F484361
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 876 | 284 | 876 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0187687|Ga0451576_0187687_757_1335 |
| Length | 192 |
| Sequence | MAPAPGARARRVRRSADAIFESESLRRSDVSGREVDMATESKWRHHGVRVVRSDQLDTRTPQTPGMDRAAAITYARMGAESLWAGTVVIHPKAKTGAHHHGPVESVIYVVSGRARMKWGERLEFTAEAGPGDFIYVPPYVPHQEINASDSEPLSCVLCRSGKDPVVVNLDLPNVEPNPENVPWVDSIHPPPN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 197 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 200 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 231 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 232 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 233 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 234 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 235 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 248 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 257 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 258 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 259 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 260 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 270 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 271 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 272 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 273 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 281 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0.46 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.14 |
| Nodule | 0 |
| Rhizoplane | 4.57 |
| Rhizosphere | 93.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1039947 | 3300001976 | Bacteria | 627 |
| 2 | JGI24747J21853_1020088 | 3300001978 | Bacteria | 723 |
| 3 | JGI24743J22301_10012420 | 3300001991 | Bacteria | 1549 |
| 4 | JGI24750J21931_1041320 | 3300002070 | Bacteria | 701 |
| 5 | JGI24749J21850_1005279 | 3300002076 | Bacteria | 1813 |
| 6 | JGI24744J21845_10055969 | 3300002077 | Bacteria | 724 |
| 7 | Ga0058863_11718871 | 3300004799 | Bacteria | 1544 |
| 8 | Ga0058862_12751779 | 3300004803 | Bacteria | 747 |
| 9 | Ga0065715_10162694 | 3300005293 | Bacteria | 1614 |
| 10 | Ga0065715_10171170 | 3300005293 | Bacteria | 1546 |
| 11 | Ga0065715_10365467 | 3300005293 | Bacteria | 929 |
| 12 | Ga0070658_10017688 | 3300005327 | Bacteria | 5702 |
| 13 | Ga0070658_10018601 | 3300005327 | Bacteria | 5564 |
| 14 | Ga0070658_10036568 | 3300005327 | Bacteria | 3957 |
| 15 | Ga0070658_10110787 | 3300005327 | Bacteria | 2274 |
| 16 | Ga0070658_10796618 | 3300005327 | Bacteria | 821 |
| 17 | Ga0070676_10000769 | 3300005328 | Bacteria | 15777 |
| 18 | Ga0070676_10005593 | 3300005328 | Bacteria | 6694 |
| 19 | Ga0070676_10032653 | 3300005328 | Bacteria | 2983 |
| 20 | Ga0070676_10283966 | 3300005328 | Bacteria | 1116 |
| 21 | Ga0070676_10744773 | 3300005328 | Bacteria | 719 |
| 22 | Ga0070683_100019402 | 3300005329 | Bacteria | 6038 |
| 23 | Ga0070683_100058588 | 3300005329 | Bacteria | 3577 |
| 24 | Ga0070683_100129952 | 3300005329 | Bacteria | 2383 |
| 25 | Ga0070690_100009005 | 3300005330 | Bacteria | 5771 |
| 26 | Ga0070670_100000274 | 3300005331 | Bacteria | 45804 |
| 27 | Ga0070670_100021437 | 3300005331 | Bacteria | 5559 |
| 28 | Ga0070670_100052188 | 3300005331 | Bacteria | 3512 |
| 29 | Ga0070670_100097188 | 3300005331 | Bacteria | 2533 |
| 30 | Ga0070670_100138970 | 3300005331 | Bacteria | 2100 |
| 31 | Ga0070670_101327314 | 3300005331 | Bacteria | 659 |
| 32 | Ga0070670_101686592 | 3300005331 | Bacteria | 583 |
| 33 | Ga0070677_10000132 | 3300005333 | Bacteria | 24789 |
| 34 | Ga0070677_10009216 | 3300005333 | Bacteria | 3344 |
| 35 | Ga0070677_10135884 | 3300005333 | Bacteria | 1128 |
| 36 | Ga0070677_10192830 | 3300005333 | Bacteria | 978 |
| 37 | Ga0070677_10429711 | 3300005333 | Bacteria | 702 |
| 38 | Ga0068869_100001694 | 3300005334 | Bacteria | 13168 |
| 39 | Ga0068869_100007694 | 3300005334 | Bacteria | 6902 |
| 40 | Ga0068869_100208930 | 3300005334 | Bacteria | 1542 |
| 41 | Ga0070666_10006650 | 3300005335 | Bacteria | 7108 |
| 42 | Ga0070666_10007688 | 3300005335 | Bacteria | 6654 |
| 43 | Ga0070666_10094719 | 3300005335 | Bacteria | 2054 |
| 44 | Ga0070666_10290317 | 3300005335 | Bacteria | 1163 |
| 45 | Ga0070666_10410922 | 3300005335 | Bacteria | 974 |
| 46 | Ga0070680_100109620 | 3300005336 | Bacteria | 2297 |
| 47 | Ga0070680_100238453 | 3300005336 | Bacteria | 1537 |
| 48 | Ga0070680_100376219 | 3300005336 | Bacteria | 1209 |
| 49 | Ga0070680_100616184 | 3300005336 | Bacteria | 932 |
| 50 | Ga0070682_100899525 | 3300005337 | Bacteria | 727 |
| 51 | Ga0068868_100005576 | 3300005338 | Bacteria | 8850 |
| 52 | Ga0068868_100028710 | 3300005338 | Bacteria | 4256 |
| 53 | Ga0068868_100045229 | 3300005338 | Bacteria | 3444 |
| 54 | Ga0068868_101232518 | 3300005338 | Bacteria | 693 |
| 55 | Ga0068868_101393863 | 3300005338 | Bacteria | 653 |
| 56 | Ga0070660_100004956 | 3300005339 | Bacteria | 9207 |
| 57 | Ga0070660_100018533 | 3300005339 | Bacteria | 5088 |
| 58 | Ga0070660_100602224 | 3300005339 | Bacteria | 919 |
| 59 | Ga0070689_100008003 | 3300005340 | Bacteria | 7418 |
| 60 | Ga0070689_100033049 | 3300005340 | Bacteria | 3939 |
| 61 | Ga0070661_100004644 | 3300005344 | Bacteria | 9458 |
| 62 | Ga0070661_100010175 | 3300005344 | Bacteria | 6534 |
| 63 | Ga0070661_100027132 | 3300005344 | Bacteria | 4122 |
| 64 | Ga0070661_100055801 | 3300005344 | Bacteria | 2892 |
| 65 | Ga0070661_100135124 | 3300005344 | Bacteria | 1855 |
| 66 | Ga0070661_100161595 | 3300005344 | Bacteria | 1697 |
| 67 | Ga0070661_100173153 | 3300005344 | Bacteria | 1640 |
| 68 | Ga0070661_100248233 | 3300005344 | Bacteria | 1373 |
| 69 | Ga0070692_10037400 | 3300005345 | Bacteria | 2468 |
| 70 | Ga0070668_100000394 | 3300005347 | Bacteria | 29015 |
| 71 | Ga0070668_100007010 | 3300005347 | Bacteria | 8351 |
| 72 | Ga0070668_100011160 | 3300005347 | Bacteria | 6688 |
| 73 | Ga0070668_100016216 | 3300005347 | Bacteria | 5573 |
| 74 | Ga0070668_100065340 | 3300005347 | Bacteria | 2822 |
| 75 | Ga0070668_100359662 | 3300005347 | Bacteria | 1234 |
| 76 | Ga0070668_100559299 | 3300005347 | Bacteria | 996 |
| 77 | Ga0070668_101249069 | 3300005347 | Bacteria | 674 |
| 78 | Ga0070669_100005562 | 3300005353 | Bacteria | 9102 |
| 79 | Ga0070669_100006708 | 3300005353 | Bacteria | 8287 |
| 80 | Ga0070669_100050895 | 3300005353 | Bacteria | 3026 |
| 81 | Ga0070669_100052789 | 3300005353 | Bacteria | 2975 |
| 82 | Ga0070669_100097767 | 3300005353 | Bacteria | 2210 |
| 83 | Ga0070669_100098531 | 3300005353 | Bacteria | 2202 |
| 84 | Ga0070669_100110841 | 3300005353 | Bacteria | 2082 |
| 85 | Ga0070669_100203979 | 3300005353 | Bacteria | 1557 |
| 86 | Ga0070669_100667379 | 3300005353 | Bacteria | 876 |
| 87 | Ga0070669_100844652 | 3300005353 | Bacteria | 780 |
| 88 | Ga0070675_100008918 | 3300005354 | Bacteria | 7792 |
| 89 | Ga0070675_100008929 | 3300005354 | Bacteria | 7786 |
| 90 | Ga0070675_100032421 | 3300005354 | Bacteria | 4228 |
| 91 | Ga0070675_100094815 | 3300005354 | Bacteria | 2505 |
| 92 | Ga0070675_100317873 | 3300005354 | Bacteria | 1375 |
| 93 | Ga0070675_100332358 | 3300005354 | Bacteria | 1344 |
| 94 | Ga0070675_100392373 | 3300005354 | Bacteria | 1237 |
| 95 | Ga0070671_100013129 | 3300005355 | Bacteria | 6674 |
| 96 | Ga0070671_100079129 | 3300005355 | Bacteria | 2747 |
| 97 | Ga0070671_100206170 | 3300005355 | Bacteria | 1667 |
| 98 | Ga0070671_100383170 | 3300005355 | Bacteria | 1202 |
| 99 | Ga0070671_100472906 | 3300005355 | Bacteria | 1076 |
| 100 | Ga0070674_100001114 | 3300005356 | Bacteria | 14095 |
| 101 | Ga0070674_100036339 | 3300005356 | Bacteria | 3306 |
| 102 | Ga0070674_100069827 | 3300005356 | Bacteria | 2479 |
| 103 | Ga0070674_100120733 | 3300005356 | Unclassified | 1940 |
| 104 | Ga0070674_100398011 | 3300005356 | Bacteria | 1124 |
| 105 | Ga0070673_100002042 | 3300005364 | Bacteria | 12186 |
| 106 | Ga0070673_100020047 | 3300005364 | Bacteria | 4815 |
| 107 | Ga0070673_100074203 | 3300005364 | Bacteria | 2741 |
| 108 | Ga0070673_100091659 | 3300005364 | Bacteria | 2485 |
| 109 | Ga0070673_100133514 | 3300005364 | Bacteria | 2086 |
| 110 | Ga0070673_100163834 | 3300005364 | Bacteria | 1893 |
| 111 | Ga0070673_100226902 | 3300005364 | Bacteria | 1619 |
| 112 | Ga0070688_100003905 | 3300005365 | Bacteria | 7733 |
| 113 | Ga0070659_100006210 | 3300005366 | Bacteria | 8630 |
| 114 | Ga0070659_100064486 | 3300005366 | Bacteria | 2899 |
| 115 | Ga0070659_100067006 | 3300005366 | Bacteria | 2846 |
| 116 | Ga0070659_100071001 | 3300005366 | Bacteria | 2768 |
| 117 | Ga0070659_100589158 | 3300005366 | Bacteria | 955 |
| 118 | Ga0070667_100002746 | 3300005367 | Bacteria | 15229 |
| 119 | Ga0070667_100010007 | 3300005367 | Bacteria | 7858 |
| 120 | Ga0070667_100021181 | 3300005367 | Bacteria | 5401 |
| 121 | Ga0070667_100127045 | 3300005367 | Bacteria | 2222 |
| 122 | Ga0070667_100156797 | 3300005367 | Bacteria | 2003 |
| 123 | Ga0070667_100213734 | 3300005367 | Bacteria | 1715 |
| 124 | Ga0070667_100248565 | 3300005367 | Bacteria | 1590 |
| 125 | Ga0070667_100422096 | 3300005367 | Bacteria | 1216 |
| 126 | Ga0070667_101109627 | 3300005367 | Bacteria | 739 |
| 127 | Ga0070667_101129898 | 3300005367 | Bacteria | 733 |
| 128 | Ga0070714_100033301 | 3300005435 | Bacteria | 4307 |
| 129 | Ga0070714_100062644 | 3300005435 | Bacteria | 3197 |
| 130 | Ga0070714_100109749 | 3300005435 | Bacteria | 2441 |
| 131 | Ga0070713_100012321 | 3300005436 | Bacteria | 6267 |
| 132 | Ga0070710_10007894 | 3300005437 | Bacteria | 5169 |
| 133 | Ga0070710_10218269 | 3300005437 | Bacteria | 1212 |
| 134 | Ga0070701_10066184 | 3300005438 | Bacteria | 1920 |
| 135 | Ga0070711_100105943 | 3300005439 | Bacteria | 2054 |
| 136 | Ga0070711_100691827 | 3300005439 | Bacteria | 858 |
| 137 | Ga0070711_100720342 | 3300005439 | Bacteria | 841 |
| 138 | Ga0070711_100928130 | 3300005439 | Bacteria | 744 |
| 139 | Ga0070700_100021916 | 3300005441 | Bacteria | 3719 |
| 140 | Ga0070700_100204956 | 3300005441 | Bacteria | 1388 |
| 141 | Ga0070700_100625458 | 3300005441 | Bacteria | 847 |
| 142 | Ga0070694_100682336 | 3300005444 | Bacteria | 834 |
| 143 | Ga0070663_100010255 | 3300005455 | Bacteria | 5836 |
| 144 | Ga0070663_100019255 | 3300005455 | Bacteria | 4494 |
| 145 | Ga0070663_100043787 | 3300005455 | Bacteria | 3152 |
| 146 | Ga0070663_100076206 | 3300005455 | Bacteria | 2452 |
| 147 | Ga0070663_100190761 | 3300005455 | Bacteria | 1595 |
| 148 | Ga0070678_100000982 | 3300005456 | Bacteria | 14738 |
| 149 | Ga0070678_100001348 | 3300005456 | Bacteria | 13061 |
| 150 | Ga0070678_100085937 | 3300005456 | Bacteria | 2398 |
| 151 | Ga0070678_100299571 | 3300005456 | Bacteria | 1366 |
| 152 | Ga0070662_100001081 | 3300005457 | Bacteria | 16613 |
| 153 | Ga0070662_100083792 | 3300005457 | Bacteria | 2380 |
| 154 | Ga0070662_100223556 | 3300005457 | Bacteria | 1503 |
| 155 | Ga0070662_100259751 | 3300005457 | Bacteria | 1399 |
| 156 | Ga0070681_10001160 | 3300005458 | Bacteria | 22748 |
| 157 | Ga0070681_10939589 | 3300005458 | Bacteria | 784 |
| 158 | Ga0070681_11030478 | 3300005458 | Bacteria | 743 |
| 159 | Ga0068867_100003590 | 3300005459 | Bacteria | 10912 |
| 160 | Ga0068867_100009061 | 3300005459 | Bacteria | 7021 |
| 161 | Ga0068867_100010823 | 3300005459 | Bacteria | 6434 |
| 162 | Ga0068867_100019400 | 3300005459 | Bacteria | 4846 |
| 163 | Ga0068867_100077601 | 3300005459 | Bacteria | 2496 |
| 164 | Ga0068867_100384660 | 3300005459 | Bacteria | 1179 |
| 165 | Ga0068867_100501068 | 3300005459 | Bacteria | 1044 |
| 166 | Ga0070685_10002380 | 3300005466 | Bacteria | 9680 |
| 167 | Ga0070706_100281817 | 3300005467 | Bacteria | 1551 |
| 168 | Ga0070706_101135846 | 3300005467 | Bacteria | 719 |
| 169 | Ga0070698_100772739 | 3300005471 | Bacteria | 904 |
| 170 | Ga0070698_101251665 | 3300005471 | Bacteria | 692 |
| 171 | Ga0070699_100093099 | 3300005518 | Bacteria | 2637 |
| 172 | Ga0070679_100019147 | 3300005530 | Bacteria | 6651 |
| 173 | Ga0070679_100178590 | 3300005530 | Bacteria | 2096 |
| 174 | Ga0070679_100696648 | 3300005530 | Bacteria | 958 |
| 175 | Ga0070684_100040000 | 3300005535 | Bacteria | 4034 |
| 176 | Ga0070684_100043995 | 3300005535 | Bacteria | 3860 |
| 177 | Ga0070684_100093491 | 3300005535 | Bacteria | 2677 |
| 178 | Ga0070684_100499945 | 3300005535 | Bacteria | 1126 |
| 179 | Ga0068853_100002757 | 3300005539 | Bacteria | 13266 |
| 180 | Ga0068853_100056192 | 3300005539 | Bacteria | 3393 |
| 181 | Ga0068853_100074913 | 3300005539 | Bacteria | 2953 |
| 182 | Ga0068853_100366468 | 3300005539 | Bacteria | 1343 |
| 183 | Ga0068853_100542898 | 3300005539 | Bacteria | 1101 |
| 184 | Ga0068853_101410792 | 3300005539 | Bacteria | 674 |
| 185 | Ga0068853_101952992 | 3300005539 | Bacteria | 569 |
| 186 | Ga0070672_100000914 | 3300005543 | Bacteria | 17688 |
| 187 | Ga0070672_100007295 | 3300005543 | Bacteria | 7493 |
| 188 | Ga0070672_100012306 | 3300005543 | Bacteria | 6000 |
| 189 | Ga0070672_100022564 | 3300005543 | Bacteria | 4626 |
| 190 | Ga0070672_100042554 | 3300005543 | Bacteria | 3498 |
| 191 | Ga0070672_100075834 | 3300005543 | Bacteria | 2685 |
| 192 | Ga0070672_100105320 | 3300005543 | Bacteria | 2293 |
| 193 | Ga0070672_100228126 | 3300005543 | Bacteria | 1564 |
| 194 | Ga0070672_101066203 | 3300005543 | Bacteria | 717 |
| 195 | Ga0070686_100085731 | 3300005544 | Bacteria | 2095 |
| 196 | Ga0070696_100004065 | 3300005546 | Bacteria | 9755 |
| 197 | Ga0070693_100691402 | 3300005547 | Bacteria | 746 |
| 198 | Ga0070665_100002542 | 3300005548 | Bacteria | 20041 |
| 199 | Ga0070665_100012901 | 3300005548 | Bacteria | 8416 |
| 200 | Ga0070665_100121697 | 3300005548 | Bacteria | 2611 |
| 201 | Ga0070665_100305035 | 3300005548 | Bacteria | 1595 |
| 202 | Ga0070665_100578305 | 3300005548 | Bacteria | 1136 |
| 203 | Ga0070665_100637102 | 3300005548 | Bacteria | 1079 |
| 204 | Ga0070665_101173044 | 3300005548 | Bacteria | 779 |
| 205 | Ga0068855_100003908 | 3300005563 | Bacteria | 18194 |
| 206 | Ga0068855_100019019 | 3300005563 | Bacteria | 8257 |
| 207 | Ga0068855_100040144 | 3300005563 | Bacteria | 5556 |
| 208 | Ga0068855_100057251 | 3300005563 | Bacteria | 4570 |
| 209 | Ga0068855_100453030 | 3300005563 | Bacteria | 1400 |
| 210 | Ga0070664_100002998 | 3300005564 | Bacteria | 13657 |
| 211 | Ga0070664_100013440 | 3300005564 | Bacteria | 6666 |
| 212 | Ga0070664_100083468 | 3300005564 | Bacteria | 2756 |
| 213 | Ga0070664_100084498 | 3300005564 | Bacteria | 2740 |
| 214 | Ga0070664_100094788 | 3300005564 | Bacteria | 2588 |
| 215 | Ga0070664_100345226 | 3300005564 | Bacteria | 1353 |
| 216 | Ga0070664_101033582 | 3300005564 | Bacteria | 773 |
| 217 | Ga0070664_101553058 | 3300005564 | Bacteria | 627 |
| 218 | Ga0068857_100008373 | 3300005577 | Bacteria | 8937 |
| 219 | Ga0068857_100010671 | 3300005577 | Bacteria | 7991 |
| 220 | Ga0068857_100065029 | 3300005577 | Bacteria | 3243 |
| 221 | Ga0068857_100399942 | 3300005577 | Bacteria | 1278 |
| 222 | Ga0068854_100002321 | 3300005578 | Bacteria | 11730 |
| 223 | Ga0068854_100055101 | 3300005578 | Bacteria | 2861 |
| 224 | Ga0068854_100115025 | 3300005578 | Bacteria | 2035 |
| 225 | Ga0068854_100163739 | 3300005578 | Bacteria | 1725 |
| 226 | Ga0068854_100196971 | 3300005578 | Bacteria | 1581 |
| 227 | Ga0068854_100322409 | 3300005578 | Bacteria | 1256 |
| 228 | Ga0068856_100001379 | 3300005614 | Bacteria | 25540 |
| 229 | Ga0068856_100022222 | 3300005614 | Bacteria | 6167 |
| 230 | Ga0068856_100365263 | 3300005614 | Bacteria | 1462 |
| 231 | Ga0068856_101572557 | 3300005614 | Bacteria | 671 |
| 232 | Ga0070702_100133372 | 3300005615 | Bacteria | 1572 |
| 233 | Ga0068852_100002000 | 3300005616 | Bacteria | 13901 |
| 234 | Ga0068852_100002691 | 3300005616 | Bacteria | 12273 |
| 235 | Ga0068852_100024896 | 3300005616 | Bacteria | 4843 |
| 236 | Ga0068852_100067303 | 3300005616 | Bacteria | 3131 |
| 237 | Ga0068852_100088668 | 3300005616 | Bacteria | 2763 |
| 238 | Ga0068852_100138091 | 3300005616 | Bacteria | 2253 |
| 239 | Ga0068852_100213207 | 3300005616 | Bacteria | 1833 |
| 240 | Ga0068852_100328423 | 3300005616 | Bacteria | 1487 |
| 241 | Ga0068859_100006523 | 3300005617 | Bacteria | 11850 |
| 242 | Ga0068859_100084366 | 3300005617 | Bacteria | 3222 |
| 243 | Ga0068859_100243236 | 3300005617 | Bacteria | 1889 |
| 244 | Ga0068859_100824334 | 3300005617 | Bacteria | 1014 |
| 245 | Ga0068864_100005598 | 3300005618 | Bacteria | 10299 |
| 246 | Ga0068864_100007903 | 3300005618 | Bacteria | 8763 |
| 247 | Ga0068864_100009458 | 3300005618 | Bacteria | 8043 |
| 248 | Ga0068864_100009678 | 3300005618 | Bacteria | 7951 |
| 249 | Ga0068864_100018419 | 3300005618 | Bacteria | 5834 |
| 250 | Ga0068864_100310185 | 3300005618 | Bacteria | 1479 |
| 251 | Ga0068864_100807004 | 3300005618 | Bacteria | 922 |
| 252 | Ga0068866_10057543 | 3300005718 | Bacteria | 2004 |
| 253 | Ga0068866_10063584 | 3300005718 | Bacteria | 1924 |
| 254 | Ga0068866_10195641 | 3300005718 | Bacteria | 1204 |
| 255 | Ga0068861_100001362 | 3300005719 | Bacteria | 15368 |
| 256 | Ga0068861_100001763 | 3300005719 | Bacteria | 13905 |
| 257 | Ga0068861_100012929 | 3300005719 | Bacteria | 5828 |
| 258 | Ga0068861_100052360 | 3300005719 | Bacteria | 3102 |
| 259 | Ga0068861_100235924 | 3300005719 | Bacteria | 1553 |
| 260 | Ga0068861_100261518 | 3300005719 | Bacteria | 1482 |
| 261 | Ga0068861_100751837 | 3300005719 | Bacteria | 911 |
| 262 | Ga0068851_10007676 | 3300005834 | Bacteria | 4962 |
| 263 | Ga0068851_10010234 | 3300005834 | Bacteria | 4374 |
| 264 | Ga0068851_10026215 | 3300005834 | Bacteria | 2863 |
| 265 | Ga0068851_10028777 | 3300005834 | Bacteria | 2746 |
| 266 | Ga0068851_10078842 | 3300005834 | Bacteria | 1716 |
| 267 | Ga0068851_10387280 | 3300005834 | Bacteria | 820 |
| 268 | Ga0068851_10489637 | 3300005834 | Bacteria | 736 |
| 269 | Ga0068870_10017237 | 3300005840 | Bacteria | 3467 |
| 270 | Ga0068870_10027358 | 3300005840 | Bacteria | 2851 |
| 271 | Ga0068863_100002100 | 3300005841 | Bacteria | 19742 |
| 272 | Ga0068863_100013029 | 3300005841 | Bacteria | 8018 |
| 273 | Ga0068863_100026961 | 3300005841 | Bacteria | 5479 |
| 274 | Ga0068863_100087053 | 3300005841 | Bacteria | 2960 |
| 275 | Ga0068863_100195704 | 3300005841 | Bacteria | 1943 |
| 276 | Ga0068863_100264682 | 3300005841 | Bacteria | 1663 |
| 277 | Ga0068858_100000612 | 3300005842 | Bacteria | 37346 |
| 278 | Ga0068858_100055030 | 3300005842 | Bacteria | 3678 |
| 279 | Ga0068858_100097393 | 3300005842 | Bacteria | 2742 |
| 280 | Ga0068858_100150477 | 3300005842 | Bacteria | 2188 |
| 281 | Ga0068858_100507461 | 3300005842 | Bacteria | 1165 |
| 282 | Ga0068860_100011838 | 3300005843 | Bacteria | 8598 |
| 283 | Ga0068860_100023346 | 3300005843 | Bacteria | 5978 |
| 284 | Ga0068860_100044277 | 3300005843 | Bacteria | 4242 |
| 285 | Ga0068860_100065973 | 3300005843 | Bacteria | 3437 |
| 286 | Ga0068860_100200958 | 3300005843 | Bacteria | 1931 |
| 287 | Ga0068860_101109312 | 3300005843 | Bacteria | 811 |
| 288 | Ga0068860_101391817 | 3300005843 | Bacteria | 723 |
| 289 | Ga0068862_100002076 | 3300005844 | Bacteria | 18077 |
| 290 | Ga0068862_100013014 | 3300005844 | Bacteria | 6880 |
| 291 | Ga0068862_100043495 | 3300005844 | Bacteria | 3830 |
| 292 | Ga0068862_100088427 | 3300005844 | Bacteria | 2695 |
| 293 | Ga0068862_100092127 | 3300005844 | Bacteria | 2641 |
| 294 | Ga0068862_102264194 | 3300005844 | Bacteria | 555 |
| 295 | Ga0081455_10317106 | 3300005937 | Bacteria | 1112 |
| 296 | Ga0075363_100230016 | 3300006048 | Bacteria | 1064 |
| 297 | Ga0075364_10000494 | 3300006051 | Bacteria | 20067 |
| 298 | Ga0075362_10242392 | 3300006177 | Bacteria | 885 |
| 299 | Ga0075367_10046720 | 3300006178 | Bacteria | 2545 |
| 300 | Ga0075369_10000250 | 3300006186 | Bacteria | 15991 |
| 301 | Ga0097621_100079081 | 3300006237 | Bacteria | 2733 |
| 302 | Ga0097621_100099569 | 3300006237 | Bacteria | 2443 |
| 303 | Ga0097621_100225486 | 3300006237 | Bacteria | 1634 |
| 304 | Ga0068871_100003825 | 3300006358 | Bacteria | 10375 |
| 305 | Ga0068871_100118990 | 3300006358 | Bacteria | 2229 |
| 306 | Ga0068871_100213997 | 3300006358 | Bacteria | 1668 |
| 307 | Ga0068871_100473592 | 3300006358 | Bacteria | 1125 |
| 308 | Ga0068871_101040792 | 3300006358 | Bacteria | 764 |
| 309 | Ga0068871_101311839 | 3300006358 | Bacteria | 681 |
| 310 | Ga0075428_100103504 | 3300006844 | Bacteria | 3104 |
| 311 | Ga0075428_100160557 | 3300006844 | Bacteria | 2440 |
| 312 | Ga0075428_100347659 | 3300006844 | Bacteria | 1592 |
| 313 | Ga0075428_100586531 | 3300006844 | Bacteria | 1191 |
| 314 | Ga0075430_100020888 | 3300006846 | Bacteria | 5567 |
| 315 | Ga0075431_100159632 | 3300006847 | Bacteria | 2319 |
| 316 | Ga0075434_100070066 | 3300006871 | Bacteria | 3497 |
| 317 | Ga0075434_100184957 | 3300006871 | Bacteria | 2104 |
| 318 | Ga0075434_100651911 | 3300006871 | Bacteria | 1071 |
| 319 | Ga0068865_100023951 | 3300006881 | Bacteria | 4001 |
| 320 | Ga0068865_100127465 | 3300006881 | Bacteria | 1902 |
| 321 | Ga0068865_100128349 | 3300006881 | Bacteria | 1896 |
| 322 | Ga0068865_100411915 | 3300006881 | Bacteria | 1109 |
| 323 | Ga0075436_100529516 | 3300006914 | Bacteria | 864 |
| 324 | Ga0075436_100706649 | 3300006914 | Bacteria | 747 |
| 325 | Ga0097620_100006521 | 3300006931 | Bacteria | 11850 |
| 326 | Ga0097620_100084360 | 3300006931 | Bacteria | 3222 |
| 327 | Ga0097620_100243229 | 3300006931 | Bacteria | 1889 |
| 328 | Ga0097620_100824340 | 3300006931 | Bacteria | 1014 |
| 329 | Ga0075435_100379716 | 3300007076 | Bacteria | 1214 |
| 330 | Ga0075435_100446474 | 3300007076 | Bacteria | 1115 |
| 331 | Ga0075435_101082020 | 3300007076 | Bacteria | 701 |
| 332 | Ga0105250_10027260 | 3300009092 | Bacteria | 2302 |
| 333 | Ga0105240_10102436 | 3300009093 | Bacteria | 3479 |
| 334 | Ga0105240_10166930 | 3300009093 | Bacteria | 2610 |
| 335 | Ga0105240_10522447 | 3300009093 | Bacteria | 1317 |
| 336 | Ga0111539_10053252 | 3300009094 | Bacteria | 4817 |
| 337 | Ga0111539_10183588 | 3300009094 | Bacteria | 2443 |
| 338 | Ga0111539_11341682 | 3300009094 | Bacteria | 830 |
| 339 | Ga0111539_11399555 | 3300009094 | Bacteria | 811 |
| 340 | Ga0105245_10200008 | 3300009098 | Bacteria | 1918 |
| 341 | Ga0105245_10470611 | 3300009098 | Bacteria | 1268 |
| 342 | Ga0105247_10010766 | 3300009101 | Bacteria | 5525 |
| 343 | Ga0114129_10354316 | 3300009147 | Bacteria | 1943 |
| 344 | Ga0114129_10480688 | 3300009147 | Bacteria | 1625 |
| 345 | Ga0105243_10118295 | 3300009148 | Bacteria | 2229 |
| 346 | Ga0105243_10321304 | 3300009148 | Bacteria | 1411 |
| 347 | Ga0105243_10336876 | 3300009148 | Bacteria | 1380 |
| 348 | Ga0105241_10121350 | 3300009174 | Bacteria | 2105 |
| 349 | Ga0105241_10143629 | 3300009174 | Bacteria | 1946 |
| 350 | Ga0105241_11041971 | 3300009174 | Bacteria | 767 |
| 351 | Ga0105242_10428620 | 3300009176 | Bacteria | 1241 |
| 352 | Ga0105248_10015240 | 3300009177 | Bacteria | 8473 |
| 353 | Ga0105248_10025258 | 3300009177 | Bacteria | 6606 |
| 354 | Ga0105248_10072760 | 3300009177 | Bacteria | 3863 |
| 355 | Ga0105248_10147483 | 3300009177 | Bacteria | 2655 |
| 356 | Ga0105248_10397237 | 3300009177 | Bacteria | 1552 |
| 357 | Ga0105248_10657051 | 3300009177 | Bacteria | 1183 |
| 358 | Ga0105248_10834945 | 3300009177 | Bacteria | 1040 |
| 359 | Ga0105237_10173559 | 3300009545 | Bacteria | 2156 |
| 360 | Ga0105237_10183286 | 3300009545 | Bacteria | 2094 |
| 361 | Ga0105238_10075696 | 3300009551 | Bacteria | 3357 |
| 362 | Ga0105238_10412946 | 3300009551 | Bacteria | 1344 |
| 363 | Ga0105238_10626678 | 3300009551 | Bacteria | 1085 |
| 364 | Ga0105238_10628665 | 3300009551 | Bacteria | 1083 |
| 365 | Ga0105249_10020425 | 3300009553 | Bacteria | 5922 |
| 366 | Ga0105249_10074146 | 3300009553 | Bacteria | 3149 |
| 367 | Ga0105249_10128452 | 3300009553 | Bacteria | 2417 |
| 368 | Ga0105249_10464426 | 3300009553 | Bacteria | 1306 |
| 369 | Ga0105249_10855570 | 3300009553 | Bacteria | 975 |
| 370 | Ga0105239_10082015 | 3300010375 | Bacteria | 3550 |
| 371 | Ga0105239_10981235 | 3300010375 | Bacteria | 971 |
| 372 | Ga0105246_10329619 | 3300011119 | Bacteria | 1244 |
| 373 | Ga0157373_10001932 | 3300013100 | Bacteria | 15747 |
| 374 | Ga0157373_10337764 | 3300013100 | Bacteria | 1073 |
| 375 | Ga0157371_10000303 | 3300013102 | Bacteria | 64643 |
| 376 | Ga0157371_10043784 | 3300013102 | Bacteria | 3188 |
| 377 | Ga0157371_10096730 | 3300013102 | Bacteria | 2092 |
| 378 | Ga0157370_10011858 | 3300013104 | Bacteria | 9092 |
| 379 | Ga0157370_10108577 | 3300013104 | Bacteria | 2594 |
| 380 | Ga0157370_10183907 | 3300013104 | Bacteria | 1941 |
| 381 | Ga0157369_10135579 | 3300013105 | Bacteria | 2607 |
| 382 | Ga0157369_10217825 | 3300013105 | Bacteria | 1999 |
| 383 | Ga0157369_10891388 | 3300013105 | Bacteria | 912 |
| 384 | Ga0157369_12357950 | 3300013105 | Bacteria | 539 |
| 385 | Ga0157374_10063682 | 3300013296 | Bacteria | 3459 |
| 386 | Ga0157374_10103382 | 3300013296 | Bacteria | 2733 |
| 387 | Ga0157374_10142988 | 3300013296 | Bacteria | 2323 |
| 388 | Ga0157374_10361450 | 3300013296 | Bacteria | 1444 |
| 389 | Ga0157374_10554585 | 3300013296 | Bacteria | 1157 |
| 390 | Ga0157374_11116787 | 3300013296 | Bacteria | 809 |
| 391 | Ga0157378_10004675 | 3300013297 | Bacteria | 12013 |
| 392 | Ga0157378_10090675 | 3300013297 | Bacteria | 2778 |
| 393 | Ga0157378_10436705 | 3300013297 | Bacteria | 1297 |
| 394 | Ga0157378_10718677 | 3300013297 | Bacteria | 1020 |
| 395 | Ga0157378_10754127 | 3300013297 | Bacteria | 996 |
| 396 | Ga0163162_10078494 | 3300013306 | Bacteria | 3367 |
| 397 | Ga0163162_10089116 | 3300013306 | Bacteria | 3165 |
| 398 | Ga0163162_10431489 | 3300013306 | Bacteria | 1450 |
| 399 | Ga0163162_10736234 | 3300013306 | Bacteria | 1106 |
| 400 | Ga0163162_12199454 | 3300013306 | Bacteria | 633 |
| 401 | Ga0157372_10001717 | 3300013307 | Bacteria | 23775 |
| 402 | Ga0157372_10002828 | 3300013307 | Bacteria | 18755 |
| 403 | Ga0157372_10007943 | 3300013307 | Bacteria | 11276 |
| 404 | Ga0157372_10011850 | 3300013307 | Bacteria | 9287 |
| 405 | Ga0157372_10049411 | 3300013307 | Bacteria | 4677 |
| 406 | Ga0157372_10148713 | 3300013307 | Bacteria | 2702 |
| 407 | Ga0157372_10310060 | 3300013307 | Bacteria | 1837 |
| 408 | Ga0157375_10002602 | 3300013308 | Bacteria | 15664 |
| 409 | Ga0157375_10049121 | 3300013308 | Bacteria | 4132 |
| 410 | Ga0157375_10300981 | 3300013308 | Bacteria | 1767 |
| 411 | Ga0157375_10484297 | 3300013308 | Bacteria | 1402 |
| 412 | Ga0157375_10860866 | 3300013308 | Bacteria | 1052 |
| 413 | Ga0157375_10862526 | 3300013308 | Bacteria | 1051 |
| 414 | Ga0157375_10937588 | 3300013308 | Bacteria | 1008 |
| 415 | Ga0157375_11246719 | 3300013308 | Bacteria | 873 |
| 416 | Ga0163163_10001190 | 3300014325 | Bacteria | 22057 |
| 417 | Ga0163163_10010520 | 3300014325 | Bacteria | 8325 |
| 418 | Ga0163163_10025908 | 3300014325 | Bacteria | 5596 |
| 419 | Ga0163163_10029634 | 3300014325 | Bacteria | 5267 |
| 420 | Ga0163163_10575587 | 3300014325 | Bacteria | 1189 |
| 421 | Ga0163163_12136756 | 3300014325 | Bacteria | 619 |
| 422 | Ga0157380_10005687 | 3300014326 | Bacteria | 8720 |
| 423 | Ga0157380_10006810 | 3300014326 | Bacteria | 8075 |
| 424 | Ga0157380_10290053 | 3300014326 | Bacteria | 1502 |
| 425 | Ga0157380_10439444 | 3300014326 | Bacteria | 1250 |
| 426 | Ga0182008_10177367 | 3300014497 | Bacteria | 1077 |
| 427 | Ga0157377_10000871 | 3300014745 | Bacteria | 12560 |
| 428 | Ga0157377_10712551 | 3300014745 | Bacteria | 730 |
| 429 | Ga0157379_10000105 | 3300014968 | Bacteria | 57976 |
| 430 | Ga0157379_10005162 | 3300014968 | Bacteria | 11213 |
| 431 | Ga0157379_10008015 | 3300014968 | Bacteria | 9165 |
| 432 | Ga0157379_10058207 | 3300014968 | Bacteria | 3455 |
| 433 | Ga0157379_10378272 | 3300014968 | Bacteria | 1299 |
| 434 | Ga0157376_10003620 | 3300014969 | Bacteria | 10665 |
| 435 | Ga0157376_10087209 | 3300014969 | Bacteria | 2693 |
| 436 | Ga0157376_10237184 | 3300014969 | Bacteria | 1697 |
| 437 | Ga0157376_10427683 | 3300014969 | Bacteria | 1286 |
| 438 | Ga0157376_10500411 | 3300014969 | Bacteria | 1194 |
| 439 | Ga0163161_10019913 | 3300017792 | Bacteria | 4706 |
| 440 | Ga0163161_10023041 | 3300017792 | Bacteria | 4388 |
| 441 | Ga0163161_10545575 | 3300017792 | Bacteria | 950 |
| 442 | Ga0163161_10632561 | 3300017792 | Bacteria | 885 |
| 443 | Ga0163161_10728437 | 3300017792 | Bacteria | 828 |
| 444 | Ga0154015_1059651 | 3300020610 | Bacteria | 2744 |
| 445 | Ga0213876_10139857 | 3300021384 | Bacteria | 1287 |
| 446 | Ga0224712_10005960 | 3300022467 | Bacteria | 3439 |
| 447 | Ga0207697_10000471 | 3300025315 | Bacteria | 22740 |
| 448 | Ga0207697_10058323 | 3300025315 | Bacteria | 1603 |
| 449 | Ga0207656_10006239 | 3300025321 | Bacteria | 4271 |
| 450 | Ga0207656_10012737 | 3300025321 | Bacteria | 3202 |
| 451 | Ga0207656_10230369 | 3300025321 | Bacteria | 903 |
| 452 | Ga0207682_10000044 | 3300025893 | Bacteria | 51808 |
| 453 | Ga0207682_10001806 | 3300025893 | Bacteria | 9787 |
| 454 | Ga0207682_10073389 | 3300025893 | Bacteria | 1453 |
| 455 | Ga0207692_10004583 | 3300025898 | Bacteria | 5481 |
| 456 | Ga0207692_10710185 | 3300025898 | Bacteria | 653 |
| 457 | Ga0207642_10057585 | 3300025899 | Bacteria | 1789 |
| 458 | Ga0207642_10066733 | 3300025899 | Bacteria | 1696 |
| 459 | Ga0207642_10188137 | 3300025899 | Bacteria | 1131 |
| 460 | Ga0207710_10033039 | 3300025900 | Bacteria | 2268 |
| 461 | Ga0207688_10091693 | 3300025901 | Bacteria | 1745 |
| 462 | Ga0207688_10100088 | 3300025901 | Bacteria | 1673 |
| 463 | Ga0207680_10002742 | 3300025903 | Bacteria | 8238 |
| 464 | Ga0207680_10019059 | 3300025903 | Bacteria | 3663 |
| 465 | Ga0207680_10047447 | 3300025903 | Bacteria | 2545 |
| 466 | Ga0207680_10103464 | 3300025903 | Bacteria | 1834 |
| 467 | Ga0207699_10029083 | 3300025906 | Bacteria | 3078 |
| 468 | Ga0207645_10001325 | 3300025907 | Bacteria | 20333 |
| 469 | Ga0207645_10004314 | 3300025907 | Bacteria | 10544 |
| 470 | Ga0207645_10013037 | 3300025907 | Bacteria | 5616 |
| 471 | Ga0207645_10061294 | 3300025907 | Bacteria | 2402 |
| 472 | Ga0207645_10155820 | 3300025907 | Bacteria | 1492 |
| 473 | Ga0207645_10624679 | 3300025907 | Bacteria | 732 |
| 474 | Ga0207643_10000161 | 3300025908 | Bacteria | 46356 |
| 475 | Ga0207643_10016622 | 3300025908 | Bacteria | 4013 |
| 476 | Ga0207705_10158344 | 3300025909 | Bacteria | 1700 |
| 477 | Ga0207705_10159353 | 3300025909 | Bacteria | 1695 |
| 478 | Ga0207705_10517182 | 3300025909 | Bacteria | 927 |
| 479 | Ga0207705_10631640 | 3300025909 | Bacteria | 833 |
| 480 | Ga0207684_10413045 | 3300025910 | Bacteria | 1160 |
| 481 | Ga0207654_10438270 | 3300025911 | Bacteria | 914 |
| 482 | Ga0207707_10282532 | 3300025912 | Bacteria | 1437 |
| 483 | Ga0207707_10454226 | 3300025912 | Bacteria | 1096 |
| 484 | Ga0207707_10791781 | 3300025912 | Bacteria | 790 |
| 485 | Ga0207695_10041552 | 3300025913 | Bacteria | 4921 |
| 486 | Ga0207695_10043837 | 3300025913 | Bacteria | 4763 |
| 487 | Ga0207671_10507887 | 3300025914 | Bacteria | 961 |
| 488 | Ga0207663_10151028 | 3300025916 | Bacteria | 1629 |
| 489 | Ga0207663_11143859 | 3300025916 | Bacteria | 626 |
| 490 | Ga0207660_10321431 | 3300025917 | Bacteria | 1236 |
| 491 | Ga0207662_10070704 | 3300025918 | Bacteria | 2111 |
| 492 | Ga0207657_10001114 | 3300025919 | Bacteria | 28498 |
| 493 | Ga0207657_10019069 | 3300025919 | Bacteria | 6526 |
| 494 | Ga0207657_10023158 | 3300025919 | Bacteria | 5790 |
| 495 | Ga0207649_10003803 | 3300025920 | Bacteria | 8235 |
| 496 | Ga0207649_10011530 | 3300025920 | Bacteria | 4875 |
| 497 | Ga0207649_10056800 | 3300025920 | Bacteria | 2445 |
| 498 | Ga0207649_10094126 | 3300025920 | Bacteria | 1968 |
| 499 | Ga0207649_10203692 | 3300025920 | Bacteria | 1399 |
| 500 | Ga0207649_10239984 | 3300025920 | Bacteria | 1300 |
| 501 | Ga0207652_10009211 | 3300025921 | Bacteria | 7942 |
| 502 | Ga0207652_10026593 | 3300025921 | Bacteria | 4821 |
| 503 | Ga0207652_10066497 | 3300025921 | Bacteria | 3124 |
| 504 | Ga0207652_10444666 | 3300025921 | Bacteria | 1169 |
| 505 | Ga0207646_10786979 | 3300025922 | Bacteria | 848 |
| 506 | Ga0207681_10006193 | 3300025923 | Bacteria | 7340 |
| 507 | Ga0207681_10049513 | 3300025923 | Bacteria | 2840 |
| 508 | Ga0207681_10094130 | 3300025923 | Bacteria | 2146 |
| 509 | Ga0207681_10182954 | 3300025923 | Unclassified | 1598 |
| 510 | Ga0207681_10190649 | 3300025923 | Bacteria | 1568 |
| 511 | Ga0207681_10274609 | 3300025923 | Bacteria | 1324 |
| 512 | Ga0207694_10061823 | 3300025924 | Bacteria | 2915 |
| 513 | Ga0207694_10895945 | 3300025924 | Bacteria | 750 |
| 514 | Ga0207650_10001658 | 3300025925 | Bacteria | 15859 |
| 515 | Ga0207650_10006587 | 3300025925 | Bacteria | 7916 |
| 516 | Ga0207650_10057166 | 3300025925 | Bacteria | 2900 |
| 517 | Ga0207650_10060690 | 3300025925 | Bacteria | 2822 |
| 518 | Ga0207650_10113441 | 3300025925 | Bacteria | 2101 |
| 519 | Ga0207650_10238504 | 3300025925 | Bacteria | 1469 |
| 520 | Ga0207650_10331078 | 3300025925 | Bacteria | 1249 |
| 521 | Ga0207650_10640552 | 3300025925 | Bacteria | 895 |
| 522 | Ga0207659_10001994 | 3300025926 | Bacteria | 12084 |
| 523 | Ga0207659_10002849 | 3300025926 | Bacteria | 10309 |
| 524 | Ga0207659_10003224 | 3300025926 | Bacteria | 9757 |
| 525 | Ga0207659_10083486 | 3300025926 | Bacteria | 2368 |
| 526 | Ga0207659_10165217 | 3300025926 | Bacteria | 1741 |
| 527 | Ga0207659_10323128 | 3300025926 | Bacteria | 1273 |
| 528 | Ga0207687_10306653 | 3300025927 | Bacteria | 1280 |
| 529 | Ga0207700_10331872 | 3300025928 | Bacteria | 1320 |
| 530 | Ga0207700_11272342 | 3300025928 | Bacteria | 656 |
| 531 | Ga0207664_10024542 | 3300025929 | Bacteria | 4532 |
| 532 | Ga0207664_10036152 | 3300025929 | Bacteria | 3816 |
| 533 | Ga0207664_10327191 | 3300025929 | Bacteria | 1353 |
| 534 | Ga0207644_10004238 | 3300025931 | Bacteria | 9309 |
| 535 | Ga0207644_10045418 | 3300025931 | Bacteria | 3125 |
| 536 | Ga0207644_10121670 | 3300025931 | Bacteria | 1987 |
| 537 | Ga0207644_10699571 | 3300025931 | Bacteria | 845 |
| 538 | Ga0207644_10728657 | 3300025931 | Bacteria | 827 |
| 539 | Ga0207644_10754011 | 3300025931 | Bacteria | 813 |
| 540 | Ga0207690_10001868 | 3300025932 | Bacteria | 12937 |
| 541 | Ga0207690_10061917 | 3300025932 | Bacteria | 2545 |
| 542 | Ga0207690_10092030 | 3300025932 | Bacteria | 2145 |
| 543 | Ga0207690_11574561 | 3300025932 | Bacteria | 549 |
| 544 | Ga0207706_10000023 | 3300025933 | Bacteria | 153979 |
| 545 | Ga0207706_10050271 | 3300025933 | Bacteria | 3684 |
| 546 | Ga0207706_10112789 | 3300025933 | Bacteria | 2392 |
| 547 | Ga0207706_11095769 | 3300025933 | Bacteria | 666 |
| 548 | Ga0207709_10531951 | 3300025935 | Bacteria | 922 |
| 549 | Ga0207670_10386246 | 3300025936 | Bacteria | 1116 |
| 550 | Ga0207669_10005949 | 3300025937 | Bacteria | 5526 |
| 551 | Ga0207669_10016174 | 3300025937 | Bacteria | 3784 |
| 552 | Ga0207669_10025077 | 3300025937 | Bacteria | 3215 |
| 553 | Ga0207669_10058700 | 3300025937 | Bacteria | 2349 |
| 554 | Ga0207669_10889296 | 3300025937 | Bacteria | 743 |
| 555 | Ga0207704_10026968 | 3300025938 | Bacteria | 3160 |
| 556 | Ga0207704_10041359 | 3300025938 | Bacteria | 2702 |
| 557 | Ga0207704_10781205 | 3300025938 | Bacteria | 796 |
| 558 | Ga0207691_10000022 | 3300025940 | Bacteria | 132936 |
| 559 | Ga0207691_10000224 | 3300025940 | Bacteria | 55186 |
| 560 | Ga0207691_10009118 | 3300025940 | Bacteria | 9523 |
| 561 | Ga0207691_10032316 | 3300025940 | Bacteria | 4880 |
| 562 | Ga0207691_10059374 | 3300025940 | Bacteria | 3478 |
| 563 | Ga0207691_10067215 | 3300025940 | Bacteria | 3241 |
| 564 | Ga0207691_10358264 | 3300025940 | Bacteria | 1247 |
| 565 | Ga0207691_10451591 | 3300025940 | Bacteria | 1094 |
| 566 | Ga0207691_11104910 | 3300025940 | Bacteria | 659 |
| 567 | Ga0207711_10012405 | 3300025941 | Bacteria | 7085 |
| 568 | Ga0207711_10028404 | 3300025941 | Bacteria | 4707 |
| 569 | Ga0207711_10178994 | 3300025941 | Bacteria | 1927 |
| 570 | Ga0207711_10205488 | 3300025941 | Bacteria | 1798 |
| 571 | Ga0207711_10277556 | 3300025941 | Bacteria | 1543 |
| 572 | Ga0207711_10946343 | 3300025941 | Bacteria | 800 |
| 573 | Ga0207689_10000147 | 3300025942 | Bacteria | 60540 |
| 574 | Ga0207689_10002088 | 3300025942 | Bacteria | 18853 |
| 575 | Ga0207689_10011258 | 3300025942 | Bacteria | 7676 |
| 576 | Ga0207661_10015607 | 3300025944 | Bacteria | 5594 |
| 577 | Ga0207661_10151896 | 3300025944 | Bacteria | 2002 |
| 578 | Ga0207661_10243076 | 3300025944 | Bacteria | 1598 |
| 579 | Ga0207679_10008603 | 3300025945 | Bacteria | 6506 |
| 580 | Ga0207679_10076457 | 3300025945 | Bacteria | 2544 |
| 581 | Ga0207679_10079241 | 3300025945 | Bacteria | 2504 |
| 582 | Ga0207679_10100532 | 3300025945 | Bacteria | 2260 |
| 583 | Ga0207679_10836373 | 3300025945 | Bacteria | 840 |
| 584 | Ga0207679_11085889 | 3300025945 | Bacteria | 734 |
| 585 | Ga0207667_10007723 | 3300025949 | Bacteria | 12857 |
| 586 | Ga0207667_10012582 | 3300025949 | Bacteria | 9733 |
| 587 | Ga0207667_10012658 | 3300025949 | Bacteria | 9696 |
| 588 | Ga0207667_10043293 | 3300025949 | Bacteria | 4779 |
| 589 | Ga0207667_10060678 | 3300025949 | Bacteria | 3958 |
| 590 | Ga0207667_10426822 | 3300025949 | Bacteria | 1348 |
| 591 | Ga0207667_11072368 | 3300025949 | Bacteria | 790 |
| 592 | Ga0207651_10005388 | 3300025960 | Bacteria | 6561 |
| 593 | Ga0207651_10008537 | 3300025960 | Bacteria | 5539 |
| 594 | Ga0207651_10012431 | 3300025960 | Bacteria | 4818 |
| 595 | Ga0207651_10021607 | 3300025960 | Bacteria | 3915 |
| 596 | Ga0207651_10031308 | 3300025960 | Bacteria | 3398 |
| 597 | Ga0207651_10747120 | 3300025960 | Bacteria | 864 |
| 598 | Ga0207712_10012882 | 3300025961 | Bacteria | 5352 |
| 599 | Ga0207712_10018851 | 3300025961 | Bacteria | 4499 |
| 600 | Ga0207712_10548820 | 3300025961 | Bacteria | 994 |
| 601 | Ga0207668_10003779 | 3300025972 | Bacteria | 8919 |
| 602 | Ga0207668_10016076 | 3300025972 | Bacteria | 4662 |
| 603 | Ga0207668_10021387 | 3300025972 | Bacteria | 4126 |
| 604 | Ga0207668_10028298 | 3300025972 | Bacteria | 3663 |
| 605 | Ga0207668_10112766 | 3300025972 | Bacteria | 2043 |
| 606 | Ga0207668_10448573 | 3300025972 | Bacteria | 1100 |
| 607 | Ga0207668_10545576 | 3300025972 | Bacteria | 1003 |
| 608 | Ga0207668_10786096 | 3300025972 | Bacteria | 842 |
| 609 | Ga0207668_11790681 | 3300025972 | Bacteria | 554 |
| 610 | Ga0207640_10009290 | 3300025981 | Bacteria | 5500 |
| 611 | Ga0207640_10021612 | 3300025981 | Bacteria | 3838 |
| 612 | Ga0207640_10062054 | 3300025981 | Bacteria | 2478 |
| 613 | Ga0207640_10083873 | 3300025981 | Bacteria | 2186 |
| 614 | Ga0207640_10091620 | 3300025981 | Bacteria | 2106 |
| 615 | Ga0207640_10406551 | 3300025981 | Bacteria | 1110 |
| 616 | Ga0207640_11333567 | 3300025981 | Bacteria | 641 |
| 617 | Ga0207658_10006239 | 3300025986 | Bacteria | 8145 |
| 618 | Ga0207658_10008453 | 3300025986 | Bacteria | 7006 |
| 619 | Ga0207658_10011567 | 3300025986 | Bacteria | 6007 |
| 620 | Ga0207658_10041400 | 3300025986 | Bacteria | 3335 |
| 621 | Ga0207658_10047658 | 3300025986 | Bacteria | 3137 |
| 622 | Ga0207658_10068524 | 3300025986 | Bacteria | 2677 |
| 623 | Ga0207658_10086932 | 3300025986 | Bacteria | 2413 |
| 624 | Ga0207658_10284877 | 3300025986 | Bacteria | 1418 |
| 625 | Ga0207658_10363502 | 3300025986 | Bacteria | 1263 |
| 626 | Ga0207677_10009797 | 3300026023 | Bacteria | 5398 |
| 627 | Ga0207677_10012063 | 3300026023 | Bacteria | 4951 |
| 628 | Ga0207677_10017587 | 3300026023 | Bacteria | 4268 |
| 629 | Ga0207677_10246566 | 3300026023 | Bacteria | 1448 |
| 630 | Ga0207703_10008603 | 3300026035 | Bacteria | 8057 |
| 631 | Ga0207703_10070477 | 3300026035 | Bacteria | 2885 |
| 632 | Ga0207703_10111517 | 3300026035 | Bacteria | 2335 |
| 633 | Ga0207703_10188286 | 3300026035 | Bacteria | 1826 |
| 634 | Ga0207703_10558159 | 3300026035 | Unclassified | 1080 |
| 635 | Ga0207639_10006189 | 3300026041 | Bacteria | 8128 |
| 636 | Ga0207639_10026571 | 3300026041 | Bacteria | 4207 |
| 637 | Ga0207639_10061326 | 3300026041 | Bacteria | 2904 |
| 638 | Ga0207639_10452391 | 3300026041 | Bacteria | 1166 |
| 639 | Ga0207639_10570097 | 3300026041 | Bacteria | 1041 |
| 640 | Ga0207639_10794483 | 3300026041 | Bacteria | 882 |
| 641 | Ga0207639_11001765 | 3300026041 | Bacteria | 782 |
| 642 | Ga0207678_10002769 | 3300026067 | Bacteria | 15871 |
| 643 | Ga0207678_10017478 | 3300026067 | Bacteria | 6297 |
| 644 | Ga0207678_10021448 | 3300026067 | Bacteria | 5663 |
| 645 | Ga0207678_10035040 | 3300026067 | Bacteria | 4370 |
| 646 | Ga0207678_10073764 | 3300026067 | Bacteria | 2924 |
| 647 | Ga0207678_10255117 | 3300026067 | Bacteria | 1502 |
| 648 | Ga0207708_10000330 | 3300026075 | Bacteria | 37297 |
| 649 | Ga0207708_10022570 | 3300026075 | Bacteria | 4753 |
| 650 | Ga0207708_10238624 | 3300026075 | Bacteria | 1462 |
| 651 | Ga0207708_10276330 | 3300026075 | Bacteria | 1360 |
| 652 | Ga0207702_10129038 | 3300026078 | Bacteria | 2273 |
| 653 | Ga0207702_10129152 | 3300026078 | Bacteria | 2272 |
| 654 | Ga0207702_10811243 | 3300026078 | Bacteria | 925 |
| 655 | Ga0207641_10004344 | 3300026088 | Bacteria | 12299 |
| 656 | Ga0207641_10006556 | 3300026088 | Bacteria | 9784 |
| 657 | Ga0207641_10010037 | 3300026088 | Bacteria | 7788 |
| 658 | Ga0207641_10137293 | 3300026088 | Bacteria | 2202 |
| 659 | Ga0207641_10197281 | 3300026088 | Bacteria | 1853 |
| 660 | Ga0207641_10208816 | 3300026088 | Bacteria | 1805 |
| 661 | Ga0207641_10581078 | 3300026088 | Bacteria | 1095 |
| 662 | Ga0207641_11545843 | 3300026088 | Bacteria | 665 |
| 663 | Ga0207641_12293335 | 3300026088 | Bacteria | 539 |
| 664 | Ga0207648_10003749 | 3300026089 | Bacteria | 15887 |
| 665 | Ga0207648_10008541 | 3300026089 | Bacteria | 9910 |
| 666 | Ga0207648_10017870 | 3300026089 | Bacteria | 6435 |
| 667 | Ga0207648_10034621 | 3300026089 | Bacteria | 4452 |
| 668 | Ga0207648_10062181 | 3300026089 | Bacteria | 3256 |
| 669 | Ga0207648_10410106 | 3300026089 | Bacteria | 1229 |
| 670 | Ga0207648_10521893 | 3300026089 | Bacteria | 1088 |
| 671 | Ga0207676_10004846 | 3300026095 | Bacteria | 9538 |
| 672 | Ga0207676_10009364 | 3300026095 | Bacteria | 6971 |
| 673 | Ga0207676_10045405 | 3300026095 | Bacteria | 3394 |
| 674 | Ga0207676_10062168 | 3300026095 | Bacteria | 2960 |
| 675 | Ga0207676_10543500 | 3300026095 | Bacteria | 1109 |
| 676 | Ga0207676_10565440 | 3300026095 | Bacteria | 1088 |
| 677 | Ga0207676_11271944 | 3300026095 | Bacteria | 730 |
| 678 | Ga0207676_11595296 | 3300026095 | Bacteria | 650 |
| 679 | Ga0207676_11738167 | 3300026095 | Unclassified | 622 |
| 680 | Ga0207674_10000775 | 3300026116 | Bacteria | 41699 |
| 681 | Ga0207674_10002604 | 3300026116 | Bacteria | 22638 |
| 682 | Ga0207674_10003926 | 3300026116 | Bacteria | 18101 |
| 683 | Ga0207674_10007754 | 3300026116 | Bacteria | 12490 |
| 684 | Ga0207674_10092555 | 3300026116 | Bacteria | 3012 |
| 685 | Ga0207675_100000632 | 3300026118 | Bacteria | 34518 |
| 686 | Ga0207675_100003092 | 3300026118 | Bacteria | 16306 |
| 687 | Ga0207675_100008081 | 3300026118 | Bacteria | 9909 |
| 688 | Ga0207675_100016851 | 3300026118 | Bacteria | 6826 |
| 689 | Ga0207675_100051806 | 3300026118 | Bacteria | 3830 |
| 690 | Ga0207675_100072589 | 3300026118 | Bacteria | 3219 |
| 691 | Ga0207675_100287668 | 3300026118 | Bacteria | 1598 |
| 692 | Ga0207675_100851294 | 3300026118 | Bacteria | 927 |
| 693 | Ga0207675_102020633 | 3300026118 | Unclassified | 594 |
| 694 | Ga0207683_10000283 | 3300026121 | Bacteria | 45381 |
| 695 | Ga0207683_10001343 | 3300026121 | Bacteria | 22211 |
| 696 | Ga0207683_10003645 | 3300026121 | Bacteria | 13401 |
| 697 | Ga0207683_10034269 | 3300026121 | Bacteria | 4412 |
| 698 | Ga0207683_10126863 | 3300026121 | Bacteria | 2293 |
| 699 | Ga0207683_11275720 | 3300026121 | Bacteria | 680 |
| 700 | Ga0207698_10006776 | 3300026142 | Bacteria | 7161 |
| 701 | Ga0207698_10015332 | 3300026142 | Bacteria | 5128 |
| 702 | Ga0207698_10065023 | 3300026142 | Bacteria | 2862 |
| 703 | Ga0207698_10114264 | 3300026142 | Bacteria | 2270 |
| 704 | Ga0207698_10280324 | 3300026142 | Bacteria | 1541 |
| 705 | Ga0207698_10663535 | 3300026142 | Bacteria | 1034 |
| 706 | Ga0207698_11201807 | 3300026142 | Bacteria | 772 |
| 707 | Ga0209983_1084532 | 3300027665 | Bacteria | 712 |
| 708 | Ga0209998_10029941 | 3300027717 | Bacteria | 1201 |
| 709 | Ga0209974_10005746 | 3300027876 | Bacteria | 4350 |
| 710 | Ga0207428_10541739 | 3300027907 | Bacteria | 842 |
| 711 | Ga0207428_10878303 | 3300027907 | Bacteria | 634 |
| 712 | Ga0268266_10003808 | 3300028379 | Bacteria | 14754 |
| 713 | Ga0268266_10028908 | 3300028379 | Bacteria | 4710 |
| 714 | Ga0268266_10099851 | 3300028379 | Bacteria | 2556 |
| 715 | Ga0268266_10126500 | 3300028379 | Bacteria | 2281 |
| 716 | Ga0268266_10245694 | 3300028379 | Bacteria | 1653 |
| 717 | Ga0268266_10431102 | 3300028379 | Bacteria | 1251 |
| 718 | Ga0268266_10486078 | 3300028379 | Bacteria | 1177 |
| 719 | Ga0268266_11053747 | 3300028379 | Bacteria | 787 |
| 720 | Ga0268266_11062613 | 3300028379 | Bacteria | 783 |
| 721 | Ga0268266_11120210 | 3300028379 | Bacteria | 761 |
| 722 | Ga0268265_10004417 | 3300028380 | Bacteria | 9769 |
| 723 | Ga0268265_10043968 | 3300028380 | Bacteria | 3324 |
| 724 | Ga0268265_10058560 | 3300028380 | Bacteria | 2942 |
| 725 | Ga0268265_10066854 | 3300028380 | Bacteria | 2780 |
| 726 | Ga0268265_10806234 | 3300028380 | Bacteria | 915 |
| 727 | Ga0268264_10010306 | 3300028381 | Bacteria | 7733 |
| 728 | Ga0268264_10020581 | 3300028381 | Bacteria | 5390 |
| 729 | Ga0268264_10052267 | 3300028381 | Bacteria | 3407 |
| 730 | Ga0268264_10147980 | 3300028381 | Bacteria | 2102 |
| 731 | Ga0268264_10208457 | 3300028381 | Bacteria | 1792 |
| 732 | Ga0268264_11634814 | 3300028381 | Bacteria | 655 |
| 733 | Ga0265330_10004514 | 3300031235 | Bacteria | 7057 |
| 734 | Ga0265332_10000141 | 3300031238 | Bacteria | 59136 |
| 735 | Ga0265325_10016639 | 3300031241 | Bacteria | 4106 |
| 736 | Ga0265339_10029144 | 3300031249 | Bacteria | 3134 |
| 737 | Ga0265331_10000972 | 3300031250 | Bacteria | 22763 |
| 738 | Ga0265327_10003882 | 3300031251 | Bacteria | 13769 |
| 739 | Ga0265316_10086543 | 3300031344 | Bacteria | 2395 |
| 740 | Ga0307408_100556982 | 3300031548 | Bacteria | 1012 |
| 741 | Ga0265342_10005713 | 3300031712 | Bacteria | 9406 |
| 742 | Ga0307405_10989691 | 3300031731 | Bacteria | 717 |
| 743 | Ga0307413_10001971 | 3300031824 | Bacteria | 8145 |
| 744 | Ga0307413_10976608 | 3300031824 | Bacteria | 724 |
| 745 | Ga0307410_10010067 | 3300031852 | Bacteria | 5339 |
| 746 | Ga0307406_10004583 | 3300031901 | Bacteria | 7523 |
| 747 | Ga0307406_10061367 | 3300031901 | Bacteria | 2428 |
| 748 | Ga0307407_10003221 | 3300031903 | Bacteria | 6631 |
| 749 | Ga0307407_10622466 | 3300031903 | Bacteria | 806 |
| 750 | Ga0307412_10013605 | 3300031911 | Bacteria | 4776 |
| 751 | Ga0307412_10197398 | 3300031911 | Bacteria | 1526 |
| 752 | Ga0307409_100010408 | 3300031995 | Bacteria | 5782 |
| 753 | Ga0307409_100052609 | 3300031995 | Bacteria | 3124 |
| 754 | Ga0307409_100064535 | 3300031995 | Bacteria | 2877 |
| 755 | Ga0307416_100002070 | 3300032002 | Bacteria | 11304 |
| 756 | Ga0307414_10013575 | 3300032004 | Bacteria | 4855 |
| 757 | Ga0307411_10011160 | 3300032005 | Bacteria | 4833 |
| 758 | Ga0307415_100054808 | 3300032126 | Bacteria | 2724 |
| 759 | Ga0373950_0050516 | 3300034818 | Bacteria | 816 |
| 760 | Ga0373939_0194589 | 3300035114 | Bacteria | 764 |
| 761 | Ga0373960_0244622 | 3300035121 | Bacteria | 650 |
| 762 | Ga0373943_0133270 | 3300035170 | Bacteria | 1332 |
| 763 | Ga0373946_0066304 | 3300035171 | Bacteria | 1548 |
| 764 | Ga0373935_1305636 | 3300035692 | Bacteria | 542 |
| 765 | Ga0373927_0020040 | 3300035695 | Bacteria | 4386 |
| 766 | Ga0373927_0149403 | 3300035695 | Bacteria | 1530 |
| 767 | Ga0373927_0234179 | 3300035695 | Bacteria | 1207 |
| 768 | Ga0373947_0609784 | 3300035725 | Bacteria | 744 |
| 769 | Ga0373937_0177543 | 3300036401 | Bacteria | 1999 |
| 770 | Ga0395900_0041433 | 3300037418 | Bacteria | 4747 |
| 771 | Ga0395900_0134464 | 3300037418 | Bacteria | 2533 |
| 772 | Ga0395900_0273378 | 3300037418 | Bacteria | 1684 |
| 773 | Ga0395898_0032291 | 3300037466 | Bacteria | 5225 |
| 774 | Ga0395898_0039327 | 3300037466 | Bacteria | 4682 |
| 775 | Ga0395898_0736931 | 3300037466 | Bacteria | 927 |
| 776 | Ga0395905_0011436 | 3300037471 | Bacteria | 8576 |
| 777 | Ga0395905_0057778 | 3300037471 | Bacteria | 3629 |
| 778 | Ga0395905_0145394 | 3300037471 | Bacteria | 2231 |
| 779 | Ga0395901_0018072 | 3300038443 | Bacteria | 7196 |
| 780 | Ga0395901_0080725 | 3300038443 | Bacteria | 3397 |
| 781 | Ga0395901_0102297 | 3300038443 | Bacteria | 3007 |
| 782 | Ga0395901_0706468 | 3300038443 | Bacteria | 1005 |
| 783 | Ga0436361_0497952 | 3300039447 | Bacteria | 1088 |
| 784 | Ga0451787_352292 | 3300041441 | Bacteria | 609 |
| 785 | Ga0451791_1618681 | 3300041451 | Bacteria | 755 |
| 786 | Ga0451853_2765974 | 3300041512 | Bacteria | 1001 |
| 787 | Ga0450896_024507 | 3300042133 | Bacteria | 894 |
| 788 | Ga0439435_0033489 | 3300042436 | Bacteria | 1407 |
| 789 | Ga0453683_0240231 | 3300044673 | Bacteria | 1154 |
| 790 | Ga0466963_0576970 | 3300044694 | Bacteria | 794 |
| 791 | Ga0466960_0135938 | 3300044901 | Bacteria | 1302 |
| 792 | Ga0451576_0187687 | 3300045051 | Bacteria | 2159 |
| 793 | Ga0466967_1203478 | 3300045976 | Bacteria | 755 |
| 794 | Ga0495629_0101132 | 3300046459 | Bacteria | 2012 |
| 795 | Ga0495580_0026495 | 3300046472 | Bacteria | 4226 |
| 796 | Ga0495598_0082323 | 3300046537 | Bacteria | 1035 |
| 797 | Ga0495621_0012018 | 3300046539 | Bacteria | 2693 |
| 798 | Ga0495621_0094697 | 3300046539 | Bacteria | 1130 |
| 799 | Ga0495621_0164018 | 3300046539 | Bacteria | 880 |
| 800 | Ga0495645_0219254 | 3300046543 | Bacteria | 1280 |
| 801 | Ga0495599_0753419 | 3300046678 | Bacteria | 559 |
| 802 | Ga0495647_0472048 | 3300046681 | Bacteria | 582 |
| 803 | Ga0496100_0095140 | 3300048903 | Bacteria | 2041 |
| 804 | Ga0496100_0989548 | 3300048903 | Bacteria | 662 |
| 805 | Ga0496101_0223571 | 3300048904 | Bacteria | 1461 |
| 806 | Ga0496101_0278742 | 3300048904 | Bacteria | 1306 |
| 807 | Ga0496102_0025261 | 3300048905 | Bacteria | 5287 |
| 808 | Ga0496102_0254880 | 3300048905 | Bacteria | 1654 |
| 809 | Ga0496102_1452203 | 3300048905 | Bacteria | 605 |
| 810 | Ga0496103_0033857 | 3300048906 | Bacteria | 3123 |
| 811 | Ga0496103_0163935 | 3300048906 | Bacteria | 1426 |
| 812 | Ga0496104_0042538 | 3300048907 | Bacteria | 4264 |
| 813 | Ga0496104_0723726 | 3300048907 | Bacteria | 903 |
| 814 | Ga0496104_0827611 | 3300048907 | Bacteria | 831 |
| 815 | Ga0496105_0003965 | 3300048908 | Bacteria | 11077 |
| 816 | Ga0496105_0627400 | 3300048908 | Bacteria | 831 |
| 817 | Ga0496106_0003978 | 3300048909 | Bacteria | 11045 |
| 818 | Ga0496106_1017183 | 3300048909 | Bacteria | 651 |
| 819 | Ga0496107_0017734 | 3300048910 | Bacteria | 5010 |
| 820 | Ga0496107_0067797 | 3300048910 | Bacteria | 2589 |
| 821 | Ga0496108_0004799 | 3300048911 | Bacteria | 10905 |
| 822 | Ga0496108_1094493 | 3300048911 | Bacteria | 677 |
| 823 | Ga0496109_0005301 | 3300048912 | Bacteria | 10776 |
| 824 | Ga0496109_0032060 | 3300048912 | Bacteria | 4721 |
| 825 | Ga0496109_0068827 | 3300048912 | Bacteria | 3245 |
| 826 | Ga0496110_0085364 | 3300048913 | Bacteria | 2818 |
| 827 | Ga0496110_0125219 | 3300048913 | Bacteria | 2318 |
| 828 | Ga0496110_0441705 | 3300048913 | Bacteria | 1186 |
| 829 | Ga0496110_0644977 | 3300048913 | Bacteria | 959 |
| 830 | Ga0496111_0053084 | 3300048914 | Bacteria | 2928 |
| 831 | Ga0496111_0206944 | 3300048914 | Bacteria | 1458 |
| 832 | Ga0496112_0003208 | 3300048915 | Bacteria | 13462 |
| 833 | Ga0496112_0575784 | 3300048915 | Bacteria | 1059 |
| 834 | Ga0496113_0009900 | 3300048916 | Bacteria | 6280 |
| 835 | Ga0496113_0195815 | 3300048916 | Bacteria | 1605 |
| 836 | Ga0496113_0278327 | 3300048916 | Bacteria | 1338 |
| 837 | Ga0496113_0591320 | 3300048916 | Bacteria | 889 |
| 838 | Ga0496114_0034466 | 3300048917 | Bacteria | 4177 |
| 839 | Ga0496114_0163843 | 3300048917 | Bacteria | 1935 |
| 840 | Ga0496114_0431513 | 3300048917 | Bacteria | 1167 |
| 841 | Ga0496119_0078771 | 3300048922 | Bacteria | 1905 |
| 842 | Ga0501034_0240414 | 3300049571 | Bacteria | 1757 |
| 843 | Ga0501047_0357560 | 3300049581 | Bacteria | 1296 |
| 844 | Ga0501067_0102919 | 3300049583 | Bacteria | 1586 |
| 845 | Ga0501069_0157360 | 3300049585 | Bacteria | 1308 |
| 846 | Ga0501073_0004503 | 3300049589 | Bacteria | 10470 |
| 847 | Ga0501075_0666380 | 3300049591 | Bacteria | 793 |
| 848 | Ga0501079_0386242 | 3300049741 | Bacteria | 1098 |
| 849 | Ga0501080_0006277 | 3300049742 | Bacteria | 10668 |
| 850 | Ga0501080_0063267 | 3300049742 | Bacteria | 3444 |
| 851 | nmdc:mga03683_326798_c1 | 3300050489 | Bacteria | 723 |
| 852 | nmdc:mga03n38_12267_c1 | 3300050490 | Bacteria | 3218 |
| 853 | nmdc:mga00v17_264_c1 | 3300050491 | Bacteria | 30927 |
| 854 | nmdc:mga06z11_71553_c1 | 3300050494 | Bacteria | 1836 |
| 855 | nmdc:mga05p37_372262_c1 | 3300050507 | Bacteria | 1676 |
| 856 | nmdc:mga05p37_7464_c1 | 3300050507 | Bacteria | 2419 |
| 857 | nmdc:mga09592_14083_c1 | 3300050508 | Bacteria | 6529 |
| 858 | nmdc:mga0qj67_479308_c1 | 3300050509 | Bacteria | 1001 |
| 859 | nmdc:mga0qj67_7494_c1 | 3300050509 | Bacteria | 8058 |
| 860 | nmdc:mga06r32_230215_c1 | 3300050510 | Bacteria | 1841 |
| 861 | nmdc:mga08y16_144437_c1 | 3300050511 | Bacteria | 2473 |
| 862 | nmdc:mga08y16_571109_c1 | 3300050511 | Bacteria | 1143 |
| 863 | nmdc:mga0n895_1037716_c1 | 3300050512 | Bacteria | 799 |
| 864 | nmdc:mga0n895_149246_c1 | 3300050512 | Bacteria | 2367 |
| 865 | nmdc:mga0n895_1590944_c1 | 3300050512 | Bacteria | 618 |
| 866 | nmdc:mga0n895_689121_c1 | 3300050512 | Bacteria | 1018 |
| 867 | nmdc:mga0n895_825838_c1 | 3300050512 | Bacteria | 916 |
| 868 | nmdc:mga0rr50_125018_c1 | 3300050513 | Bacteria | 2052 |
| 869 | nmdc:mga0rr50_313508_c1 | 3300050513 | Bacteria | 1314 |
| 870 | nmdc:mga0sz30_509_c1 | 3300050516 | Bacteria | 14494 |
| 871 | Ga0495601_0368569 | 3300053077 | Bacteria | 933 |
| 872 | Ga0495595_0022102 | 3300053084 | Bacteria | 2789 |
| 873 | Ga0495595_0546880 | 3300053084 | Bacteria | 591 |
| 874 | Ga0495619_0442441 | 3300053085 | Bacteria | 896 |
| 875 | Ga0495619_0630544 | 3300053085 | Bacteria | 732 |
| 876 | Ga0530510_0157164 | 3300061734 | Bacteria | 1681 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013296 | Ga0157374_11116787 | Ga0157374_111167872 | 152 |
| 2 | 3300037466 | Ga0395898_0736931 | Ga0395898_0736931_245_709 | 152 |
| 3 | 3300038443 | Ga0395901_0102297 | Ga0395901_0102297_942_1406 | 152 |
| 4 | 3300005439 | Ga0070711_100720342 | Ga0070711_1007203422 | 153 |
| 5 | 3300006048 | Ga0075363_100230016 | Ga0075363_1002300162 | 153 |
| 6 | 3300006051 | Ga0075364_10000494 | Ga0075364_1000049415 | 153 |
| 7 | 3300006177 | Ga0075362_10242392 | Ga0075362_102423922 | 153 |
| 8 | 3300006178 | Ga0075367_10046720 | Ga0075367_100467203 | 153 |
| 9 | 3300006186 | Ga0075369_10000250 | Ga0075369_1000025015 | 153 |
| 10 | 3300007076 | Ga0075435_100379716 | Ga0075435_1003797162 | 153 |
| 11 | 3300009092 | Ga0105250_10027260 | Ga0105250_100272602 | 153 |
| 12 | 3300009148 | Ga0105243_10321304 | Ga0105243_103213042 | 153 |
| 13 | 3300009553 | Ga0105249_10464426 | Ga0105249_104644263 | 153 |
| 14 | 3300014326 | Ga0157380_10290053 | Ga0157380_102900531 | 153 |
| 15 | 3300021384 | Ga0213876_10139857 | Ga0213876_101398572 | 153 |
| 16 | 3300031731 | Ga0307405_10989691 | Ga0307405_109896912 | 153 |
| 17 | 3300031911 | Ga0307412_10197398 | Ga0307412_101973982 | 153 |
| 18 | 3300035121 | Ga0373960_0244622 | Ga0373960_0244622_64_528 | 153 |
| 19 | 3300039447 | Ga0436361_0497952 | Ga0436361_0497952_142_621 | 153 |
| 20 | 3300048904 | Ga0496101_0278742 | Ga0496101_0278742_333_812 | 153 |
| 21 | 3300048907 | Ga0496104_0723726 | Ga0496104_0723726_103_582 | 153 |
| 22 | 3300048907 | Ga0496104_0827611 | Ga0496104_0827611_290_769 | 153 |
| 23 | 3300048908 | Ga0496105_0627400 | Ga0496105_0627400_63_542 | 153 |
| 24 | 3300048913 | Ga0496110_0125219 | Ga0496110_0125219_1279_1758 | 153 |
| 25 | 3300048914 | Ga0496111_0053084 | Ga0496111_0053084_148_627 | 153 |
| 26 | 3300048916 | Ga0496113_0009900 | Ga0496113_0009900_5583_6062 | 153 |
| 27 | 3300048922 | Ga0496119_0078771 | Ga0496119_0078771_955_1434 | 153 |
| 28 | 3300049571 | Ga0501034_0240414 | Ga0501034_0240414_991_1461 | 153 |
| 29 | 3300050489 | nmdc:mga03683_326798_c1 | nmdc:mga03683_326798_c1_234_698 | 153 |
| 30 | 3300050490 | nmdc:mga03n38_12267_c1 | nmdc:mga03n38_12267_c1_135_599 | 153 |
| 31 | 3300050491 | nmdc:mga00v17_264_c1 | nmdc:mga00v17_264_c1_24359_24823 | 153 |
| 32 | 3300050494 | nmdc:mga06z11_71553_c1 | nmdc:mga06z11_71553_c1_1272_1736 | 153 |
| 33 | 3300050513 | nmdc:mga0rr50_313508_c1 | nmdc:mga0rr50_313508_c1_244_708 | 153 |
| 34 | 3300050516 | nmdc:mga0sz30_509_c1 | nmdc:mga0sz30_509_c1_2414_2878 | 153 |
| 35 | 3300053077 | Ga0495601_0368569 | Ga0495601_0368569_52_531 | 153 |
| 36 | 3300053084 | Ga0495595_0022102 | Ga0495595_0022102_2133_2612 | 153 |
| 37 | 3300005331 | Ga0070670_101327314 | Ga0070670_1013273141 | 154 |
| 38 | 3300005336 | Ga0070680_100238453 | Ga0070680_1002384532 | 154 |
| 39 | 3300005353 | Ga0070669_100098531 | Ga0070669_1000985312 | 154 |
| 40 | 3300005355 | Ga0070671_100079129 | Ga0070671_1000791292 | 154 |
| 41 | 3300005356 | Ga0070674_100036339 | Ga0070674_1000363392 | 154 |
| 42 | 3300005539 | Ga0068853_101952992 | Ga0068853_1019529921 | 154 |
| 43 | 3300005563 | Ga0068855_100453030 | Ga0068855_1004530302 | 154 |
| 44 | 3300005578 | Ga0068854_100322409 | Ga0068854_1003224091 | 154 |
| 45 | 3300005614 | Ga0068856_100022222 | Ga0068856_1000222225 | 154 |
| 46 | 3300005616 | Ga0068852_100138091 | Ga0068852_1001380912 | 154 |
| 47 | 3300005844 | Ga0068862_100043495 | Ga0068862_1000434954 | 154 |
| 48 | 3300009093 | Ga0105240_10522447 | Ga0105240_105224472 | 154 |
| 49 | 3300009094 | Ga0111539_11341682 | Ga0111539_113416822 | 154 |
| 50 | 3300013104 | Ga0157370_10108577 | Ga0157370_101085772 | 154 |
| 51 | 3300013307 | Ga0157372_10011850 | Ga0157372_100118505 | 154 |
| 52 | 3300025912 | Ga0207707_10282532 | Ga0207707_102825321 | 154 |
| 53 | 3300025923 | Ga0207681_10094130 | Ga0207681_100941302 | 154 |
| 54 | 3300025931 | Ga0207644_10699571 | Ga0207644_106995712 | 154 |
| 55 | 3300025937 | Ga0207669_10016174 | Ga0207669_100161744 | 154 |
| 56 | 3300025981 | Ga0207640_10406551 | Ga0207640_104065511 | 154 |
| 57 | 3300026088 | Ga0207641_11545843 | Ga0207641_115458431 | 154 |
| 58 | 3300026089 | Ga0207648_10410106 | Ga0207648_104101062 | 154 |
| 59 | 3300026142 | Ga0207698_11201807 | Ga0207698_112018072 | 154 |
| 60 | 3300028380 | Ga0268265_10066854 | Ga0268265_100668543 | 154 |
| 61 | 3300037418 | Ga0395900_0134464 | Ga0395900_0134464_1204_1674 | 154 |
| 62 | 3300037466 | Ga0395898_0039327 | Ga0395898_0039327_1149_1619 | 154 |
| 63 | 3300038443 | Ga0395901_0080725 | Ga0395901_0080725_777_1247 | 154 |
| 64 | 3300044694 | Ga0466963_0576970 | Ga0466963_0576970_285_749 | 154 |
| 65 | 3300048905 | Ga0496102_1452203 | Ga0496102_1452203_56_520 | 154 |
| 66 | 3300004799 | Ga0058863_11718871 | Ga0058863_117188711 | 155 |
| 67 | 3300004803 | Ga0058862_12751779 | Ga0058862_127517792 | 155 |
| 68 | 3300005327 | Ga0070658_10017688 | Ga0070658_100176886 | 155 |
| 69 | 3300005327 | Ga0070658_10036568 | Ga0070658_100365685 | 155 |
| 70 | 3300005329 | Ga0070683_100019402 | Ga0070683_1000194023 | 155 |
| 71 | 3300005329 | Ga0070683_100058588 | Ga0070683_1000585883 | 155 |
| 72 | 3300005331 | Ga0070670_101686592 | Ga0070670_1016865921 | 155 |
| 73 | 3300005335 | Ga0070666_10410922 | Ga0070666_104109222 | 155 |
| 74 | 3300005336 | Ga0070680_100109620 | Ga0070680_1001096202 | 155 |
| 75 | 3300005336 | Ga0070680_100376219 | Ga0070680_1003762192 | 155 |
| 76 | 3300005339 | Ga0070660_100004956 | Ga0070660_1000049563 | 155 |
| 77 | 3300005339 | Ga0070660_100018533 | Ga0070660_1000185332 | 155 |
| 78 | 3300005344 | Ga0070661_100010175 | Ga0070661_1000101752 | 155 |
| 79 | 3300005344 | Ga0070661_100027132 | Ga0070661_1000271325 | 155 |
| 80 | 3300005344 | Ga0070661_100173153 | Ga0070661_1001731531 | 155 |
| 81 | 3300005353 | Ga0070669_100006708 | Ga0070669_1000067083 | 155 |
| 82 | 3300005354 | Ga0070675_100392373 | Ga0070675_1003923732 | 155 |
| 83 | 3300005364 | Ga0070673_100091659 | Ga0070673_1000916592 | 155 |
| 84 | 3300005366 | Ga0070659_100006210 | Ga0070659_1000062106 | 155 |
| 85 | 3300005366 | Ga0070659_100064486 | Ga0070659_1000644862 | 155 |
| 86 | 3300005366 | Ga0070659_100589158 | Ga0070659_1005891582 | 155 |
| 87 | 3300005367 | Ga0070667_100213734 | Ga0070667_1002137342 | 155 |
| 88 | 3300005435 | Ga0070714_100033301 | Ga0070714_1000333011 | 155 |
| 89 | 3300005441 | Ga0070700_100204956 | Ga0070700_1002049562 | 155 |
| 90 | 3300005455 | Ga0070663_100010255 | Ga0070663_1000102552 | 155 |
| 91 | 3300005457 | Ga0070662_100001081 | Ga0070662_1000010818 | 155 |
| 92 | 3300005530 | Ga0070679_100019147 | Ga0070679_1000191475 | 155 |
| 93 | 3300005535 | Ga0070684_100040000 | Ga0070684_1000400002 | 155 |
| 94 | 3300005535 | Ga0070684_100043995 | Ga0070684_1000439952 | 155 |
| 95 | 3300005539 | Ga0068853_100056192 | Ga0068853_1000561922 | 155 |
| 96 | 3300005539 | Ga0068853_100542898 | Ga0068853_1005428982 | 155 |
| 97 | 3300005543 | Ga0070672_100022564 | Ga0070672_1000225642 | 155 |
| 98 | 3300005563 | Ga0068855_100003908 | Ga0068855_1000039082 | 155 |
| 99 | 3300005564 | Ga0070664_100002998 | Ga0070664_10000299813 | 155 |
| 100 | 3300005564 | Ga0070664_101553058 | Ga0070664_1015530581 | 155 |
| 101 | 3300005577 | Ga0068857_100008373 | Ga0068857_1000083734 | 155 |
| 102 | 3300005578 | Ga0068854_100002321 | Ga0068854_1000023216 | 155 |
| 103 | 3300005578 | Ga0068854_100115025 | Ga0068854_1001150252 | 155 |
| 104 | 3300005578 | Ga0068854_100163739 | Ga0068854_1001637392 | 155 |
| 105 | 3300005614 | Ga0068856_100001379 | Ga0068856_10000137916 | 155 |
| 106 | 3300005614 | Ga0068856_101572557 | Ga0068856_1015725571 | 155 |
| 107 | 3300005616 | Ga0068852_100002000 | Ga0068852_1000020002 | 155 |
| 108 | 3300005616 | Ga0068852_100067303 | Ga0068852_1000673033 | 155 |
| 109 | 3300005616 | Ga0068852_100213207 | Ga0068852_1002132072 | 155 |
| 110 | 3300005719 | Ga0068861_100001362 | Ga0068861_1000013625 | 155 |
| 111 | 3300005834 | Ga0068851_10010234 | Ga0068851_100102344 | 155 |
| 112 | 3300005834 | Ga0068851_10028777 | Ga0068851_100287773 | 155 |
| 113 | 3300005840 | Ga0068870_10017237 | Ga0068870_100172373 | 155 |
| 114 | 3300005844 | Ga0068862_100002076 | Ga0068862_1000020764 | 155 |
| 115 | 3300005937 | Ga0081455_10317106 | Ga0081455_103171062 | 155 |
| 116 | 3300006844 | Ga0075428_100160557 | Ga0075428_1001605573 | 155 |
| 117 | 3300006844 | Ga0075428_100347659 | Ga0075428_1003476592 | 155 |
| 118 | 3300006844 | Ga0075428_100586531 | Ga0075428_1005865312 | 155 |
| 119 | 3300006846 | Ga0075430_100020888 | Ga0075430_1000208886 | 155 |
| 120 | 3300006847 | Ga0075431_100159632 | Ga0075431_1001596323 | 155 |
| 121 | 3300009094 | Ga0111539_10053252 | Ga0111539_100532522 | 155 |
| 122 | 3300009148 | Ga0105243_10336876 | Ga0105243_103368762 | 155 |
| 123 | 3300009174 | Ga0105241_11041971 | Ga0105241_110419711 | 155 |
| 124 | 3300009545 | Ga0105237_10173559 | Ga0105237_101735592 | 155 |
| 125 | 3300009553 | Ga0105249_10020425 | Ga0105249_100204253 | 155 |
| 126 | 3300010375 | Ga0105239_10082015 | Ga0105239_100820154 | 155 |
| 127 | 3300010375 | Ga0105239_10981235 | Ga0105239_109812352 | 155 |
| 128 | 3300013100 | Ga0157373_10001932 | Ga0157373_100019322 | 155 |
| 129 | 3300013102 | Ga0157371_10000303 | Ga0157371_1000030360 | 155 |
| 130 | 3300013105 | Ga0157369_12357950 | Ga0157369_123579501 | 155 |
| 131 | 3300013306 | Ga0163162_10089116 | Ga0163162_100891162 | 155 |
| 132 | 3300013307 | Ga0157372_10001717 | Ga0157372_1000171714 | 155 |
| 133 | 3300013307 | Ga0157372_10007943 | Ga0157372_100079432 | 155 |
| 134 | 3300013308 | Ga0157375_10300981 | Ga0157375_103009812 | 155 |
| 135 | 3300013308 | Ga0157375_10860866 | Ga0157375_108608662 | 155 |
| 136 | 3300014326 | Ga0157380_10006810 | Ga0157380_100068104 | 155 |
| 137 | 3300017792 | Ga0163161_10545575 | Ga0163161_105455751 | 155 |
| 138 | 3300020610 | Ga0154015_1059651 | Ga0154015_10596513 | 155 |
| 139 | 3300022467 | Ga0224712_10005960 | Ga0224712_100059602 | 155 |
| 140 | 3300025898 | Ga0207692_10710185 | Ga0207692_107101851 | 155 |
| 141 | 3300025907 | Ga0207645_10061294 | Ga0207645_100612943 | 155 |
| 142 | 3300025908 | Ga0207643_10016622 | Ga0207643_100166222 | 155 |
| 143 | 3300025909 | Ga0207705_10517182 | Ga0207705_105171822 | 155 |
| 144 | 3300025911 | Ga0207654_10438270 | Ga0207654_104382702 | 155 |
| 145 | 3300025913 | Ga0207695_10041552 | Ga0207695_100415522 | 155 |
| 146 | 3300025917 | Ga0207660_10321431 | Ga0207660_103214312 | 155 |
| 147 | 3300025919 | Ga0207657_10001114 | Ga0207657_100011144 | 155 |
| 148 | 3300025919 | Ga0207657_10019069 | Ga0207657_100190695 | 155 |
| 149 | 3300025919 | Ga0207657_10023158 | Ga0207657_100231586 | 155 |
| 150 | 3300025920 | Ga0207649_10003803 | Ga0207649_100038033 | 155 |
| 151 | 3300025921 | Ga0207652_10009211 | Ga0207652_100092117 | 155 |
| 152 | 3300025921 | Ga0207652_10026593 | Ga0207652_100265935 | 155 |
| 153 | 3300025924 | Ga0207694_10061823 | Ga0207694_100618231 | 155 |
| 154 | 3300025925 | Ga0207650_10238504 | Ga0207650_102385042 | 155 |
| 155 | 3300025926 | Ga0207659_10165217 | Ga0207659_101652172 | 155 |
| 156 | 3300025929 | Ga0207664_10327191 | Ga0207664_103271912 | 155 |
| 157 | 3300025931 | Ga0207644_10121670 | Ga0207644_101216702 | 155 |
| 158 | 3300025932 | Ga0207690_10001868 | Ga0207690_1000186811 | 155 |
| 159 | 3300025932 | Ga0207690_10061917 | Ga0207690_100619171 | 155 |
| 160 | 3300025932 | Ga0207690_10092030 | Ga0207690_100920302 | 155 |
| 161 | 3300025933 | Ga0207706_10000023 | Ga0207706_10000023125 | 155 |
| 162 | 3300025933 | Ga0207706_10112789 | Ga0207706_101127893 | 155 |
| 163 | 3300025940 | Ga0207691_10009118 | Ga0207691_100091184 | 155 |
| 164 | 3300025944 | Ga0207661_10151896 | Ga0207661_101518962 | 155 |
| 165 | 3300025945 | Ga0207679_10008603 | Ga0207679_100086032 | 155 |
| 166 | 3300025945 | Ga0207679_10100532 | Ga0207679_101005322 | 155 |
| 167 | 3300025945 | Ga0207679_10836373 | Ga0207679_108363731 | 155 |
| 168 | 3300025949 | Ga0207667_10007723 | Ga0207667_100077234 | 155 |
| 169 | 3300025949 | Ga0207667_10060678 | Ga0207667_100606784 | 155 |
| 170 | 3300025949 | Ga0207667_11072368 | Ga0207667_110723682 | 155 |
| 171 | 3300025960 | Ga0207651_10021607 | Ga0207651_100216074 | 155 |
| 172 | 3300025961 | Ga0207712_10012882 | Ga0207712_100128823 | 155 |
| 173 | 3300025972 | Ga0207668_10112766 | Ga0207668_101127662 | 155 |
| 174 | 3300025981 | Ga0207640_10009290 | Ga0207640_100092903 | 155 |
| 175 | 3300025981 | Ga0207640_10021612 | Ga0207640_100216124 | 155 |
| 176 | 3300025981 | Ga0207640_10083873 | Ga0207640_100838732 | 155 |
| 177 | 3300025986 | Ga0207658_10284877 | Ga0207658_102848772 | 155 |
| 178 | 3300026041 | Ga0207639_10061326 | Ga0207639_100613262 | 155 |
| 179 | 3300026041 | Ga0207639_10570097 | Ga0207639_105700972 | 155 |
| 180 | 3300026041 | Ga0207639_10794483 | Ga0207639_107944832 | 155 |
| 181 | 3300026067 | Ga0207678_10017478 | Ga0207678_100174786 | 155 |
| 182 | 3300026075 | Ga0207708_10022570 | Ga0207708_100225703 | 155 |
| 183 | 3300026075 | Ga0207708_10238624 | Ga0207708_102386242 | 155 |
| 184 | 3300026078 | Ga0207702_10129038 | Ga0207702_101290381 | 155 |
| 185 | 3300026078 | Ga0207702_10129152 | Ga0207702_101291523 | 155 |
| 186 | 3300026088 | Ga0207641_10208816 | Ga0207641_102088162 | 155 |
| 187 | 3300026095 | Ga0207676_11595296 | Ga0207676_115952962 | 155 |
| 188 | 3300026116 | Ga0207674_10002604 | Ga0207674_1000260411 | 155 |
| 189 | 3300026116 | Ga0207674_10003926 | Ga0207674_1000392617 | 155 |
| 190 | 3300026118 | Ga0207675_100003092 | Ga0207675_1000030922 | 155 |
| 191 | 3300026142 | Ga0207698_10015332 | Ga0207698_100153325 | 155 |
| 192 | 3300026142 | Ga0207698_10280324 | Ga0207698_102803242 | 155 |
| 193 | 3300027665 | Ga0209983_1084532 | Ga0209983_10845322 | 155 |
| 194 | 3300027717 | Ga0209998_10029941 | Ga0209998_100299411 | 155 |
| 195 | 3300027876 | Ga0209974_10005746 | Ga0209974_100057462 | 155 |
| 196 | 3300028380 | Ga0268265_10004417 | Ga0268265_100044174 | 155 |
| 197 | 3300031548 | Ga0307408_100556982 | Ga0307408_1005569822 | 155 |
| 198 | 3300031824 | Ga0307413_10001971 | Ga0307413_100019712 | 155 |
| 199 | 3300031852 | Ga0307410_10010067 | Ga0307410_100100671 | 155 |
| 200 | 3300031901 | Ga0307406_10004583 | Ga0307406_100045832 | 155 |
| 201 | 3300031903 | Ga0307407_10003221 | Ga0307407_100032212 | 155 |
| 202 | 3300031911 | Ga0307412_10013605 | Ga0307412_100136052 | 155 |
| 203 | 3300031995 | Ga0307409_100010408 | Ga0307409_1000104081 | 155 |
| 204 | 3300032002 | Ga0307416_100002070 | Ga0307416_1000020706 | 155 |
| 205 | 3300032004 | Ga0307414_10013575 | Ga0307414_100135752 | 155 |
| 206 | 3300032005 | Ga0307411_10011160 | Ga0307411_100111601 | 155 |
| 207 | 3300032126 | Ga0307415_100054808 | Ga0307415_1000548082 | 155 |
| 208 | 3300037418 | Ga0395900_0041433 | Ga0395900_0041433_2158_2649 | 155 |
| 209 | 3300037418 | Ga0395900_0273378 | Ga0395900_0273378_163_636 | 155 |
| 210 | 3300037466 | Ga0395898_0032291 | Ga0395898_0032291_608_1099 | 155 |
| 211 | 3300037471 | Ga0395905_0011436 | Ga0395905_0011436_2912_3403 | 155 |
| 212 | 3300037471 | Ga0395905_0057778 | Ga0395905_0057778_792_1265 | 155 |
| 213 | 3300037471 | Ga0395905_0145394 | Ga0395905_0145394_1316_1807 | 155 |
| 214 | 3300038443 | Ga0395901_0018072 | Ga0395901_0018072_2113_2604 | 155 |
| 215 | 3300048906 | Ga0496103_0163935 | Ga0496103_0163935_91_558 | 155 |
| 216 | 3300048909 | Ga0496106_0003978 | Ga0496106_0003978_9739_10206 | 155 |
| 217 | 3300048910 | Ga0496107_0017734 | Ga0496107_0017734_1548_2015 | 155 |
| 218 | 3300048916 | Ga0496113_0591320 | Ga0496113_0591320_401_874 | 155 |
| 219 | 3300050507 | nmdc:mga05p37_7464_c1 | nmdc:mga05p37_7464_c1_304_780 | 155 |
| 220 | 3300050508 | nmdc:mga09592_14083_c1 | nmdc:mga09592_14083_c1_2104_2580 | 155 |
| 221 | 3300050509 | nmdc:mga0qj67_479308_c1 | nmdc:mga0qj67_479308_c1_439_909 | 155 |
| 222 | 3300050509 | nmdc:mga0qj67_7494_c1 | nmdc:mga0qj67_7494_c1_4230_4706 | 155 |
| 223 | 3300050510 | nmdc:mga06r32_230215_c1 | nmdc:mga06r32_230215_c1_1342_1818 | 155 |
| 224 | 3300050511 | nmdc:mga08y16_144437_c1 | nmdc:mga08y16_144437_c1_1279_1761 | 155 |
| 225 | 3300050512 | nmdc:mga0n895_1037716_c1 | nmdc:mga0n895_1037716_c1_81_554 | 155 |
| 226 | 3300005293 | Ga0065715_10162694 | Ga0065715_101626942 | 156 |
| 227 | 3300005293 | Ga0065715_10365467 | Ga0065715_103654671 | 156 |
| 228 | 3300005328 | Ga0070676_10032653 | Ga0070676_100326533 | 156 |
| 229 | 3300005331 | Ga0070670_100021437 | Ga0070670_1000214372 | 156 |
| 230 | 3300005333 | Ga0070677_10135884 | Ga0070677_101358842 | 156 |
| 231 | 3300005334 | Ga0068869_100007694 | Ga0068869_1000076946 | 156 |
| 232 | 3300005337 | Ga0070682_100899525 | Ga0070682_1008995251 | 156 |
| 233 | 3300005338 | Ga0068868_100045229 | Ga0068868_1000452295 | 156 |
| 234 | 3300005344 | Ga0070661_100248233 | Ga0070661_1002482331 | 156 |
| 235 | 3300005347 | Ga0070668_100007010 | Ga0070668_1000070101 | 156 |
| 236 | 3300005347 | Ga0070668_100016216 | Ga0070668_1000162168 | 156 |
| 237 | 3300005347 | Ga0070668_100559299 | Ga0070668_1005592992 | 156 |
| 238 | 3300005347 | Ga0070668_101249069 | Ga0070668_1012490692 | 156 |
| 239 | 3300005353 | Ga0070669_100110841 | Ga0070669_1001108412 | 156 |
| 240 | 3300005353 | Ga0070669_100667379 | Ga0070669_1006673792 | 156 |
| 241 | 3300005354 | Ga0070675_100008929 | Ga0070675_10000892910 | 156 |
| 242 | 3300005354 | Ga0070675_100094815 | Ga0070675_1000948152 | 156 |
| 243 | 3300005354 | Ga0070675_100317873 | Ga0070675_1003178732 | 156 |
| 244 | 3300005354 | Ga0070675_100332358 | Ga0070675_1003323582 | 156 |
| 245 | 3300005355 | Ga0070671_100383170 | Ga0070671_1003831701 | 156 |
| 246 | 3300005356 | Ga0070674_100120733 | Ga0070674_1001207332 | 156 |
| 247 | 3300005356 | Ga0070674_100398011 | Ga0070674_1003980112 | 156 |
| 248 | 3300005364 | Ga0070673_100074203 | Ga0070673_1000742034 | 156 |
| 249 | 3300005366 | Ga0070659_100071001 | Ga0070659_1000710012 | 156 |
| 250 | 3300005367 | Ga0070667_100127045 | Ga0070667_1001270454 | 156 |
| 251 | 3300005367 | Ga0070667_100422096 | Ga0070667_1004220962 | 156 |
| 252 | 3300005435 | Ga0070714_100062644 | Ga0070714_1000626443 | 156 |
| 253 | 3300005439 | Ga0070711_100691827 | Ga0070711_1006918271 | 156 |
| 254 | 3300005439 | Ga0070711_100928130 | Ga0070711_1009281301 | 156 |
| 255 | 3300005455 | Ga0070663_100190761 | Ga0070663_1001907612 | 156 |
| 256 | 3300005457 | Ga0070662_100259751 | Ga0070662_1002597512 | 156 |
| 257 | 3300005458 | Ga0070681_10001160 | Ga0070681_1000116012 | 156 |
| 258 | 3300005458 | Ga0070681_11030478 | Ga0070681_110304781 | 156 |
| 259 | 3300005459 | Ga0068867_100010823 | Ga0068867_1000108233 | 156 |
| 260 | 3300005459 | Ga0068867_100384660 | Ga0068867_1003846602 | 156 |
| 261 | 3300005518 | Ga0070699_100093099 | Ga0070699_1000930993 | 156 |
| 262 | 3300005530 | Ga0070679_100178590 | Ga0070679_1001785901 | 156 |
| 263 | 3300005539 | Ga0068853_100074913 | Ga0068853_1000749132 | 156 |
| 264 | 3300005539 | Ga0068853_101410792 | Ga0068853_1014107921 | 156 |
| 265 | 3300005543 | Ga0070672_100012306 | Ga0070672_1000123066 | 156 |
| 266 | 3300005543 | Ga0070672_100075834 | Ga0070672_1000758342 | 156 |
| 267 | 3300005543 | Ga0070672_100228126 | Ga0070672_1002281261 | 156 |
| 268 | 3300005548 | Ga0070665_100305035 | Ga0070665_1003050352 | 156 |
| 269 | 3300005563 | Ga0068855_100019019 | Ga0068855_1000190192 | 156 |
| 270 | 3300005563 | Ga0068855_100040144 | Ga0068855_1000401441 | 156 |
| 271 | 3300005564 | Ga0070664_100084498 | Ga0070664_1000844982 | 156 |
| 272 | 3300005564 | Ga0070664_100094788 | Ga0070664_1000947883 | 156 |
| 273 | 3300005564 | Ga0070664_101033582 | Ga0070664_1010335822 | 156 |
| 274 | 3300005577 | Ga0068857_100065029 | Ga0068857_1000650294 | 156 |
| 275 | 3300005577 | Ga0068857_100399942 | Ga0068857_1003999422 | 156 |
| 276 | 3300005616 | Ga0068852_100328423 | Ga0068852_1003284232 | 156 |
| 277 | 3300005617 | Ga0068859_100243236 | Ga0068859_1002432362 | 156 |
| 278 | 3300005617 | Ga0068859_100824334 | Ga0068859_1008243342 | 156 |
| 279 | 3300005618 | Ga0068864_100018419 | Ga0068864_1000184192 | 156 |
| 280 | 3300005618 | Ga0068864_100807004 | Ga0068864_1008070042 | 156 |
| 281 | 3300005718 | Ga0068866_10195641 | Ga0068866_101956412 | 156 |
| 282 | 3300005719 | Ga0068861_100235924 | Ga0068861_1002359242 | 156 |
| 283 | 3300005719 | Ga0068861_100261518 | Ga0068861_1002615181 | 156 |
| 284 | 3300005719 | Ga0068861_100751837 | Ga0068861_1007518371 | 156 |
| 285 | 3300005834 | Ga0068851_10078842 | Ga0068851_100788422 | 156 |
| 286 | 3300005841 | Ga0068863_100264682 | Ga0068863_1002646822 | 156 |
| 287 | 3300005842 | Ga0068858_100150477 | Ga0068858_1001504772 | 156 |
| 288 | 3300005843 | Ga0068860_100200958 | Ga0068860_1002009582 | 156 |
| 289 | 3300005844 | Ga0068862_102264194 | Ga0068862_1022641941 | 156 |
| 290 | 3300006237 | Ga0097621_100099569 | Ga0097621_1000995692 | 156 |
| 291 | 3300006358 | Ga0068871_100213997 | Ga0068871_1002139973 | 156 |
| 292 | 3300006358 | Ga0068871_100473592 | Ga0068871_1004735922 | 156 |
| 293 | 3300006871 | Ga0075434_100651911 | Ga0075434_1006519111 | 156 |
| 294 | 3300006881 | Ga0068865_100023951 | Ga0068865_1000239514 | 156 |
| 295 | 3300006914 | Ga0075436_100706649 | Ga0075436_1007066492 | 156 |
| 296 | 3300006931 | Ga0097620_100243229 | Ga0097620_1002432292 | 156 |
| 297 | 3300006931 | Ga0097620_100824340 | Ga0097620_1008243402 | 156 |
| 298 | 3300009093 | Ga0105240_10166930 | Ga0105240_101669303 | 156 |
| 299 | 3300009098 | Ga0105245_10470611 | Ga0105245_104706112 | 156 |
| 300 | 3300009174 | Ga0105241_10143629 | Ga0105241_101436292 | 156 |
| 301 | 3300009177 | Ga0105248_10147483 | Ga0105248_101474832 | 156 |
| 302 | 3300009177 | Ga0105248_10397237 | Ga0105248_103972372 | 156 |
| 303 | 3300009551 | Ga0105238_10075696 | Ga0105238_100756963 | 156 |
| 304 | 3300009551 | Ga0105238_10412946 | Ga0105238_104129462 | 156 |
| 305 | 3300009553 | Ga0105249_10128452 | Ga0105249_101284522 | 156 |
| 306 | 3300013102 | Ga0157371_10043784 | Ga0157371_100437842 | 156 |
| 307 | 3300013105 | Ga0157369_10217825 | Ga0157369_102178253 | 156 |
| 308 | 3300013296 | Ga0157374_10554585 | Ga0157374_105545852 | 156 |
| 309 | 3300013297 | Ga0157378_10004675 | Ga0157378_1000467510 | 156 |
| 310 | 3300013306 | Ga0163162_10078494 | Ga0163162_100784942 | 156 |
| 311 | 3300013307 | Ga0157372_10049411 | Ga0157372_100494112 | 156 |
| 312 | 3300013308 | Ga0157375_10862526 | Ga0157375_108625262 | 156 |
| 313 | 3300014325 | Ga0163163_10025908 | Ga0163163_100259083 | 156 |
| 314 | 3300014325 | Ga0163163_10575587 | Ga0163163_105755872 | 156 |
| 315 | 3300014968 | Ga0157379_10058207 | Ga0157379_100582073 | 156 |
| 316 | 3300014969 | Ga0157376_10237184 | Ga0157376_102371842 | 156 |
| 317 | 3300017792 | Ga0163161_10728437 | Ga0163161_107284372 | 156 |
| 318 | 3300025321 | Ga0207656_10230369 | Ga0207656_102303692 | 156 |
| 319 | 3300025893 | Ga0207682_10073389 | Ga0207682_100733892 | 156 |
| 320 | 3300025899 | Ga0207642_10188137 | Ga0207642_101881372 | 156 |
| 321 | 3300025901 | Ga0207688_10091693 | Ga0207688_100916931 | 156 |
| 322 | 3300025903 | Ga0207680_10103464 | Ga0207680_101034642 | 156 |
| 323 | 3300025907 | Ga0207645_10013037 | Ga0207645_100130376 | 156 |
| 324 | 3300025912 | Ga0207707_10454226 | Ga0207707_104542262 | 156 |
| 325 | 3300025912 | Ga0207707_10791781 | Ga0207707_107917811 | 156 |
| 326 | 3300025916 | Ga0207663_11143859 | Ga0207663_111438592 | 156 |
| 327 | 3300025920 | Ga0207649_10011530 | Ga0207649_100115304 | 156 |
| 328 | 3300025921 | Ga0207652_10066497 | Ga0207652_100664972 | 156 |
| 329 | 3300025923 | Ga0207681_10049513 | Ga0207681_100495133 | 156 |
| 330 | 3300025925 | Ga0207650_10006587 | Ga0207650_100065872 | 156 |
| 331 | 3300025925 | Ga0207650_10640552 | Ga0207650_106405521 | 156 |
| 332 | 3300025926 | Ga0207659_10001994 | Ga0207659_100019949 | 156 |
| 333 | 3300025926 | Ga0207659_10083486 | Ga0207659_100834862 | 156 |
| 334 | 3300025926 | Ga0207659_10323128 | Ga0207659_103231282 | 156 |
| 335 | 3300025927 | Ga0207687_10306653 | Ga0207687_103066532 | 156 |
| 336 | 3300025929 | Ga0207664_10036152 | Ga0207664_100361522 | 156 |
| 337 | 3300025931 | Ga0207644_10045418 | Ga0207644_100454182 | 156 |
| 338 | 3300025932 | Ga0207690_11574561 | Ga0207690_115745611 | 156 |
| 339 | 3300025933 | Ga0207706_11095769 | Ga0207706_110957691 | 156 |
| 340 | 3300025936 | Ga0207670_10386246 | Ga0207670_103862462 | 156 |
| 341 | 3300025937 | Ga0207669_10058700 | Ga0207669_100587002 | 156 |
| 342 | 3300025937 | Ga0207669_10889296 | Ga0207669_108892962 | 156 |
| 343 | 3300025940 | Ga0207691_10000022 | Ga0207691_1000002249 | 156 |
| 344 | 3300025940 | Ga0207691_10032316 | Ga0207691_100323165 | 156 |
| 345 | 3300025942 | Ga0207689_10011258 | Ga0207689_100112584 | 156 |
| 346 | 3300025945 | Ga0207679_10076457 | Ga0207679_100764573 | 156 |
| 347 | 3300025945 | Ga0207679_11085889 | Ga0207679_110858891 | 156 |
| 348 | 3300025949 | Ga0207667_10012582 | Ga0207667_100125822 | 156 |
| 349 | 3300025949 | Ga0207667_10012658 | Ga0207667_100126584 | 156 |
| 350 | 3300025960 | Ga0207651_10008537 | Ga0207651_100085375 | 156 |
| 351 | 3300025961 | Ga0207712_10548820 | Ga0207712_105488202 | 156 |
| 352 | 3300025972 | Ga0207668_10003779 | Ga0207668_100037794 | 156 |
| 353 | 3300025972 | Ga0207668_10448573 | Ga0207668_104485731 | 156 |
| 354 | 3300025972 | Ga0207668_11790681 | Ga0207668_117906811 | 156 |
| 355 | 3300025981 | Ga0207640_11333567 | Ga0207640_113335672 | 156 |
| 356 | 3300025986 | Ga0207658_10041400 | Ga0207658_100414003 | 156 |
| 357 | 3300025986 | Ga0207658_10047658 | Ga0207658_100476582 | 156 |
| 358 | 3300026023 | Ga0207677_10012063 | Ga0207677_100120635 | 156 |
| 359 | 3300026023 | Ga0207677_10017587 | Ga0207677_100175875 | 156 |
| 360 | 3300026035 | Ga0207703_10070477 | Ga0207703_100704772 | 156 |
| 361 | 3300026041 | Ga0207639_10026571 | Ga0207639_100265712 | 156 |
| 362 | 3300026041 | Ga0207639_11001765 | Ga0207639_110017652 | 156 |
| 363 | 3300026088 | Ga0207641_10006556 | Ga0207641_100065562 | 156 |
| 364 | 3300026088 | Ga0207641_10137293 | Ga0207641_101372932 | 156 |
| 365 | 3300026088 | Ga0207641_12293335 | Ga0207641_122933351 | 156 |
| 366 | 3300026089 | Ga0207648_10017870 | Ga0207648_100178703 | 156 |
| 367 | 3300026089 | Ga0207648_10521893 | Ga0207648_105218932 | 156 |
| 368 | 3300026116 | Ga0207674_10092555 | Ga0207674_100925552 | 156 |
| 369 | 3300026118 | Ga0207675_100016851 | Ga0207675_1000168515 | 156 |
| 370 | 3300026118 | Ga0207675_100287668 | Ga0207675_1002876682 | 156 |
| 371 | 3300026118 | Ga0207675_100851294 | Ga0207675_1008512942 | 156 |
| 372 | 3300026121 | Ga0207683_10000283 | Ga0207683_1000028336 | 156 |
| 373 | 3300026121 | Ga0207683_10034269 | Ga0207683_100342694 | 156 |
| 374 | 3300026142 | Ga0207698_10114264 | Ga0207698_101142642 | 156 |
| 375 | 3300026142 | Ga0207698_10663535 | Ga0207698_106635352 | 156 |
| 376 | 3300028379 | Ga0268266_10245694 | Ga0268266_102456942 | 156 |
| 377 | 3300028379 | Ga0268266_11053747 | Ga0268266_110537472 | 156 |
| 378 | 3300028379 | Ga0268266_11120210 | Ga0268266_111202101 | 156 |
| 379 | 3300028380 | Ga0268265_10043968 | Ga0268265_100439682 | 156 |
| 380 | 3300028381 | Ga0268264_10052267 | Ga0268264_100522672 | 156 |
| 381 | 3300028381 | Ga0268264_10147980 | Ga0268264_101479801 | 156 |
| 382 | 3300031903 | Ga0307407_10622466 | Ga0307407_106224661 | 156 |
| 383 | 3300035170 | Ga0373943_0133270 | Ga0373943_0133270_301_771 | 156 |
| 384 | 3300035692 | Ga0373935_1305636 | Ga0373935_1305636_28_498 | 156 |
| 385 | 3300035695 | Ga0373927_0234179 | Ga0373927_0234179_645_1115 | 156 |
| 386 | 3300035725 | Ga0373947_0609784 | Ga0373947_0609784_222_692 | 156 |
| 387 | 3300036401 | Ga0373937_0177543 | Ga0373937_0177543_401_871 | 156 |
| 388 | 3300041451 | Ga0451791_1618681 | Ga0451791_1618681_33_512 | 156 |
| 389 | 3300041512 | Ga0451853_2765974 | Ga0451853_2765974_59_553 | 156 |
| 390 | 3300044901 | Ga0466960_0135938 | Ga0466960_0135938_787_1266 | 156 |
| 391 | 3300045051 | Ga0451576_0187687 | Ga0451576_0187687_757_1335 | 156 |
| 392 | 3300045976 | Ga0466967_1203478 | Ga0466967_1203478_144_626 | 156 |
| 393 | 3300046539 | Ga0495621_0164018 | Ga0495621_0164018_98_568 | 156 |
| 394 | 3300046543 | Ga0495645_0219254 | Ga0495645_0219254_61_549 | 156 |
| 395 | 3300046678 | Ga0495599_0753419 | Ga0495599_0753419_53_541 | 156 |
| 396 | 3300048903 | Ga0496100_0989548 | Ga0496100_0989548_137_631 | 156 |
| 397 | 3300048917 | Ga0496114_0163843 | Ga0496114_0163843_1279_1755 | 156 |
| 398 | 3300048917 | Ga0496114_0431513 | Ga0496114_0431513_258_743 | 156 |
| 399 | 3300049581 | Ga0501047_0357560 | Ga0501047_0357560_487_999 | 156 |
| 400 | 3300049583 | Ga0501067_0102919 | Ga0501067_0102919_636_1148 | 156 |
| 401 | 3300049585 | Ga0501069_0157360 | Ga0501069_0157360_786_1277 | 156 |
| 402 | 3300049589 | Ga0501073_0004503 | Ga0501073_0004503_8600_9112 | 156 |
| 403 | 3300049741 | Ga0501079_0386242 | Ga0501079_0386242_244_756 | 156 |
| 404 | 3300049742 | Ga0501080_0006277 | Ga0501080_0006277_5546_6058 | 156 |
| 405 | 3300049742 | Ga0501080_0063267 | Ga0501080_0063267_720_1211 | 156 |
| 406 | 3300050512 | nmdc:mga0n895_1590944_c1 | nmdc:mga0n895_1590944_c1_49_519 | 156 |
| 407 | 3300050512 | nmdc:mga0n895_689121_c1 | nmdc:mga0n895_689121_c1_322_792 | 156 |
| 408 | 3300005328 | Ga0070676_10283966 | Ga0070676_102839661 | 157 |
| 409 | 3300005328 | Ga0070676_10744773 | Ga0070676_107447732 | 157 |
| 410 | 3300005331 | Ga0070670_100000274 | Ga0070670_1000002744 | 157 |
| 411 | 3300005331 | Ga0070670_100052188 | Ga0070670_1000521883 | 157 |
| 412 | 3300005333 | Ga0070677_10192830 | Ga0070677_101928301 | 157 |
| 413 | 3300005333 | Ga0070677_10429711 | Ga0070677_104297112 | 157 |
| 414 | 3300005334 | Ga0068869_100001694 | Ga0068869_1000016949 | 157 |
| 415 | 3300005335 | Ga0070666_10007688 | Ga0070666_100076883 | 157 |
| 416 | 3300005336 | Ga0070680_100616184 | Ga0070680_1006161842 | 157 |
| 417 | 3300005338 | Ga0068868_100028710 | Ga0068868_1000287104 | 157 |
| 418 | 3300005340 | Ga0070689_100033049 | Ga0070689_1000330493 | 157 |
| 419 | 3300005344 | Ga0070661_100135124 | Ga0070661_1001351241 | 157 |
| 420 | 3300005344 | Ga0070661_100161595 | Ga0070661_1001615952 | 157 |
| 421 | 3300005347 | Ga0070668_100011160 | Ga0070668_1000111605 | 157 |
| 422 | 3300005347 | Ga0070668_100065340 | Ga0070668_1000653402 | 157 |
| 423 | 3300005347 | Ga0070668_100359662 | Ga0070668_1003596622 | 157 |
| 424 | 3300005353 | Ga0070669_100005562 | Ga0070669_1000055625 | 157 |
| 425 | 3300005353 | Ga0070669_100050895 | Ga0070669_1000508952 | 157 |
| 426 | 3300005353 | Ga0070669_100203979 | Ga0070669_1002039792 | 157 |
| 427 | 3300005364 | Ga0070673_100020047 | Ga0070673_1000200473 | 157 |
| 428 | 3300005364 | Ga0070673_100226902 | Ga0070673_1002269022 | 157 |
| 429 | 3300005367 | Ga0070667_100002746 | Ga0070667_1000027464 | 157 |
| 430 | 3300005367 | Ga0070667_100010007 | Ga0070667_1000100076 | 157 |
| 431 | 3300005367 | Ga0070667_100156797 | Ga0070667_1001567974 | 157 |
| 432 | 3300005367 | Ga0070667_100248565 | Ga0070667_1002485652 | 157 |
| 433 | 3300005367 | Ga0070667_101129898 | Ga0070667_1011298982 | 157 |
| 434 | 3300005435 | Ga0070714_100109749 | Ga0070714_1001097492 | 157 |
| 435 | 3300005436 | Ga0070713_100012321 | Ga0070713_1000123213 | 157 |
| 436 | 3300005437 | Ga0070710_10007894 | Ga0070710_100078943 | 157 |
| 437 | 3300005437 | Ga0070710_10218269 | Ga0070710_102182692 | 157 |
| 438 | 3300005439 | Ga0070711_100105943 | Ga0070711_1001059432 | 157 |
| 439 | 3300005441 | Ga0070700_100625458 | Ga0070700_1006254581 | 157 |
| 440 | 3300005444 | Ga0070694_100682336 | Ga0070694_1006823362 | 157 |
| 441 | 3300005455 | Ga0070663_100043787 | Ga0070663_1000437873 | 157 |
| 442 | 3300005456 | Ga0070678_100000982 | Ga0070678_10000098212 | 157 |
| 443 | 3300005456 | Ga0070678_100299571 | Ga0070678_1002995712 | 157 |
| 444 | 3300005458 | Ga0070681_10939589 | Ga0070681_109395891 | 157 |
| 445 | 3300005459 | Ga0068867_100009061 | Ga0068867_1000090614 | 157 |
| 446 | 3300005459 | Ga0068867_100019400 | Ga0068867_1000194004 | 157 |
| 447 | 3300005459 | Ga0068867_100501068 | Ga0068867_1005010682 | 157 |
| 448 | 3300005467 | Ga0070706_100281817 | Ga0070706_1002818173 | 157 |
| 449 | 3300005467 | Ga0070706_101135846 | Ga0070706_1011358462 | 157 |
| 450 | 3300005471 | Ga0070698_100772739 | Ga0070698_1007727392 | 157 |
| 451 | 3300005471 | Ga0070698_101251665 | Ga0070698_1012516652 | 157 |
| 452 | 3300005530 | Ga0070679_100696648 | Ga0070679_1006966482 | 157 |
| 453 | 3300005539 | Ga0068853_100366468 | Ga0068853_1003664682 | 157 |
| 454 | 3300005543 | Ga0070672_100007295 | Ga0070672_1000072954 | 157 |
| 455 | 3300005543 | Ga0070672_100105320 | Ga0070672_1001053202 | 157 |
| 456 | 3300005546 | Ga0070696_100004065 | Ga0070696_1000040658 | 157 |
| 457 | 3300005548 | Ga0070665_100002542 | Ga0070665_1000025424 | 157 |
| 458 | 3300005548 | Ga0070665_100578305 | Ga0070665_1005783052 | 157 |
| 459 | 3300005563 | Ga0068855_100057251 | Ga0068855_1000572512 | 157 |
| 460 | 3300005564 | Ga0070664_100345226 | Ga0070664_1003452262 | 157 |
| 461 | 3300005617 | Ga0068859_100006523 | Ga0068859_1000065234 | 157 |
| 462 | 3300005618 | Ga0068864_100005598 | Ga0068864_1000055984 | 157 |
| 463 | 3300005618 | Ga0068864_100310185 | Ga0068864_1003101852 | 157 |
| 464 | 3300005719 | Ga0068861_100001763 | Ga0068861_1000017638 | 157 |
| 465 | 3300005719 | Ga0068861_100052360 | Ga0068861_1000523602 | 157 |
| 466 | 3300005834 | Ga0068851_10489637 | Ga0068851_104896372 | 157 |
| 467 | 3300005841 | Ga0068863_100002100 | Ga0068863_1000021008 | 157 |
| 468 | 3300005841 | Ga0068863_100087053 | Ga0068863_1000870533 | 157 |
| 469 | 3300005842 | Ga0068858_100000612 | Ga0068858_10000061223 | 157 |
| 470 | 3300005842 | Ga0068858_100097393 | Ga0068858_1000973932 | 157 |
| 471 | 3300005842 | Ga0068858_100507461 | Ga0068858_1005074612 | 157 |
| 472 | 3300005843 | Ga0068860_100011838 | Ga0068860_1000118383 | 157 |
| 473 | 3300005843 | Ga0068860_100065973 | Ga0068860_1000659733 | 157 |
| 474 | 3300005843 | Ga0068860_101109312 | Ga0068860_1011093122 | 157 |
| 475 | 3300005843 | Ga0068860_101391817 | Ga0068860_1013918171 | 157 |
| 476 | 3300005844 | Ga0068862_100013014 | Ga0068862_1000130146 | 157 |
| 477 | 3300005844 | Ga0068862_100092127 | Ga0068862_1000921272 | 157 |
| 478 | 3300006237 | Ga0097621_100079081 | Ga0097621_1000790811 | 157 |
| 479 | 3300006358 | Ga0068871_101040792 | Ga0068871_1010407922 | 157 |
| 480 | 3300006358 | Ga0068871_101311839 | Ga0068871_1013118392 | 157 |
| 481 | 3300006844 | Ga0075428_100103504 | Ga0075428_1001035042 | 157 |
| 482 | 3300006871 | Ga0075434_100184957 | Ga0075434_1001849573 | 157 |
| 483 | 3300006881 | Ga0068865_100127465 | Ga0068865_1001274652 | 157 |
| 484 | 3300006881 | Ga0068865_100411915 | Ga0068865_1004119152 | 157 |
| 485 | 3300006931 | Ga0097620_100006521 | Ga0097620_1000065214 | 157 |
| 486 | 3300009093 | Ga0105240_10102436 | Ga0105240_101024362 | 157 |
| 487 | 3300009094 | Ga0111539_11399555 | Ga0111539_113995552 | 157 |
| 488 | 3300009098 | Ga0105245_10200008 | Ga0105245_102000082 | 157 |
| 489 | 3300009101 | Ga0105247_10010766 | Ga0105247_100107663 | 157 |
| 490 | 3300009147 | Ga0114129_10480688 | Ga0114129_104806881 | 157 |
| 491 | 3300009174 | Ga0105241_10121350 | Ga0105241_101213502 | 157 |
| 492 | 3300009177 | Ga0105248_10015240 | Ga0105248_100152404 | 157 |
| 493 | 3300009177 | Ga0105248_10657051 | Ga0105248_106570512 | 157 |
| 494 | 3300009177 | Ga0105248_10834945 | Ga0105248_108349452 | 157 |
| 495 | 3300009545 | Ga0105237_10183286 | Ga0105237_101832862 | 157 |
| 496 | 3300009551 | Ga0105238_10628665 | Ga0105238_106286652 | 157 |
| 497 | 3300009553 | Ga0105249_10855570 | Ga0105249_108555702 | 157 |
| 498 | 3300013104 | Ga0157370_10011858 | Ga0157370_100118585 | 157 |
| 499 | 3300013104 | Ga0157370_10183907 | Ga0157370_101839072 | 157 |
| 500 | 3300013105 | Ga0157369_10891388 | Ga0157369_108913882 | 157 |
| 501 | 3300013297 | Ga0157378_10090675 | Ga0157378_100906753 | 157 |
| 502 | 3300013306 | Ga0163162_10736234 | Ga0163162_107362342 | 157 |
| 503 | 3300013306 | Ga0163162_12199454 | Ga0163162_121994542 | 157 |
| 504 | 3300013307 | Ga0157372_10002828 | Ga0157372_100028289 | 157 |
| 505 | 3300013308 | Ga0157375_10049121 | Ga0157375_100491214 | 157 |
| 506 | 3300013308 | Ga0157375_10937588 | Ga0157375_109375882 | 157 |
| 507 | 3300013308 | Ga0157375_11246719 | Ga0157375_112467192 | 157 |
| 508 | 3300014325 | Ga0163163_10001190 | Ga0163163_100011904 | 157 |
| 509 | 3300014325 | Ga0163163_12136756 | Ga0163163_121367561 | 157 |
| 510 | 3300014326 | Ga0157380_10439444 | Ga0157380_104394442 | 157 |
| 511 | 3300014968 | Ga0157379_10000105 | Ga0157379_100001059 | 157 |
| 512 | 3300014968 | Ga0157379_10005162 | Ga0157379_100051622 | 157 |
| 513 | 3300014969 | Ga0157376_10003620 | Ga0157376_100036204 | 157 |
| 514 | 3300014969 | Ga0157376_10500411 | Ga0157376_105004112 | 157 |
| 515 | 3300025898 | Ga0207692_10004583 | Ga0207692_100045833 | 157 |
| 516 | 3300025900 | Ga0207710_10033039 | Ga0207710_100330392 | 157 |
| 517 | 3300025903 | Ga0207680_10047447 | Ga0207680_100474472 | 157 |
| 518 | 3300025906 | Ga0207699_10029083 | Ga0207699_100290832 | 157 |
| 519 | 3300025907 | Ga0207645_10155820 | Ga0207645_101558202 | 157 |
| 520 | 3300025907 | Ga0207645_10624679 | Ga0207645_106246792 | 157 |
| 521 | 3300025910 | Ga0207684_10413045 | Ga0207684_104130453 | 157 |
| 522 | 3300025913 | Ga0207695_10043837 | Ga0207695_100438373 | 157 |
| 523 | 3300025914 | Ga0207671_10507887 | Ga0207671_105078872 | 157 |
| 524 | 3300025916 | Ga0207663_10151028 | Ga0207663_101510282 | 157 |
| 525 | 3300025920 | Ga0207649_10094126 | Ga0207649_100941263 | 157 |
| 526 | 3300025920 | Ga0207649_10203692 | Ga0207649_102036922 | 157 |
| 527 | 3300025922 | Ga0207646_10786979 | Ga0207646_107869791 | 157 |
| 528 | 3300025923 | Ga0207681_10006193 | Ga0207681_100061939 | 157 |
| 529 | 3300025923 | Ga0207681_10190649 | Ga0207681_101906492 | 157 |
| 530 | 3300025925 | Ga0207650_10057166 | Ga0207650_100571662 | 157 |
| 531 | 3300025925 | Ga0207650_10060690 | Ga0207650_100606903 | 157 |
| 532 | 3300025928 | Ga0207700_10331872 | Ga0207700_103318722 | 157 |
| 533 | 3300025928 | Ga0207700_11272342 | Ga0207700_112723421 | 157 |
| 534 | 3300025929 | Ga0207664_10024542 | Ga0207664_100245422 | 157 |
| 535 | 3300025937 | Ga0207669_10005949 | Ga0207669_100059494 | 157 |
| 536 | 3300025938 | Ga0207704_10026968 | Ga0207704_100269683 | 157 |
| 537 | 3300025940 | Ga0207691_10067215 | Ga0207691_100672153 | 157 |
| 538 | 3300025940 | Ga0207691_11104910 | Ga0207691_111049102 | 157 |
| 539 | 3300025941 | Ga0207711_10028404 | Ga0207711_100284047 | 157 |
| 540 | 3300025941 | Ga0207711_10277556 | Ga0207711_102775563 | 157 |
| 541 | 3300025941 | Ga0207711_10946343 | Ga0207711_109463432 | 157 |
| 542 | 3300025942 | Ga0207689_10000147 | Ga0207689_1000014741 | 157 |
| 543 | 3300025949 | Ga0207667_10043293 | Ga0207667_100432937 | 157 |
| 544 | 3300025960 | Ga0207651_10012431 | Ga0207651_100124313 | 157 |
| 545 | 3300025961 | Ga0207712_10018851 | Ga0207712_100188513 | 157 |
| 546 | 3300025972 | Ga0207668_10021387 | Ga0207668_100213871 | 157 |
| 547 | 3300025972 | Ga0207668_10028298 | Ga0207668_100282984 | 157 |
| 548 | 3300025972 | Ga0207668_10786096 | Ga0207668_107860962 | 157 |
| 549 | 3300025986 | Ga0207658_10006239 | Ga0207658_100062394 | 157 |
| 550 | 3300025986 | Ga0207658_10008453 | Ga0207658_100084533 | 157 |
| 551 | 3300025986 | Ga0207658_10086932 | Ga0207658_100869322 | 157 |
| 552 | 3300025986 | Ga0207658_10363502 | Ga0207658_103635021 | 157 |
| 553 | 3300026035 | Ga0207703_10008603 | Ga0207703_100086034 | 157 |
| 554 | 3300026035 | Ga0207703_10188286 | Ga0207703_101882862 | 157 |
| 555 | 3300026041 | Ga0207639_10452391 | Ga0207639_104523912 | 157 |
| 556 | 3300026067 | Ga0207678_10073764 | Ga0207678_100737643 | 157 |
| 557 | 3300026075 | Ga0207708_10276330 | Ga0207708_102763302 | 157 |
| 558 | 3300026088 | Ga0207641_10004344 | Ga0207641_1000434413 | 157 |
| 559 | 3300026088 | Ga0207641_10581078 | Ga0207641_105810782 | 157 |
| 560 | 3300026089 | Ga0207648_10008541 | Ga0207648_100085417 | 157 |
| 561 | 3300026089 | Ga0207648_10034621 | Ga0207648_100346213 | 157 |
| 562 | 3300026095 | Ga0207676_10045405 | Ga0207676_100454051 | 157 |
| 563 | 3300026095 | Ga0207676_10543500 | Ga0207676_105435002 | 157 |
| 564 | 3300026095 | Ga0207676_11271944 | Ga0207676_112719441 | 157 |
| 565 | 3300026116 | Ga0207674_10007754 | Ga0207674_1000775414 | 157 |
| 566 | 3300026118 | Ga0207675_100008081 | Ga0207675_1000080813 | 157 |
| 567 | 3300026118 | Ga0207675_100051806 | Ga0207675_1000518063 | 157 |
| 568 | 3300026121 | Ga0207683_10003645 | Ga0207683_100036454 | 157 |
| 569 | 3300027907 | Ga0207428_10541739 | Ga0207428_105417391 | 157 |
| 570 | 3300028379 | Ga0268266_10028908 | Ga0268266_100289083 | 157 |
| 571 | 3300028379 | Ga0268266_10099851 | Ga0268266_100998513 | 157 |
| 572 | 3300028379 | Ga0268266_10431102 | Ga0268266_104311022 | 157 |
| 573 | 3300028380 | Ga0268265_10058560 | Ga0268265_100585603 | 157 |
| 574 | 3300028381 | Ga0268264_10010306 | Ga0268264_100103064 | 157 |
| 575 | 3300028381 | Ga0268264_10208457 | Ga0268264_102084572 | 157 |
| 576 | 3300031824 | Ga0307413_10976608 | Ga0307413_109766082 | 157 |
| 577 | 3300031995 | Ga0307409_100052609 | Ga0307409_1000526094 | 157 |
| 578 | 3300031995 | Ga0307409_100064535 | Ga0307409_1000645355 | 157 |
| 579 | 3300035695 | Ga0373927_0020040 | Ga0373927_0020040_2142_2702 | 157 |
| 580 | 3300035695 | Ga0373927_0149403 | Ga0373927_0149403_111_596 | 157 |
| 581 | 3300041441 | Ga0451787_352292 | Ga0451787_352292_84_566 | 157 |
| 582 | 3300042133 | Ga0450896_024507 | Ga0450896_024507_92_571 | 157 |
| 583 | 3300042436 | Ga0439435_0033489 | Ga0439435_0033489_11_508 | 157 |
| 584 | 3300044673 | Ga0453683_0240231 | Ga0453683_0240231_444_923 | 157 |
| 585 | 3300046472 | Ga0495580_0026495 | Ga0495580_0026495_1788_2273 | 157 |
| 586 | 3300046539 | Ga0495621_0094697 | Ga0495621_0094697_561_1058 | 157 |
| 587 | 3300046681 | Ga0495647_0472048 | Ga0495647_0472048_24_503 | 157 |
| 588 | 3300048905 | Ga0496102_0025261 | Ga0496102_0025261_4429_4908 | 157 |
| 589 | 3300048906 | Ga0496103_0033857 | Ga0496103_0033857_417_896 | 157 |
| 590 | 3300048911 | Ga0496108_1094493 | Ga0496108_1094493_78_566 | 157 |
| 591 | 3300048912 | Ga0496109_0032060 | Ga0496109_0032060_933_1412 | 157 |
| 592 | 3300048912 | Ga0496109_0068827 | Ga0496109_0068827_1463_1951 | 157 |
| 593 | 3300048913 | Ga0496110_0644977 | Ga0496110_0644977_396_890 | 157 |
| 594 | 3300048914 | Ga0496111_0206944 | Ga0496111_0206944_430_918 | 157 |
| 595 | 3300048915 | Ga0496112_0003208 | Ga0496112_0003208_6641_7129 | 157 |
| 596 | 3300048916 | Ga0496113_0195815 | Ga0496113_0195815_313_801 | 157 |
| 597 | 3300049591 | Ga0501075_0666380 | Ga0501075_0666380_47_535 | 157 |
| 598 | 3300050512 | nmdc:mga0n895_149246_c1 | nmdc:mga0n895_149246_c1_455_943 | 157 |
| 599 | 3300061734 | Ga0530510_0157164 | Ga0530510_0157164_368_856 | 157 |
| 600 | 3300001976 | JGI24752J21851_1039947 | JGI24752J21851_10399471 | 158 |
| 601 | 3300001978 | JGI24747J21853_1020088 | JGI24747J21853_10200882 | 158 |
| 602 | 3300001991 | JGI24743J22301_10012420 | JGI24743J22301_100124202 | 158 |
| 603 | 3300002070 | JGI24750J21931_1041320 | JGI24750J21931_10413202 | 158 |
| 604 | 3300002076 | JGI24749J21850_1005279 | JGI24749J21850_10052792 | 158 |
| 605 | 3300002077 | JGI24744J21845_10055969 | JGI24744J21845_100559692 | 158 |
| 606 | 3300005293 | Ga0065715_10171170 | Ga0065715_101711702 | 158 |
| 607 | 3300005327 | Ga0070658_10018601 | Ga0070658_100186011 | 158 |
| 608 | 3300005327 | Ga0070658_10110787 | Ga0070658_101107873 | 158 |
| 609 | 3300005327 | Ga0070658_10796618 | Ga0070658_107966181 | 158 |
| 610 | 3300005328 | Ga0070676_10000769 | Ga0070676_100007692 | 158 |
| 611 | 3300005328 | Ga0070676_10005593 | Ga0070676_100055933 | 158 |
| 612 | 3300005329 | Ga0070683_100129952 | Ga0070683_1001299523 | 158 |
| 613 | 3300005330 | Ga0070690_100009005 | Ga0070690_1000090052 | 158 |
| 614 | 3300005331 | Ga0070670_100097188 | Ga0070670_1000971882 | 158 |
| 615 | 3300005331 | Ga0070670_100138970 | Ga0070670_1001389703 | 158 |
| 616 | 3300005333 | Ga0070677_10000132 | Ga0070677_1000013221 | 158 |
| 617 | 3300005333 | Ga0070677_10009216 | Ga0070677_100092163 | 158 |
| 618 | 3300005334 | Ga0068869_100208930 | Ga0068869_1002089302 | 158 |
| 619 | 3300005335 | Ga0070666_10006650 | Ga0070666_100066502 | 158 |
| 620 | 3300005335 | Ga0070666_10094719 | Ga0070666_100947192 | 158 |
| 621 | 3300005335 | Ga0070666_10290317 | Ga0070666_102903172 | 158 |
| 622 | 3300005338 | Ga0068868_100005576 | Ga0068868_1000055764 | 158 |
| 623 | 3300005338 | Ga0068868_101232518 | Ga0068868_1012325181 | 158 |
| 624 | 3300005338 | Ga0068868_101393863 | Ga0068868_1013938632 | 158 |
| 625 | 3300005339 | Ga0070660_100602224 | Ga0070660_1006022241 | 158 |
| 626 | 3300005340 | Ga0070689_100008003 | Ga0070689_1000080032 | 158 |
| 627 | 3300005344 | Ga0070661_100004644 | Ga0070661_1000046442 | 158 |
| 628 | 3300005344 | Ga0070661_100055801 | Ga0070661_1000558012 | 158 |
| 629 | 3300005345 | Ga0070692_10037400 | Ga0070692_100374002 | 158 |
| 630 | 3300005347 | Ga0070668_100000394 | Ga0070668_10000039417 | 158 |
| 631 | 3300005353 | Ga0070669_100052789 | Ga0070669_1000527892 | 158 |
| 632 | 3300005353 | Ga0070669_100097767 | Ga0070669_1000977672 | 158 |
| 633 | 3300005353 | Ga0070669_100844652 | Ga0070669_1008446521 | 158 |
| 634 | 3300005354 | Ga0070675_100008918 | Ga0070675_1000089182 | 158 |
| 635 | 3300005354 | Ga0070675_100032421 | Ga0070675_1000324213 | 158 |
| 636 | 3300005355 | Ga0070671_100013129 | Ga0070671_1000131292 | 158 |
| 637 | 3300005355 | Ga0070671_100206170 | Ga0070671_1002061702 | 158 |
| 638 | 3300005355 | Ga0070671_100472906 | Ga0070671_1004729062 | 158 |
| 639 | 3300005356 | Ga0070674_100001114 | Ga0070674_10000111413 | 158 |
| 640 | 3300005356 | Ga0070674_100069827 | Ga0070674_1000698272 | 158 |
| 641 | 3300005364 | Ga0070673_100002042 | Ga0070673_1000020422 | 158 |
| 642 | 3300005364 | Ga0070673_100133514 | Ga0070673_1001335142 | 158 |
| 643 | 3300005364 | Ga0070673_100163834 | Ga0070673_1001638342 | 158 |
| 644 | 3300005365 | Ga0070688_100003905 | Ga0070688_1000039055 | 158 |
| 645 | 3300005366 | Ga0070659_100067006 | Ga0070659_1000670062 | 158 |
| 646 | 3300005367 | Ga0070667_100021181 | Ga0070667_1000211812 | 158 |
| 647 | 3300005367 | Ga0070667_101109627 | Ga0070667_1011096272 | 158 |
| 648 | 3300005438 | Ga0070701_10066184 | Ga0070701_100661842 | 158 |
| 649 | 3300005441 | Ga0070700_100021916 | Ga0070700_1000219162 | 158 |
| 650 | 3300005455 | Ga0070663_100019255 | Ga0070663_1000192553 | 158 |
| 651 | 3300005455 | Ga0070663_100076206 | Ga0070663_1000762062 | 158 |
| 652 | 3300005456 | Ga0070678_100001348 | Ga0070678_1000013486 | 158 |
| 653 | 3300005456 | Ga0070678_100085937 | Ga0070678_1000859372 | 158 |
| 654 | 3300005457 | Ga0070662_100083792 | Ga0070662_1000837922 | 158 |
| 655 | 3300005457 | Ga0070662_100223556 | Ga0070662_1002235562 | 158 |
| 656 | 3300005459 | Ga0068867_100003590 | Ga0068867_1000035906 | 158 |
| 657 | 3300005459 | Ga0068867_100077601 | Ga0068867_1000776012 | 158 |
| 658 | 3300005466 | Ga0070685_10002380 | Ga0070685_100023807 | 158 |
| 659 | 3300005535 | Ga0070684_100093491 | Ga0070684_1000934911 | 158 |
| 660 | 3300005535 | Ga0070684_100499945 | Ga0070684_1004999452 | 158 |
| 661 | 3300005539 | Ga0068853_100002757 | Ga0068853_1000027573 | 158 |
| 662 | 3300005543 | Ga0070672_100000914 | Ga0070672_10000091418 | 158 |
| 663 | 3300005543 | Ga0070672_100042554 | Ga0070672_1000425543 | 158 |
| 664 | 3300005543 | Ga0070672_101066203 | Ga0070672_1010662031 | 158 |
| 665 | 3300005544 | Ga0070686_100085731 | Ga0070686_1000857311 | 158 |
| 666 | 3300005547 | Ga0070693_100691402 | Ga0070693_1006914022 | 158 |
| 667 | 3300005548 | Ga0070665_100012901 | Ga0070665_1000129017 | 158 |
| 668 | 3300005548 | Ga0070665_100121697 | Ga0070665_1001216972 | 158 |
| 669 | 3300005548 | Ga0070665_100637102 | Ga0070665_1006371022 | 158 |
| 670 | 3300005548 | Ga0070665_101173044 | Ga0070665_1011730442 | 158 |
| 671 | 3300005564 | Ga0070664_100013440 | Ga0070664_1000134402 | 158 |
| 672 | 3300005564 | Ga0070664_100083468 | Ga0070664_1000834682 | 158 |
| 673 | 3300005577 | Ga0068857_100010671 | Ga0068857_1000106715 | 158 |
| 674 | 3300005578 | Ga0068854_100055101 | Ga0068854_1000551012 | 158 |
| 675 | 3300005578 | Ga0068854_100196971 | Ga0068854_1001969712 | 158 |
| 676 | 3300005614 | Ga0068856_100365263 | Ga0068856_1003652632 | 158 |
| 677 | 3300005615 | Ga0070702_100133372 | Ga0070702_1001333721 | 158 |
| 678 | 3300005616 | Ga0068852_100002691 | Ga0068852_1000026914 | 158 |
| 679 | 3300005616 | Ga0068852_100024896 | Ga0068852_1000248963 | 158 |
| 680 | 3300005616 | Ga0068852_100088668 | Ga0068852_1000886682 | 158 |
| 681 | 3300005617 | Ga0068859_100084366 | Ga0068859_1000843662 | 158 |
| 682 | 3300005618 | Ga0068864_100007903 | Ga0068864_1000079033 | 158 |
| 683 | 3300005618 | Ga0068864_100009458 | Ga0068864_1000094587 | 158 |
| 684 | 3300005618 | Ga0068864_100009678 | Ga0068864_1000096788 | 158 |
| 685 | 3300005718 | Ga0068866_10057543 | Ga0068866_100575432 | 158 |
| 686 | 3300005718 | Ga0068866_10063584 | Ga0068866_100635842 | 158 |
| 687 | 3300005719 | Ga0068861_100012929 | Ga0068861_1000129292 | 158 |
| 688 | 3300005834 | Ga0068851_10007676 | Ga0068851_100076764 | 158 |
| 689 | 3300005834 | Ga0068851_10026215 | Ga0068851_100262152 | 158 |
| 690 | 3300005834 | Ga0068851_10387280 | Ga0068851_103872802 | 158 |
| 691 | 3300005840 | Ga0068870_10027358 | Ga0068870_100273582 | 158 |
| 692 | 3300005841 | Ga0068863_100013029 | Ga0068863_1000130295 | 158 |
| 693 | 3300005841 | Ga0068863_100026961 | Ga0068863_1000269613 | 158 |
| 694 | 3300005841 | Ga0068863_100195704 | Ga0068863_1001957042 | 158 |
| 695 | 3300005842 | Ga0068858_100055030 | Ga0068858_1000550303 | 158 |
| 696 | 3300005843 | Ga0068860_100023346 | Ga0068860_1000233466 | 158 |
| 697 | 3300005843 | Ga0068860_100044277 | Ga0068860_1000442772 | 158 |
| 698 | 3300005844 | Ga0068862_100088427 | Ga0068862_1000884273 | 158 |
| 699 | 3300006237 | Ga0097621_100225486 | Ga0097621_1002254862 | 158 |
| 700 | 3300006358 | Ga0068871_100003825 | Ga0068871_10000382511 | 158 |
| 701 | 3300006358 | Ga0068871_100118990 | Ga0068871_1001189902 | 158 |
| 702 | 3300006871 | Ga0075434_100070066 | Ga0075434_1000700662 | 158 |
| 703 | 3300006881 | Ga0068865_100128349 | Ga0068865_1001283492 | 158 |
| 704 | 3300006914 | Ga0075436_100529516 | Ga0075436_1005295162 | 158 |
| 705 | 3300006931 | Ga0097620_100084360 | Ga0097620_1000843603 | 158 |
| 706 | 3300007076 | Ga0075435_100446474 | Ga0075435_1004464741 | 158 |
| 707 | 3300007076 | Ga0075435_101082020 | Ga0075435_1010820201 | 158 |
| 708 | 3300009094 | Ga0111539_10183588 | Ga0111539_101835882 | 158 |
| 709 | 3300009147 | Ga0114129_10354316 | Ga0114129_103543162 | 158 |
| 710 | 3300009148 | Ga0105243_10118295 | Ga0105243_101182952 | 158 |
| 711 | 3300009176 | Ga0105242_10428620 | Ga0105242_104286202 | 158 |
| 712 | 3300009177 | Ga0105248_10025258 | Ga0105248_100252584 | 158 |
| 713 | 3300009177 | Ga0105248_10072760 | Ga0105248_100727602 | 158 |
| 714 | 3300009551 | Ga0105238_10626678 | Ga0105238_106266782 | 158 |
| 715 | 3300009553 | Ga0105249_10074146 | Ga0105249_100741463 | 158 |
| 716 | 3300011119 | Ga0105246_10329619 | Ga0105246_103296192 | 158 |
| 717 | 3300013100 | Ga0157373_10337764 | Ga0157373_103377642 | 158 |
| 718 | 3300013102 | Ga0157371_10096730 | Ga0157371_100967302 | 158 |
| 719 | 3300013105 | Ga0157369_10135579 | Ga0157369_101355793 | 158 |
| 720 | 3300013296 | Ga0157374_10063682 | Ga0157374_100636823 | 158 |
| 721 | 3300013296 | Ga0157374_10103382 | Ga0157374_101033823 | 158 |
| 722 | 3300013296 | Ga0157374_10142988 | Ga0157374_101429882 | 158 |
| 723 | 3300013296 | Ga0157374_10361450 | Ga0157374_103614503 | 158 |
| 724 | 3300013297 | Ga0157378_10436705 | Ga0157378_104367052 | 158 |
| 725 | 3300013297 | Ga0157378_10718677 | Ga0157378_107186772 | 158 |
| 726 | 3300013297 | Ga0157378_10754127 | Ga0157378_107541272 | 158 |
| 727 | 3300013306 | Ga0163162_10431489 | Ga0163162_104314892 | 158 |
| 728 | 3300013307 | Ga0157372_10148713 | Ga0157372_101487133 | 158 |
| 729 | 3300013307 | Ga0157372_10310060 | Ga0157372_103100602 | 158 |
| 730 | 3300013308 | Ga0157375_10002602 | Ga0157375_100026022 | 158 |
| 731 | 3300013308 | Ga0157375_10484297 | Ga0157375_104842972 | 158 |
| 732 | 3300014325 | Ga0163163_10010520 | Ga0163163_100105206 | 158 |
| 733 | 3300014325 | Ga0163163_10029634 | Ga0163163_100296345 | 158 |
| 734 | 3300014326 | Ga0157380_10005687 | Ga0157380_100056872 | 158 |
| 735 | 3300014497 | Ga0182008_10177367 | Ga0182008_101773672 | 158 |
| 736 | 3300014745 | Ga0157377_10000871 | Ga0157377_100008714 | 158 |
| 737 | 3300014745 | Ga0157377_10712551 | Ga0157377_107125512 | 158 |
| 738 | 3300014968 | Ga0157379_10008015 | Ga0157379_100080155 | 158 |
| 739 | 3300014968 | Ga0157379_10378272 | Ga0157379_103782722 | 158 |
| 740 | 3300014969 | Ga0157376_10087209 | Ga0157376_100872092 | 158 |
| 741 | 3300014969 | Ga0157376_10427683 | Ga0157376_104276832 | 158 |
| 742 | 3300017792 | Ga0163161_10019913 | Ga0163161_100199134 | 158 |
| 743 | 3300017792 | Ga0163161_10023041 | Ga0163161_100230413 | 158 |
| 744 | 3300017792 | Ga0163161_10632561 | Ga0163161_106325612 | 158 |
| 745 | 3300025315 | Ga0207697_10000471 | Ga0207697_1000047116 | 158 |
| 746 | 3300025315 | Ga0207697_10058323 | Ga0207697_100583232 | 158 |
| 747 | 3300025321 | Ga0207656_10006239 | Ga0207656_100062392 | 158 |
| 748 | 3300025321 | Ga0207656_10012737 | Ga0207656_100127372 | 158 |
| 749 | 3300025893 | Ga0207682_10000044 | Ga0207682_1000004430 | 158 |
| 750 | 3300025893 | Ga0207682_10001806 | Ga0207682_100018065 | 158 |
| 751 | 3300025899 | Ga0207642_10057585 | Ga0207642_100575852 | 158 |
| 752 | 3300025899 | Ga0207642_10066733 | Ga0207642_100667332 | 158 |
| 753 | 3300025901 | Ga0207688_10100088 | Ga0207688_101000882 | 158 |
| 754 | 3300025903 | Ga0207680_10002742 | Ga0207680_100027423 | 158 |
| 755 | 3300025903 | Ga0207680_10019059 | Ga0207680_100190592 | 158 |
| 756 | 3300025907 | Ga0207645_10001325 | Ga0207645_100013252 | 158 |
| 757 | 3300025907 | Ga0207645_10004314 | Ga0207645_1000431410 | 158 |
| 758 | 3300025908 | Ga0207643_10000161 | Ga0207643_100001616 | 158 |
| 759 | 3300025909 | Ga0207705_10158344 | Ga0207705_101583442 | 158 |
| 760 | 3300025909 | Ga0207705_10159353 | Ga0207705_101593532 | 158 |
| 761 | 3300025909 | Ga0207705_10631640 | Ga0207705_106316401 | 158 |
| 762 | 3300025918 | Ga0207662_10070704 | Ga0207662_100707042 | 158 |
| 763 | 3300025920 | Ga0207649_10056800 | Ga0207649_100568002 | 158 |
| 764 | 3300025920 | Ga0207649_10239984 | Ga0207649_102399842 | 158 |
| 765 | 3300025921 | Ga0207652_10444666 | Ga0207652_104446662 | 158 |
| 766 | 3300025923 | Ga0207681_10182954 | Ga0207681_101829541 | 158 |
| 767 | 3300025923 | Ga0207681_10274609 | Ga0207681_102746092 | 158 |
| 768 | 3300025924 | Ga0207694_10895945 | Ga0207694_108959451 | 158 |
| 769 | 3300025925 | Ga0207650_10001658 | Ga0207650_1000165815 | 158 |
| 770 | 3300025925 | Ga0207650_10113441 | Ga0207650_101134413 | 158 |
| 771 | 3300025925 | Ga0207650_10331078 | Ga0207650_103310782 | 158 |
| 772 | 3300025926 | Ga0207659_10002849 | Ga0207659_100028497 | 158 |
| 773 | 3300025926 | Ga0207659_10003224 | Ga0207659_100032244 | 158 |
| 774 | 3300025931 | Ga0207644_10004238 | Ga0207644_100042386 | 158 |
| 775 | 3300025931 | Ga0207644_10728657 | Ga0207644_107286571 | 158 |
| 776 | 3300025931 | Ga0207644_10754011 | Ga0207644_107540111 | 158 |
| 777 | 3300025933 | Ga0207706_10050271 | Ga0207706_100502713 | 158 |
| 778 | 3300025935 | Ga0207709_10531951 | Ga0207709_105319512 | 158 |
| 779 | 3300025937 | Ga0207669_10025077 | Ga0207669_100250772 | 158 |
| 780 | 3300025938 | Ga0207704_10041359 | Ga0207704_100413592 | 158 |
| 781 | 3300025938 | Ga0207704_10781205 | Ga0207704_107812051 | 158 |
| 782 | 3300025940 | Ga0207691_10000224 | Ga0207691_1000022414 | 158 |
| 783 | 3300025940 | Ga0207691_10059374 | Ga0207691_100593742 | 158 |
| 784 | 3300025940 | Ga0207691_10358264 | Ga0207691_103582642 | 158 |
| 785 | 3300025940 | Ga0207691_10451591 | Ga0207691_104515912 | 158 |
| 786 | 3300025941 | Ga0207711_10012405 | Ga0207711_100124052 | 158 |
| 787 | 3300025941 | Ga0207711_10178994 | Ga0207711_101789942 | 158 |
| 788 | 3300025941 | Ga0207711_10205488 | Ga0207711_102054882 | 158 |
| 789 | 3300025942 | Ga0207689_10002088 | Ga0207689_1000208815 | 158 |
| 790 | 3300025944 | Ga0207661_10015607 | Ga0207661_100156073 | 158 |
| 791 | 3300025944 | Ga0207661_10243076 | Ga0207661_102430762 | 158 |
| 792 | 3300025945 | Ga0207679_10079241 | Ga0207679_100792411 | 158 |
| 793 | 3300025949 | Ga0207667_10426822 | Ga0207667_104268222 | 158 |
| 794 | 3300025960 | Ga0207651_10005388 | Ga0207651_100053886 | 158 |
| 795 | 3300025960 | Ga0207651_10031308 | Ga0207651_100313082 | 158 |
| 796 | 3300025960 | Ga0207651_10747120 | Ga0207651_107471202 | 158 |
| 797 | 3300025972 | Ga0207668_10016076 | Ga0207668_100160762 | 158 |
| 798 | 3300025972 | Ga0207668_10545576 | Ga0207668_105455762 | 158 |
| 799 | 3300025981 | Ga0207640_10062054 | Ga0207640_100620542 | 158 |
| 800 | 3300025981 | Ga0207640_10091620 | Ga0207640_100916202 | 158 |
| 801 | 3300025986 | Ga0207658_10011567 | Ga0207658_100115676 | 158 |
| 802 | 3300025986 | Ga0207658_10068524 | Ga0207658_100685242 | 158 |
| 803 | 3300026023 | Ga0207677_10009797 | Ga0207677_100097974 | 158 |
| 804 | 3300026023 | Ga0207677_10246566 | Ga0207677_102465662 | 158 |
| 805 | 3300026035 | Ga0207703_10111517 | Ga0207703_101115173 | 158 |
| 806 | 3300026035 | Ga0207703_10558159 | Ga0207703_105581591 | 158 |
| 807 | 3300026041 | Ga0207639_10006189 | Ga0207639_100061896 | 158 |
| 808 | 3300026067 | Ga0207678_10002769 | Ga0207678_100027695 | 158 |
| 809 | 3300026067 | Ga0207678_10021448 | Ga0207678_100214486 | 158 |
| 810 | 3300026067 | Ga0207678_10035040 | Ga0207678_100350405 | 158 |
| 811 | 3300026067 | Ga0207678_10255117 | Ga0207678_102551173 | 158 |
| 812 | 3300026075 | Ga0207708_10000330 | Ga0207708_1000033019 | 158 |
| 813 | 3300026078 | Ga0207702_10811243 | Ga0207702_108112431 | 158 |
| 814 | 3300026088 | Ga0207641_10010037 | Ga0207641_100100376 | 158 |
| 815 | 3300026088 | Ga0207641_10197281 | Ga0207641_101972812 | 158 |
| 816 | 3300026089 | Ga0207648_10003749 | Ga0207648_100037498 | 158 |
| 817 | 3300026089 | Ga0207648_10062181 | Ga0207648_100621813 | 158 |
| 818 | 3300026095 | Ga0207676_10004846 | Ga0207676_100048467 | 158 |
| 819 | 3300026095 | Ga0207676_10009364 | Ga0207676_100093642 | 158 |
| 820 | 3300026095 | Ga0207676_10062168 | Ga0207676_100621681 | 158 |
| 821 | 3300026095 | Ga0207676_10565440 | Ga0207676_105654401 | 158 |
| 822 | 3300026095 | Ga0207676_11738167 | Ga0207676_117381671 | 158 |
| 823 | 3300026116 | Ga0207674_10000775 | Ga0207674_1000077530 | 158 |
| 824 | 3300026118 | Ga0207675_100000632 | Ga0207675_10000063230 | 158 |
| 825 | 3300026118 | Ga0207675_100072589 | Ga0207675_1000725892 | 158 |
| 826 | 3300026118 | Ga0207675_102020633 | Ga0207675_1020206331 | 158 |
| 827 | 3300026121 | Ga0207683_10001343 | Ga0207683_100013438 | 158 |
| 828 | 3300026121 | Ga0207683_10126863 | Ga0207683_101268632 | 158 |
| 829 | 3300026121 | Ga0207683_11275720 | Ga0207683_112757201 | 158 |
| 830 | 3300026142 | Ga0207698_10006776 | Ga0207698_100067764 | 158 |
| 831 | 3300026142 | Ga0207698_10065023 | Ga0207698_100650231 | 158 |
| 832 | 3300027907 | Ga0207428_10878303 | Ga0207428_108783031 | 158 |
| 833 | 3300028379 | Ga0268266_10003808 | Ga0268266_1000380812 | 158 |
| 834 | 3300028379 | Ga0268266_10126500 | Ga0268266_101265003 | 158 |
| 835 | 3300028379 | Ga0268266_10486078 | Ga0268266_104860782 | 158 |
| 836 | 3300028379 | Ga0268266_11062613 | Ga0268266_110626131 | 158 |
| 837 | 3300028380 | Ga0268265_10806234 | Ga0268265_108062341 | 158 |
| 838 | 3300028381 | Ga0268264_10020581 | Ga0268264_100205813 | 158 |
| 839 | 3300028381 | Ga0268264_11634814 | Ga0268264_116348141 | 158 |
| 840 | 3300031235 | Ga0265330_10004514 | Ga0265330_100045142 | 158 |
| 841 | 3300031238 | Ga0265332_10000141 | Ga0265332_1000014152 | 158 |
| 842 | 3300031241 | Ga0265325_10016639 | Ga0265325_100166392 | 158 |
| 843 | 3300031249 | Ga0265339_10029144 | Ga0265339_100291443 | 158 |
| 844 | 3300031250 | Ga0265331_10000972 | Ga0265331_1000097218 | 158 |
| 845 | 3300031251 | Ga0265327_10003882 | Ga0265327_100038829 | 158 |
| 846 | 3300031344 | Ga0265316_10086543 | Ga0265316_100865432 | 158 |
| 847 | 3300031712 | Ga0265342_10005713 | Ga0265342_100057133 | 158 |
| 848 | 3300031901 | Ga0307406_10061367 | Ga0307406_100613673 | 158 |
| 849 | 3300034818 | Ga0373950_0050516 | Ga0373950_0050516_101_577 | 158 |
| 850 | 3300035114 | Ga0373939_0194589 | Ga0373939_0194589_246_725 | 158 |
| 851 | 3300035171 | Ga0373946_0066304 | Ga0373946_0066304_631_1107 | 158 |
| 852 | 3300038443 | Ga0395901_0706468 | Ga0395901_0706468_368_886 | 158 |
| 853 | 3300046459 | Ga0495629_0101132 | Ga0495629_0101132_1369_1863 | 158 |
| 854 | 3300046537 | Ga0495598_0082323 | Ga0495598_0082323_106_582 | 158 |
| 855 | 3300046539 | Ga0495621_0012018 | Ga0495621_0012018_2034_2510 | 158 |
| 856 | 3300048903 | Ga0496100_0095140 | Ga0496100_0095140_464_940 | 158 |
| 857 | 3300048904 | Ga0496101_0223571 | Ga0496101_0223571_498_974 | 158 |
| 858 | 3300048905 | Ga0496102_0254880 | Ga0496102_0254880_725_1201 | 158 |
| 859 | 3300048907 | Ga0496104_0042538 | Ga0496104_0042538_700_1176 | 158 |
| 860 | 3300048908 | Ga0496105_0003965 | Ga0496105_0003965_428_904 | 158 |
| 861 | 3300048909 | Ga0496106_1017183 | Ga0496106_1017183_147_629 | 158 |
| 862 | 3300048910 | Ga0496107_0067797 | Ga0496107_0067797_1037_1513 | 158 |
| 863 | 3300048911 | Ga0496108_0004799 | Ga0496108_0004799_8752_9228 | 158 |
| 864 | 3300048912 | Ga0496109_0005301 | Ga0496109_0005301_6185_6661 | 158 |
| 865 | 3300048913 | Ga0496110_0085364 | Ga0496110_0085364_84_560 | 158 |
| 866 | 3300048913 | Ga0496110_0441705 | Ga0496110_0441705_624_1106 | 158 |
| 867 | 3300048915 | Ga0496112_0575784 | Ga0496112_0575784_138_614 | 158 |
| 868 | 3300048916 | Ga0496113_0278327 | Ga0496113_0278327_209_685 | 158 |
| 869 | 3300048917 | Ga0496114_0034466 | Ga0496114_0034466_618_1094 | 158 |
| 870 | 3300050507 | nmdc:mga05p37_372262_c1 | nmdc:mga05p37_372262_c1_215_697 | 158 |
| 871 | 3300050511 | nmdc:mga08y16_571109_c1 | nmdc:mga08y16_571109_c1_534_1010 | 158 |
| 872 | 3300050512 | nmdc:mga0n895_825838_c1 | nmdc:mga0n895_825838_c1_77_559 | 158 |
| 873 | 3300050513 | nmdc:mga0rr50_125018_c1 | nmdc:mga0rr50_125018_c1_1251_1733 | 158 |
| 874 | 3300053084 | Ga0495595_0546880 | Ga0495595_0546880_53_544 | 158 |
| 875 | 3300053085 | Ga0495619_0442441 | Ga0495619_0442441_295_789 | 158 |
| 876 | 3300053085 | Ga0495619_0630544 | Ga0495619_0630544_29_505 | 158 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6a55-assembly1.cif.gz_B | crystal structure of dddk mutant y122a | 0.913 | 46 | 124 |
| 2pyt-assembly1.cif.gz_B | crystal structure of a putative ethanolamine utilization protein q (eutq, stm2468) from salmonella typhimurium lt2 at 1.90 a resolution | 0.9095 | 46 | 124 |
| 7zyb-assembly1.cif.gz_A | bekdgf with ca | 0.9022 | 46 | 127 |
| 3nst-assembly1.cif.gz_A | crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans | 0.8922 | 46 | 124 |
| 6o2d-assembly1.cif.gz_A | schizosaccharomyces pombe cnp3 cupin domain | 0.8867 | 41 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9USR9_537_626_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9176 | 44 | 125 | 2.60.120.10 |
| 3nvcA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9098 | 46 | 124 | 2.60.120.10 |
| af_Q2G2A6_62_177_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9038 | 46 | 126 | 2.60.120.10 |
| af_Q59013_3_123_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9015 | 45 | 124 | 2.60.120.10 |
| af_A0A1D8PPZ7_421_512_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8924 | 46 | 126 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1NSL9-F1-model_v4 | Cupin domain-containing protein | 0.9402 | 46 | 125 |
|
| AF-A0A1T3NQY4-F1-model_v4 | Cupin 2 conserved barrel domain-containing protein | 0.9234 | 46 | 125 |
|
| AF-A0A2E2VFP7-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9231 | 46 | 124 |
|
| AF-A0A6N8V5M9-F1-model_v4 | Cupin domain-containing protein | 0.923 | 46 | 124 |
|
| AF-A0A327HQN2-F1-model_v4 | Cupin | 0.9225 | 46 | 124 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar