F484361

General Info

Members Datasets Scaffolds Average Seq Length
876 284 876 159

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0187687|Ga0451576_0187687_757_1335
Length 192
Sequence MAPAPGARARRVRRSADAIFESESLRRSDVSGREVDMATESKWRHHGVRVVRSDQLDTRTPQTPGMDRAAAITYARMGAESLWAGTVVIHPKAKTGAHHHGPVESVIYVVSGRARMKWGERLEFTAEAGPGDFIYVPPYVPHQEINASDSEPLSCVLCRSGKDPVVVNLDLPNVEPNPENVPWVDSIHPPPN

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
199 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
200 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
215 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
229 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
230 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
231 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
232 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
233 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 4.57
Rhizosphere 93.95
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1039947 3300001976 Bacteria 627
2 JGI24747J21853_1020088 3300001978 Bacteria 723
3 JGI24743J22301_10012420 3300001991 Bacteria 1549
4 JGI24750J21931_1041320 3300002070 Bacteria 701
5 JGI24749J21850_1005279 3300002076 Bacteria 1813
6 JGI24744J21845_10055969 3300002077 Bacteria 724
7 Ga0058863_11718871 3300004799 Bacteria 1544
8 Ga0058862_12751779 3300004803 Bacteria 747
9 Ga0065715_10162694 3300005293 Bacteria 1614
10 Ga0065715_10171170 3300005293 Bacteria 1546
11 Ga0065715_10365467 3300005293 Bacteria 929
12 Ga0070658_10017688 3300005327 Bacteria 5702
13 Ga0070658_10018601 3300005327 Bacteria 5564
14 Ga0070658_10036568 3300005327 Bacteria 3957
15 Ga0070658_10110787 3300005327 Bacteria 2274
16 Ga0070658_10796618 3300005327 Bacteria 821
17 Ga0070676_10000769 3300005328 Bacteria 15777
18 Ga0070676_10005593 3300005328 Bacteria 6694
19 Ga0070676_10032653 3300005328 Bacteria 2983
20 Ga0070676_10283966 3300005328 Bacteria 1116
21 Ga0070676_10744773 3300005328 Bacteria 719
22 Ga0070683_100019402 3300005329 Bacteria 6038
23 Ga0070683_100058588 3300005329 Bacteria 3577
24 Ga0070683_100129952 3300005329 Bacteria 2383
25 Ga0070690_100009005 3300005330 Bacteria 5771
26 Ga0070670_100000274 3300005331 Bacteria 45804
27 Ga0070670_100021437 3300005331 Bacteria 5559
28 Ga0070670_100052188 3300005331 Bacteria 3512
29 Ga0070670_100097188 3300005331 Bacteria 2533
30 Ga0070670_100138970 3300005331 Bacteria 2100
31 Ga0070670_101327314 3300005331 Bacteria 659
32 Ga0070670_101686592 3300005331 Bacteria 583
33 Ga0070677_10000132 3300005333 Bacteria 24789
34 Ga0070677_10009216 3300005333 Bacteria 3344
35 Ga0070677_10135884 3300005333 Bacteria 1128
36 Ga0070677_10192830 3300005333 Bacteria 978
37 Ga0070677_10429711 3300005333 Bacteria 702
38 Ga0068869_100001694 3300005334 Bacteria 13168
39 Ga0068869_100007694 3300005334 Bacteria 6902
40 Ga0068869_100208930 3300005334 Bacteria 1542
41 Ga0070666_10006650 3300005335 Bacteria 7108
42 Ga0070666_10007688 3300005335 Bacteria 6654
43 Ga0070666_10094719 3300005335 Bacteria 2054
44 Ga0070666_10290317 3300005335 Bacteria 1163
45 Ga0070666_10410922 3300005335 Bacteria 974
46 Ga0070680_100109620 3300005336 Bacteria 2297
47 Ga0070680_100238453 3300005336 Bacteria 1537
48 Ga0070680_100376219 3300005336 Bacteria 1209
49 Ga0070680_100616184 3300005336 Bacteria 932
50 Ga0070682_100899525 3300005337 Bacteria 727
51 Ga0068868_100005576 3300005338 Bacteria 8850
52 Ga0068868_100028710 3300005338 Bacteria 4256
53 Ga0068868_100045229 3300005338 Bacteria 3444
54 Ga0068868_101232518 3300005338 Bacteria 693
55 Ga0068868_101393863 3300005338 Bacteria 653
56 Ga0070660_100004956 3300005339 Bacteria 9207
57 Ga0070660_100018533 3300005339 Bacteria 5088
58 Ga0070660_100602224 3300005339 Bacteria 919
59 Ga0070689_100008003 3300005340 Bacteria 7418
60 Ga0070689_100033049 3300005340 Bacteria 3939
61 Ga0070661_100004644 3300005344 Bacteria 9458
62 Ga0070661_100010175 3300005344 Bacteria 6534
63 Ga0070661_100027132 3300005344 Bacteria 4122
64 Ga0070661_100055801 3300005344 Bacteria 2892
65 Ga0070661_100135124 3300005344 Bacteria 1855
66 Ga0070661_100161595 3300005344 Bacteria 1697
67 Ga0070661_100173153 3300005344 Bacteria 1640
68 Ga0070661_100248233 3300005344 Bacteria 1373
69 Ga0070692_10037400 3300005345 Bacteria 2468
70 Ga0070668_100000394 3300005347 Bacteria 29015
71 Ga0070668_100007010 3300005347 Bacteria 8351
72 Ga0070668_100011160 3300005347 Bacteria 6688
73 Ga0070668_100016216 3300005347 Bacteria 5573
74 Ga0070668_100065340 3300005347 Bacteria 2822
75 Ga0070668_100359662 3300005347 Bacteria 1234
76 Ga0070668_100559299 3300005347 Bacteria 996
77 Ga0070668_101249069 3300005347 Bacteria 674
78 Ga0070669_100005562 3300005353 Bacteria 9102
79 Ga0070669_100006708 3300005353 Bacteria 8287
80 Ga0070669_100050895 3300005353 Bacteria 3026
81 Ga0070669_100052789 3300005353 Bacteria 2975
82 Ga0070669_100097767 3300005353 Bacteria 2210
83 Ga0070669_100098531 3300005353 Bacteria 2202
84 Ga0070669_100110841 3300005353 Bacteria 2082
85 Ga0070669_100203979 3300005353 Bacteria 1557
86 Ga0070669_100667379 3300005353 Bacteria 876
87 Ga0070669_100844652 3300005353 Bacteria 780
88 Ga0070675_100008918 3300005354 Bacteria 7792
89 Ga0070675_100008929 3300005354 Bacteria 7786
90 Ga0070675_100032421 3300005354 Bacteria 4228
91 Ga0070675_100094815 3300005354 Bacteria 2505
92 Ga0070675_100317873 3300005354 Bacteria 1375
93 Ga0070675_100332358 3300005354 Bacteria 1344
94 Ga0070675_100392373 3300005354 Bacteria 1237
95 Ga0070671_100013129 3300005355 Bacteria 6674
96 Ga0070671_100079129 3300005355 Bacteria 2747
97 Ga0070671_100206170 3300005355 Bacteria 1667
98 Ga0070671_100383170 3300005355 Bacteria 1202
99 Ga0070671_100472906 3300005355 Bacteria 1076
100 Ga0070674_100001114 3300005356 Bacteria 14095
101 Ga0070674_100036339 3300005356 Bacteria 3306
102 Ga0070674_100069827 3300005356 Bacteria 2479
103 Ga0070674_100120733 3300005356 Unclassified 1940
104 Ga0070674_100398011 3300005356 Bacteria 1124
105 Ga0070673_100002042 3300005364 Bacteria 12186
106 Ga0070673_100020047 3300005364 Bacteria 4815
107 Ga0070673_100074203 3300005364 Bacteria 2741
108 Ga0070673_100091659 3300005364 Bacteria 2485
109 Ga0070673_100133514 3300005364 Bacteria 2086
110 Ga0070673_100163834 3300005364 Bacteria 1893
111 Ga0070673_100226902 3300005364 Bacteria 1619
112 Ga0070688_100003905 3300005365 Bacteria 7733
113 Ga0070659_100006210 3300005366 Bacteria 8630
114 Ga0070659_100064486 3300005366 Bacteria 2899
115 Ga0070659_100067006 3300005366 Bacteria 2846
116 Ga0070659_100071001 3300005366 Bacteria 2768
117 Ga0070659_100589158 3300005366 Bacteria 955
118 Ga0070667_100002746 3300005367 Bacteria 15229
119 Ga0070667_100010007 3300005367 Bacteria 7858
120 Ga0070667_100021181 3300005367 Bacteria 5401
121 Ga0070667_100127045 3300005367 Bacteria 2222
122 Ga0070667_100156797 3300005367 Bacteria 2003
123 Ga0070667_100213734 3300005367 Bacteria 1715
124 Ga0070667_100248565 3300005367 Bacteria 1590
125 Ga0070667_100422096 3300005367 Bacteria 1216
126 Ga0070667_101109627 3300005367 Bacteria 739
127 Ga0070667_101129898 3300005367 Bacteria 733
128 Ga0070714_100033301 3300005435 Bacteria 4307
129 Ga0070714_100062644 3300005435 Bacteria 3197
130 Ga0070714_100109749 3300005435 Bacteria 2441
131 Ga0070713_100012321 3300005436 Bacteria 6267
132 Ga0070710_10007894 3300005437 Bacteria 5169
133 Ga0070710_10218269 3300005437 Bacteria 1212
134 Ga0070701_10066184 3300005438 Bacteria 1920
135 Ga0070711_100105943 3300005439 Bacteria 2054
136 Ga0070711_100691827 3300005439 Bacteria 858
137 Ga0070711_100720342 3300005439 Bacteria 841
138 Ga0070711_100928130 3300005439 Bacteria 744
139 Ga0070700_100021916 3300005441 Bacteria 3719
140 Ga0070700_100204956 3300005441 Bacteria 1388
141 Ga0070700_100625458 3300005441 Bacteria 847
142 Ga0070694_100682336 3300005444 Bacteria 834
143 Ga0070663_100010255 3300005455 Bacteria 5836
144 Ga0070663_100019255 3300005455 Bacteria 4494
145 Ga0070663_100043787 3300005455 Bacteria 3152
146 Ga0070663_100076206 3300005455 Bacteria 2452
147 Ga0070663_100190761 3300005455 Bacteria 1595
148 Ga0070678_100000982 3300005456 Bacteria 14738
149 Ga0070678_100001348 3300005456 Bacteria 13061
150 Ga0070678_100085937 3300005456 Bacteria 2398
151 Ga0070678_100299571 3300005456 Bacteria 1366
152 Ga0070662_100001081 3300005457 Bacteria 16613
153 Ga0070662_100083792 3300005457 Bacteria 2380
154 Ga0070662_100223556 3300005457 Bacteria 1503
155 Ga0070662_100259751 3300005457 Bacteria 1399
156 Ga0070681_10001160 3300005458 Bacteria 22748
157 Ga0070681_10939589 3300005458 Bacteria 784
158 Ga0070681_11030478 3300005458 Bacteria 743
159 Ga0068867_100003590 3300005459 Bacteria 10912
160 Ga0068867_100009061 3300005459 Bacteria 7021
161 Ga0068867_100010823 3300005459 Bacteria 6434
162 Ga0068867_100019400 3300005459 Bacteria 4846
163 Ga0068867_100077601 3300005459 Bacteria 2496
164 Ga0068867_100384660 3300005459 Bacteria 1179
165 Ga0068867_100501068 3300005459 Bacteria 1044
166 Ga0070685_10002380 3300005466 Bacteria 9680
167 Ga0070706_100281817 3300005467 Bacteria 1551
168 Ga0070706_101135846 3300005467 Bacteria 719
169 Ga0070698_100772739 3300005471 Bacteria 904
170 Ga0070698_101251665 3300005471 Bacteria 692
171 Ga0070699_100093099 3300005518 Bacteria 2637
172 Ga0070679_100019147 3300005530 Bacteria 6651
173 Ga0070679_100178590 3300005530 Bacteria 2096
174 Ga0070679_100696648 3300005530 Bacteria 958
175 Ga0070684_100040000 3300005535 Bacteria 4034
176 Ga0070684_100043995 3300005535 Bacteria 3860
177 Ga0070684_100093491 3300005535 Bacteria 2677
178 Ga0070684_100499945 3300005535 Bacteria 1126
179 Ga0068853_100002757 3300005539 Bacteria 13266
180 Ga0068853_100056192 3300005539 Bacteria 3393
181 Ga0068853_100074913 3300005539 Bacteria 2953
182 Ga0068853_100366468 3300005539 Bacteria 1343
183 Ga0068853_100542898 3300005539 Bacteria 1101
184 Ga0068853_101410792 3300005539 Bacteria 674
185 Ga0068853_101952992 3300005539 Bacteria 569
186 Ga0070672_100000914 3300005543 Bacteria 17688
187 Ga0070672_100007295 3300005543 Bacteria 7493
188 Ga0070672_100012306 3300005543 Bacteria 6000
189 Ga0070672_100022564 3300005543 Bacteria 4626
190 Ga0070672_100042554 3300005543 Bacteria 3498
191 Ga0070672_100075834 3300005543 Bacteria 2685
192 Ga0070672_100105320 3300005543 Bacteria 2293
193 Ga0070672_100228126 3300005543 Bacteria 1564
194 Ga0070672_101066203 3300005543 Bacteria 717
195 Ga0070686_100085731 3300005544 Bacteria 2095
196 Ga0070696_100004065 3300005546 Bacteria 9755
197 Ga0070693_100691402 3300005547 Bacteria 746
198 Ga0070665_100002542 3300005548 Bacteria 20041
199 Ga0070665_100012901 3300005548 Bacteria 8416
200 Ga0070665_100121697 3300005548 Bacteria 2611
201 Ga0070665_100305035 3300005548 Bacteria 1595
202 Ga0070665_100578305 3300005548 Bacteria 1136
203 Ga0070665_100637102 3300005548 Bacteria 1079
204 Ga0070665_101173044 3300005548 Bacteria 779
205 Ga0068855_100003908 3300005563 Bacteria 18194
206 Ga0068855_100019019 3300005563 Bacteria 8257
207 Ga0068855_100040144 3300005563 Bacteria 5556
208 Ga0068855_100057251 3300005563 Bacteria 4570
209 Ga0068855_100453030 3300005563 Bacteria 1400
210 Ga0070664_100002998 3300005564 Bacteria 13657
211 Ga0070664_100013440 3300005564 Bacteria 6666
212 Ga0070664_100083468 3300005564 Bacteria 2756
213 Ga0070664_100084498 3300005564 Bacteria 2740
214 Ga0070664_100094788 3300005564 Bacteria 2588
215 Ga0070664_100345226 3300005564 Bacteria 1353
216 Ga0070664_101033582 3300005564 Bacteria 773
217 Ga0070664_101553058 3300005564 Bacteria 627
218 Ga0068857_100008373 3300005577 Bacteria 8937
219 Ga0068857_100010671 3300005577 Bacteria 7991
220 Ga0068857_100065029 3300005577 Bacteria 3243
221 Ga0068857_100399942 3300005577 Bacteria 1278
222 Ga0068854_100002321 3300005578 Bacteria 11730
223 Ga0068854_100055101 3300005578 Bacteria 2861
224 Ga0068854_100115025 3300005578 Bacteria 2035
225 Ga0068854_100163739 3300005578 Bacteria 1725
226 Ga0068854_100196971 3300005578 Bacteria 1581
227 Ga0068854_100322409 3300005578 Bacteria 1256
228 Ga0068856_100001379 3300005614 Bacteria 25540
229 Ga0068856_100022222 3300005614 Bacteria 6167
230 Ga0068856_100365263 3300005614 Bacteria 1462
231 Ga0068856_101572557 3300005614 Bacteria 671
232 Ga0070702_100133372 3300005615 Bacteria 1572
233 Ga0068852_100002000 3300005616 Bacteria 13901
234 Ga0068852_100002691 3300005616 Bacteria 12273
235 Ga0068852_100024896 3300005616 Bacteria 4843
236 Ga0068852_100067303 3300005616 Bacteria 3131
237 Ga0068852_100088668 3300005616 Bacteria 2763
238 Ga0068852_100138091 3300005616 Bacteria 2253
239 Ga0068852_100213207 3300005616 Bacteria 1833
240 Ga0068852_100328423 3300005616 Bacteria 1487
241 Ga0068859_100006523 3300005617 Bacteria 11850
242 Ga0068859_100084366 3300005617 Bacteria 3222
243 Ga0068859_100243236 3300005617 Bacteria 1889
244 Ga0068859_100824334 3300005617 Bacteria 1014
245 Ga0068864_100005598 3300005618 Bacteria 10299
246 Ga0068864_100007903 3300005618 Bacteria 8763
247 Ga0068864_100009458 3300005618 Bacteria 8043
248 Ga0068864_100009678 3300005618 Bacteria 7951
249 Ga0068864_100018419 3300005618 Bacteria 5834
250 Ga0068864_100310185 3300005618 Bacteria 1479
251 Ga0068864_100807004 3300005618 Bacteria 922
252 Ga0068866_10057543 3300005718 Bacteria 2004
253 Ga0068866_10063584 3300005718 Bacteria 1924
254 Ga0068866_10195641 3300005718 Bacteria 1204
255 Ga0068861_100001362 3300005719 Bacteria 15368
256 Ga0068861_100001763 3300005719 Bacteria 13905
257 Ga0068861_100012929 3300005719 Bacteria 5828
258 Ga0068861_100052360 3300005719 Bacteria 3102
259 Ga0068861_100235924 3300005719 Bacteria 1553
260 Ga0068861_100261518 3300005719 Bacteria 1482
261 Ga0068861_100751837 3300005719 Bacteria 911
262 Ga0068851_10007676 3300005834 Bacteria 4962
263 Ga0068851_10010234 3300005834 Bacteria 4374
264 Ga0068851_10026215 3300005834 Bacteria 2863
265 Ga0068851_10028777 3300005834 Bacteria 2746
266 Ga0068851_10078842 3300005834 Bacteria 1716
267 Ga0068851_10387280 3300005834 Bacteria 820
268 Ga0068851_10489637 3300005834 Bacteria 736
269 Ga0068870_10017237 3300005840 Bacteria 3467
270 Ga0068870_10027358 3300005840 Bacteria 2851
271 Ga0068863_100002100 3300005841 Bacteria 19742
272 Ga0068863_100013029 3300005841 Bacteria 8018
273 Ga0068863_100026961 3300005841 Bacteria 5479
274 Ga0068863_100087053 3300005841 Bacteria 2960
275 Ga0068863_100195704 3300005841 Bacteria 1943
276 Ga0068863_100264682 3300005841 Bacteria 1663
277 Ga0068858_100000612 3300005842 Bacteria 37346
278 Ga0068858_100055030 3300005842 Bacteria 3678
279 Ga0068858_100097393 3300005842 Bacteria 2742
280 Ga0068858_100150477 3300005842 Bacteria 2188
281 Ga0068858_100507461 3300005842 Bacteria 1165
282 Ga0068860_100011838 3300005843 Bacteria 8598
283 Ga0068860_100023346 3300005843 Bacteria 5978
284 Ga0068860_100044277 3300005843 Bacteria 4242
285 Ga0068860_100065973 3300005843 Bacteria 3437
286 Ga0068860_100200958 3300005843 Bacteria 1931
287 Ga0068860_101109312 3300005843 Bacteria 811
288 Ga0068860_101391817 3300005843 Bacteria 723
289 Ga0068862_100002076 3300005844 Bacteria 18077
290 Ga0068862_100013014 3300005844 Bacteria 6880
291 Ga0068862_100043495 3300005844 Bacteria 3830
292 Ga0068862_100088427 3300005844 Bacteria 2695
293 Ga0068862_100092127 3300005844 Bacteria 2641
294 Ga0068862_102264194 3300005844 Bacteria 555
295 Ga0081455_10317106 3300005937 Bacteria 1112
296 Ga0075363_100230016 3300006048 Bacteria 1064
297 Ga0075364_10000494 3300006051 Bacteria 20067
298 Ga0075362_10242392 3300006177 Bacteria 885
299 Ga0075367_10046720 3300006178 Bacteria 2545
300 Ga0075369_10000250 3300006186 Bacteria 15991
301 Ga0097621_100079081 3300006237 Bacteria 2733
302 Ga0097621_100099569 3300006237 Bacteria 2443
303 Ga0097621_100225486 3300006237 Bacteria 1634
304 Ga0068871_100003825 3300006358 Bacteria 10375
305 Ga0068871_100118990 3300006358 Bacteria 2229
306 Ga0068871_100213997 3300006358 Bacteria 1668
307 Ga0068871_100473592 3300006358 Bacteria 1125
308 Ga0068871_101040792 3300006358 Bacteria 764
309 Ga0068871_101311839 3300006358 Bacteria 681
310 Ga0075428_100103504 3300006844 Bacteria 3104
311 Ga0075428_100160557 3300006844 Bacteria 2440
312 Ga0075428_100347659 3300006844 Bacteria 1592
313 Ga0075428_100586531 3300006844 Bacteria 1191
314 Ga0075430_100020888 3300006846 Bacteria 5567
315 Ga0075431_100159632 3300006847 Bacteria 2319
316 Ga0075434_100070066 3300006871 Bacteria 3497
317 Ga0075434_100184957 3300006871 Bacteria 2104
318 Ga0075434_100651911 3300006871 Bacteria 1071
319 Ga0068865_100023951 3300006881 Bacteria 4001
320 Ga0068865_100127465 3300006881 Bacteria 1902
321 Ga0068865_100128349 3300006881 Bacteria 1896
322 Ga0068865_100411915 3300006881 Bacteria 1109
323 Ga0075436_100529516 3300006914 Bacteria 864
324 Ga0075436_100706649 3300006914 Bacteria 747
325 Ga0097620_100006521 3300006931 Bacteria 11850
326 Ga0097620_100084360 3300006931 Bacteria 3222
327 Ga0097620_100243229 3300006931 Bacteria 1889
328 Ga0097620_100824340 3300006931 Bacteria 1014
329 Ga0075435_100379716 3300007076 Bacteria 1214
330 Ga0075435_100446474 3300007076 Bacteria 1115
331 Ga0075435_101082020 3300007076 Bacteria 701
332 Ga0105250_10027260 3300009092 Bacteria 2302
333 Ga0105240_10102436 3300009093 Bacteria 3479
334 Ga0105240_10166930 3300009093 Bacteria 2610
335 Ga0105240_10522447 3300009093 Bacteria 1317
336 Ga0111539_10053252 3300009094 Bacteria 4817
337 Ga0111539_10183588 3300009094 Bacteria 2443
338 Ga0111539_11341682 3300009094 Bacteria 830
339 Ga0111539_11399555 3300009094 Bacteria 811
340 Ga0105245_10200008 3300009098 Bacteria 1918
341 Ga0105245_10470611 3300009098 Bacteria 1268
342 Ga0105247_10010766 3300009101 Bacteria 5525
343 Ga0114129_10354316 3300009147 Bacteria 1943
344 Ga0114129_10480688 3300009147 Bacteria 1625
345 Ga0105243_10118295 3300009148 Bacteria 2229
346 Ga0105243_10321304 3300009148 Bacteria 1411
347 Ga0105243_10336876 3300009148 Bacteria 1380
348 Ga0105241_10121350 3300009174 Bacteria 2105
349 Ga0105241_10143629 3300009174 Bacteria 1946
350 Ga0105241_11041971 3300009174 Bacteria 767
351 Ga0105242_10428620 3300009176 Bacteria 1241
352 Ga0105248_10015240 3300009177 Bacteria 8473
353 Ga0105248_10025258 3300009177 Bacteria 6606
354 Ga0105248_10072760 3300009177 Bacteria 3863
355 Ga0105248_10147483 3300009177 Bacteria 2655
356 Ga0105248_10397237 3300009177 Bacteria 1552
357 Ga0105248_10657051 3300009177 Bacteria 1183
358 Ga0105248_10834945 3300009177 Bacteria 1040
359 Ga0105237_10173559 3300009545 Bacteria 2156
360 Ga0105237_10183286 3300009545 Bacteria 2094
361 Ga0105238_10075696 3300009551 Bacteria 3357
362 Ga0105238_10412946 3300009551 Bacteria 1344
363 Ga0105238_10626678 3300009551 Bacteria 1085
364 Ga0105238_10628665 3300009551 Bacteria 1083
365 Ga0105249_10020425 3300009553 Bacteria 5922
366 Ga0105249_10074146 3300009553 Bacteria 3149
367 Ga0105249_10128452 3300009553 Bacteria 2417
368 Ga0105249_10464426 3300009553 Bacteria 1306
369 Ga0105249_10855570 3300009553 Bacteria 975
370 Ga0105239_10082015 3300010375 Bacteria 3550
371 Ga0105239_10981235 3300010375 Bacteria 971
372 Ga0105246_10329619 3300011119 Bacteria 1244
373 Ga0157373_10001932 3300013100 Bacteria 15747
374 Ga0157373_10337764 3300013100 Bacteria 1073
375 Ga0157371_10000303 3300013102 Bacteria 64643
376 Ga0157371_10043784 3300013102 Bacteria 3188
377 Ga0157371_10096730 3300013102 Bacteria 2092
378 Ga0157370_10011858 3300013104 Bacteria 9092
379 Ga0157370_10108577 3300013104 Bacteria 2594
380 Ga0157370_10183907 3300013104 Bacteria 1941
381 Ga0157369_10135579 3300013105 Bacteria 2607
382 Ga0157369_10217825 3300013105 Bacteria 1999
383 Ga0157369_10891388 3300013105 Bacteria 912
384 Ga0157369_12357950 3300013105 Bacteria 539
385 Ga0157374_10063682 3300013296 Bacteria 3459
386 Ga0157374_10103382 3300013296 Bacteria 2733
387 Ga0157374_10142988 3300013296 Bacteria 2323
388 Ga0157374_10361450 3300013296 Bacteria 1444
389 Ga0157374_10554585 3300013296 Bacteria 1157
390 Ga0157374_11116787 3300013296 Bacteria 809
391 Ga0157378_10004675 3300013297 Bacteria 12013
392 Ga0157378_10090675 3300013297 Bacteria 2778
393 Ga0157378_10436705 3300013297 Bacteria 1297
394 Ga0157378_10718677 3300013297 Bacteria 1020
395 Ga0157378_10754127 3300013297 Bacteria 996
396 Ga0163162_10078494 3300013306 Bacteria 3367
397 Ga0163162_10089116 3300013306 Bacteria 3165
398 Ga0163162_10431489 3300013306 Bacteria 1450
399 Ga0163162_10736234 3300013306 Bacteria 1106
400 Ga0163162_12199454 3300013306 Bacteria 633
401 Ga0157372_10001717 3300013307 Bacteria 23775
402 Ga0157372_10002828 3300013307 Bacteria 18755
403 Ga0157372_10007943 3300013307 Bacteria 11276
404 Ga0157372_10011850 3300013307 Bacteria 9287
405 Ga0157372_10049411 3300013307 Bacteria 4677
406 Ga0157372_10148713 3300013307 Bacteria 2702
407 Ga0157372_10310060 3300013307 Bacteria 1837
408 Ga0157375_10002602 3300013308 Bacteria 15664
409 Ga0157375_10049121 3300013308 Bacteria 4132
410 Ga0157375_10300981 3300013308 Bacteria 1767
411 Ga0157375_10484297 3300013308 Bacteria 1402
412 Ga0157375_10860866 3300013308 Bacteria 1052
413 Ga0157375_10862526 3300013308 Bacteria 1051
414 Ga0157375_10937588 3300013308 Bacteria 1008
415 Ga0157375_11246719 3300013308 Bacteria 873
416 Ga0163163_10001190 3300014325 Bacteria 22057
417 Ga0163163_10010520 3300014325 Bacteria 8325
418 Ga0163163_10025908 3300014325 Bacteria 5596
419 Ga0163163_10029634 3300014325 Bacteria 5267
420 Ga0163163_10575587 3300014325 Bacteria 1189
421 Ga0163163_12136756 3300014325 Bacteria 619
422 Ga0157380_10005687 3300014326 Bacteria 8720
423 Ga0157380_10006810 3300014326 Bacteria 8075
424 Ga0157380_10290053 3300014326 Bacteria 1502
425 Ga0157380_10439444 3300014326 Bacteria 1250
426 Ga0182008_10177367 3300014497 Bacteria 1077
427 Ga0157377_10000871 3300014745 Bacteria 12560
428 Ga0157377_10712551 3300014745 Bacteria 730
429 Ga0157379_10000105 3300014968 Bacteria 57976
430 Ga0157379_10005162 3300014968 Bacteria 11213
431 Ga0157379_10008015 3300014968 Bacteria 9165
432 Ga0157379_10058207 3300014968 Bacteria 3455
433 Ga0157379_10378272 3300014968 Bacteria 1299
434 Ga0157376_10003620 3300014969 Bacteria 10665
435 Ga0157376_10087209 3300014969 Bacteria 2693
436 Ga0157376_10237184 3300014969 Bacteria 1697
437 Ga0157376_10427683 3300014969 Bacteria 1286
438 Ga0157376_10500411 3300014969 Bacteria 1194
439 Ga0163161_10019913 3300017792 Bacteria 4706
440 Ga0163161_10023041 3300017792 Bacteria 4388
441 Ga0163161_10545575 3300017792 Bacteria 950
442 Ga0163161_10632561 3300017792 Bacteria 885
443 Ga0163161_10728437 3300017792 Bacteria 828
444 Ga0154015_1059651 3300020610 Bacteria 2744
445 Ga0213876_10139857 3300021384 Bacteria 1287
446 Ga0224712_10005960 3300022467 Bacteria 3439
447 Ga0207697_10000471 3300025315 Bacteria 22740
448 Ga0207697_10058323 3300025315 Bacteria 1603
449 Ga0207656_10006239 3300025321 Bacteria 4271
450 Ga0207656_10012737 3300025321 Bacteria 3202
451 Ga0207656_10230369 3300025321 Bacteria 903
452 Ga0207682_10000044 3300025893 Bacteria 51808
453 Ga0207682_10001806 3300025893 Bacteria 9787
454 Ga0207682_10073389 3300025893 Bacteria 1453
455 Ga0207692_10004583 3300025898 Bacteria 5481
456 Ga0207692_10710185 3300025898 Bacteria 653
457 Ga0207642_10057585 3300025899 Bacteria 1789
458 Ga0207642_10066733 3300025899 Bacteria 1696
459 Ga0207642_10188137 3300025899 Bacteria 1131
460 Ga0207710_10033039 3300025900 Bacteria 2268
461 Ga0207688_10091693 3300025901 Bacteria 1745
462 Ga0207688_10100088 3300025901 Bacteria 1673
463 Ga0207680_10002742 3300025903 Bacteria 8238
464 Ga0207680_10019059 3300025903 Bacteria 3663
465 Ga0207680_10047447 3300025903 Bacteria 2545
466 Ga0207680_10103464 3300025903 Bacteria 1834
467 Ga0207699_10029083 3300025906 Bacteria 3078
468 Ga0207645_10001325 3300025907 Bacteria 20333
469 Ga0207645_10004314 3300025907 Bacteria 10544
470 Ga0207645_10013037 3300025907 Bacteria 5616
471 Ga0207645_10061294 3300025907 Bacteria 2402
472 Ga0207645_10155820 3300025907 Bacteria 1492
473 Ga0207645_10624679 3300025907 Bacteria 732
474 Ga0207643_10000161 3300025908 Bacteria 46356
475 Ga0207643_10016622 3300025908 Bacteria 4013
476 Ga0207705_10158344 3300025909 Bacteria 1700
477 Ga0207705_10159353 3300025909 Bacteria 1695
478 Ga0207705_10517182 3300025909 Bacteria 927
479 Ga0207705_10631640 3300025909 Bacteria 833
480 Ga0207684_10413045 3300025910 Bacteria 1160
481 Ga0207654_10438270 3300025911 Bacteria 914
482 Ga0207707_10282532 3300025912 Bacteria 1437
483 Ga0207707_10454226 3300025912 Bacteria 1096
484 Ga0207707_10791781 3300025912 Bacteria 790
485 Ga0207695_10041552 3300025913 Bacteria 4921
486 Ga0207695_10043837 3300025913 Bacteria 4763
487 Ga0207671_10507887 3300025914 Bacteria 961
488 Ga0207663_10151028 3300025916 Bacteria 1629
489 Ga0207663_11143859 3300025916 Bacteria 626
490 Ga0207660_10321431 3300025917 Bacteria 1236
491 Ga0207662_10070704 3300025918 Bacteria 2111
492 Ga0207657_10001114 3300025919 Bacteria 28498
493 Ga0207657_10019069 3300025919 Bacteria 6526
494 Ga0207657_10023158 3300025919 Bacteria 5790
495 Ga0207649_10003803 3300025920 Bacteria 8235
496 Ga0207649_10011530 3300025920 Bacteria 4875
497 Ga0207649_10056800 3300025920 Bacteria 2445
498 Ga0207649_10094126 3300025920 Bacteria 1968
499 Ga0207649_10203692 3300025920 Bacteria 1399
500 Ga0207649_10239984 3300025920 Bacteria 1300
501 Ga0207652_10009211 3300025921 Bacteria 7942
502 Ga0207652_10026593 3300025921 Bacteria 4821
503 Ga0207652_10066497 3300025921 Bacteria 3124
504 Ga0207652_10444666 3300025921 Bacteria 1169
505 Ga0207646_10786979 3300025922 Bacteria 848
506 Ga0207681_10006193 3300025923 Bacteria 7340
507 Ga0207681_10049513 3300025923 Bacteria 2840
508 Ga0207681_10094130 3300025923 Bacteria 2146
509 Ga0207681_10182954 3300025923 Unclassified 1598
510 Ga0207681_10190649 3300025923 Bacteria 1568
511 Ga0207681_10274609 3300025923 Bacteria 1324
512 Ga0207694_10061823 3300025924 Bacteria 2915
513 Ga0207694_10895945 3300025924 Bacteria 750
514 Ga0207650_10001658 3300025925 Bacteria 15859
515 Ga0207650_10006587 3300025925 Bacteria 7916
516 Ga0207650_10057166 3300025925 Bacteria 2900
517 Ga0207650_10060690 3300025925 Bacteria 2822
518 Ga0207650_10113441 3300025925 Bacteria 2101
519 Ga0207650_10238504 3300025925 Bacteria 1469
520 Ga0207650_10331078 3300025925 Bacteria 1249
521 Ga0207650_10640552 3300025925 Bacteria 895
522 Ga0207659_10001994 3300025926 Bacteria 12084
523 Ga0207659_10002849 3300025926 Bacteria 10309
524 Ga0207659_10003224 3300025926 Bacteria 9757
525 Ga0207659_10083486 3300025926 Bacteria 2368
526 Ga0207659_10165217 3300025926 Bacteria 1741
527 Ga0207659_10323128 3300025926 Bacteria 1273
528 Ga0207687_10306653 3300025927 Bacteria 1280
529 Ga0207700_10331872 3300025928 Bacteria 1320
530 Ga0207700_11272342 3300025928 Bacteria 656
531 Ga0207664_10024542 3300025929 Bacteria 4532
532 Ga0207664_10036152 3300025929 Bacteria 3816
533 Ga0207664_10327191 3300025929 Bacteria 1353
534 Ga0207644_10004238 3300025931 Bacteria 9309
535 Ga0207644_10045418 3300025931 Bacteria 3125
536 Ga0207644_10121670 3300025931 Bacteria 1987
537 Ga0207644_10699571 3300025931 Bacteria 845
538 Ga0207644_10728657 3300025931 Bacteria 827
539 Ga0207644_10754011 3300025931 Bacteria 813
540 Ga0207690_10001868 3300025932 Bacteria 12937
541 Ga0207690_10061917 3300025932 Bacteria 2545
542 Ga0207690_10092030 3300025932 Bacteria 2145
543 Ga0207690_11574561 3300025932 Bacteria 549
544 Ga0207706_10000023 3300025933 Bacteria 153979
545 Ga0207706_10050271 3300025933 Bacteria 3684
546 Ga0207706_10112789 3300025933 Bacteria 2392
547 Ga0207706_11095769 3300025933 Bacteria 666
548 Ga0207709_10531951 3300025935 Bacteria 922
549 Ga0207670_10386246 3300025936 Bacteria 1116
550 Ga0207669_10005949 3300025937 Bacteria 5526
551 Ga0207669_10016174 3300025937 Bacteria 3784
552 Ga0207669_10025077 3300025937 Bacteria 3215
553 Ga0207669_10058700 3300025937 Bacteria 2349
554 Ga0207669_10889296 3300025937 Bacteria 743
555 Ga0207704_10026968 3300025938 Bacteria 3160
556 Ga0207704_10041359 3300025938 Bacteria 2702
557 Ga0207704_10781205 3300025938 Bacteria 796
558 Ga0207691_10000022 3300025940 Bacteria 132936
559 Ga0207691_10000224 3300025940 Bacteria 55186
560 Ga0207691_10009118 3300025940 Bacteria 9523
561 Ga0207691_10032316 3300025940 Bacteria 4880
562 Ga0207691_10059374 3300025940 Bacteria 3478
563 Ga0207691_10067215 3300025940 Bacteria 3241
564 Ga0207691_10358264 3300025940 Bacteria 1247
565 Ga0207691_10451591 3300025940 Bacteria 1094
566 Ga0207691_11104910 3300025940 Bacteria 659
567 Ga0207711_10012405 3300025941 Bacteria 7085
568 Ga0207711_10028404 3300025941 Bacteria 4707
569 Ga0207711_10178994 3300025941 Bacteria 1927
570 Ga0207711_10205488 3300025941 Bacteria 1798
571 Ga0207711_10277556 3300025941 Bacteria 1543
572 Ga0207711_10946343 3300025941 Bacteria 800
573 Ga0207689_10000147 3300025942 Bacteria 60540
574 Ga0207689_10002088 3300025942 Bacteria 18853
575 Ga0207689_10011258 3300025942 Bacteria 7676
576 Ga0207661_10015607 3300025944 Bacteria 5594
577 Ga0207661_10151896 3300025944 Bacteria 2002
578 Ga0207661_10243076 3300025944 Bacteria 1598
579 Ga0207679_10008603 3300025945 Bacteria 6506
580 Ga0207679_10076457 3300025945 Bacteria 2544
581 Ga0207679_10079241 3300025945 Bacteria 2504
582 Ga0207679_10100532 3300025945 Bacteria 2260
583 Ga0207679_10836373 3300025945 Bacteria 840
584 Ga0207679_11085889 3300025945 Bacteria 734
585 Ga0207667_10007723 3300025949 Bacteria 12857
586 Ga0207667_10012582 3300025949 Bacteria 9733
587 Ga0207667_10012658 3300025949 Bacteria 9696
588 Ga0207667_10043293 3300025949 Bacteria 4779
589 Ga0207667_10060678 3300025949 Bacteria 3958
590 Ga0207667_10426822 3300025949 Bacteria 1348
591 Ga0207667_11072368 3300025949 Bacteria 790
592 Ga0207651_10005388 3300025960 Bacteria 6561
593 Ga0207651_10008537 3300025960 Bacteria 5539
594 Ga0207651_10012431 3300025960 Bacteria 4818
595 Ga0207651_10021607 3300025960 Bacteria 3915
596 Ga0207651_10031308 3300025960 Bacteria 3398
597 Ga0207651_10747120 3300025960 Bacteria 864
598 Ga0207712_10012882 3300025961 Bacteria 5352
599 Ga0207712_10018851 3300025961 Bacteria 4499
600 Ga0207712_10548820 3300025961 Bacteria 994
601 Ga0207668_10003779 3300025972 Bacteria 8919
602 Ga0207668_10016076 3300025972 Bacteria 4662
603 Ga0207668_10021387 3300025972 Bacteria 4126
604 Ga0207668_10028298 3300025972 Bacteria 3663
605 Ga0207668_10112766 3300025972 Bacteria 2043
606 Ga0207668_10448573 3300025972 Bacteria 1100
607 Ga0207668_10545576 3300025972 Bacteria 1003
608 Ga0207668_10786096 3300025972 Bacteria 842
609 Ga0207668_11790681 3300025972 Bacteria 554
610 Ga0207640_10009290 3300025981 Bacteria 5500
611 Ga0207640_10021612 3300025981 Bacteria 3838
612 Ga0207640_10062054 3300025981 Bacteria 2478
613 Ga0207640_10083873 3300025981 Bacteria 2186
614 Ga0207640_10091620 3300025981 Bacteria 2106
615 Ga0207640_10406551 3300025981 Bacteria 1110
616 Ga0207640_11333567 3300025981 Bacteria 641
617 Ga0207658_10006239 3300025986 Bacteria 8145
618 Ga0207658_10008453 3300025986 Bacteria 7006
619 Ga0207658_10011567 3300025986 Bacteria 6007
620 Ga0207658_10041400 3300025986 Bacteria 3335
621 Ga0207658_10047658 3300025986 Bacteria 3137
622 Ga0207658_10068524 3300025986 Bacteria 2677
623 Ga0207658_10086932 3300025986 Bacteria 2413
624 Ga0207658_10284877 3300025986 Bacteria 1418
625 Ga0207658_10363502 3300025986 Bacteria 1263
626 Ga0207677_10009797 3300026023 Bacteria 5398
627 Ga0207677_10012063 3300026023 Bacteria 4951
628 Ga0207677_10017587 3300026023 Bacteria 4268
629 Ga0207677_10246566 3300026023 Bacteria 1448
630 Ga0207703_10008603 3300026035 Bacteria 8057
631 Ga0207703_10070477 3300026035 Bacteria 2885
632 Ga0207703_10111517 3300026035 Bacteria 2335
633 Ga0207703_10188286 3300026035 Bacteria 1826
634 Ga0207703_10558159 3300026035 Unclassified 1080
635 Ga0207639_10006189 3300026041 Bacteria 8128
636 Ga0207639_10026571 3300026041 Bacteria 4207
637 Ga0207639_10061326 3300026041 Bacteria 2904
638 Ga0207639_10452391 3300026041 Bacteria 1166
639 Ga0207639_10570097 3300026041 Bacteria 1041
640 Ga0207639_10794483 3300026041 Bacteria 882
641 Ga0207639_11001765 3300026041 Bacteria 782
642 Ga0207678_10002769 3300026067 Bacteria 15871
643 Ga0207678_10017478 3300026067 Bacteria 6297
644 Ga0207678_10021448 3300026067 Bacteria 5663
645 Ga0207678_10035040 3300026067 Bacteria 4370
646 Ga0207678_10073764 3300026067 Bacteria 2924
647 Ga0207678_10255117 3300026067 Bacteria 1502
648 Ga0207708_10000330 3300026075 Bacteria 37297
649 Ga0207708_10022570 3300026075 Bacteria 4753
650 Ga0207708_10238624 3300026075 Bacteria 1462
651 Ga0207708_10276330 3300026075 Bacteria 1360
652 Ga0207702_10129038 3300026078 Bacteria 2273
653 Ga0207702_10129152 3300026078 Bacteria 2272
654 Ga0207702_10811243 3300026078 Bacteria 925
655 Ga0207641_10004344 3300026088 Bacteria 12299
656 Ga0207641_10006556 3300026088 Bacteria 9784
657 Ga0207641_10010037 3300026088 Bacteria 7788
658 Ga0207641_10137293 3300026088 Bacteria 2202
659 Ga0207641_10197281 3300026088 Bacteria 1853
660 Ga0207641_10208816 3300026088 Bacteria 1805
661 Ga0207641_10581078 3300026088 Bacteria 1095
662 Ga0207641_11545843 3300026088 Bacteria 665
663 Ga0207641_12293335 3300026088 Bacteria 539
664 Ga0207648_10003749 3300026089 Bacteria 15887
665 Ga0207648_10008541 3300026089 Bacteria 9910
666 Ga0207648_10017870 3300026089 Bacteria 6435
667 Ga0207648_10034621 3300026089 Bacteria 4452
668 Ga0207648_10062181 3300026089 Bacteria 3256
669 Ga0207648_10410106 3300026089 Bacteria 1229
670 Ga0207648_10521893 3300026089 Bacteria 1088
671 Ga0207676_10004846 3300026095 Bacteria 9538
672 Ga0207676_10009364 3300026095 Bacteria 6971
673 Ga0207676_10045405 3300026095 Bacteria 3394
674 Ga0207676_10062168 3300026095 Bacteria 2960
675 Ga0207676_10543500 3300026095 Bacteria 1109
676 Ga0207676_10565440 3300026095 Bacteria 1088
677 Ga0207676_11271944 3300026095 Bacteria 730
678 Ga0207676_11595296 3300026095 Bacteria 650
679 Ga0207676_11738167 3300026095 Unclassified 622
680 Ga0207674_10000775 3300026116 Bacteria 41699
681 Ga0207674_10002604 3300026116 Bacteria 22638
682 Ga0207674_10003926 3300026116 Bacteria 18101
683 Ga0207674_10007754 3300026116 Bacteria 12490
684 Ga0207674_10092555 3300026116 Bacteria 3012
685 Ga0207675_100000632 3300026118 Bacteria 34518
686 Ga0207675_100003092 3300026118 Bacteria 16306
687 Ga0207675_100008081 3300026118 Bacteria 9909
688 Ga0207675_100016851 3300026118 Bacteria 6826
689 Ga0207675_100051806 3300026118 Bacteria 3830
690 Ga0207675_100072589 3300026118 Bacteria 3219
691 Ga0207675_100287668 3300026118 Bacteria 1598
692 Ga0207675_100851294 3300026118 Bacteria 927
693 Ga0207675_102020633 3300026118 Unclassified 594
694 Ga0207683_10000283 3300026121 Bacteria 45381
695 Ga0207683_10001343 3300026121 Bacteria 22211
696 Ga0207683_10003645 3300026121 Bacteria 13401
697 Ga0207683_10034269 3300026121 Bacteria 4412
698 Ga0207683_10126863 3300026121 Bacteria 2293
699 Ga0207683_11275720 3300026121 Bacteria 680
700 Ga0207698_10006776 3300026142 Bacteria 7161
701 Ga0207698_10015332 3300026142 Bacteria 5128
702 Ga0207698_10065023 3300026142 Bacteria 2862
703 Ga0207698_10114264 3300026142 Bacteria 2270
704 Ga0207698_10280324 3300026142 Bacteria 1541
705 Ga0207698_10663535 3300026142 Bacteria 1034
706 Ga0207698_11201807 3300026142 Bacteria 772
707 Ga0209983_1084532 3300027665 Bacteria 712
708 Ga0209998_10029941 3300027717 Bacteria 1201
709 Ga0209974_10005746 3300027876 Bacteria 4350
710 Ga0207428_10541739 3300027907 Bacteria 842
711 Ga0207428_10878303 3300027907 Bacteria 634
712 Ga0268266_10003808 3300028379 Bacteria 14754
713 Ga0268266_10028908 3300028379 Bacteria 4710
714 Ga0268266_10099851 3300028379 Bacteria 2556
715 Ga0268266_10126500 3300028379 Bacteria 2281
716 Ga0268266_10245694 3300028379 Bacteria 1653
717 Ga0268266_10431102 3300028379 Bacteria 1251
718 Ga0268266_10486078 3300028379 Bacteria 1177
719 Ga0268266_11053747 3300028379 Bacteria 787
720 Ga0268266_11062613 3300028379 Bacteria 783
721 Ga0268266_11120210 3300028379 Bacteria 761
722 Ga0268265_10004417 3300028380 Bacteria 9769
723 Ga0268265_10043968 3300028380 Bacteria 3324
724 Ga0268265_10058560 3300028380 Bacteria 2942
725 Ga0268265_10066854 3300028380 Bacteria 2780
726 Ga0268265_10806234 3300028380 Bacteria 915
727 Ga0268264_10010306 3300028381 Bacteria 7733
728 Ga0268264_10020581 3300028381 Bacteria 5390
729 Ga0268264_10052267 3300028381 Bacteria 3407
730 Ga0268264_10147980 3300028381 Bacteria 2102
731 Ga0268264_10208457 3300028381 Bacteria 1792
732 Ga0268264_11634814 3300028381 Bacteria 655
733 Ga0265330_10004514 3300031235 Bacteria 7057
734 Ga0265332_10000141 3300031238 Bacteria 59136
735 Ga0265325_10016639 3300031241 Bacteria 4106
736 Ga0265339_10029144 3300031249 Bacteria 3134
737 Ga0265331_10000972 3300031250 Bacteria 22763
738 Ga0265327_10003882 3300031251 Bacteria 13769
739 Ga0265316_10086543 3300031344 Bacteria 2395
740 Ga0307408_100556982 3300031548 Bacteria 1012
741 Ga0265342_10005713 3300031712 Bacteria 9406
742 Ga0307405_10989691 3300031731 Bacteria 717
743 Ga0307413_10001971 3300031824 Bacteria 8145
744 Ga0307413_10976608 3300031824 Bacteria 724
745 Ga0307410_10010067 3300031852 Bacteria 5339
746 Ga0307406_10004583 3300031901 Bacteria 7523
747 Ga0307406_10061367 3300031901 Bacteria 2428
748 Ga0307407_10003221 3300031903 Bacteria 6631
749 Ga0307407_10622466 3300031903 Bacteria 806
750 Ga0307412_10013605 3300031911 Bacteria 4776
751 Ga0307412_10197398 3300031911 Bacteria 1526
752 Ga0307409_100010408 3300031995 Bacteria 5782
753 Ga0307409_100052609 3300031995 Bacteria 3124
754 Ga0307409_100064535 3300031995 Bacteria 2877
755 Ga0307416_100002070 3300032002 Bacteria 11304
756 Ga0307414_10013575 3300032004 Bacteria 4855
757 Ga0307411_10011160 3300032005 Bacteria 4833
758 Ga0307415_100054808 3300032126 Bacteria 2724
759 Ga0373950_0050516 3300034818 Bacteria 816
760 Ga0373939_0194589 3300035114 Bacteria 764
761 Ga0373960_0244622 3300035121 Bacteria 650
762 Ga0373943_0133270 3300035170 Bacteria 1332
763 Ga0373946_0066304 3300035171 Bacteria 1548
764 Ga0373935_1305636 3300035692 Bacteria 542
765 Ga0373927_0020040 3300035695 Bacteria 4386
766 Ga0373927_0149403 3300035695 Bacteria 1530
767 Ga0373927_0234179 3300035695 Bacteria 1207
768 Ga0373947_0609784 3300035725 Bacteria 744
769 Ga0373937_0177543 3300036401 Bacteria 1999
770 Ga0395900_0041433 3300037418 Bacteria 4747
771 Ga0395900_0134464 3300037418 Bacteria 2533
772 Ga0395900_0273378 3300037418 Bacteria 1684
773 Ga0395898_0032291 3300037466 Bacteria 5225
774 Ga0395898_0039327 3300037466 Bacteria 4682
775 Ga0395898_0736931 3300037466 Bacteria 927
776 Ga0395905_0011436 3300037471 Bacteria 8576
777 Ga0395905_0057778 3300037471 Bacteria 3629
778 Ga0395905_0145394 3300037471 Bacteria 2231
779 Ga0395901_0018072 3300038443 Bacteria 7196
780 Ga0395901_0080725 3300038443 Bacteria 3397
781 Ga0395901_0102297 3300038443 Bacteria 3007
782 Ga0395901_0706468 3300038443 Bacteria 1005
783 Ga0436361_0497952 3300039447 Bacteria 1088
784 Ga0451787_352292 3300041441 Bacteria 609
785 Ga0451791_1618681 3300041451 Bacteria 755
786 Ga0451853_2765974 3300041512 Bacteria 1001
787 Ga0450896_024507 3300042133 Bacteria 894
788 Ga0439435_0033489 3300042436 Bacteria 1407
789 Ga0453683_0240231 3300044673 Bacteria 1154
790 Ga0466963_0576970 3300044694 Bacteria 794
791 Ga0466960_0135938 3300044901 Bacteria 1302
792 Ga0451576_0187687 3300045051 Bacteria 2159
793 Ga0466967_1203478 3300045976 Bacteria 755
794 Ga0495629_0101132 3300046459 Bacteria 2012
795 Ga0495580_0026495 3300046472 Bacteria 4226
796 Ga0495598_0082323 3300046537 Bacteria 1035
797 Ga0495621_0012018 3300046539 Bacteria 2693
798 Ga0495621_0094697 3300046539 Bacteria 1130
799 Ga0495621_0164018 3300046539 Bacteria 880
800 Ga0495645_0219254 3300046543 Bacteria 1280
801 Ga0495599_0753419 3300046678 Bacteria 559
802 Ga0495647_0472048 3300046681 Bacteria 582
803 Ga0496100_0095140 3300048903 Bacteria 2041
804 Ga0496100_0989548 3300048903 Bacteria 662
805 Ga0496101_0223571 3300048904 Bacteria 1461
806 Ga0496101_0278742 3300048904 Bacteria 1306
807 Ga0496102_0025261 3300048905 Bacteria 5287
808 Ga0496102_0254880 3300048905 Bacteria 1654
809 Ga0496102_1452203 3300048905 Bacteria 605
810 Ga0496103_0033857 3300048906 Bacteria 3123
811 Ga0496103_0163935 3300048906 Bacteria 1426
812 Ga0496104_0042538 3300048907 Bacteria 4264
813 Ga0496104_0723726 3300048907 Bacteria 903
814 Ga0496104_0827611 3300048907 Bacteria 831
815 Ga0496105_0003965 3300048908 Bacteria 11077
816 Ga0496105_0627400 3300048908 Bacteria 831
817 Ga0496106_0003978 3300048909 Bacteria 11045
818 Ga0496106_1017183 3300048909 Bacteria 651
819 Ga0496107_0017734 3300048910 Bacteria 5010
820 Ga0496107_0067797 3300048910 Bacteria 2589
821 Ga0496108_0004799 3300048911 Bacteria 10905
822 Ga0496108_1094493 3300048911 Bacteria 677
823 Ga0496109_0005301 3300048912 Bacteria 10776
824 Ga0496109_0032060 3300048912 Bacteria 4721
825 Ga0496109_0068827 3300048912 Bacteria 3245
826 Ga0496110_0085364 3300048913 Bacteria 2818
827 Ga0496110_0125219 3300048913 Bacteria 2318
828 Ga0496110_0441705 3300048913 Bacteria 1186
829 Ga0496110_0644977 3300048913 Bacteria 959
830 Ga0496111_0053084 3300048914 Bacteria 2928
831 Ga0496111_0206944 3300048914 Bacteria 1458
832 Ga0496112_0003208 3300048915 Bacteria 13462
833 Ga0496112_0575784 3300048915 Bacteria 1059
834 Ga0496113_0009900 3300048916 Bacteria 6280
835 Ga0496113_0195815 3300048916 Bacteria 1605
836 Ga0496113_0278327 3300048916 Bacteria 1338
837 Ga0496113_0591320 3300048916 Bacteria 889
838 Ga0496114_0034466 3300048917 Bacteria 4177
839 Ga0496114_0163843 3300048917 Bacteria 1935
840 Ga0496114_0431513 3300048917 Bacteria 1167
841 Ga0496119_0078771 3300048922 Bacteria 1905
842 Ga0501034_0240414 3300049571 Bacteria 1757
843 Ga0501047_0357560 3300049581 Bacteria 1296
844 Ga0501067_0102919 3300049583 Bacteria 1586
845 Ga0501069_0157360 3300049585 Bacteria 1308
846 Ga0501073_0004503 3300049589 Bacteria 10470
847 Ga0501075_0666380 3300049591 Bacteria 793
848 Ga0501079_0386242 3300049741 Bacteria 1098
849 Ga0501080_0006277 3300049742 Bacteria 10668
850 Ga0501080_0063267 3300049742 Bacteria 3444
851 nmdc:mga03683_326798_c1 3300050489 Bacteria 723
852 nmdc:mga03n38_12267_c1 3300050490 Bacteria 3218
853 nmdc:mga00v17_264_c1 3300050491 Bacteria 30927
854 nmdc:mga06z11_71553_c1 3300050494 Bacteria 1836
855 nmdc:mga05p37_372262_c1 3300050507 Bacteria 1676
856 nmdc:mga05p37_7464_c1 3300050507 Bacteria 2419
857 nmdc:mga09592_14083_c1 3300050508 Bacteria 6529
858 nmdc:mga0qj67_479308_c1 3300050509 Bacteria 1001
859 nmdc:mga0qj67_7494_c1 3300050509 Bacteria 8058
860 nmdc:mga06r32_230215_c1 3300050510 Bacteria 1841
861 nmdc:mga08y16_144437_c1 3300050511 Bacteria 2473
862 nmdc:mga08y16_571109_c1 3300050511 Bacteria 1143
863 nmdc:mga0n895_1037716_c1 3300050512 Bacteria 799
864 nmdc:mga0n895_149246_c1 3300050512 Bacteria 2367
865 nmdc:mga0n895_1590944_c1 3300050512 Bacteria 618
866 nmdc:mga0n895_689121_c1 3300050512 Bacteria 1018
867 nmdc:mga0n895_825838_c1 3300050512 Bacteria 916
868 nmdc:mga0rr50_125018_c1 3300050513 Bacteria 2052
869 nmdc:mga0rr50_313508_c1 3300050513 Bacteria 1314
870 nmdc:mga0sz30_509_c1 3300050516 Bacteria 14494
871 Ga0495601_0368569 3300053077 Bacteria 933
872 Ga0495595_0022102 3300053084 Bacteria 2789
873 Ga0495595_0546880 3300053084 Bacteria 591
874 Ga0495619_0442441 3300053085 Bacteria 896
875 Ga0495619_0630544 3300053085 Bacteria 732
876 Ga0530510_0157164 3300061734 Bacteria 1681

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_11116787 Ga0157374_111167872 152
2 3300037466 Ga0395898_0736931 Ga0395898_0736931_245_709 152
3 3300038443 Ga0395901_0102297 Ga0395901_0102297_942_1406 152
4 3300005439 Ga0070711_100720342 Ga0070711_1007203422 153
5 3300006048 Ga0075363_100230016 Ga0075363_1002300162 153
6 3300006051 Ga0075364_10000494 Ga0075364_1000049415 153
7 3300006177 Ga0075362_10242392 Ga0075362_102423922 153
8 3300006178 Ga0075367_10046720 Ga0075367_100467203 153
9 3300006186 Ga0075369_10000250 Ga0075369_1000025015 153
10 3300007076 Ga0075435_100379716 Ga0075435_1003797162 153
11 3300009092 Ga0105250_10027260 Ga0105250_100272602 153
12 3300009148 Ga0105243_10321304 Ga0105243_103213042 153
13 3300009553 Ga0105249_10464426 Ga0105249_104644263 153
14 3300014326 Ga0157380_10290053 Ga0157380_102900531 153
15 3300021384 Ga0213876_10139857 Ga0213876_101398572 153
16 3300031731 Ga0307405_10989691 Ga0307405_109896912 153
17 3300031911 Ga0307412_10197398 Ga0307412_101973982 153
18 3300035121 Ga0373960_0244622 Ga0373960_0244622_64_528 153
19 3300039447 Ga0436361_0497952 Ga0436361_0497952_142_621 153
20 3300048904 Ga0496101_0278742 Ga0496101_0278742_333_812 153
21 3300048907 Ga0496104_0723726 Ga0496104_0723726_103_582 153
22 3300048907 Ga0496104_0827611 Ga0496104_0827611_290_769 153
23 3300048908 Ga0496105_0627400 Ga0496105_0627400_63_542 153
24 3300048913 Ga0496110_0125219 Ga0496110_0125219_1279_1758 153
25 3300048914 Ga0496111_0053084 Ga0496111_0053084_148_627 153
26 3300048916 Ga0496113_0009900 Ga0496113_0009900_5583_6062 153
27 3300048922 Ga0496119_0078771 Ga0496119_0078771_955_1434 153
28 3300049571 Ga0501034_0240414 Ga0501034_0240414_991_1461 153
29 3300050489 nmdc:mga03683_326798_c1 nmdc:mga03683_326798_c1_234_698 153
30 3300050490 nmdc:mga03n38_12267_c1 nmdc:mga03n38_12267_c1_135_599 153
31 3300050491 nmdc:mga00v17_264_c1 nmdc:mga00v17_264_c1_24359_24823 153
32 3300050494 nmdc:mga06z11_71553_c1 nmdc:mga06z11_71553_c1_1272_1736 153
33 3300050513 nmdc:mga0rr50_313508_c1 nmdc:mga0rr50_313508_c1_244_708 153
34 3300050516 nmdc:mga0sz30_509_c1 nmdc:mga0sz30_509_c1_2414_2878 153
35 3300053077 Ga0495601_0368569 Ga0495601_0368569_52_531 153
36 3300053084 Ga0495595_0022102 Ga0495595_0022102_2133_2612 153
37 3300005331 Ga0070670_101327314 Ga0070670_1013273141 154
38 3300005336 Ga0070680_100238453 Ga0070680_1002384532 154
39 3300005353 Ga0070669_100098531 Ga0070669_1000985312 154
40 3300005355 Ga0070671_100079129 Ga0070671_1000791292 154
41 3300005356 Ga0070674_100036339 Ga0070674_1000363392 154
42 3300005539 Ga0068853_101952992 Ga0068853_1019529921 154
43 3300005563 Ga0068855_100453030 Ga0068855_1004530302 154
44 3300005578 Ga0068854_100322409 Ga0068854_1003224091 154
45 3300005614 Ga0068856_100022222 Ga0068856_1000222225 154
46 3300005616 Ga0068852_100138091 Ga0068852_1001380912 154
47 3300005844 Ga0068862_100043495 Ga0068862_1000434954 154
48 3300009093 Ga0105240_10522447 Ga0105240_105224472 154
49 3300009094 Ga0111539_11341682 Ga0111539_113416822 154
50 3300013104 Ga0157370_10108577 Ga0157370_101085772 154
51 3300013307 Ga0157372_10011850 Ga0157372_100118505 154
52 3300025912 Ga0207707_10282532 Ga0207707_102825321 154
53 3300025923 Ga0207681_10094130 Ga0207681_100941302 154
54 3300025931 Ga0207644_10699571 Ga0207644_106995712 154
55 3300025937 Ga0207669_10016174 Ga0207669_100161744 154
56 3300025981 Ga0207640_10406551 Ga0207640_104065511 154
57 3300026088 Ga0207641_11545843 Ga0207641_115458431 154
58 3300026089 Ga0207648_10410106 Ga0207648_104101062 154
59 3300026142 Ga0207698_11201807 Ga0207698_112018072 154
60 3300028380 Ga0268265_10066854 Ga0268265_100668543 154
61 3300037418 Ga0395900_0134464 Ga0395900_0134464_1204_1674 154
62 3300037466 Ga0395898_0039327 Ga0395898_0039327_1149_1619 154
63 3300038443 Ga0395901_0080725 Ga0395901_0080725_777_1247 154
64 3300044694 Ga0466963_0576970 Ga0466963_0576970_285_749 154
65 3300048905 Ga0496102_1452203 Ga0496102_1452203_56_520 154
66 3300004799 Ga0058863_11718871 Ga0058863_117188711 155
67 3300004803 Ga0058862_12751779 Ga0058862_127517792 155
68 3300005327 Ga0070658_10017688 Ga0070658_100176886 155
69 3300005327 Ga0070658_10036568 Ga0070658_100365685 155
70 3300005329 Ga0070683_100019402 Ga0070683_1000194023 155
71 3300005329 Ga0070683_100058588 Ga0070683_1000585883 155
72 3300005331 Ga0070670_101686592 Ga0070670_1016865921 155
73 3300005335 Ga0070666_10410922 Ga0070666_104109222 155
74 3300005336 Ga0070680_100109620 Ga0070680_1001096202 155
75 3300005336 Ga0070680_100376219 Ga0070680_1003762192 155
76 3300005339 Ga0070660_100004956 Ga0070660_1000049563 155
77 3300005339 Ga0070660_100018533 Ga0070660_1000185332 155
78 3300005344 Ga0070661_100010175 Ga0070661_1000101752 155
79 3300005344 Ga0070661_100027132 Ga0070661_1000271325 155
80 3300005344 Ga0070661_100173153 Ga0070661_1001731531 155
81 3300005353 Ga0070669_100006708 Ga0070669_1000067083 155
82 3300005354 Ga0070675_100392373 Ga0070675_1003923732 155
83 3300005364 Ga0070673_100091659 Ga0070673_1000916592 155
84 3300005366 Ga0070659_100006210 Ga0070659_1000062106 155
85 3300005366 Ga0070659_100064486 Ga0070659_1000644862 155
86 3300005366 Ga0070659_100589158 Ga0070659_1005891582 155
87 3300005367 Ga0070667_100213734 Ga0070667_1002137342 155
88 3300005435 Ga0070714_100033301 Ga0070714_1000333011 155
89 3300005441 Ga0070700_100204956 Ga0070700_1002049562 155
90 3300005455 Ga0070663_100010255 Ga0070663_1000102552 155
91 3300005457 Ga0070662_100001081 Ga0070662_1000010818 155
92 3300005530 Ga0070679_100019147 Ga0070679_1000191475 155
93 3300005535 Ga0070684_100040000 Ga0070684_1000400002 155
94 3300005535 Ga0070684_100043995 Ga0070684_1000439952 155
95 3300005539 Ga0068853_100056192 Ga0068853_1000561922 155
96 3300005539 Ga0068853_100542898 Ga0068853_1005428982 155
97 3300005543 Ga0070672_100022564 Ga0070672_1000225642 155
98 3300005563 Ga0068855_100003908 Ga0068855_1000039082 155
99 3300005564 Ga0070664_100002998 Ga0070664_10000299813 155
100 3300005564 Ga0070664_101553058 Ga0070664_1015530581 155
101 3300005577 Ga0068857_100008373 Ga0068857_1000083734 155
102 3300005578 Ga0068854_100002321 Ga0068854_1000023216 155
103 3300005578 Ga0068854_100115025 Ga0068854_1001150252 155
104 3300005578 Ga0068854_100163739 Ga0068854_1001637392 155
105 3300005614 Ga0068856_100001379 Ga0068856_10000137916 155
106 3300005614 Ga0068856_101572557 Ga0068856_1015725571 155
107 3300005616 Ga0068852_100002000 Ga0068852_1000020002 155
108 3300005616 Ga0068852_100067303 Ga0068852_1000673033 155
109 3300005616 Ga0068852_100213207 Ga0068852_1002132072 155
110 3300005719 Ga0068861_100001362 Ga0068861_1000013625 155
111 3300005834 Ga0068851_10010234 Ga0068851_100102344 155
112 3300005834 Ga0068851_10028777 Ga0068851_100287773 155
113 3300005840 Ga0068870_10017237 Ga0068870_100172373 155
114 3300005844 Ga0068862_100002076 Ga0068862_1000020764 155
115 3300005937 Ga0081455_10317106 Ga0081455_103171062 155
116 3300006844 Ga0075428_100160557 Ga0075428_1001605573 155
117 3300006844 Ga0075428_100347659 Ga0075428_1003476592 155
118 3300006844 Ga0075428_100586531 Ga0075428_1005865312 155
119 3300006846 Ga0075430_100020888 Ga0075430_1000208886 155
120 3300006847 Ga0075431_100159632 Ga0075431_1001596323 155
121 3300009094 Ga0111539_10053252 Ga0111539_100532522 155
122 3300009148 Ga0105243_10336876 Ga0105243_103368762 155
123 3300009174 Ga0105241_11041971 Ga0105241_110419711 155
124 3300009545 Ga0105237_10173559 Ga0105237_101735592 155
125 3300009553 Ga0105249_10020425 Ga0105249_100204253 155
126 3300010375 Ga0105239_10082015 Ga0105239_100820154 155
127 3300010375 Ga0105239_10981235 Ga0105239_109812352 155
128 3300013100 Ga0157373_10001932 Ga0157373_100019322 155
129 3300013102 Ga0157371_10000303 Ga0157371_1000030360 155
130 3300013105 Ga0157369_12357950 Ga0157369_123579501 155
131 3300013306 Ga0163162_10089116 Ga0163162_100891162 155
132 3300013307 Ga0157372_10001717 Ga0157372_1000171714 155
133 3300013307 Ga0157372_10007943 Ga0157372_100079432 155
134 3300013308 Ga0157375_10300981 Ga0157375_103009812 155
135 3300013308 Ga0157375_10860866 Ga0157375_108608662 155
136 3300014326 Ga0157380_10006810 Ga0157380_100068104 155
137 3300017792 Ga0163161_10545575 Ga0163161_105455751 155
138 3300020610 Ga0154015_1059651 Ga0154015_10596513 155
139 3300022467 Ga0224712_10005960 Ga0224712_100059602 155
140 3300025898 Ga0207692_10710185 Ga0207692_107101851 155
141 3300025907 Ga0207645_10061294 Ga0207645_100612943 155
142 3300025908 Ga0207643_10016622 Ga0207643_100166222 155
143 3300025909 Ga0207705_10517182 Ga0207705_105171822 155
144 3300025911 Ga0207654_10438270 Ga0207654_104382702 155
145 3300025913 Ga0207695_10041552 Ga0207695_100415522 155
146 3300025917 Ga0207660_10321431 Ga0207660_103214312 155
147 3300025919 Ga0207657_10001114 Ga0207657_100011144 155
148 3300025919 Ga0207657_10019069 Ga0207657_100190695 155
149 3300025919 Ga0207657_10023158 Ga0207657_100231586 155
150 3300025920 Ga0207649_10003803 Ga0207649_100038033 155
151 3300025921 Ga0207652_10009211 Ga0207652_100092117 155
152 3300025921 Ga0207652_10026593 Ga0207652_100265935 155
153 3300025924 Ga0207694_10061823 Ga0207694_100618231 155
154 3300025925 Ga0207650_10238504 Ga0207650_102385042 155
155 3300025926 Ga0207659_10165217 Ga0207659_101652172 155
156 3300025929 Ga0207664_10327191 Ga0207664_103271912 155
157 3300025931 Ga0207644_10121670 Ga0207644_101216702 155
158 3300025932 Ga0207690_10001868 Ga0207690_1000186811 155
159 3300025932 Ga0207690_10061917 Ga0207690_100619171 155
160 3300025932 Ga0207690_10092030 Ga0207690_100920302 155
161 3300025933 Ga0207706_10000023 Ga0207706_10000023125 155
162 3300025933 Ga0207706_10112789 Ga0207706_101127893 155
163 3300025940 Ga0207691_10009118 Ga0207691_100091184 155
164 3300025944 Ga0207661_10151896 Ga0207661_101518962 155
165 3300025945 Ga0207679_10008603 Ga0207679_100086032 155
166 3300025945 Ga0207679_10100532 Ga0207679_101005322 155
167 3300025945 Ga0207679_10836373 Ga0207679_108363731 155
168 3300025949 Ga0207667_10007723 Ga0207667_100077234 155
169 3300025949 Ga0207667_10060678 Ga0207667_100606784 155
170 3300025949 Ga0207667_11072368 Ga0207667_110723682 155
171 3300025960 Ga0207651_10021607 Ga0207651_100216074 155
172 3300025961 Ga0207712_10012882 Ga0207712_100128823 155
173 3300025972 Ga0207668_10112766 Ga0207668_101127662 155
174 3300025981 Ga0207640_10009290 Ga0207640_100092903 155
175 3300025981 Ga0207640_10021612 Ga0207640_100216124 155
176 3300025981 Ga0207640_10083873 Ga0207640_100838732 155
177 3300025986 Ga0207658_10284877 Ga0207658_102848772 155
178 3300026041 Ga0207639_10061326 Ga0207639_100613262 155
179 3300026041 Ga0207639_10570097 Ga0207639_105700972 155
180 3300026041 Ga0207639_10794483 Ga0207639_107944832 155
181 3300026067 Ga0207678_10017478 Ga0207678_100174786 155
182 3300026075 Ga0207708_10022570 Ga0207708_100225703 155
183 3300026075 Ga0207708_10238624 Ga0207708_102386242 155
184 3300026078 Ga0207702_10129038 Ga0207702_101290381 155
185 3300026078 Ga0207702_10129152 Ga0207702_101291523 155
186 3300026088 Ga0207641_10208816 Ga0207641_102088162 155
187 3300026095 Ga0207676_11595296 Ga0207676_115952962 155
188 3300026116 Ga0207674_10002604 Ga0207674_1000260411 155
189 3300026116 Ga0207674_10003926 Ga0207674_1000392617 155
190 3300026118 Ga0207675_100003092 Ga0207675_1000030922 155
191 3300026142 Ga0207698_10015332 Ga0207698_100153325 155
192 3300026142 Ga0207698_10280324 Ga0207698_102803242 155
193 3300027665 Ga0209983_1084532 Ga0209983_10845322 155
194 3300027717 Ga0209998_10029941 Ga0209998_100299411 155
195 3300027876 Ga0209974_10005746 Ga0209974_100057462 155
196 3300028380 Ga0268265_10004417 Ga0268265_100044174 155
197 3300031548 Ga0307408_100556982 Ga0307408_1005569822 155
198 3300031824 Ga0307413_10001971 Ga0307413_100019712 155
199 3300031852 Ga0307410_10010067 Ga0307410_100100671 155
200 3300031901 Ga0307406_10004583 Ga0307406_100045832 155
201 3300031903 Ga0307407_10003221 Ga0307407_100032212 155
202 3300031911 Ga0307412_10013605 Ga0307412_100136052 155
203 3300031995 Ga0307409_100010408 Ga0307409_1000104081 155
204 3300032002 Ga0307416_100002070 Ga0307416_1000020706 155
205 3300032004 Ga0307414_10013575 Ga0307414_100135752 155
206 3300032005 Ga0307411_10011160 Ga0307411_100111601 155
207 3300032126 Ga0307415_100054808 Ga0307415_1000548082 155
208 3300037418 Ga0395900_0041433 Ga0395900_0041433_2158_2649 155
209 3300037418 Ga0395900_0273378 Ga0395900_0273378_163_636 155
210 3300037466 Ga0395898_0032291 Ga0395898_0032291_608_1099 155
211 3300037471 Ga0395905_0011436 Ga0395905_0011436_2912_3403 155
212 3300037471 Ga0395905_0057778 Ga0395905_0057778_792_1265 155
213 3300037471 Ga0395905_0145394 Ga0395905_0145394_1316_1807 155
214 3300038443 Ga0395901_0018072 Ga0395901_0018072_2113_2604 155
215 3300048906 Ga0496103_0163935 Ga0496103_0163935_91_558 155
216 3300048909 Ga0496106_0003978 Ga0496106_0003978_9739_10206 155
217 3300048910 Ga0496107_0017734 Ga0496107_0017734_1548_2015 155
218 3300048916 Ga0496113_0591320 Ga0496113_0591320_401_874 155
219 3300050507 nmdc:mga05p37_7464_c1 nmdc:mga05p37_7464_c1_304_780 155
220 3300050508 nmdc:mga09592_14083_c1 nmdc:mga09592_14083_c1_2104_2580 155
221 3300050509 nmdc:mga0qj67_479308_c1 nmdc:mga0qj67_479308_c1_439_909 155
222 3300050509 nmdc:mga0qj67_7494_c1 nmdc:mga0qj67_7494_c1_4230_4706 155
223 3300050510 nmdc:mga06r32_230215_c1 nmdc:mga06r32_230215_c1_1342_1818 155
224 3300050511 nmdc:mga08y16_144437_c1 nmdc:mga08y16_144437_c1_1279_1761 155
225 3300050512 nmdc:mga0n895_1037716_c1 nmdc:mga0n895_1037716_c1_81_554 155
226 3300005293 Ga0065715_10162694 Ga0065715_101626942 156
227 3300005293 Ga0065715_10365467 Ga0065715_103654671 156
228 3300005328 Ga0070676_10032653 Ga0070676_100326533 156
229 3300005331 Ga0070670_100021437 Ga0070670_1000214372 156
230 3300005333 Ga0070677_10135884 Ga0070677_101358842 156
231 3300005334 Ga0068869_100007694 Ga0068869_1000076946 156
232 3300005337 Ga0070682_100899525 Ga0070682_1008995251 156
233 3300005338 Ga0068868_100045229 Ga0068868_1000452295 156
234 3300005344 Ga0070661_100248233 Ga0070661_1002482331 156
235 3300005347 Ga0070668_100007010 Ga0070668_1000070101 156
236 3300005347 Ga0070668_100016216 Ga0070668_1000162168 156
237 3300005347 Ga0070668_100559299 Ga0070668_1005592992 156
238 3300005347 Ga0070668_101249069 Ga0070668_1012490692 156
239 3300005353 Ga0070669_100110841 Ga0070669_1001108412 156
240 3300005353 Ga0070669_100667379 Ga0070669_1006673792 156
241 3300005354 Ga0070675_100008929 Ga0070675_10000892910 156
242 3300005354 Ga0070675_100094815 Ga0070675_1000948152 156
243 3300005354 Ga0070675_100317873 Ga0070675_1003178732 156
244 3300005354 Ga0070675_100332358 Ga0070675_1003323582 156
245 3300005355 Ga0070671_100383170 Ga0070671_1003831701 156
246 3300005356 Ga0070674_100120733 Ga0070674_1001207332 156
247 3300005356 Ga0070674_100398011 Ga0070674_1003980112 156
248 3300005364 Ga0070673_100074203 Ga0070673_1000742034 156
249 3300005366 Ga0070659_100071001 Ga0070659_1000710012 156
250 3300005367 Ga0070667_100127045 Ga0070667_1001270454 156
251 3300005367 Ga0070667_100422096 Ga0070667_1004220962 156
252 3300005435 Ga0070714_100062644 Ga0070714_1000626443 156
253 3300005439 Ga0070711_100691827 Ga0070711_1006918271 156
254 3300005439 Ga0070711_100928130 Ga0070711_1009281301 156
255 3300005455 Ga0070663_100190761 Ga0070663_1001907612 156
256 3300005457 Ga0070662_100259751 Ga0070662_1002597512 156
257 3300005458 Ga0070681_10001160 Ga0070681_1000116012 156
258 3300005458 Ga0070681_11030478 Ga0070681_110304781 156
259 3300005459 Ga0068867_100010823 Ga0068867_1000108233 156
260 3300005459 Ga0068867_100384660 Ga0068867_1003846602 156
261 3300005518 Ga0070699_100093099 Ga0070699_1000930993 156
262 3300005530 Ga0070679_100178590 Ga0070679_1001785901 156
263 3300005539 Ga0068853_100074913 Ga0068853_1000749132 156
264 3300005539 Ga0068853_101410792 Ga0068853_1014107921 156
265 3300005543 Ga0070672_100012306 Ga0070672_1000123066 156
266 3300005543 Ga0070672_100075834 Ga0070672_1000758342 156
267 3300005543 Ga0070672_100228126 Ga0070672_1002281261 156
268 3300005548 Ga0070665_100305035 Ga0070665_1003050352 156
269 3300005563 Ga0068855_100019019 Ga0068855_1000190192 156
270 3300005563 Ga0068855_100040144 Ga0068855_1000401441 156
271 3300005564 Ga0070664_100084498 Ga0070664_1000844982 156
272 3300005564 Ga0070664_100094788 Ga0070664_1000947883 156
273 3300005564 Ga0070664_101033582 Ga0070664_1010335822 156
274 3300005577 Ga0068857_100065029 Ga0068857_1000650294 156
275 3300005577 Ga0068857_100399942 Ga0068857_1003999422 156
276 3300005616 Ga0068852_100328423 Ga0068852_1003284232 156
277 3300005617 Ga0068859_100243236 Ga0068859_1002432362 156
278 3300005617 Ga0068859_100824334 Ga0068859_1008243342 156
279 3300005618 Ga0068864_100018419 Ga0068864_1000184192 156
280 3300005618 Ga0068864_100807004 Ga0068864_1008070042 156
281 3300005718 Ga0068866_10195641 Ga0068866_101956412 156
282 3300005719 Ga0068861_100235924 Ga0068861_1002359242 156
283 3300005719 Ga0068861_100261518 Ga0068861_1002615181 156
284 3300005719 Ga0068861_100751837 Ga0068861_1007518371 156
285 3300005834 Ga0068851_10078842 Ga0068851_100788422 156
286 3300005841 Ga0068863_100264682 Ga0068863_1002646822 156
287 3300005842 Ga0068858_100150477 Ga0068858_1001504772 156
288 3300005843 Ga0068860_100200958 Ga0068860_1002009582 156
289 3300005844 Ga0068862_102264194 Ga0068862_1022641941 156
290 3300006237 Ga0097621_100099569 Ga0097621_1000995692 156
291 3300006358 Ga0068871_100213997 Ga0068871_1002139973 156
292 3300006358 Ga0068871_100473592 Ga0068871_1004735922 156
293 3300006871 Ga0075434_100651911 Ga0075434_1006519111 156
294 3300006881 Ga0068865_100023951 Ga0068865_1000239514 156
295 3300006914 Ga0075436_100706649 Ga0075436_1007066492 156
296 3300006931 Ga0097620_100243229 Ga0097620_1002432292 156
297 3300006931 Ga0097620_100824340 Ga0097620_1008243402 156
298 3300009093 Ga0105240_10166930 Ga0105240_101669303 156
299 3300009098 Ga0105245_10470611 Ga0105245_104706112 156
300 3300009174 Ga0105241_10143629 Ga0105241_101436292 156
301 3300009177 Ga0105248_10147483 Ga0105248_101474832 156
302 3300009177 Ga0105248_10397237 Ga0105248_103972372 156
303 3300009551 Ga0105238_10075696 Ga0105238_100756963 156
304 3300009551 Ga0105238_10412946 Ga0105238_104129462 156
305 3300009553 Ga0105249_10128452 Ga0105249_101284522 156
306 3300013102 Ga0157371_10043784 Ga0157371_100437842 156
307 3300013105 Ga0157369_10217825 Ga0157369_102178253 156
308 3300013296 Ga0157374_10554585 Ga0157374_105545852 156
309 3300013297 Ga0157378_10004675 Ga0157378_1000467510 156
310 3300013306 Ga0163162_10078494 Ga0163162_100784942 156
311 3300013307 Ga0157372_10049411 Ga0157372_100494112 156
312 3300013308 Ga0157375_10862526 Ga0157375_108625262 156
313 3300014325 Ga0163163_10025908 Ga0163163_100259083 156
314 3300014325 Ga0163163_10575587 Ga0163163_105755872 156
315 3300014968 Ga0157379_10058207 Ga0157379_100582073 156
316 3300014969 Ga0157376_10237184 Ga0157376_102371842 156
317 3300017792 Ga0163161_10728437 Ga0163161_107284372 156
318 3300025321 Ga0207656_10230369 Ga0207656_102303692 156
319 3300025893 Ga0207682_10073389 Ga0207682_100733892 156
320 3300025899 Ga0207642_10188137 Ga0207642_101881372 156
321 3300025901 Ga0207688_10091693 Ga0207688_100916931 156
322 3300025903 Ga0207680_10103464 Ga0207680_101034642 156
323 3300025907 Ga0207645_10013037 Ga0207645_100130376 156
324 3300025912 Ga0207707_10454226 Ga0207707_104542262 156
325 3300025912 Ga0207707_10791781 Ga0207707_107917811 156
326 3300025916 Ga0207663_11143859 Ga0207663_111438592 156
327 3300025920 Ga0207649_10011530 Ga0207649_100115304 156
328 3300025921 Ga0207652_10066497 Ga0207652_100664972 156
329 3300025923 Ga0207681_10049513 Ga0207681_100495133 156
330 3300025925 Ga0207650_10006587 Ga0207650_100065872 156
331 3300025925 Ga0207650_10640552 Ga0207650_106405521 156
332 3300025926 Ga0207659_10001994 Ga0207659_100019949 156
333 3300025926 Ga0207659_10083486 Ga0207659_100834862 156
334 3300025926 Ga0207659_10323128 Ga0207659_103231282 156
335 3300025927 Ga0207687_10306653 Ga0207687_103066532 156
336 3300025929 Ga0207664_10036152 Ga0207664_100361522 156
337 3300025931 Ga0207644_10045418 Ga0207644_100454182 156
338 3300025932 Ga0207690_11574561 Ga0207690_115745611 156
339 3300025933 Ga0207706_11095769 Ga0207706_110957691 156
340 3300025936 Ga0207670_10386246 Ga0207670_103862462 156
341 3300025937 Ga0207669_10058700 Ga0207669_100587002 156
342 3300025937 Ga0207669_10889296 Ga0207669_108892962 156
343 3300025940 Ga0207691_10000022 Ga0207691_1000002249 156
344 3300025940 Ga0207691_10032316 Ga0207691_100323165 156
345 3300025942 Ga0207689_10011258 Ga0207689_100112584 156
346 3300025945 Ga0207679_10076457 Ga0207679_100764573 156
347 3300025945 Ga0207679_11085889 Ga0207679_110858891 156
348 3300025949 Ga0207667_10012582 Ga0207667_100125822 156
349 3300025949 Ga0207667_10012658 Ga0207667_100126584 156
350 3300025960 Ga0207651_10008537 Ga0207651_100085375 156
351 3300025961 Ga0207712_10548820 Ga0207712_105488202 156
352 3300025972 Ga0207668_10003779 Ga0207668_100037794 156
353 3300025972 Ga0207668_10448573 Ga0207668_104485731 156
354 3300025972 Ga0207668_11790681 Ga0207668_117906811 156
355 3300025981 Ga0207640_11333567 Ga0207640_113335672 156
356 3300025986 Ga0207658_10041400 Ga0207658_100414003 156
357 3300025986 Ga0207658_10047658 Ga0207658_100476582 156
358 3300026023 Ga0207677_10012063 Ga0207677_100120635 156
359 3300026023 Ga0207677_10017587 Ga0207677_100175875 156
360 3300026035 Ga0207703_10070477 Ga0207703_100704772 156
361 3300026041 Ga0207639_10026571 Ga0207639_100265712 156
362 3300026041 Ga0207639_11001765 Ga0207639_110017652 156
363 3300026088 Ga0207641_10006556 Ga0207641_100065562 156
364 3300026088 Ga0207641_10137293 Ga0207641_101372932 156
365 3300026088 Ga0207641_12293335 Ga0207641_122933351 156
366 3300026089 Ga0207648_10017870 Ga0207648_100178703 156
367 3300026089 Ga0207648_10521893 Ga0207648_105218932 156
368 3300026116 Ga0207674_10092555 Ga0207674_100925552 156
369 3300026118 Ga0207675_100016851 Ga0207675_1000168515 156
370 3300026118 Ga0207675_100287668 Ga0207675_1002876682 156
371 3300026118 Ga0207675_100851294 Ga0207675_1008512942 156
372 3300026121 Ga0207683_10000283 Ga0207683_1000028336 156
373 3300026121 Ga0207683_10034269 Ga0207683_100342694 156
374 3300026142 Ga0207698_10114264 Ga0207698_101142642 156
375 3300026142 Ga0207698_10663535 Ga0207698_106635352 156
376 3300028379 Ga0268266_10245694 Ga0268266_102456942 156
377 3300028379 Ga0268266_11053747 Ga0268266_110537472 156
378 3300028379 Ga0268266_11120210 Ga0268266_111202101 156
379 3300028380 Ga0268265_10043968 Ga0268265_100439682 156
380 3300028381 Ga0268264_10052267 Ga0268264_100522672 156
381 3300028381 Ga0268264_10147980 Ga0268264_101479801 156
382 3300031903 Ga0307407_10622466 Ga0307407_106224661 156
383 3300035170 Ga0373943_0133270 Ga0373943_0133270_301_771 156
384 3300035692 Ga0373935_1305636 Ga0373935_1305636_28_498 156
385 3300035695 Ga0373927_0234179 Ga0373927_0234179_645_1115 156
386 3300035725 Ga0373947_0609784 Ga0373947_0609784_222_692 156
387 3300036401 Ga0373937_0177543 Ga0373937_0177543_401_871 156
388 3300041451 Ga0451791_1618681 Ga0451791_1618681_33_512 156
389 3300041512 Ga0451853_2765974 Ga0451853_2765974_59_553 156
390 3300044901 Ga0466960_0135938 Ga0466960_0135938_787_1266 156
391 3300045051 Ga0451576_0187687 Ga0451576_0187687_757_1335 156
392 3300045976 Ga0466967_1203478 Ga0466967_1203478_144_626 156
393 3300046539 Ga0495621_0164018 Ga0495621_0164018_98_568 156
394 3300046543 Ga0495645_0219254 Ga0495645_0219254_61_549 156
395 3300046678 Ga0495599_0753419 Ga0495599_0753419_53_541 156
396 3300048903 Ga0496100_0989548 Ga0496100_0989548_137_631 156
397 3300048917 Ga0496114_0163843 Ga0496114_0163843_1279_1755 156
398 3300048917 Ga0496114_0431513 Ga0496114_0431513_258_743 156
399 3300049581 Ga0501047_0357560 Ga0501047_0357560_487_999 156
400 3300049583 Ga0501067_0102919 Ga0501067_0102919_636_1148 156
401 3300049585 Ga0501069_0157360 Ga0501069_0157360_786_1277 156
402 3300049589 Ga0501073_0004503 Ga0501073_0004503_8600_9112 156
403 3300049741 Ga0501079_0386242 Ga0501079_0386242_244_756 156
404 3300049742 Ga0501080_0006277 Ga0501080_0006277_5546_6058 156
405 3300049742 Ga0501080_0063267 Ga0501080_0063267_720_1211 156
406 3300050512 nmdc:mga0n895_1590944_c1 nmdc:mga0n895_1590944_c1_49_519 156
407 3300050512 nmdc:mga0n895_689121_c1 nmdc:mga0n895_689121_c1_322_792 156
408 3300005328 Ga0070676_10283966 Ga0070676_102839661 157
409 3300005328 Ga0070676_10744773 Ga0070676_107447732 157
410 3300005331 Ga0070670_100000274 Ga0070670_1000002744 157
411 3300005331 Ga0070670_100052188 Ga0070670_1000521883 157
412 3300005333 Ga0070677_10192830 Ga0070677_101928301 157
413 3300005333 Ga0070677_10429711 Ga0070677_104297112 157
414 3300005334 Ga0068869_100001694 Ga0068869_1000016949 157
415 3300005335 Ga0070666_10007688 Ga0070666_100076883 157
416 3300005336 Ga0070680_100616184 Ga0070680_1006161842 157
417 3300005338 Ga0068868_100028710 Ga0068868_1000287104 157
418 3300005340 Ga0070689_100033049 Ga0070689_1000330493 157
419 3300005344 Ga0070661_100135124 Ga0070661_1001351241 157
420 3300005344 Ga0070661_100161595 Ga0070661_1001615952 157
421 3300005347 Ga0070668_100011160 Ga0070668_1000111605 157
422 3300005347 Ga0070668_100065340 Ga0070668_1000653402 157
423 3300005347 Ga0070668_100359662 Ga0070668_1003596622 157
424 3300005353 Ga0070669_100005562 Ga0070669_1000055625 157
425 3300005353 Ga0070669_100050895 Ga0070669_1000508952 157
426 3300005353 Ga0070669_100203979 Ga0070669_1002039792 157
427 3300005364 Ga0070673_100020047 Ga0070673_1000200473 157
428 3300005364 Ga0070673_100226902 Ga0070673_1002269022 157
429 3300005367 Ga0070667_100002746 Ga0070667_1000027464 157
430 3300005367 Ga0070667_100010007 Ga0070667_1000100076 157
431 3300005367 Ga0070667_100156797 Ga0070667_1001567974 157
432 3300005367 Ga0070667_100248565 Ga0070667_1002485652 157
433 3300005367 Ga0070667_101129898 Ga0070667_1011298982 157
434 3300005435 Ga0070714_100109749 Ga0070714_1001097492 157
435 3300005436 Ga0070713_100012321 Ga0070713_1000123213 157
436 3300005437 Ga0070710_10007894 Ga0070710_100078943 157
437 3300005437 Ga0070710_10218269 Ga0070710_102182692 157
438 3300005439 Ga0070711_100105943 Ga0070711_1001059432 157
439 3300005441 Ga0070700_100625458 Ga0070700_1006254581 157
440 3300005444 Ga0070694_100682336 Ga0070694_1006823362 157
441 3300005455 Ga0070663_100043787 Ga0070663_1000437873 157
442 3300005456 Ga0070678_100000982 Ga0070678_10000098212 157
443 3300005456 Ga0070678_100299571 Ga0070678_1002995712 157
444 3300005458 Ga0070681_10939589 Ga0070681_109395891 157
445 3300005459 Ga0068867_100009061 Ga0068867_1000090614 157
446 3300005459 Ga0068867_100019400 Ga0068867_1000194004 157
447 3300005459 Ga0068867_100501068 Ga0068867_1005010682 157
448 3300005467 Ga0070706_100281817 Ga0070706_1002818173 157
449 3300005467 Ga0070706_101135846 Ga0070706_1011358462 157
450 3300005471 Ga0070698_100772739 Ga0070698_1007727392 157
451 3300005471 Ga0070698_101251665 Ga0070698_1012516652 157
452 3300005530 Ga0070679_100696648 Ga0070679_1006966482 157
453 3300005539 Ga0068853_100366468 Ga0068853_1003664682 157
454 3300005543 Ga0070672_100007295 Ga0070672_1000072954 157
455 3300005543 Ga0070672_100105320 Ga0070672_1001053202 157
456 3300005546 Ga0070696_100004065 Ga0070696_1000040658 157
457 3300005548 Ga0070665_100002542 Ga0070665_1000025424 157
458 3300005548 Ga0070665_100578305 Ga0070665_1005783052 157
459 3300005563 Ga0068855_100057251 Ga0068855_1000572512 157
460 3300005564 Ga0070664_100345226 Ga0070664_1003452262 157
461 3300005617 Ga0068859_100006523 Ga0068859_1000065234 157
462 3300005618 Ga0068864_100005598 Ga0068864_1000055984 157
463 3300005618 Ga0068864_100310185 Ga0068864_1003101852 157
464 3300005719 Ga0068861_100001763 Ga0068861_1000017638 157
465 3300005719 Ga0068861_100052360 Ga0068861_1000523602 157
466 3300005834 Ga0068851_10489637 Ga0068851_104896372 157
467 3300005841 Ga0068863_100002100 Ga0068863_1000021008 157
468 3300005841 Ga0068863_100087053 Ga0068863_1000870533 157
469 3300005842 Ga0068858_100000612 Ga0068858_10000061223 157
470 3300005842 Ga0068858_100097393 Ga0068858_1000973932 157
471 3300005842 Ga0068858_100507461 Ga0068858_1005074612 157
472 3300005843 Ga0068860_100011838 Ga0068860_1000118383 157
473 3300005843 Ga0068860_100065973 Ga0068860_1000659733 157
474 3300005843 Ga0068860_101109312 Ga0068860_1011093122 157
475 3300005843 Ga0068860_101391817 Ga0068860_1013918171 157
476 3300005844 Ga0068862_100013014 Ga0068862_1000130146 157
477 3300005844 Ga0068862_100092127 Ga0068862_1000921272 157
478 3300006237 Ga0097621_100079081 Ga0097621_1000790811 157
479 3300006358 Ga0068871_101040792 Ga0068871_1010407922 157
480 3300006358 Ga0068871_101311839 Ga0068871_1013118392 157
481 3300006844 Ga0075428_100103504 Ga0075428_1001035042 157
482 3300006871 Ga0075434_100184957 Ga0075434_1001849573 157
483 3300006881 Ga0068865_100127465 Ga0068865_1001274652 157
484 3300006881 Ga0068865_100411915 Ga0068865_1004119152 157
485 3300006931 Ga0097620_100006521 Ga0097620_1000065214 157
486 3300009093 Ga0105240_10102436 Ga0105240_101024362 157
487 3300009094 Ga0111539_11399555 Ga0111539_113995552 157
488 3300009098 Ga0105245_10200008 Ga0105245_102000082 157
489 3300009101 Ga0105247_10010766 Ga0105247_100107663 157
490 3300009147 Ga0114129_10480688 Ga0114129_104806881 157
491 3300009174 Ga0105241_10121350 Ga0105241_101213502 157
492 3300009177 Ga0105248_10015240 Ga0105248_100152404 157
493 3300009177 Ga0105248_10657051 Ga0105248_106570512 157
494 3300009177 Ga0105248_10834945 Ga0105248_108349452 157
495 3300009545 Ga0105237_10183286 Ga0105237_101832862 157
496 3300009551 Ga0105238_10628665 Ga0105238_106286652 157
497 3300009553 Ga0105249_10855570 Ga0105249_108555702 157
498 3300013104 Ga0157370_10011858 Ga0157370_100118585 157
499 3300013104 Ga0157370_10183907 Ga0157370_101839072 157
500 3300013105 Ga0157369_10891388 Ga0157369_108913882 157
501 3300013297 Ga0157378_10090675 Ga0157378_100906753 157
502 3300013306 Ga0163162_10736234 Ga0163162_107362342 157
503 3300013306 Ga0163162_12199454 Ga0163162_121994542 157
504 3300013307 Ga0157372_10002828 Ga0157372_100028289 157
505 3300013308 Ga0157375_10049121 Ga0157375_100491214 157
506 3300013308 Ga0157375_10937588 Ga0157375_109375882 157
507 3300013308 Ga0157375_11246719 Ga0157375_112467192 157
508 3300014325 Ga0163163_10001190 Ga0163163_100011904 157
509 3300014325 Ga0163163_12136756 Ga0163163_121367561 157
510 3300014326 Ga0157380_10439444 Ga0157380_104394442 157
511 3300014968 Ga0157379_10000105 Ga0157379_100001059 157
512 3300014968 Ga0157379_10005162 Ga0157379_100051622 157
513 3300014969 Ga0157376_10003620 Ga0157376_100036204 157
514 3300014969 Ga0157376_10500411 Ga0157376_105004112 157
515 3300025898 Ga0207692_10004583 Ga0207692_100045833 157
516 3300025900 Ga0207710_10033039 Ga0207710_100330392 157
517 3300025903 Ga0207680_10047447 Ga0207680_100474472 157
518 3300025906 Ga0207699_10029083 Ga0207699_100290832 157
519 3300025907 Ga0207645_10155820 Ga0207645_101558202 157
520 3300025907 Ga0207645_10624679 Ga0207645_106246792 157
521 3300025910 Ga0207684_10413045 Ga0207684_104130453 157
522 3300025913 Ga0207695_10043837 Ga0207695_100438373 157
523 3300025914 Ga0207671_10507887 Ga0207671_105078872 157
524 3300025916 Ga0207663_10151028 Ga0207663_101510282 157
525 3300025920 Ga0207649_10094126 Ga0207649_100941263 157
526 3300025920 Ga0207649_10203692 Ga0207649_102036922 157
527 3300025922 Ga0207646_10786979 Ga0207646_107869791 157
528 3300025923 Ga0207681_10006193 Ga0207681_100061939 157
529 3300025923 Ga0207681_10190649 Ga0207681_101906492 157
530 3300025925 Ga0207650_10057166 Ga0207650_100571662 157
531 3300025925 Ga0207650_10060690 Ga0207650_100606903 157
532 3300025928 Ga0207700_10331872 Ga0207700_103318722 157
533 3300025928 Ga0207700_11272342 Ga0207700_112723421 157
534 3300025929 Ga0207664_10024542 Ga0207664_100245422 157
535 3300025937 Ga0207669_10005949 Ga0207669_100059494 157
536 3300025938 Ga0207704_10026968 Ga0207704_100269683 157
537 3300025940 Ga0207691_10067215 Ga0207691_100672153 157
538 3300025940 Ga0207691_11104910 Ga0207691_111049102 157
539 3300025941 Ga0207711_10028404 Ga0207711_100284047 157
540 3300025941 Ga0207711_10277556 Ga0207711_102775563 157
541 3300025941 Ga0207711_10946343 Ga0207711_109463432 157
542 3300025942 Ga0207689_10000147 Ga0207689_1000014741 157
543 3300025949 Ga0207667_10043293 Ga0207667_100432937 157
544 3300025960 Ga0207651_10012431 Ga0207651_100124313 157
545 3300025961 Ga0207712_10018851 Ga0207712_100188513 157
546 3300025972 Ga0207668_10021387 Ga0207668_100213871 157
547 3300025972 Ga0207668_10028298 Ga0207668_100282984 157
548 3300025972 Ga0207668_10786096 Ga0207668_107860962 157
549 3300025986 Ga0207658_10006239 Ga0207658_100062394 157
550 3300025986 Ga0207658_10008453 Ga0207658_100084533 157
551 3300025986 Ga0207658_10086932 Ga0207658_100869322 157
552 3300025986 Ga0207658_10363502 Ga0207658_103635021 157
553 3300026035 Ga0207703_10008603 Ga0207703_100086034 157
554 3300026035 Ga0207703_10188286 Ga0207703_101882862 157
555 3300026041 Ga0207639_10452391 Ga0207639_104523912 157
556 3300026067 Ga0207678_10073764 Ga0207678_100737643 157
557 3300026075 Ga0207708_10276330 Ga0207708_102763302 157
558 3300026088 Ga0207641_10004344 Ga0207641_1000434413 157
559 3300026088 Ga0207641_10581078 Ga0207641_105810782 157
560 3300026089 Ga0207648_10008541 Ga0207648_100085417 157
561 3300026089 Ga0207648_10034621 Ga0207648_100346213 157
562 3300026095 Ga0207676_10045405 Ga0207676_100454051 157
563 3300026095 Ga0207676_10543500 Ga0207676_105435002 157
564 3300026095 Ga0207676_11271944 Ga0207676_112719441 157
565 3300026116 Ga0207674_10007754 Ga0207674_1000775414 157
566 3300026118 Ga0207675_100008081 Ga0207675_1000080813 157
567 3300026118 Ga0207675_100051806 Ga0207675_1000518063 157
568 3300026121 Ga0207683_10003645 Ga0207683_100036454 157
569 3300027907 Ga0207428_10541739 Ga0207428_105417391 157
570 3300028379 Ga0268266_10028908 Ga0268266_100289083 157
571 3300028379 Ga0268266_10099851 Ga0268266_100998513 157
572 3300028379 Ga0268266_10431102 Ga0268266_104311022 157
573 3300028380 Ga0268265_10058560 Ga0268265_100585603 157
574 3300028381 Ga0268264_10010306 Ga0268264_100103064 157
575 3300028381 Ga0268264_10208457 Ga0268264_102084572 157
576 3300031824 Ga0307413_10976608 Ga0307413_109766082 157
577 3300031995 Ga0307409_100052609 Ga0307409_1000526094 157
578 3300031995 Ga0307409_100064535 Ga0307409_1000645355 157
579 3300035695 Ga0373927_0020040 Ga0373927_0020040_2142_2702 157
580 3300035695 Ga0373927_0149403 Ga0373927_0149403_111_596 157
581 3300041441 Ga0451787_352292 Ga0451787_352292_84_566 157
582 3300042133 Ga0450896_024507 Ga0450896_024507_92_571 157
583 3300042436 Ga0439435_0033489 Ga0439435_0033489_11_508 157
584 3300044673 Ga0453683_0240231 Ga0453683_0240231_444_923 157
585 3300046472 Ga0495580_0026495 Ga0495580_0026495_1788_2273 157
586 3300046539 Ga0495621_0094697 Ga0495621_0094697_561_1058 157
587 3300046681 Ga0495647_0472048 Ga0495647_0472048_24_503 157
588 3300048905 Ga0496102_0025261 Ga0496102_0025261_4429_4908 157
589 3300048906 Ga0496103_0033857 Ga0496103_0033857_417_896 157
590 3300048911 Ga0496108_1094493 Ga0496108_1094493_78_566 157
591 3300048912 Ga0496109_0032060 Ga0496109_0032060_933_1412 157
592 3300048912 Ga0496109_0068827 Ga0496109_0068827_1463_1951 157
593 3300048913 Ga0496110_0644977 Ga0496110_0644977_396_890 157
594 3300048914 Ga0496111_0206944 Ga0496111_0206944_430_918 157
595 3300048915 Ga0496112_0003208 Ga0496112_0003208_6641_7129 157
596 3300048916 Ga0496113_0195815 Ga0496113_0195815_313_801 157
597 3300049591 Ga0501075_0666380 Ga0501075_0666380_47_535 157
598 3300050512 nmdc:mga0n895_149246_c1 nmdc:mga0n895_149246_c1_455_943 157
599 3300061734 Ga0530510_0157164 Ga0530510_0157164_368_856 157
600 3300001976 JGI24752J21851_1039947 JGI24752J21851_10399471 158
601 3300001978 JGI24747J21853_1020088 JGI24747J21853_10200882 158
602 3300001991 JGI24743J22301_10012420 JGI24743J22301_100124202 158
603 3300002070 JGI24750J21931_1041320 JGI24750J21931_10413202 158
604 3300002076 JGI24749J21850_1005279 JGI24749J21850_10052792 158
605 3300002077 JGI24744J21845_10055969 JGI24744J21845_100559692 158
606 3300005293 Ga0065715_10171170 Ga0065715_101711702 158
607 3300005327 Ga0070658_10018601 Ga0070658_100186011 158
608 3300005327 Ga0070658_10110787 Ga0070658_101107873 158
609 3300005327 Ga0070658_10796618 Ga0070658_107966181 158
610 3300005328 Ga0070676_10000769 Ga0070676_100007692 158
611 3300005328 Ga0070676_10005593 Ga0070676_100055933 158
612 3300005329 Ga0070683_100129952 Ga0070683_1001299523 158
613 3300005330 Ga0070690_100009005 Ga0070690_1000090052 158
614 3300005331 Ga0070670_100097188 Ga0070670_1000971882 158
615 3300005331 Ga0070670_100138970 Ga0070670_1001389703 158
616 3300005333 Ga0070677_10000132 Ga0070677_1000013221 158
617 3300005333 Ga0070677_10009216 Ga0070677_100092163 158
618 3300005334 Ga0068869_100208930 Ga0068869_1002089302 158
619 3300005335 Ga0070666_10006650 Ga0070666_100066502 158
620 3300005335 Ga0070666_10094719 Ga0070666_100947192 158
621 3300005335 Ga0070666_10290317 Ga0070666_102903172 158
622 3300005338 Ga0068868_100005576 Ga0068868_1000055764 158
623 3300005338 Ga0068868_101232518 Ga0068868_1012325181 158
624 3300005338 Ga0068868_101393863 Ga0068868_1013938632 158
625 3300005339 Ga0070660_100602224 Ga0070660_1006022241 158
626 3300005340 Ga0070689_100008003 Ga0070689_1000080032 158
627 3300005344 Ga0070661_100004644 Ga0070661_1000046442 158
628 3300005344 Ga0070661_100055801 Ga0070661_1000558012 158
629 3300005345 Ga0070692_10037400 Ga0070692_100374002 158
630 3300005347 Ga0070668_100000394 Ga0070668_10000039417 158
631 3300005353 Ga0070669_100052789 Ga0070669_1000527892 158
632 3300005353 Ga0070669_100097767 Ga0070669_1000977672 158
633 3300005353 Ga0070669_100844652 Ga0070669_1008446521 158
634 3300005354 Ga0070675_100008918 Ga0070675_1000089182 158
635 3300005354 Ga0070675_100032421 Ga0070675_1000324213 158
636 3300005355 Ga0070671_100013129 Ga0070671_1000131292 158
637 3300005355 Ga0070671_100206170 Ga0070671_1002061702 158
638 3300005355 Ga0070671_100472906 Ga0070671_1004729062 158
639 3300005356 Ga0070674_100001114 Ga0070674_10000111413 158
640 3300005356 Ga0070674_100069827 Ga0070674_1000698272 158
641 3300005364 Ga0070673_100002042 Ga0070673_1000020422 158
642 3300005364 Ga0070673_100133514 Ga0070673_1001335142 158
643 3300005364 Ga0070673_100163834 Ga0070673_1001638342 158
644 3300005365 Ga0070688_100003905 Ga0070688_1000039055 158
645 3300005366 Ga0070659_100067006 Ga0070659_1000670062 158
646 3300005367 Ga0070667_100021181 Ga0070667_1000211812 158
647 3300005367 Ga0070667_101109627 Ga0070667_1011096272 158
648 3300005438 Ga0070701_10066184 Ga0070701_100661842 158
649 3300005441 Ga0070700_100021916 Ga0070700_1000219162 158
650 3300005455 Ga0070663_100019255 Ga0070663_1000192553 158
651 3300005455 Ga0070663_100076206 Ga0070663_1000762062 158
652 3300005456 Ga0070678_100001348 Ga0070678_1000013486 158
653 3300005456 Ga0070678_100085937 Ga0070678_1000859372 158
654 3300005457 Ga0070662_100083792 Ga0070662_1000837922 158
655 3300005457 Ga0070662_100223556 Ga0070662_1002235562 158
656 3300005459 Ga0068867_100003590 Ga0068867_1000035906 158
657 3300005459 Ga0068867_100077601 Ga0068867_1000776012 158
658 3300005466 Ga0070685_10002380 Ga0070685_100023807 158
659 3300005535 Ga0070684_100093491 Ga0070684_1000934911 158
660 3300005535 Ga0070684_100499945 Ga0070684_1004999452 158
661 3300005539 Ga0068853_100002757 Ga0068853_1000027573 158
662 3300005543 Ga0070672_100000914 Ga0070672_10000091418 158
663 3300005543 Ga0070672_100042554 Ga0070672_1000425543 158
664 3300005543 Ga0070672_101066203 Ga0070672_1010662031 158
665 3300005544 Ga0070686_100085731 Ga0070686_1000857311 158
666 3300005547 Ga0070693_100691402 Ga0070693_1006914022 158
667 3300005548 Ga0070665_100012901 Ga0070665_1000129017 158
668 3300005548 Ga0070665_100121697 Ga0070665_1001216972 158
669 3300005548 Ga0070665_100637102 Ga0070665_1006371022 158
670 3300005548 Ga0070665_101173044 Ga0070665_1011730442 158
671 3300005564 Ga0070664_100013440 Ga0070664_1000134402 158
672 3300005564 Ga0070664_100083468 Ga0070664_1000834682 158
673 3300005577 Ga0068857_100010671 Ga0068857_1000106715 158
674 3300005578 Ga0068854_100055101 Ga0068854_1000551012 158
675 3300005578 Ga0068854_100196971 Ga0068854_1001969712 158
676 3300005614 Ga0068856_100365263 Ga0068856_1003652632 158
677 3300005615 Ga0070702_100133372 Ga0070702_1001333721 158
678 3300005616 Ga0068852_100002691 Ga0068852_1000026914 158
679 3300005616 Ga0068852_100024896 Ga0068852_1000248963 158
680 3300005616 Ga0068852_100088668 Ga0068852_1000886682 158
681 3300005617 Ga0068859_100084366 Ga0068859_1000843662 158
682 3300005618 Ga0068864_100007903 Ga0068864_1000079033 158
683 3300005618 Ga0068864_100009458 Ga0068864_1000094587 158
684 3300005618 Ga0068864_100009678 Ga0068864_1000096788 158
685 3300005718 Ga0068866_10057543 Ga0068866_100575432 158
686 3300005718 Ga0068866_10063584 Ga0068866_100635842 158
687 3300005719 Ga0068861_100012929 Ga0068861_1000129292 158
688 3300005834 Ga0068851_10007676 Ga0068851_100076764 158
689 3300005834 Ga0068851_10026215 Ga0068851_100262152 158
690 3300005834 Ga0068851_10387280 Ga0068851_103872802 158
691 3300005840 Ga0068870_10027358 Ga0068870_100273582 158
692 3300005841 Ga0068863_100013029 Ga0068863_1000130295 158
693 3300005841 Ga0068863_100026961 Ga0068863_1000269613 158
694 3300005841 Ga0068863_100195704 Ga0068863_1001957042 158
695 3300005842 Ga0068858_100055030 Ga0068858_1000550303 158
696 3300005843 Ga0068860_100023346 Ga0068860_1000233466 158
697 3300005843 Ga0068860_100044277 Ga0068860_1000442772 158
698 3300005844 Ga0068862_100088427 Ga0068862_1000884273 158
699 3300006237 Ga0097621_100225486 Ga0097621_1002254862 158
700 3300006358 Ga0068871_100003825 Ga0068871_10000382511 158
701 3300006358 Ga0068871_100118990 Ga0068871_1001189902 158
702 3300006871 Ga0075434_100070066 Ga0075434_1000700662 158
703 3300006881 Ga0068865_100128349 Ga0068865_1001283492 158
704 3300006914 Ga0075436_100529516 Ga0075436_1005295162 158
705 3300006931 Ga0097620_100084360 Ga0097620_1000843603 158
706 3300007076 Ga0075435_100446474 Ga0075435_1004464741 158
707 3300007076 Ga0075435_101082020 Ga0075435_1010820201 158
708 3300009094 Ga0111539_10183588 Ga0111539_101835882 158
709 3300009147 Ga0114129_10354316 Ga0114129_103543162 158
710 3300009148 Ga0105243_10118295 Ga0105243_101182952 158
711 3300009176 Ga0105242_10428620 Ga0105242_104286202 158
712 3300009177 Ga0105248_10025258 Ga0105248_100252584 158
713 3300009177 Ga0105248_10072760 Ga0105248_100727602 158
714 3300009551 Ga0105238_10626678 Ga0105238_106266782 158
715 3300009553 Ga0105249_10074146 Ga0105249_100741463 158
716 3300011119 Ga0105246_10329619 Ga0105246_103296192 158
717 3300013100 Ga0157373_10337764 Ga0157373_103377642 158
718 3300013102 Ga0157371_10096730 Ga0157371_100967302 158
719 3300013105 Ga0157369_10135579 Ga0157369_101355793 158
720 3300013296 Ga0157374_10063682 Ga0157374_100636823 158
721 3300013296 Ga0157374_10103382 Ga0157374_101033823 158
722 3300013296 Ga0157374_10142988 Ga0157374_101429882 158
723 3300013296 Ga0157374_10361450 Ga0157374_103614503 158
724 3300013297 Ga0157378_10436705 Ga0157378_104367052 158
725 3300013297 Ga0157378_10718677 Ga0157378_107186772 158
726 3300013297 Ga0157378_10754127 Ga0157378_107541272 158
727 3300013306 Ga0163162_10431489 Ga0163162_104314892 158
728 3300013307 Ga0157372_10148713 Ga0157372_101487133 158
729 3300013307 Ga0157372_10310060 Ga0157372_103100602 158
730 3300013308 Ga0157375_10002602 Ga0157375_100026022 158
731 3300013308 Ga0157375_10484297 Ga0157375_104842972 158
732 3300014325 Ga0163163_10010520 Ga0163163_100105206 158
733 3300014325 Ga0163163_10029634 Ga0163163_100296345 158
734 3300014326 Ga0157380_10005687 Ga0157380_100056872 158
735 3300014497 Ga0182008_10177367 Ga0182008_101773672 158
736 3300014745 Ga0157377_10000871 Ga0157377_100008714 158
737 3300014745 Ga0157377_10712551 Ga0157377_107125512 158
738 3300014968 Ga0157379_10008015 Ga0157379_100080155 158
739 3300014968 Ga0157379_10378272 Ga0157379_103782722 158
740 3300014969 Ga0157376_10087209 Ga0157376_100872092 158
741 3300014969 Ga0157376_10427683 Ga0157376_104276832 158
742 3300017792 Ga0163161_10019913 Ga0163161_100199134 158
743 3300017792 Ga0163161_10023041 Ga0163161_100230413 158
744 3300017792 Ga0163161_10632561 Ga0163161_106325612 158
745 3300025315 Ga0207697_10000471 Ga0207697_1000047116 158
746 3300025315 Ga0207697_10058323 Ga0207697_100583232 158
747 3300025321 Ga0207656_10006239 Ga0207656_100062392 158
748 3300025321 Ga0207656_10012737 Ga0207656_100127372 158
749 3300025893 Ga0207682_10000044 Ga0207682_1000004430 158
750 3300025893 Ga0207682_10001806 Ga0207682_100018065 158
751 3300025899 Ga0207642_10057585 Ga0207642_100575852 158
752 3300025899 Ga0207642_10066733 Ga0207642_100667332 158
753 3300025901 Ga0207688_10100088 Ga0207688_101000882 158
754 3300025903 Ga0207680_10002742 Ga0207680_100027423 158
755 3300025903 Ga0207680_10019059 Ga0207680_100190592 158
756 3300025907 Ga0207645_10001325 Ga0207645_100013252 158
757 3300025907 Ga0207645_10004314 Ga0207645_1000431410 158
758 3300025908 Ga0207643_10000161 Ga0207643_100001616 158
759 3300025909 Ga0207705_10158344 Ga0207705_101583442 158
760 3300025909 Ga0207705_10159353 Ga0207705_101593532 158
761 3300025909 Ga0207705_10631640 Ga0207705_106316401 158
762 3300025918 Ga0207662_10070704 Ga0207662_100707042 158
763 3300025920 Ga0207649_10056800 Ga0207649_100568002 158
764 3300025920 Ga0207649_10239984 Ga0207649_102399842 158
765 3300025921 Ga0207652_10444666 Ga0207652_104446662 158
766 3300025923 Ga0207681_10182954 Ga0207681_101829541 158
767 3300025923 Ga0207681_10274609 Ga0207681_102746092 158
768 3300025924 Ga0207694_10895945 Ga0207694_108959451 158
769 3300025925 Ga0207650_10001658 Ga0207650_1000165815 158
770 3300025925 Ga0207650_10113441 Ga0207650_101134413 158
771 3300025925 Ga0207650_10331078 Ga0207650_103310782 158
772 3300025926 Ga0207659_10002849 Ga0207659_100028497 158
773 3300025926 Ga0207659_10003224 Ga0207659_100032244 158
774 3300025931 Ga0207644_10004238 Ga0207644_100042386 158
775 3300025931 Ga0207644_10728657 Ga0207644_107286571 158
776 3300025931 Ga0207644_10754011 Ga0207644_107540111 158
777 3300025933 Ga0207706_10050271 Ga0207706_100502713 158
778 3300025935 Ga0207709_10531951 Ga0207709_105319512 158
779 3300025937 Ga0207669_10025077 Ga0207669_100250772 158
780 3300025938 Ga0207704_10041359 Ga0207704_100413592 158
781 3300025938 Ga0207704_10781205 Ga0207704_107812051 158
782 3300025940 Ga0207691_10000224 Ga0207691_1000022414 158
783 3300025940 Ga0207691_10059374 Ga0207691_100593742 158
784 3300025940 Ga0207691_10358264 Ga0207691_103582642 158
785 3300025940 Ga0207691_10451591 Ga0207691_104515912 158
786 3300025941 Ga0207711_10012405 Ga0207711_100124052 158
787 3300025941 Ga0207711_10178994 Ga0207711_101789942 158
788 3300025941 Ga0207711_10205488 Ga0207711_102054882 158
789 3300025942 Ga0207689_10002088 Ga0207689_1000208815 158
790 3300025944 Ga0207661_10015607 Ga0207661_100156073 158
791 3300025944 Ga0207661_10243076 Ga0207661_102430762 158
792 3300025945 Ga0207679_10079241 Ga0207679_100792411 158
793 3300025949 Ga0207667_10426822 Ga0207667_104268222 158
794 3300025960 Ga0207651_10005388 Ga0207651_100053886 158
795 3300025960 Ga0207651_10031308 Ga0207651_100313082 158
796 3300025960 Ga0207651_10747120 Ga0207651_107471202 158
797 3300025972 Ga0207668_10016076 Ga0207668_100160762 158
798 3300025972 Ga0207668_10545576 Ga0207668_105455762 158
799 3300025981 Ga0207640_10062054 Ga0207640_100620542 158
800 3300025981 Ga0207640_10091620 Ga0207640_100916202 158
801 3300025986 Ga0207658_10011567 Ga0207658_100115676 158
802 3300025986 Ga0207658_10068524 Ga0207658_100685242 158
803 3300026023 Ga0207677_10009797 Ga0207677_100097974 158
804 3300026023 Ga0207677_10246566 Ga0207677_102465662 158
805 3300026035 Ga0207703_10111517 Ga0207703_101115173 158
806 3300026035 Ga0207703_10558159 Ga0207703_105581591 158
807 3300026041 Ga0207639_10006189 Ga0207639_100061896 158
808 3300026067 Ga0207678_10002769 Ga0207678_100027695 158
809 3300026067 Ga0207678_10021448 Ga0207678_100214486 158
810 3300026067 Ga0207678_10035040 Ga0207678_100350405 158
811 3300026067 Ga0207678_10255117 Ga0207678_102551173 158
812 3300026075 Ga0207708_10000330 Ga0207708_1000033019 158
813 3300026078 Ga0207702_10811243 Ga0207702_108112431 158
814 3300026088 Ga0207641_10010037 Ga0207641_100100376 158
815 3300026088 Ga0207641_10197281 Ga0207641_101972812 158
816 3300026089 Ga0207648_10003749 Ga0207648_100037498 158
817 3300026089 Ga0207648_10062181 Ga0207648_100621813 158
818 3300026095 Ga0207676_10004846 Ga0207676_100048467 158
819 3300026095 Ga0207676_10009364 Ga0207676_100093642 158
820 3300026095 Ga0207676_10062168 Ga0207676_100621681 158
821 3300026095 Ga0207676_10565440 Ga0207676_105654401 158
822 3300026095 Ga0207676_11738167 Ga0207676_117381671 158
823 3300026116 Ga0207674_10000775 Ga0207674_1000077530 158
824 3300026118 Ga0207675_100000632 Ga0207675_10000063230 158
825 3300026118 Ga0207675_100072589 Ga0207675_1000725892 158
826 3300026118 Ga0207675_102020633 Ga0207675_1020206331 158
827 3300026121 Ga0207683_10001343 Ga0207683_100013438 158
828 3300026121 Ga0207683_10126863 Ga0207683_101268632 158
829 3300026121 Ga0207683_11275720 Ga0207683_112757201 158
830 3300026142 Ga0207698_10006776 Ga0207698_100067764 158
831 3300026142 Ga0207698_10065023 Ga0207698_100650231 158
832 3300027907 Ga0207428_10878303 Ga0207428_108783031 158
833 3300028379 Ga0268266_10003808 Ga0268266_1000380812 158
834 3300028379 Ga0268266_10126500 Ga0268266_101265003 158
835 3300028379 Ga0268266_10486078 Ga0268266_104860782 158
836 3300028379 Ga0268266_11062613 Ga0268266_110626131 158
837 3300028380 Ga0268265_10806234 Ga0268265_108062341 158
838 3300028381 Ga0268264_10020581 Ga0268264_100205813 158
839 3300028381 Ga0268264_11634814 Ga0268264_116348141 158
840 3300031235 Ga0265330_10004514 Ga0265330_100045142 158
841 3300031238 Ga0265332_10000141 Ga0265332_1000014152 158
842 3300031241 Ga0265325_10016639 Ga0265325_100166392 158
843 3300031249 Ga0265339_10029144 Ga0265339_100291443 158
844 3300031250 Ga0265331_10000972 Ga0265331_1000097218 158
845 3300031251 Ga0265327_10003882 Ga0265327_100038829 158
846 3300031344 Ga0265316_10086543 Ga0265316_100865432 158
847 3300031712 Ga0265342_10005713 Ga0265342_100057133 158
848 3300031901 Ga0307406_10061367 Ga0307406_100613673 158
849 3300034818 Ga0373950_0050516 Ga0373950_0050516_101_577 158
850 3300035114 Ga0373939_0194589 Ga0373939_0194589_246_725 158
851 3300035171 Ga0373946_0066304 Ga0373946_0066304_631_1107 158
852 3300038443 Ga0395901_0706468 Ga0395901_0706468_368_886 158
853 3300046459 Ga0495629_0101132 Ga0495629_0101132_1369_1863 158
854 3300046537 Ga0495598_0082323 Ga0495598_0082323_106_582 158
855 3300046539 Ga0495621_0012018 Ga0495621_0012018_2034_2510 158
856 3300048903 Ga0496100_0095140 Ga0496100_0095140_464_940 158
857 3300048904 Ga0496101_0223571 Ga0496101_0223571_498_974 158
858 3300048905 Ga0496102_0254880 Ga0496102_0254880_725_1201 158
859 3300048907 Ga0496104_0042538 Ga0496104_0042538_700_1176 158
860 3300048908 Ga0496105_0003965 Ga0496105_0003965_428_904 158
861 3300048909 Ga0496106_1017183 Ga0496106_1017183_147_629 158
862 3300048910 Ga0496107_0067797 Ga0496107_0067797_1037_1513 158
863 3300048911 Ga0496108_0004799 Ga0496108_0004799_8752_9228 158
864 3300048912 Ga0496109_0005301 Ga0496109_0005301_6185_6661 158
865 3300048913 Ga0496110_0085364 Ga0496110_0085364_84_560 158
866 3300048913 Ga0496110_0441705 Ga0496110_0441705_624_1106 158
867 3300048915 Ga0496112_0575784 Ga0496112_0575784_138_614 158
868 3300048916 Ga0496113_0278327 Ga0496113_0278327_209_685 158
869 3300048917 Ga0496114_0034466 Ga0496114_0034466_618_1094 158
870 3300050507 nmdc:mga05p37_372262_c1 nmdc:mga05p37_372262_c1_215_697 158
871 3300050511 nmdc:mga08y16_571109_c1 nmdc:mga08y16_571109_c1_534_1010 158
872 3300050512 nmdc:mga0n895_825838_c1 nmdc:mga0n895_825838_c1_77_559 158
873 3300050513 nmdc:mga0rr50_125018_c1 nmdc:mga0rr50_125018_c1_1251_1733 158
874 3300053084 Ga0495595_0546880 Ga0495595_0546880_53_544 158
875 3300053085 Ga0495619_0442441 Ga0495619_0442441_295_789 158
876 3300053085 Ga0495619_0630544 Ga0495619_0630544_29_505 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

85

158

0.9

PF00190

Cupin_1

Cupin

79

177

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a55-assembly1.cif.gz_B crystal structure of dddk mutant y122a 0.913 46 124
2pyt-assembly1.cif.gz_B crystal structure of a putative ethanolamine utilization protein q (eutq, stm2468) from salmonella typhimurium lt2 at 1.90 a resolution 0.9095 46 124
7zyb-assembly1.cif.gz_A bekdgf with ca 0.9022 46 127
3nst-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans 0.8922 46 124
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.8867 41 126
ID Description Score Start End Superfamily
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9176 44 125 2.60.120.10
3nvcA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9098 46 124 2.60.120.10
af_Q2G2A6_62_177_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9038 46 126 2.60.120.10
af_Q59013_3_123_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9015 45 124 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8924 46 126 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7W1NSL9-F1-model_v4 Cupin domain-containing protein 0.9402 46 125
AF-A0A1T3NQY4-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9234 46 125
AF-A0A2E2VFP7-F1-model_v4 Cupin type-2 domain-containing protein 0.9231 46 124
AF-A0A6N8V5M9-F1-model_v4 Cupin domain-containing protein 0.923 46 124
AF-A0A327HQN2-F1-model_v4 Cupin 0.9225 46 124

Feature Viewer

pLDDT pTM Quality
68.44 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map