356 | Ga0070674_100401020 | Ga0070674_1004010201 | 301 |
| 147 | 3300005435 | Ga0070714_100128714 | Ga0070714_1001287142 | 301 |
| 148 | 3300005456 | Ga0070678_100073926 | Ga0070678_1000739263 | 301 |
| 149 | 3300005458 | Ga0070681_10162783 | Ga0070681_101627831 | 301 |
| 150 | 3300005459 | Ga0068867_100017647 | Ga0068867_1000176474 | 301 |
| 151 | 3300005530 | Ga0070679_100442781 | Ga0070679_1004427812 | 301 |
| 152 | 3300005539 | Ga0068853_100051686 | Ga0068853_1000516862 | 301 |
| 153 | 3300005563 | Ga0068855_100114999 | Ga0068855_1001149992 | 301 |
| 154 | 3300005614 | Ga0068856_100213730 | Ga0068856_1002137302 | 301 |
| 155 | 3300005842 | Ga0068858_100037266 | Ga0068858_1000372665 | 301 |
| 156 | 3300009093 | Ga0105240_10044396 | Ga0105240_100443965 | 301 |
| 157 | 3300009093 | Ga0105240_10118858 | Ga0105240_101188584 | 301 |
| 158 | 3300009174 | Ga0105241_10074841 | Ga0105241_100748413 | 301 |
| 159 | 3300009176 | Ga0105242_10148976 | Ga0105242_101489762 | 301 |
| 160 | 3300009551 | Ga0105238_10052151 | Ga0105238_100521512 | 301 |
| 161 | 3300013105 | Ga0157369_10073010 | Ga0157369_100730102 | 301 |
| 162 | 3300013105 | Ga0157369_10477747 | Ga0157369_104777471 | 301 |
| 163 | 3300013297 | Ga0157378_10143373 | Ga0157378_101433733 | 301 |
| 164 | 3300013307 | Ga0157372_10114167 | Ga0157372_101141672 | 301 |
| 165 | 3300014325 | Ga0163163_10014090 | Ga0163163_100140904 | 301 |
| 166 | 3300014968 | Ga0157379_10053702 | Ga0157379_100537023 | 301 |
| 167 | 3300017792 | Ga0163161_10012234 | Ga0163161_100122341 | 301 |
| 168 | 3300025911 | Ga0207654_10013552 | Ga0207654_100135523 | 301 |
| 169 | 3300025913 | Ga0207695_10007386 | Ga0207695_100073866 | 301 |
| 170 | 3300025924 | Ga0207694_10234747 | Ga0207694_102347472 | 301 |
| 171 | 3300025928 | Ga0207700_10347522 | Ga0207700_103475221 | 301 |
| 172 | 3300025944 | Ga0207661_10342499 | Ga0207661_103424992 | 301 |
| 173 | 3300025949 | Ga0207667_10045468 | Ga0207667_100454682 | 301 |
| 174 | 3300026035 | Ga0207703_10125813 | Ga0207703_101258131 | 301 |
| 175 | 3300026041 | Ga0207639_10178421 | Ga0207639_101784212 | 301 |
| 176 | 3300026078 | Ga0207702_10303351 | Ga0207702_103033512 | 301 |
| 177 | 3300026089 | Ga0207648_10098558 | Ga0207648_100985582 | 301 |
| 178 | 3300026121 | Ga0207683_10009881 | Ga0207683_100098818 | 301 |
| 179 | 3300026121 | Ga0207683_10302087 | Ga0207683_103020871 | 301 |
| 180 | 3300028381 | Ga0268264_10167479 | Ga0268264_101674793 | 301 |
| 181 | 3300035086 | Ga0373934_0001656 | Ga0373934_0001656_4068_4976 | 301 |
| 182 | 3300035118 | Ga0373954_0002047 | Ga0373954_0002047_3440_4360 | 301 |
| 183 | 3300035119 | Ga0373956_0000371 | Ga0373956_0000371_9969_10877 | 301 |
| 184 | 3300035724 | Ga0373933_0002506 | Ga0373933_0002506_7193_8101 | 301 |
| 185 | 3300036401 | Ga0373937_0004381 | Ga0373937_0004381_7602_8510 | 301 |
| 186 | 3300049590 | Ga0501074_0010752 | Ga0501074_0010752_2170_3078 | 301 |
| 187 | 3300005539 | Ga0068853_100300166 | Ga0068853_1003001662 | 302 |
| 188 | 3300006852 | Ga0075433_10089796 | Ga0075433_100897963 | 302 |
| 189 | 3300006871 | Ga0075434_100102280 | Ga0075434_1001022802 | 302 |
| 190 | 3300009098 | Ga0105245_10158716 | Ga0105245_101587162 | 302 |
| 191 | 3300009176 | Ga0105242_10059563 | Ga0105242_100595633 | 302 |
| 192 | 3300013296 | Ga0157374_10000770 | Ga0157374_1000077015 | 302 |
| 193 | 3300014326 | Ga0157380_10344040 | Ga0157380_103440402 | 302 |
| 194 | 3300025927 | Ga0207687_10079934 | Ga0207687_100799342 | 302 |
| 195 | 3300028786 | Ga0307517_10100353 | Ga0307517_101003532 | 302 |
| 196 | 3300050512 | nmdc:mga0n895_27445_c1 | nmdc:mga0n895_27445_c1_3708_4619 | 302 |
| 197 | 3300005327 | Ga0070658_10107589 | Ga0070658_101075893 | 303 |
| 198 | 3300005441 | Ga0070700_100205572 | Ga0070700_1002055722 | 303 |
| 199 | 3300005459 | Ga0068867_100092869 | Ga0068867_1000928692 | 303 |
| 200 | 3300005719 | Ga0068861_100285235 | Ga0068861_1002852352 | 303 |
| 201 | 3300005985 | Ga0081539_10016545 | Ga0081539_100165454 | 303 |
| 202 | 3300006881 | Ga0068865_100195936 | Ga0068865_1001959363 | 303 |
| 203 | 3300009148 | Ga0105243_10140005 | Ga0105243_101400051 | 303 |
| 204 | 3300009176 | Ga0105242_10000164 | Ga0105242_1000016430 | 303 |
| 205 | 3300009177 | Ga0105248_10051808 | Ga0105248_100518083 | 303 |
| 206 | 3300009551 | Ga0105238_10160067 | Ga0105238_101600672 | 303 |
| 207 | 3300014968 | Ga0157379_10040901 | Ga0157379_100409014 | 303 |
| 208 | 3300025909 | Ga0207705_10073050 | Ga0207705_100730503 | 303 |
| 209 | 3300025924 | Ga0207694_10028502 | Ga0207694_100285022 | 303 |
| 210 | 3300025924 | Ga0207694_10147422 | Ga0207694_101474221 | 303 |
| 211 | 3300025934 | Ga0207686_10004958 | Ga0207686_100049584 | 303 |
| 212 | 3300025935 | Ga0207709_10048377 | Ga0207709_100483773 | 303 |
| 213 | 3300025941 | Ga0207711_10124989 | Ga0207711_101249892 | 303 |
| 214 | 3300026035 | Ga0207703_10092928 | Ga0207703_100929283 | 303 |
| 215 | 3300026089 | Ga0207648_10055564 | Ga0207648_100555642 | 303 |
| 216 | 3300026121 | Ga0207683_10060834 | Ga0207683_100608343 | 303 |
| 217 | 3300050493 | nmdc:mga0k408_171499_c1 | nmdc:mga0k408_171499_c1_309_1223 | 303 |
| 218 | 3300005343 | Ga0070687_100146759 | Ga0070687_1001467592 | 304 |
| 219 | 3300005354 | Ga0070675_100156214 | Ga0070675_1001562142 | 304 |
| 220 | 3300005434 | Ga0070709_10055690 | Ga0070709_100556902 | 304 |
| 221 | 3300005436 | Ga0070713_100003229 | Ga0070713_1000032293 | 304 |
| 222 | 3300005438 | Ga0070701_10057766 | Ga0070701_100577662 | 304 |
| 223 | 3300005617 | Ga0068859_100296865 | Ga0068859_1002968651 | 304 |
| 224 | 3300005719 | Ga0068861_100218927 | Ga0068861_1002189272 | 304 |
| 225 | 3300006914 | Ga0075436_100063727 | Ga0075436_1000637271 | 304 |
| 226 | 3300006931 | Ga0097620_100296861 | Ga0097620_1002968611 | 304 |
| 227 | 3300025906 | Ga0207699_10212859 | Ga0207699_102128592 | 304 |
| 228 | 3300025918 | Ga0207662_10112600 | Ga0207662_101126002 | 304 |
| 229 | 3300025928 | Ga0207700_10004520 | Ga0207700_100045203 | 304 |
| 230 | 3300026118 | Ga0207675_100236629 | Ga0207675_1002366292 | 304 |
| 231 | 3300032133 | Ga0316583_10000196 | Ga0316583_1000019610 | 304 |
| 232 | 3300049822 | Ga0501035_0407026 | Ga0501035_0407026_133_1056 | 304 |
| 233 | 3300053177 | Ga0500636_0000406 | Ga0500636_0000406_17723_18643 | 304 |
| 234 | 3300053178 | Ga0500637_0002477 | Ga0500637_0002477_2778_3698 | 304 |
| 235 | 3300053729 | Ga0500625_030665 | Ga0500625_030665_206_1126 | 304 |
| 236 | 3300005327 | Ga0070658_10032537 | Ga0070658_100325374 | 305 |
| 237 | 3300005327 | Ga0070658_10150425 | Ga0070658_101504252 | 305 |
| 238 | 3300005327 | Ga0070658_10279917 | Ga0070658_102799171 | 305 |
| 239 | 3300005436 | Ga0070713_100000182 | Ga0070713_10000018226 | 305 |
| 240 | 3300005518 | Ga0070699_100016446 | Ga0070699_1000164466 | 305 |
| 241 | 3300005530 | Ga0070679_100027131 | Ga0070679_1000271311 | 305 |
| 242 | 3300005539 | Ga0068853_100410378 | Ga0068853_1004103781 | 305 |
| 243 | 3300005546 | Ga0070696_100016471 | Ga0070696_1000164714 | 305 |
| 244 | 3300005548 | Ga0070665_100164869 | Ga0070665_1001648693 | 305 |
| 245 | 3300005563 | Ga0068855_100081055 | Ga0068855_1000810553 | 305 |
| 246 | 3300005563 | Ga0068855_100178555 | Ga0068855_1001785553 | 305 |
| 247 | 3300005563 | Ga0068855_100285350 | Ga0068855_1002853501 | 305 |
| 248 | 3300005578 | Ga0068854_100106183 | Ga0068854_1001061832 | 305 |
| 249 | 3300005614 | Ga0068856_100456762 | Ga0068856_1004567622 | 305 |
| 250 | 3300005616 | Ga0068852_100015543 | Ga0068852_1000155432 | 305 |
| 251 | 3300005616 | Ga0068852_100039410 | Ga0068852_1000394103 | 305 |
| 252 | 3300005616 | Ga0068852_100074021 | Ga0068852_1000740213 | 305 |
| 253 | 3300009093 | Ga0105240_10137030 | Ga0105240_101370303 | 305 |
| 254 | 3300009093 | Ga0105240_10438741 | Ga0105240_104387412 | 305 |
| 255 | 3300013104 | Ga0157370_10070211 | Ga0157370_100702112 | 305 |
| 256 | 3300013104 | Ga0157370_10154989 | Ga0157370_101549892 | 305 |
| 257 | 3300013105 | Ga0157369_10000733 | Ga0157369_1000073325 | 305 |
| 258 | 3300013307 | Ga0157372_10001652 | Ga0157372_100016528 | 305 |
| 259 | 3300021384 | Ga0213876_10050192 | Ga0213876_100501923 | 305 |
| 260 | 3300025909 | Ga0207705_10093645 | Ga0207705_100936452 | 305 |
| 261 | 3300025909 | Ga0207705_10136169 | Ga0207705_101361692 | 305 |
| 262 | 3300025909 | Ga0207705_10155202 | Ga0207705_101552022 | 305 |
| 263 | 3300025913 | Ga0207695_10479509 | Ga0207695_104795091 | 305 |
| 264 | 3300025921 | Ga0207652_10027029 | Ga0207652_100270293 | 305 |
| 265 | 3300025928 | Ga0207700_10000031 | Ga0207700_1000003129 | 305 |
| 266 | 3300025949 | Ga0207667_10221978 | Ga0207667_102219782 | 305 |
| 267 | 3300026142 | Ga0207698_10010183 | Ga0207698_100101831 | 305 |
| 268 | 3300026142 | Ga0207698_10040284 | Ga0207698_100402842 | 305 |
| 269 | 3300026142 | Ga0207698_10049530 | Ga0207698_100495303 | 305 |
| 270 | 3300028379 | Ga0268266_10096595 | Ga0268266_100965952 | 305 |
| 271 | 3300031548 | Ga0307408_100005363 | Ga0307408_1000053637 | 305 |
| 272 | 3300031824 | Ga0307413_10007333 | Ga0307413_100073332 | 305 |
| 273 | 3300031852 | Ga0307410_10005872 | Ga0307410_100058727 | 305 |
| 274 | 3300031903 | Ga0307407_10006793 | Ga0307407_100067935 | 305 |
| 275 | 3300031911 | Ga0307412_10044277 | Ga0307412_100442772 | 305 |
| 276 | 3300031995 | Ga0307409_100007270 | Ga0307409_1000072705 | 305 |
| 277 | 3300032005 | Ga0307411_10020842 | Ga0307411_100208423 | 305 |
| 278 | 3300032126 | Ga0307415_100020252 | Ga0307415_1000202522 | 305 |
| 279 | 3300037418 | Ga0395900_0017004 | Ga0395900_0017004_5787_6707 | 305 |
| 280 | 3300037471 | Ga0395905_0029937 | Ga0395905_0029937_2437_3357 | 305 |
| 281 | 3300038443 | Ga0395901_0031022 | Ga0395901_0031022_2920_3840 | 305 |
| 282 | 3300039437 | Ga0436365_1551353 | Ga0436365_1551353_588_1553 | 305 |
| 283 | 3300049581 | Ga0501047_0003041 | Ga0501047_0003041_14917_15837 | 305 |
| 284 | 3300049581 | Ga0501047_0188544 | Ga0501047_0188544_934_1854 | 305 |
| 285 | 3300049581 | Ga0501047_0307849 | Ga0501047_0307849_247_1194 | 305 |
| 286 | 3300049583 | Ga0501067_0073234 | Ga0501067_0073234_962_1882 | 305 |
| 287 | 3300049584 | Ga0501068_0006943 | Ga0501068_0006943_2680_3600 | 305 |
| 288 | 3300049585 | Ga0501069_0000613 | Ga0501069_0000613_1953_2873 | 305 |
| 289 | 3300049741 | Ga0501079_0012357 | Ga0501079_0012357_4757_5677 | 305 |
| 290 | 3300049823 | Ga0501044_0224710 | Ga0501044_0224710_221_1141 | 305 |
| 291 | 3300054114 | Ga0501084_0069796 | Ga0501084_0069796_405_1325 | 305 |
| 292 | 3300060353 | Ga0501082_0065815 | Ga0501082_0065815_642_1562 | 305 |
| 293 | 3300005334 | Ga0068869_100072865 | Ga0068869_1000728652 | 306 |
| 294 | 3300005344 | Ga0070661_100163491 | Ga0070661_1001634912 | 306 |
| 295 | 3300005347 | Ga0070668_100046878 | Ga0070668_1000468782 | 306 |
| 296 | 3300005354 | Ga0070675_100094290 | Ga0070675_1000942903 | 306 |
| 297 | 3300005719 | Ga0068861_100084993 | Ga0068861_1000849932 | 306 |
| 298 | 3300005834 | Ga0068851_10000960 | Ga0068851_1000096011 | 306 |
| 299 | 3300005844 | Ga0068862_100190539 | Ga0068862_1001905392 | 306 |
| 300 | 3300006358 | Ga0068871_100026390 | Ga0068871_1000263905 | 306 |
| 301 | 3300006871 | Ga0075434_100132442 | Ga0075434_1001324422 | 306 |
| 302 | 3300007076 | Ga0075435_100104729 | Ga0075435_1001047292 | 306 |
| 303 | 3300013296 | Ga0157374_10324897 | Ga0157374_103248972 | 306 |
| 304 | 3300014326 | Ga0157380_10065644 | Ga0157380_100656443 | 306 |
| 305 | 3300025926 | Ga0207659_10087319 | Ga0207659_100873192 | 306 |
| 306 | 3300025942 | Ga0207689_10055328 | Ga0207689_100553283 | 306 |
| 307 | 3300025972 | Ga0207668_10043006 | Ga0207668_100430062 | 306 |
| 308 | 3300026116 | Ga0207674_10101320 | Ga0207674_101013202 | 306 |
| 309 | 3300028380 | Ga0268265_10157048 | Ga0268265_101570482 | 306 |
| 310 | 3300031241 | Ga0265325_10000877 | Ga0265325_1000087710 | 306 |
| 311 | 3300031247 | Ga0265340_10002744 | Ga0265340_100027449 | 306 |
| 312 | 3300031250 | Ga0265331_10118728 | Ga0265331_101187281 | 306 |
| 313 | 3300031595 | Ga0265313_10058399 | Ga0265313_100583992 | 306 |
| 314 | 3300037068 | Ga0373925_0203955 | Ga0373925_0203955_622_1545 | 306 |
| 315 | 3300042876 | Ga0451577_0000384 | Ga0451577_0000384_50893_51816 | 306 |
| 316 | 3300042876 | Ga0451577_0010249 | Ga0451577_0010249_7792_8721 | 306 |
| 317 | 3300044712 | Ga0453684_0000005 | Ga0453684_0000005_912093_913016 | 306 |
| 318 | 3300044712 | Ga0453684_0000292 | Ga0453684_0000292_185344_186267 | 306 |
| 319 | 3300045051 | Ga0451576_0171487 | Ga0451576_0171487_558_1487 | 306 |
| 320 | 3300045051 | Ga0451576_0217368 | Ga0451576_0217368_1006_1929 | 306 |
| 321 | 3300050493 | nmdc:mga0k408_41636_c1 | nmdc:mga0k408_41636_c1_1433_2377 | 306 |
| 322 | 3300050512 | nmdc:mga0n895_102946_c1 | nmdc:mga0n895_102946_c1_1102_2055 | 306 |
| 323 | 3300050514 | nmdc:mga08x19_375_c1 | nmdc:mga08x19_375_c1_11674_12627 | 306 |
| 324 | 3300005327 | Ga0070658_10035028 | Ga0070658_100350282 | 307 |
| 325 | 3300005329 | Ga0070683_100009335 | Ga0070683_1000093355 | 307 |
| 326 | 3300005337 | Ga0070682_100022407 | Ga0070682_1000224073 | 307 |
| 327 | 3300005339 | Ga0070660_100182922 | Ga0070660_1001829222 | 307 |
| 328 | 3300005366 | Ga0070659_100009887 | Ga0070659_1000098872 | 307 |
| 329 | 3300005439 | Ga0070711_100259675 | Ga0070711_1002596751 | 307 |
| 330 | 3300005455 | Ga0070663_100179948 | Ga0070663_1001799482 | 307 |
| 331 | 3300005467 | Ga0070706_100012233 | Ga0070706_1000122336 | 307 |
| 332 | 3300005535 | Ga0070684_100008621 | Ga0070684_1000086216 | 307 |
| 333 | 3300005536 | Ga0070697_100030789 | Ga0070697_1000307894 | 307 |
| 334 | 3300005539 | Ga0068853_100017260 | Ga0068853_1000172603 | 307 |
| 335 | 3300005545 | Ga0070695_100125609 | Ga0070695_1001256092 | 307 |
| 336 | 3300005564 | Ga0070664_100044446 | Ga0070664_1000444462 | 307 |
| 337 | 3300005577 | Ga0068857_100230592 | Ga0068857_1002305922 | 307 |
| 338 | 3300005578 | Ga0068854_100002439 | Ga0068854_1000024394 | 307 |
| 339 | 3300005614 | Ga0068856_100020687 | Ga0068856_1000206875 | 307 |
| 340 | 3300005616 | Ga0068852_100307024 | Ga0068852_1003070242 | 307 |
| 341 | 3300006852 | Ga0075433_10279420 | Ga0075433_102794202 | 307 |
| 342 | 3300006871 | Ga0075434_100166946 | Ga0075434_1001669462 | 307 |
| 343 | 3300007076 | Ga0075435_100146547 | Ga0075435_1001465472 | 307 |
| 344 | 3300009093 | Ga0105240_10149417 | Ga0105240_101494172 | 307 |
| 345 | 3300009147 | Ga0114129_10134553 | Ga0114129_101345533 | 307 |
| 346 | 3300009174 | Ga0105241_10157905 | Ga0105241_101579052 | 307 |
| 347 | 3300009545 | Ga0105237_10094826 | Ga0105237_100948262 | 307 |
| 348 | 3300009551 | Ga0105238_10098449 | Ga0105238_100984493 | 307 |
| 349 | 3300010375 | Ga0105239_10085915 | Ga0105239_100859152 | 307 |
| 350 | 3300013100 | Ga0157373_10002952 | Ga0157373_100029526 | 307 |
| 351 | 3300020082 | Ga0206353_11406765 | Ga0206353_114067652 | 307 |
| 352 | 3300025315 | Ga0207697_10028498 | Ga0207697_100284982 | 307 |
| 353 | 3300025321 | Ga0207656_10011621 | Ga0207656_100116213 | 307 |
| 354 | 3300025909 | Ga0207705_10017704 | Ga0207705_100177042 | 307 |
| 355 | 3300025912 | Ga0207707_10008732 | Ga0207707_100087329 | 307 |
| 356 | 3300025913 | Ga0207695_10012077 | Ga0207695_100120776 | 307 |
| 357 | 3300025917 | Ga0207660_10016190 | Ga0207660_100161903 | 307 |
| 358 | 3300025919 | Ga0207657_10002834 | Ga0207657_1000283411 | 307 |
| 359 | 3300025920 | Ga0207649_10006699 | Ga0207649_100066996 | 307 |
| 360 | 3300025921 | Ga0207652_10032211 | Ga0207652_100322112 | 307 |
| 361 | 3300025932 | Ga0207690_10013641 | Ga0207690_100136415 | 307 |
| 362 | 3300025944 | Ga0207661_10007655 | Ga0207661_100076554 | 307 |
| 363 | 3300025945 | Ga0207679_10015724 | Ga0207679_100157245 | 307 |
| 364 | 3300025949 | Ga0207667_10014732 | Ga0207667_100147322 | 307 |
| 365 | 3300026067 | Ga0207678_10003847 | Ga0207678_100038479 | 307 |
| 366 | 3300026078 | Ga0207702_10021819 | Ga0207702_100218193 | 307 |
| 367 | 3300026116 | Ga0207674_10001272 | Ga0207674_100012729 | 307 |
| 368 | 3300026142 | Ga0207698_10008826 | Ga0207698_100088265 | 307 |
| 369 | 3300037471 | Ga0395905_0196359 | Ga0395905_0196359_555_1481 | 307 |
| 370 | 3300050507 | nmdc:mga05p37_80753_c1 | nmdc:mga05p37_80753_c1_1612_2544 | 307 |
| 371 | 3300050512 | nmdc:mga0n895_84373_c1 | nmdc:mga0n895_84373_c1_787_1719 | 307 |
| 372 | 3300050513 | nmdc:mga0rr50_29161_c2 | nmdc:mga0rr50_29161_c2_197_1129 | 307 |
| 373 | 3300005328 | Ga0070676_10068314 | Ga0070676_100683142 | 308 |
| 374 | 3300005328 | Ga0070676_10272219 | Ga0070676_102722191 | 308 |
| 375 | 3300005330 | Ga0070690_100149440 | Ga0070690_1001494402 | 308 |
| 376 | 3300005331 | Ga0070670_100008816 | Ga0070670_1000088168 | 308 |
| 377 | 3300005331 | Ga0070670_100016066 | Ga0070670_1000160663 | 308 |
| 378 | 3300005331 | Ga0070670_100136518 | Ga0070670_1001365183 | 308 |
| 379 | 3300005334 | Ga0068869_100004739 | Ga0068869_1000047393 | 308 |
| 380 | 3300005335 | Ga0070666_10105763 | Ga0070666_101057632 | 308 |
| 381 | 3300005336 | Ga0070680_100196864 | Ga0070680_1001968641 | 308 |
| 382 | 3300005339 | Ga0070660_100046204 | Ga0070660_1000462043 | 308 |
| 383 | 3300005344 | Ga0070661_100022620 | Ga0070661_1000226202 | 308 |
| 384 | 3300005344 | Ga0070661_100214918 | Ga0070661_1002149182 | 308 |
| 385 | 3300005347 | Ga0070668_100197707 | Ga0070668_1001977072 | 308 |
| 386 | 3300005347 | Ga0070668_100202278 | Ga0070668_1002022781 | 308 |
| 387 | 3300005353 | Ga0070669_100012251 | Ga0070669_1000122515 | 308 |
| 388 | 3300005354 | Ga0070675_100019261 | Ga0070675_1000192614 | 308 |
| 389 | 3300005354 | Ga0070675_100020262 | Ga0070675_1000202624 | 308 |
| 390 | 3300005355 | Ga0070671_100049314 | Ga0070671_1000493143 | 308 |
| 391 | 3300005355 | Ga0070671_100224776 | Ga0070671_1002247762 | 308 |
| 392 | 3300005364 | Ga0070673_100002674 | Ga0070673_1000026749 | 308 |
| 393 | 3300005365 | Ga0070688_100011341 | Ga0070688_1000113412 | 308 |
| 394 | 3300005367 | Ga0070667_100030235 | Ga0070667_1000302354 | 308 |
| 395 | 3300005456 | Ga0070678_100042143 | Ga0070678_1000421433 | 308 |
| 396 | 3300005466 | Ga0070685_10023375 | Ga0070685_100233753 | 308 |
| 397 | 3300005539 | Ga0068853_100482296 | Ga0068853_1004822961 | 308 |
| 398 | 3300005543 | Ga0070672_100003013 | Ga0070672_1000030138 | 308 |
| 399 | 3300005543 | Ga0070672_100128537 | Ga0070672_1001285372 | 308 |
| 400 | 3300005617 | Ga0068859_100273439 | Ga0068859_1002734392 | 308 |
| 401 | 3300005618 | Ga0068864_100000938 | Ga0068864_1000009383 | 308 |
| 402 | 3300005618 | Ga0068864_100057543 | Ga0068864_1000575432 | 308 |
| 403 | 3300005618 | Ga0068864_100080267 | Ga0068864_1000802674 | 308 |
| 404 | 3300005718 | Ga0068866_10008728 | Ga0068866_100087283 | 308 |
| 405 | 3300005719 | Ga0068861_100119890 | Ga0068861_1001198902 | 308 |
| 406 | 3300005841 | Ga0068863_100001021 | Ga0068863_10000102118 | 308 |
| 407 | 3300005841 | Ga0068863_100187956 | Ga0068863_1001879562 | 308 |
| 408 | 3300005843 | Ga0068860_100053521 | Ga0068860_1000535213 | 308 |
| 409 | 3300005844 | Ga0068862_100005987 | Ga0068862_10000598710 | 308 |
| 410 | 3300006237 | Ga0097621_100059498 | Ga0097621_1000594982 | 308 |
| 411 | 3300006358 | Ga0068871_100004641 | Ga0068871_1000046416 | 308 |
| 412 | 3300006358 | Ga0068871_100025386 | Ga0068871_1000253864 | 308 |
| 413 | 3300006844 | Ga0075428_100392606 | Ga0075428_1003926062 | 308 |
| 414 | 3300006881 | Ga0068865_100003642 | Ga0068865_1000036427 | 308 |
| 415 | 3300006931 | Ga0097620_100273455 | Ga0097620_1002734552 | 308 |
| 416 | 3300009098 | Ga0105245_10110179 | Ga0105245_101101791 | 308 |
| 417 | 3300009176 | Ga0105242_10058443 | Ga0105242_100584433 | 308 |
| 418 | 3300009177 | Ga0105248_10174036 | Ga0105248_101740362 | 308 |
| 419 | 3300009177 | Ga0105248_10187291 | Ga0105248_101872911 | 308 |
| 420 | 3300009553 | Ga0105249_10021927 | Ga0105249_100219272 | 308 |
| 421 | 3300009553 | Ga0105249_10241456 | Ga0105249_102414562 | 308 |
| 422 | 3300013100 | Ga0157373_10043899 | Ga0157373_100438992 | 308 |
| 423 | 3300013104 | Ga0157370_10022125 | Ga0157370_100221255 | 308 |
| 424 | 3300013104 | Ga0157370_10026443 | Ga0157370_100264434 | 308 |
| 425 | 3300013306 | Ga0163162_10048032 | Ga0163162_100480323 | 308 |
| 426 | 3300013306 | Ga0163162_10113072 | Ga0163162_101130722 | 308 |
| 427 | 3300013307 | Ga0157372_10090554 | Ga0157372_100905542 | 308 |
| 428 | 3300013307 | Ga0157372_10251019 | Ga0157372_102510192 | 308 |
| 429 | 3300013308 | Ga0157375_10002885 | Ga0157375_100028852 | 308 |
| 430 | 3300014325 | Ga0163163_10154655 | Ga0163163_101546552 | 308 |
| 431 | 3300014326 | Ga0157380_10096019 | Ga0157380_100960192 | 308 |
| 432 | 3300014968 | Ga0157379_10125381 | Ga0157379_101253811 | 308 |
| 433 | 3300017792 | Ga0163161_10022874 | Ga0163161_100228742 | 308 |
| 434 | 3300017792 | Ga0163161_10040274 | Ga0163161_100402743 | 308 |
| 435 | 3300025899 | Ga0207642_10019622 | Ga0207642_100196223 | 308 |
| 436 | 3300025903 | Ga0207680_10128919 | Ga0207680_101289192 | 308 |
| 437 | 3300025912 | Ga0207707_10059921 | Ga0207707_100599213 | 308 |
| 438 | 3300025919 | Ga0207657_10046523 | Ga0207657_100465235 | 308 |
| 439 | 3300025920 | Ga0207649_10031690 | Ga0207649_100316902 | 308 |
| 440 | 3300025921 | Ga0207652_10019068 | Ga0207652_100190684 | 308 |
| 441 | 3300025923 | Ga0207681_10059152 | Ga0207681_100591522 | 308 |
| 442 | 3300025925 | Ga0207650_10005168 | Ga0207650_100051688 | 308 |
| 443 | 3300025925 | Ga0207650_10025039 | Ga0207650_100250392 | 308 |
| 444 | 3300025925 | Ga0207650_10117475 | Ga0207650_101174752 | 308 |
| 445 | 3300025925 | Ga0207650_10135378 | Ga0207650_101353782 | 308 |
| 446 | 3300025926 | Ga0207659_10312555 | Ga0207659_103125552 | 308 |
| 447 | 3300025931 | Ga0207644_10034668 | Ga0207644_100346683 | 308 |
| 448 | 3300025931 | Ga0207644_10172667 | Ga0207644_101726672 | 308 |
| 449 | 3300025934 | Ga0207686_10119143 | Ga0207686_101191432 | 308 |
| 450 | 3300025937 | Ga0207669_10013482 | Ga0207669_100134823 | 308 |
| 451 | 3300025938 | Ga0207704_10009976 | Ga0207704_100099762 | 308 |
| 452 | 3300025940 | Ga0207691_10003579 | Ga0207691_1000357913 | 308 |
| 453 | 3300025940 | Ga0207691_10004159 | Ga0207691_100041596 | 308 |
| 454 | 3300025942 | Ga0207689_10005585 | Ga0207689_1000558511 | 308 |
| 455 | 3300025960 | Ga0207651_10028614 | Ga0207651_100286143 | 308 |
| 456 | 3300025972 | Ga0207668_10037112 | Ga0207668_100371122 | 308 |
| 457 | 3300025986 | Ga0207658_10051451 | Ga0207658_100514513 | 308 |
| 458 | 3300026035 | Ga0207703_10109175 | Ga0207703_101091753 | 308 |
| 459 | 3300026088 | Ga0207641_10023159 | Ga0207641_100231594 | 308 |
| 460 | 3300026088 | Ga0207641_10204402 | Ga0207641_102044023 | 308 |
| 461 | 3300026089 | Ga0207648_10010928 | Ga0207648_100109285 | 308 |
| 462 | 3300026089 | Ga0207648_10050141 | Ga0207648_100501414 | 308 |
| 463 | 3300026095 | Ga0207676_10003209 | Ga0207676_100032099 | 308 |
| 464 | 3300026095 | Ga0207676_10211577 | Ga0207676_102115771 | 308 |
| 465 | 3300026116 | Ga0207674_10022069 | Ga0207674_100220694 | 308 |
| 466 | 3300026118 | Ga0207675_100017152 | Ga0207675_1000171524 | 308 |
| 467 | 3300026118 | Ga0207675_100096111 | Ga0207675_1000961112 | 308 |
| 468 | 3300026121 | Ga0207683_10022316 | Ga0207683_100223163 | 308 |
| 469 | 3300028379 | Ga0268266_10175235 | Ga0268266_101752352 | 308 |
| 470 | 3300028380 | Ga0268265_10131196 | Ga0268265_101311962 | 308 |
| 471 | 3300042001 | Ga0439441_017770 | Ga0439441_017770_201_1247 | 308 |
| 472 | 3300048915 | Ga0496112_0108435 | Ga0496112_0108435_1566_2576 | 308 |
| 473 | 3300049586 | Ga0501070_0006738 | Ga0501070_0006738_1902_2867 | 308 |
| 474 | 3300049588 | Ga0501072_0059746 | Ga0501072_0059746_201_1166 | 308 |
| 475 | 3300049589 | Ga0501073_0009180 | Ga0501073_0009180_2646_3611 | 308 |
| 476 | 3300049822 | Ga0501035_0130693 | Ga0501035_0130693_1107_2072 | 308 |
| 477 | 3300005293 | Ga0065715_10116233 | Ga0065715_101162332 | 309 |
| 478 | 3300005328 | Ga0070676_10004721 | Ga0070676_100047212 | 309 |
| 479 | 3300005328 | Ga0070676_10027813 | Ga0070676_100278132 | 309 |
| 480 | 3300005330 | Ga0070690_100010995 | Ga0070690_1000109954 | 309 |
| 481 | 3300005331 | Ga0070670_100003022 | Ga0070670_1000030222 | 309 |
| 482 | 3300005331 | Ga0070670_100018840 | Ga0070670_1000188403 | 309 |
| 483 | 3300005331 | Ga0070670_100058387 | Ga0070670_1000583873 | 309 |
| 484 | 3300005331 | Ga0070670_100232640 | Ga0070670_1002326401 | 309 |
| 485 | 3300005334 | Ga0068869_100017352 | Ga0068869_1000173522 | 309 |
| 486 | 3300005335 | Ga0070666_10015504 | Ga0070666_100155043 | 309 |
| 487 | 3300005336 | Ga0070680_100028406 | Ga0070680_1000284064 | 309 |
| 488 | 3300005337 | Ga0070682_100013039 | Ga0070682_1000130392 | 309 |
| 489 | 3300005338 | Ga0068868_100023464 | Ga0068868_1000234645 | 309 |
| 490 | 3300005338 | Ga0068868_100103782 | Ga0068868_1001037822 | 309 |
| 491 | 3300005339 | Ga0070660_100000724 | Ga0070660_1000007243 | 309 |
| 492 | 3300005339 | Ga0070660_100091271 | Ga0070660_1000912712 | 309 |
| 493 | 3300005340 | Ga0070689_100005389 | Ga0070689_1000053893 | 309 |
| 494 | 3300005340 | Ga0070689_100148884 | Ga0070689_1001488841 | 309 |
| 495 | 3300005344 | Ga0070661_100005119 | Ga0070661_1000051198 | 309 |
| 496 | 3300005345 | Ga0070692_10033452 | Ga0070692_100334522 | 309 |
| 497 | 3300005347 | Ga0070668_100105961 | Ga0070668_1001059612 | 309 |
| 498 | 3300005347 | Ga0070668_100118729 | Ga0070668_1001187292 | 309 |
| 499 | 3300005353 | Ga0070669_100002694 | Ga0070669_1000026949 | 309 |
| 500 | 3300005353 | Ga0070669_100007605 | Ga0070669_1000076053 | 309 |
| 501 | 3300005354 | Ga0070675_100057957 | Ga0070675_1000579573 | 309 |
| 502 | 3300005354 | Ga0070675_100111503 | Ga0070675_1001115032 | 309 |
| 503 | 3300005354 | Ga0070675_100364342 | Ga0070675_1003643422 | 309 |
| 504 | 3300005355 | Ga0070671_100002660 | Ga0070671_1000026609 | 309 |
| 505 | 3300005355 | Ga0070671_100021571 | Ga0070671_1000215715 | 309 |
| 506 | 3300005355 | Ga0070671_100396199 | Ga0070671_1003961991 | 309 |
| 507 | 3300005356 | Ga0070674_100017868 | Ga0070674_1000178683 | 309 |
| 508 | 3300005356 | Ga0070674_100031410 | Ga0070674_1000314101 | 309 |
| 509 | 3300005356 | Ga0070674_100375787 | Ga0070674_1003757871 | 309 |
| 510 | 3300005364 | Ga0070673_100000781 | Ga0070673_1000007819 | 309 |
| 511 | 3300005365 | Ga0070688_100002928 | Ga0070688_1000029283 | 309 |
| 512 | 3300005366 | Ga0070659_100004500 | Ga0070659_10000450010 | 309 |
| 513 | 3300005366 | Ga0070659_100051079 | Ga0070659_1000510791 | 309 |
| 514 | 3300005367 | Ga0070667_100006019 | Ga0070667_1000060198 | 309 |
| 515 | 3300005367 | Ga0070667_100029920 | Ga0070667_1000299203 | 309 |
| 516 | 3300005367 | Ga0070667_100048324 | Ga0070667_1000483243 | 309 |
| 517 | 3300005367 | Ga0070667_100150958 | Ga0070667_1001509582 | 309 |
| 518 | 3300005434 | Ga0070709_10046145 | Ga0070709_100461452 | 309 |
| 519 | 3300005435 | Ga0070714_100519007 | Ga0070714_1005190072 | 309 |
| 520 | 3300005436 | Ga0070713_100167543 | Ga0070713_1001675431 | 309 |
| 521 | 3300005437 | Ga0070710_10020640 | Ga0070710_100206401 | 309 |
| 522 | 3300005438 | Ga0070701_10031766 | Ga0070701_100317662 | 309 |
| 523 | 3300005439 | Ga0070711_100057321 | Ga0070711_1000573213 | 309 |
| 524 | 3300005439 | Ga0070711_100292887 | Ga0070711_1002928871 | 309 |
| 525 | 3300005440 | Ga0070705_100009362 | Ga0070705_1000093625 | 309 |
| 526 | 3300005440 | Ga0070705_100143361 | Ga0070705_1001433612 | 309 |
| 527 | 3300005444 | Ga0070694_100037288 | Ga0070694_1000372883 | 309 |
| 528 | 3300005445 | Ga0070708_100000207 | Ga0070708_10000020723 | 309 |
| 529 | 3300005445 | Ga0070708_100013833 | Ga0070708_1000138332 | 309 |
| 530 | 3300005445 | Ga0070708_100157507 | Ga0070708_1001575073 | 309 |
| 531 | 3300005455 | Ga0070663_100004359 | Ga0070663_1000043594 | 309 |
| 532 | 3300005455 | Ga0070663_100085310 | Ga0070663_1000853102 | 309 |
| 533 | 3300005455 | Ga0070663_100215697 | Ga0070663_1002156972 | 309 |
| 534 | 3300005456 | Ga0070678_100015662 | Ga0070678_1000156623 | 309 |
| 535 | 3300005457 | Ga0070662_100001938 | Ga0070662_1000019385 | 309 |
| 536 | 3300005457 | Ga0070662_100105418 | Ga0070662_1001054184 | 309 |
| 537 | 3300005458 | Ga0070681_10032263 | Ga0070681_100322634 | 309 |
| 538 | 3300005459 | Ga0068867_100001219 | Ga0068867_10000121912 | 309 |
| 539 | 3300005459 | Ga0068867_100032888 | Ga0068867_1000328883 | 309 |
| 540 | 3300005459 | Ga0068867_100069617 | Ga0068867_1000696173 | 309 |
| 541 | 3300005459 | Ga0068867_100071110 | Ga0068867_1000711103 | 309 |
| 542 | 3300005466 | Ga0070685_10033508 | Ga0070685_100335083 | 309 |
| 543 | 3300005466 | Ga0070685_10124569 | Ga0070685_101245691 | 309 |
| 544 | 3300005467 | Ga0070706_100014759 | Ga0070706_1000147595 | 309 |
| 545 | 3300005467 | Ga0070706_100021479 | Ga0070706_1000214795 | 309 |
| 546 | 3300005467 | Ga0070706_100303711 | Ga0070706_1003037112 | 309 |
| 547 | 3300005468 | Ga0070707_100053719 | Ga0070707_1000537193 | 309 |
| 548 | 3300005468 | Ga0070707_100228470 | Ga0070707_1002284701 | 309 |
| 549 | 3300005471 | Ga0070698_100160694 | Ga0070698_1001606942 | 309 |
| 550 | 3300005518 | Ga0070699_100065339 | Ga0070699_1000653392 | 309 |
| 551 | 3300005530 | Ga0070679_100095712 | Ga0070679_1000957123 | 309 |
| 552 | 3300005530 | Ga0070679_100171380 | Ga0070679_1001713802 | 309 |
| 553 | 3300005535 | Ga0070684_100077446 | Ga0070684_1000774463 | 309 |
| 554 | 3300005536 | Ga0070697_100137959 | Ga0070697_1001379591 | 309 |
| 555 | 3300005539 | Ga0068853_100006566 | Ga0068853_1000065662 | 309 |
| 556 | 3300005539 | Ga0068853_100385458 | Ga0068853_1003854582 | 309 |
| 557 | 3300005543 | Ga0070672_100008331 | Ga0070672_1000083318 | 309 |
| 558 | 3300005543 | Ga0070672_100267940 | Ga0070672_1002679402 | 309 |
| 559 | 3300005545 | Ga0070695_100292465 | Ga0070695_1002924651 | 309 |
| 560 | 3300005546 | Ga0070696_100096392 | Ga0070696_1000963922 | 309 |
| 561 | 3300005547 | Ga0070693_100000167 | Ga0070693_1000001675 | 309 |
| 562 | 3300005548 | Ga0070665_100086087 | Ga0070665_1000860874 | 309 |
| 563 | 3300005548 | Ga0070665_100100363 | Ga0070665_1001003633 | 309 |
| 564 | 3300005548 | Ga0070665_100168298 | Ga0070665_1001682982 | 309 |
| 565 | 3300005549 | Ga0070704_100252825 | Ga0070704_1002528252 | 309 |
| 566 | 3300005563 | Ga0068855_100001160 | Ga0068855_10000116022 | 309 |
| 567 | 3300005563 | Ga0068855_100231263 | Ga0068855_1002312632 | 309 |
| 568 | 3300005563 | Ga0068855_100390756 | Ga0068855_1003907562 | 309 |
| 569 | 3300005564 | Ga0070664_100000955 | Ga0070664_10000095515 | 309 |
| 570 | 3300005564 | Ga0070664_100039893 | Ga0070664_1000398933 | 309 |
| 571 | 3300005564 | Ga0070664_100245147 | Ga0070664_1002451471 | 309 |
| 572 | 3300005577 | Ga0068857_100001623 | Ga0068857_1000016239 | 309 |
| 573 | 3300005578 | Ga0068854_100002132 | Ga0068854_1000021323 | 309 |
| 574 | 3300005578 | Ga0068854_100047083 | Ga0068854_1000470833 | 309 |
| 575 | 3300005614 | Ga0068856_100001343 | Ga0068856_10000134322 | 309 |
| 576 | 3300005615 | Ga0070702_100055567 | Ga0070702_1000555672 | 309 |
| 577 | 3300005615 | Ga0070702_100082392 | Ga0070702_1000823922 | 309 |
| 578 | 3300005617 | Ga0068859_100001484 | Ga0068859_10000148416 | 309 |
| 579 | 3300005617 | Ga0068859_100005749 | Ga0068859_10000574912 | 309 |
| 580 | 3300005617 | Ga0068859_100009886 | Ga0068859_1000098865 | 309 |
| 581 | 3300005617 | Ga0068859_100171956 | Ga0068859_1001719562 | 309 |
| 582 | 3300005617 | Ga0068859_100382569 | Ga0068859_1003825692 | 309 |
| 583 | 3300005618 | Ga0068864_100002372 | Ga0068864_1000023728 | 309 |
| 584 | 3300005618 | Ga0068864_100009418 | Ga0068864_1000094185 | 309 |
| 585 | 3300005618 | Ga0068864_100012050 | Ga0068864_1000120505 | 309 |
| 586 | 3300005618 | Ga0068864_100288362 | Ga0068864_1002883622 | 309 |
| 587 | 3300005718 | Ga0068866_10004687 | Ga0068866_100046873 | 309 |
| 588 | 3300005719 | Ga0068861_100000187 | Ga0068861_1000001876 | 309 |
| 589 | 3300005719 | Ga0068861_100032868 | Ga0068861_1000328682 | 309 |
| 590 | 3300005840 | Ga0068870_10002579 | Ga0068870_100025792 | 309 |
| 591 | 3300005840 | Ga0068870_10036417 | Ga0068870_100364172 | 309 |
| 592 | 3300005841 | Ga0068863_100006037 | Ga0068863_10000603710 | 309 |
| 593 | 3300005841 | Ga0068863_100017026 | Ga0068863_1000170267 | 309 |
| 594 | 3300005841 | Ga0068863_100067668 | Ga0068863_1000676682 | 309 |
| 595 | 3300005841 | Ga0068863_100089366 | Ga0068863_1000893663 | 309 |
| 596 | 3300005841 | Ga0068863_100105364 | Ga0068863_1001053643 | 309 |
| 597 | 3300005842 | Ga0068858_100018888 | Ga0068858_1000188888 | 309 |
| 598 | 3300005842 | Ga0068858_100059857 | Ga0068858_1000598573 | 309 |
| 599 | 3300005843 | Ga0068860_100002049 | Ga0068860_10000204912 | 309 |
| 600 | 3300005843 | Ga0068860_100011724 | Ga0068860_1000117248 | 309 |
| 601 | 3300005843 | Ga0068860_100015024 | Ga0068860_1000150245 | 309 |
| 602 | 3300005843 | Ga0068860_100037387 | Ga0068860_1000373873 | 309 |
| 603 | 3300005843 | Ga0068860_100080420 | Ga0068860_1000804203 | 309 |
| 604 | 3300005843 | Ga0068860_100490388 | Ga0068860_1004903881 | 309 |
| 605 | 3300005844 | Ga0068862_100032015 | Ga0068862_1000320155 | 309 |
| 606 | 3300005844 | Ga0068862_100061523 | Ga0068862_1000615233 | 309 |
| 607 | 3300005844 | Ga0068862_100133897 | Ga0068862_1001338973 | 309 |
| 608 | 3300006175 | Ga0070712_100057002 | Ga0070712_1000570022 | 309 |
| 609 | 3300006237 | Ga0097621_100000972 | Ga0097621_1000009729 | 309 |
| 610 | 3300006237 | Ga0097621_100185151 | Ga0097621_1001851512 | 309 |
| 611 | 3300006358 | Ga0068871_100038217 | Ga0068871_1000382172 | 309 |
| 612 | 3300006871 | Ga0075434_100099450 | Ga0075434_1000994503 | 309 |
| 613 | 3300006881 | Ga0068865_100129330 | Ga0068865_1001293302 | 309 |
| 614 | 3300006881 | Ga0068865_100184963 | Ga0068865_1001849632 | 309 |
| 615 | 3300006914 | Ga0075436_100251542 | Ga0075436_1002515422 | 309 |
| 616 | 3300006931 | Ga0097620_100001484 | Ga0097620_1000014848 | 309 |
| 617 | 3300006931 | Ga0097620_100005749 | Ga0097620_10000574912 | 309 |
| 618 | 3300006931 | Ga0097620_100009886 | Ga0097620_1000098865 | 309 |
| 619 | 3300006931 | Ga0097620_100171954 | Ga0097620_1001719542 | 309 |
| 620 | 3300006931 | Ga0097620_100382578 | Ga0097620_1003825782 | 309 |
| 621 | 3300007076 | Ga0075435_100147197 | Ga0075435_1001471972 | 309 |
| 622 | 3300009098 | Ga0105245_10012549 | Ga0105245_100125493 | 309 |
| 623 | 3300009098 | Ga0105245_10097497 | Ga0105245_100974973 | 309 |
| 624 | 3300009098 | Ga0105245_10179197 | Ga0105245_101791971 | 309 |
| 625 | 3300009101 | Ga0105247_10012360 | Ga0105247_100123603 | 309 |
| 626 | 3300009176 | Ga0105242_10585788 | Ga0105242_105857881 | 309 |
| 627 | 3300009177 | Ga0105248_10010030 | Ga0105248_100100304 | 309 |
| 628 | 3300009177 | Ga0105248_10472094 | Ga0105248_104720942 | 309 |
| 629 | 3300009545 | Ga0105237_10132236 | Ga0105237_101322362 | 309 |
| 630 | 3300010375 | Ga0105239_10105346 | Ga0105239_101053462 | 309 |
| 631 | 3300013100 | Ga0157373_10000447 | Ga0157373_1000044717 | 309 |
| 632 | 3300013102 | Ga0157371_10001482 | Ga0157371_1000148217 | 309 |
| 633 | 3300013104 | Ga0157370_10003331 | Ga0157370_1000333118 | 309 |
| 634 | 3300013104 | Ga0157370_10093375 | Ga0157370_100933752 | 309 |
| 635 | 3300013105 | Ga0157369_10046834 | Ga0157369_100468342 | 309 |
| 636 | 3300013105 | Ga0157369_10210252 | Ga0157369_102102522 | 309 |
| 637 | 3300013296 | Ga0157374_10021298 | Ga0157374_100212985 | 309 |
| 638 | 3300013297 | Ga0157378_10008577 | Ga0157378_100085774 | 309 |
| 639 | 3300013297 | Ga0157378_10022887 | Ga0157378_100228875 | 309 |
| 640 | 3300013297 | Ga0157378_10023714 | Ga0157378_100237143 | 309 |
| 641 | 3300013297 | Ga0157378_10136278 | Ga0157378_101362783 | 309 |
| 642 | 3300013306 | Ga0163162_10002232 | Ga0163162_1000223210 | 309 |
| 643 | 3300013306 | Ga0163162_10011501 | Ga0163162_100115013 | 309 |
| 644 | 3300013306 | Ga0163162_10170868 | Ga0163162_101708683 | 309 |
| 645 | 3300013307 | Ga0157372_10004508 | Ga0157372_100045087 | 309 |
| 646 | 3300013307 | Ga0157372_10358940 | Ga0157372_103589402 | 309 |
| 647 | 3300013308 | Ga0157375_10007037 | Ga0157375_100070375 | 309 |
| 648 | 3300013308 | Ga0157375_10009095 | Ga0157375_100090952 | 309 |
| 649 | 3300013308 | Ga0157375_10127714 | Ga0157375_101277143 | 309 |
| 650 | 3300013308 | Ga0157375_10200422 | Ga0157375_102004222 | 309 |
| 651 | 3300013308 | Ga0157375_10250873 | Ga0157375_102508733 | 309 |
| 652 | 3300014325 | Ga0163163_10006684 | Ga0163163_100066843 | 309 |
| 653 | 3300014325 | Ga0163163_10281184 | Ga0163163_102811842 | 309 |
| 654 | 3300014745 | Ga0157377_10014176 | Ga0157377_100141762 | 309 |
| 655 | 3300014968 | Ga0157379_10001106 | Ga0157379_1000110614 | 309 |
| 656 | 3300014968 | Ga0157379_10002047 | Ga0157379_100020472 | 309 |
| 657 | 3300014968 | Ga0157379_10004185 | Ga0157379_1000418510 | 309 |
| 658 | 3300014968 | Ga0157379_10237701 | Ga0157379_102377012 | 309 |
| 659 | 3300014969 | Ga0157376_10010457 | Ga0157376_100104571 | 309 |
| 660 | 3300014969 | Ga0157376_10122392 | Ga0157376_101223923 | 309 |
| 661 | 3300025315 | Ga0207697_10009495 | Ga0207697_100094955 | 309 |
| 662 | 3300025315 | Ga0207697_10012374 | Ga0207697_100123743 | 309 |
| 663 | 3300025885 | Ga0207653_10051330 | Ga0207653_100513302 | 309 |
| 664 | 3300025898 | Ga0207692_10016570 | Ga0207692_100165704 | 309 |
| 665 | 3300025899 | Ga0207642_10002368 | Ga0207642_100023686 | 309 |
| 666 | 3300025905 | Ga0207685_10005968 | Ga0207685_100059682 | 309 |
| 667 | 3300025907 | Ga0207645_10001058 | Ga0207645_100010588 | 309 |
| 668 | 3300025910 | Ga0207684_10027046 | Ga0207684_100270464 | 309 |
| 669 | 3300025910 | Ga0207684_10120923 | Ga0207684_101209231 | 309 |
| 670 | 3300025910 | Ga0207684_10272337 | Ga0207684_102723372 | 309 |
| 671 | 3300025915 | Ga0207693_10002176 | Ga0207693_100021764 | 309 |
| 672 | 3300025915 | Ga0207693_10012772 | Ga0207693_100127723 | 309 |
| 673 | 3300025919 | Ga0207657_10000371 | Ga0207657_1000037142 | 309 |
| 674 | 3300025919 | Ga0207657_10021571 | Ga0207657_100215712 | 309 |
| 675 | 3300025920 | Ga0207649_10073901 | Ga0207649_100739012 | 309 |
| 676 | 3300025921 | Ga0207652_10062293 | Ga0207652_100622933 | 309 |
| 677 | 3300025921 | Ga0207652_10101618 | Ga0207652_101016182 | 309 |
| 678 | 3300025923 | Ga0207681_10003039 | Ga0207681_100030395 | 309 |
| 679 | 3300025923 | Ga0207681_10007075 | Ga0207681_100070753 | 309 |
| 680 | 3300025925 | Ga0207650_10050810 | Ga0207650_100508103 | 309 |
| 681 | 3300025925 | Ga0207650_10078797 | Ga0207650_100787972 | 309 |
| 682 | 3300025925 | Ga0207650_10086907 | Ga0207650_100869073 | 309 |
| 683 | 3300025925 | Ga0207650_10134836 | Ga0207650_101348362 | 309 |
| 684 | 3300025925 | Ga0207650_10348937 | Ga0207650_103489371 | 309 |
| 685 | 3300025926 | Ga0207659_10002989 | Ga0207659_100029898 | 309 |
| 686 | 3300025926 | Ga0207659_10039362 | Ga0207659_100393624 | 309 |
| 687 | 3300025926 | Ga0207659_10042751 | Ga0207659_100427512 | 309 |
| 688 | 3300025927 | Ga0207687_10001668 | Ga0207687_100016686 | 309 |
| 689 | 3300025927 | Ga0207687_10022739 | Ga0207687_100227394 | 309 |
| 690 | 3300025927 | Ga0207687_10137867 | Ga0207687_101378671 | 309 |
| 691 | 3300025929 | Ga0207664_10001654 | Ga0207664_100016546 | 309 |
| 692 | 3300025931 | Ga0207644_10005084 | Ga0207644_100050844 | 309 |
| 693 | 3300025931 | Ga0207644_10014130 | Ga0207644_100141303 | 309 |
| 694 | 3300025931 | Ga0207644_10018467 | Ga0207644_100184674 | 309 |
| 695 | 3300025931 | Ga0207644_10163062 | Ga0207644_101630622 | 309 |
| 696 | 3300025931 | Ga0207644_10203741 | Ga0207644_102037412 | 309 |
| 697 | 3300025932 | Ga0207690_10004056 | Ga0207690_100040565 | 309 |
| 698 | 3300025933 | Ga0207706_10003193 | Ga0207706_100031939 | 309 |
| 699 | 3300025933 | Ga0207706_10079309 | Ga0207706_100793092 | 309 |
| 700 | 3300025933 | Ga0207706_10111896 | Ga0207706_101118963 | 309 |
| 701 | 3300025933 | Ga0207706_10112050 | Ga0207706_101120504 | 309 |
| 702 | 3300025934 | Ga0207686_10000198 | Ga0207686_1000019810 | 309 |
| 703 | 3300025935 | Ga0207709_10098015 | Ga0207709_100980152 | 309 |
| 704 | 3300025936 | Ga0207670_10053128 | Ga0207670_100531283 | 309 |
| 705 | 3300025936 | Ga0207670_10069615 | Ga0207670_100696153 | 309 |
| 706 | 3300025937 | Ga0207669_10311747 | Ga0207669_103117472 | 309 |
| 707 | 3300025938 | Ga0207704_10080526 | Ga0207704_100805262 | 309 |
| 708 | 3300025938 | Ga0207704_10216624 | Ga0207704_102166242 | 309 |
| 709 | 3300025939 | Ga0207665_10014015 | Ga0207665_100140153 | 309 |
| 710 | 3300025939 | Ga0207665_10043053 | Ga0207665_100430533 | 309 |
| 711 | 3300025940 | Ga0207691_10000041 | Ga0207691_1000004180 | 309 |
| 712 | 3300025940 | Ga0207691_10009490 | Ga0207691_100094907 | 309 |
| 713 | 3300025940 | Ga0207691_10129154 | Ga0207691_101291542 | 309 |
| 714 | 3300025940 | Ga0207691_10176499 | Ga0207691_101764992 | 309 |
| 715 | 3300025940 | Ga0207691_10223429 | Ga0207691_102234291 | 309 |
| 716 | 3300025941 | Ga0207711_10003428 | Ga0207711_1000342812 | 309 |
| 717 | 3300025941 | Ga0207711_10141164 | Ga0207711_101411642 | 309 |
| 718 | 3300025941 | Ga0207711_10342706 | Ga0207711_103427062 | 309 |
| 719 | 3300025942 | Ga0207689_10027083 | Ga0207689_100270834 | 309 |
| 720 | 3300025942 | Ga0207689_10040648 | Ga0207689_100406482 | 309 |
| 721 | 3300025945 | Ga0207679_10001683 | Ga0207679_100016835 | 309 |
| 722 | 3300025945 | Ga0207679_10115313 | Ga0207679_101153133 | 309 |
| 723 | 3300025945 | Ga0207679_10277827 | Ga0207679_102778271 | 309 |
| 724 | 3300025949 | Ga0207667_10003619 | Ga0207667_100036197 | 309 |
| 725 | 3300025949 | Ga0207667_10195073 | Ga0207667_101950732 | 309 |
| 726 | 3300025949 | Ga0207667_10345781 | Ga0207667_103457812 | 309 |
| 727 | 3300025960 | Ga0207651_10001393 | Ga0207651_100013933 | 309 |
| 728 | 3300025972 | Ga0207668_10001997 | Ga0207668_100019977 | 309 |
| 729 | 3300025972 | Ga0207668_10009587 | Ga0207668_100095874 | 309 |
| 730 | 3300025972 | Ga0207668_10150037 | Ga0207668_101500372 | 309 |
| 731 | 3300025986 | Ga0207658_10002334 | Ga0207658_100023349 | 309 |
| 732 | 3300025986 | Ga0207658_10006384 | Ga0207658_100063848 | 309 |
| 733 | 3300025986 | Ga0207658_10061091 | Ga0207658_100610914 | 309 |
| 734 | 3300025986 | Ga0207658_10132864 | Ga0207658_101328643 | 309 |
| 735 | 3300025986 | Ga0207658_10245612 | Ga0207658_102456122 | 309 |
| 736 | 3300026023 | Ga0207677_10000799 | Ga0207677_100007998 | 309 |
| 737 | 3300026023 | Ga0207677_10011028 | Ga0207677_100110282 | 309 |
| 738 | 3300026023 | Ga0207677_10109751 | Ga0207677_101097512 | 309 |
| 739 | 3300026023 | Ga0207677_10149734 | Ga0207677_101497342 | 309 |
| 740 | 3300026023 | Ga0207677_10194732 | Ga0207677_101947322 | 309 |
| 741 | 3300026035 | Ga0207703_10000143 | Ga0207703_100001438 | 309 |
| 742 | 3300026035 | Ga0207703_10009453 | Ga0207703_100094533 | 309 |
| 743 | 3300026041 | Ga0207639_10024584 | Ga0207639_100245843 | 309 |
| 744 | 3300026041 | Ga0207639_10394692 | Ga0207639_103946922 | 309 |
| 745 | 3300026067 | Ga0207678_10034156 | Ga0207678_100341563 | 309 |
| 746 | 3300026078 | Ga0207702_10003083 | Ga0207702_100030839 | 309 |
| 747 | 3300026088 | Ga0207641_10007742 | Ga0207641_100077427 | 309 |
| 748 | 3300026088 | Ga0207641_10008173 | Ga0207641_100081739 | 309 |
| 749 | 3300026088 | Ga0207641_10009450 | Ga0207641_100094503 | 309 |
| 750 | 3300026088 | Ga0207641_10119853 | Ga0207641_101198533 | 309 |
| 751 | 3300026088 | Ga0207641_10232239 | Ga0207641_102322392 | 309 |
| 752 | 3300026088 | Ga0207641_10263971 | Ga0207641_102639712 | 309 |
| 753 | 3300026089 | Ga0207648_10000601 | Ga0207648_1000060127 | 309 |
| 754 | 3300026089 | Ga0207648_10002730 | Ga0207648_1000273017 | 309 |
| 755 | 3300026089 | Ga0207648_10065770 | Ga0207648_100657703 | 309 |
| 756 | 3300026089 | Ga0207648_10143825 | Ga0207648_101438252 | 309 |
| 757 | 3300026095 | Ga0207676_10000837 | Ga0207676_1000083710 | 309 |
| 758 | 3300026095 | Ga0207676_10004178 | Ga0207676_100041788 | 309 |
| 759 | 3300026095 | Ga0207676_10406325 | Ga0207676_104063252 | 309 |
| 760 | 3300026116 | Ga0207674_10003466 | Ga0207674_1000346611 | 309 |
| 761 | 3300026118 | Ga0207675_100000517 | Ga0207675_10000051721 | 309 |
| 762 | 3300026118 | Ga0207675_100016774 | Ga0207675_1000167743 | 309 |
| 763 | 3300026118 | Ga0207675_100100218 | Ga0207675_1001002183 | 309 |
| 764 | 3300026121 | Ga0207683_10000011 | Ga0207683_1000001137 | 309 |
| 765 | 3300026121 | Ga0207683_10199082 | Ga0207683_101990822 | 309 |
| 766 | 3300026142 | Ga0207698_10071607 | Ga0207698_100716072 | 309 |
| 767 | 3300027665 | Ga0209983_1015175 | Ga0209983_10151752 | 309 |
| 768 | 3300027682 | Ga0209971_1005384 | Ga0209971_10053843 | 309 |
| 769 | 3300028379 | Ga0268266_10032521 | Ga0268266_100325214 | 309 |
| 770 | 3300028379 | Ga0268266_10060826 | Ga0268266_100608262 | 309 |
| 771 | 3300028379 | Ga0268266_10133826 | Ga0268266_101338262 | 309 |
| 772 | 3300028379 | Ga0268266_10171313 | Ga0268266_101713133 | 309 |
| 773 | 3300028380 | Ga0268265_10015632 | Ga0268265_100156324 | 309 |
| 774 | 3300028380 | Ga0268265_10019444 | Ga0268265_100194445 | 309 |
| 775 | 3300028380 | Ga0268265_10410493 | Ga0268265_104104932 | 309 |
| 776 | 3300028381 | Ga0268264_10000641 | Ga0268264_1000064117 | 309 |
| 777 | 3300028381 | Ga0268264_10003919 | Ga0268264_100039199 | 309 |
| 778 | 3300028381 | Ga0268264_10020018 | Ga0268264_100200182 | 309 |
| 779 | 3300028381 | Ga0268264_10025067 | Ga0268264_100250674 | 309 |
| 780 | 3300028381 | Ga0268264_10045620 | Ga0268264_100456203 | 309 |
| 781 | 3300028381 | Ga0268264_10167528 | Ga0268264_101675282 | 309 |
| 782 | 3300031235 | Ga0265330_10010054 | Ga0265330_100100542 | 309 |
| 783 | 3300031238 | Ga0265332_10001333 | Ga0265332_100013335 | 309 |
| 784 | 3300031249 | Ga0265339_10064615 | Ga0265339_100646152 | 309 |
| 785 | 3300031250 | Ga0265331_10000310 | Ga0265331_1000031031 | 309 |
| 786 | 3300031251 | Ga0265327_10002920 | Ga0265327_100029205 | 309 |
| 787 | 3300031344 | Ga0265316_10052062 | Ga0265316_100520622 | 309 |
| 788 | 3300031548 | Ga0307408_100004310 | Ga0307408_1000043103 | 309 |
| 789 | 3300031711 | Ga0265314_10003412 | Ga0265314_100034124 | 309 |
| 790 | 3300031731 | Ga0307405_10001375 | Ga0307405_100013752 | 309 |
| 791 | 3300031824 | Ga0307413_10013300 | Ga0307413_100133002 | 309 |
| 792 | 3300031852 | Ga0307410_10008880 | Ga0307410_100088803 | 309 |
| 793 | 3300031901 | Ga0307406_10025843 | Ga0307406_100258433 | 309 |
| 794 | 3300031903 | Ga0307407_10010883 | Ga0307407_100108832 | 309 |
| 795 | 3300031911 | Ga0307412_10030015 | Ga0307412_100300151 | 309 |
| 796 | 3300031995 | Ga0307409_100012433 | Ga0307409_1000124333 | 309 |
| 797 | 3300032002 | Ga0307416_100010652 | Ga0307416_1000106522 | 309 |
| 798 | 3300032004 | Ga0307414_10056839 | Ga0307414_100568393 | 309 |
| 799 | 3300032005 | Ga0307411_10000280 | Ga0307411_100002807 | 309 |
| 800 | 3300032126 | Ga0307415_100030087 | Ga0307415_1000300872 | 309 |
| 801 | 3300035083 | Ga0373926_0035913 | Ga0373926_0035913_289_1236 | 309 |
| 802 | 3300035119 | Ga0373956_0018705 | Ga0373956_0018705_1754_2701 | 309 |
| 803 | 3300035119 | Ga0373956_0027005 | Ga0373956_0027005_1118_2065 | 309 |
| 804 | 3300035170 | Ga0373943_0040108 | Ga0373943_0040108_451_1398 | 309 |
| 805 | 3300035171 | Ga0373946_0038180 | Ga0373946_0038180_249_1196 | 309 |
| 806 | 3300035410 | Ga0373924_0053614 | Ga0373924_0053614_229_1176 | 309 |
| 807 | 3300035691 | Ga0373931_0047147 | Ga0373931_0047147_390_1322 | 309 |
| 808 | 3300035691 | Ga0373931_0070837 | Ga0373931_0070837_815_1753 | 309 |
| 809 | 3300035692 | Ga0373935_0056925 | Ga0373935_0056925_800_1747 | 309 |
| 810 | 3300035692 | Ga0373935_0140824 | Ga0373935_0140824_604_1539 | 309 |
| 811 | 3300035695 | Ga0373927_0009964 | Ga0373927_0009964_4242_5189 | 309 |
| 812 | 3300035695 | Ga0373927_0065625 | Ga0373927_0065625_92_1036 | 309 |
| 813 | 3300035724 | Ga0373933_0046747 | Ga0373933_0046747_783_1730 | 309 |
| 814 | 3300035724 | Ga0373933_0128305 | Ga0373933_0128305_147_1079 | 309 |
| 815 | 3300035725 | Ga0373947_0034332 | Ga0373947_0034332_1113_2060 | 309 |
| 816 | 3300035725 | Ga0373947_0144067 | Ga0373947_0144067_459_1406 | 309 |
| 817 | 3300036401 | Ga0373937_0025706 | Ga0373937_0025706_723_1670 | 309 |
| 818 | 3300036401 | Ga0373937_0136086 | Ga0373937_0136086_223_1170 | 309 |
| 819 | 3300036401 | Ga0373937_0170311 | Ga0373937_0170311_800_1747 | 309 |
| 820 | 3300037068 | Ga0373925_0027934 | Ga0373925_0027934_1828_2763 | 309 |
| 821 | 3300037068 | Ga0373925_0037859 | Ga0373925_0037859_770_1717 | 309 |
| 822 | 3300037068 | Ga0373925_0237920 | Ga0373925_0237920_364_1311 | 309 |
| 823 | 3300042005 | Ga0439448_0015880 | Ga0439448_0015880_552_1499 | 309 |
| 824 | 3300042876 | Ga0451577_0183588 | Ga0451577_0183588_909_1841 | 309 |
| 825 | 3300042876 | Ga0451577_0247110 | Ga0451577_0247110_509_1444 | 309 |
| 826 | 3300044694 | Ga0466963_0037905 | Ga0466963_0037905_977_1942 | 309 |
| 827 | 3300045976 | Ga0466967_0060125 | Ga0466967_0060125_491_1456 | 309 |
| 828 | 3300046455 | Ga0495603_0032134 | Ga0495603_0032134_579_1526 | 309 |
| 829 | 3300046459 | Ga0495629_0008490 | Ga0495629_0008490_1442_2389 | 309 |
| 830 | 3300046472 | Ga0495580_0025942 | Ga0495580_0025942_2559_3506 | 309 |
| 831 | 3300046472 | Ga0495580_0134757 | Ga0495580_0134757_412_1353 | 309 |
| 832 | 3300046472 | Ga0495580_0135755 | Ga0495580_0135755_82_1026 | 309 |
| 833 | 3300046473 | Ga0495582_0033204 | Ga0495582_0033204_716_1663 | 309 |
| 834 | 3300046475 | Ga0495639_0010739 | Ga0495639_0010739_2356_3303 | 309 |
| 835 | 3300046476 | Ga0495662_0012744 | Ga0495662_0012744_650_1597 | 309 |
| 836 | 3300046477 | Ga0495664_0206648 | Ga0495664_0206648_27_974 | 309 |
| 837 | 3300046499 | Ga0495594_0133825 | Ga0495594_0133825_85_1032 | 309 |
| 838 | 3300046516 | Ga0495628_0240187 | Ga0495628_0240187_154_1101 | 309 |
| 839 | 3300046517 | Ga0495630_0166857 | Ga0495630_0166857_442_1389 | 309 |
| 840 | 3300046526 | Ga0495666_0072732 | Ga0495666_0072732_132_1079 | 309 |
| 841 | 3300046533 | Ga0495640_0016426 | Ga0495640_0016426_4295_5242 | 309 |
| 842 | 3300046539 | Ga0495621_0038213 | Ga0495621_0038213_387_1334 | 309 |
| 843 | 3300046543 | Ga0495645_0009637 | Ga0495645_0009637_538_1485 | 309 |
| 844 | 3300046543 | Ga0495645_0088405 | Ga0495645_0088405_384_1331 | 309 |
| 845 | 3300046559 | Ga0495667_0048450 | Ga0495667_0048450_1728_2675 | 309 |
| 846 | 3300046663 | Ga0495635_0035566 | Ga0495635_0035566_800_1747 | 309 |
| 847 | 3300046674 | Ga0495588_0153647 | Ga0495588_0153647_217_1164 | 309 |
| 848 | 3300046678 | Ga0495599_0110823 | Ga0495599_0110823_210_1157 | 309 |
| 849 | 3300046679 | Ga0495623_0053021 | Ga0495623_0053021_1356_2303 | 309 |
| 850 | 3300046681 | Ga0495647_0008144 | Ga0495647_0008144_1559_2506 | 309 |
| 851 | 3300046809 | Ga0495600_0012682 | Ga0495600_0012682_1252_2199 | 309 |
| 852 | 3300047315 | Ga0495581_0001341 | Ga0495581_0001341_11252_12199 | 309 |
| 853 | 3300047319 | Ga0495674_0105678 | Ga0495674_0105678_904_1851 | 309 |
| 854 | 3300047322 | Ga0495680_0084404 | Ga0495680_0084404_1086_2033 | 309 |
| 855 | 3300047471 | Ga0495684_0068442 | Ga0495684_0068442_350_1297 | 309 |
| 856 | 3300047673 | Ga0495593_0026218 | Ga0495593_0026218_1805_2752 | 309 |
| 857 | 3300048089 | Ga0495614_0018592 | Ga0495614_0018592_431_1378 | 309 |
| 858 | 3300048903 | Ga0496100_0063644 | Ga0496100_0063644_833_1780 | 309 |
| 859 | 3300048904 | Ga0496101_0150811 | Ga0496101_0150811_249_1196 | 309 |
| 860 | 3300048905 | Ga0496102_0004733 | Ga0496102_0004733_2414_3352 | 309 |
| 861 | 3300048905 | Ga0496102_0049371 | Ga0496102_0049371_1759_2814 | 309 |
| 862 | 3300048905 | Ga0496102_0061780 | Ga0496102_0061780_60_992 | 309 |
| 863 | 3300048906 | Ga0496103_0063096 | Ga0496103_0063096_883_1821 | 309 |
| 864 | 3300048906 | Ga0496103_0105565 | Ga0496103_0105565_214_1146 | 309 |
| 865 | 3300048907 | Ga0496104_0008261 | Ga0496104_0008261_7043_7990 | 309 |
| 866 | 3300048907 | Ga0496104_0165794 | Ga0496104_0165794_708_1637 | 309 |
| 867 | 3300048908 | Ga0496105_0043192 | Ga0496105_0043192_1426_2373 | 309 |
| 868 | 3300048909 | Ga0496106_0000409 | Ga0496106_0000409_16560_17498 | 309 |
| 869 | 3300048909 | Ga0496106_0250476 | Ga0496106_0250476_36_968 | 309 |
| 870 | 3300048909 | Ga0496106_0261029 | Ga0496106_0261029_404_1351 | 309 |
| 871 | 3300048910 | Ga0496107_0001779 | Ga0496107_0001779_492_1430 | 309 |
| 872 | 3300048910 | Ga0496107_0154722 | Ga0496107_0154722_227_1174 | 309 |
| 873 | 3300048911 | Ga0496108_0117995 | Ga0496108_0117995_49_996 | 309 |
| 874 | 3300048912 | Ga0496109_0058897 | Ga0496109_0058897_1814_2746 | 309 |
| 875 | 3300048912 | Ga0496109_0107524 | Ga0496109_0107524_1300_2247 | 309 |
| 876 | 3300048912 | Ga0496109_0133532 | Ga0496109_0133532_1354_2286 | 309 |
| 877 | 3300048913 | Ga0496110_0106413 | Ga0496110_0106413_841_1773 | 309 |
| 878 | 3300048915 | Ga0496112_0002525 | Ga0496112_0002525_3459_4400 | 309 |
| 879 | 3300048915 | Ga0496112_0017345 | Ga0496112_0017345_4034_4981 | 309 |
| 880 | 3300048917 | Ga0496114_0066614 | Ga0496114_0066614_1001_1948 | 309 |
| 881 | 3300053078 | Ga0495612_0071855 | Ga0495612_0071855_279_1226 | 309 |
| 882 | 3300053084 | Ga0495595_0021137 | Ga0495595_0021137_1751_2698 | 309 |
| 883 | 3300053084 | Ga0495595_0090214 | Ga0495595_0090214_331_1263 | 309 |
| 884 | 3300053085 | Ga0495619_0040676 | Ga0495619_0040676_1610_2557 | 309 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8k9g-assembly1.cif.gz_A | cryo-em structure of crt-sparta-grna-tdna dimer (conformation-1) | 0.9618 | 120 | 149 |
| 8t0j-assembly1.cif.gz_A | salmonella typhimurium arnd | 0.9219 | 1 | 299 |
| 8t0j-assembly1.cif.gz_A | salmonella typhimurium arnd | 0.9187 | 1 | 299 |
| 4m1b-assembly2.cif.gz_B | structural determination of ba0150, a polysaccharide deacetylase from bacillus anthracis | 0.8405 | 2 | 270 |
| 7y51-assembly1.cif.gz_A-2 | acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant | 0.828 | 2 | 267 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76472_1_267_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.864 | 1 | 266 | 3.30.70.260 |
| af_P76472_1_267_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.8553 | 1 | 266 | 3.30.70.260 |
| 4m1bB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8405 | 2 | 270 | 3.20.20.370 |
| 4l1gD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8176 | 2 | 268 | 3.20.20.370 |
| 5lgcA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8147 | 2 | 271 | 3.20.20.370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y8JB32-F1-model_v4 | 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase | 0.9687 | 2 | 304 |
GO:0005975
GO:0016810 |
| AF-A0A084XY50-F1-model_v4 | Putative 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD (EC 3.5.1.-) | 0.9669 | 93 | 300 |
GO:0005975
GO:0016810 |
| AF-A0A7V5XDF1-F1-model_v4 | NodB homology domain-containing protein | 0.9647 | 93 | 299 |
GO:0005975
GO:0016810 |
| AF-G2FBZ7-F1-model_v4 | Polymyxin resistance protein PmrJ | 0.9613 | 85 | 299 |
GO:0005975
|
| AF-A0A365VMQ7-F1-model_v4 | deleted | 0.9593 | 113 | 251 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar