F484324

General Info

Members Datasets Scaffolds Average Seq Length
875 559 701 232

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10309168|Ga0207661_103091682
Length 270
Sequence MIELRPFAKLGGADHGWLKAKHHFSFASYYDPNNMSHGALRVWNDDEIAPNTGFPAHPHANMEIITYVREGAITHQDSLGNKGRTEAGDVQVMSAGSGIRHSEYNLEPTLTRIFQIWIEPTTHGGQPTWGSKPFPKSNRSGKLVTIASGLPGDTDALPIRADARVLATTLKAGESAQYAADKARNLYLVPAAGSVEVNGVRVNARDGAAISGHNHVDHRCSHAEQRYPGTDRISARHRRSAPDQGTQINRPDQGQMESGVVHAVSPRPQC

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
8 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
11 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
16 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
17 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
18 2643221651 Afipia sp. Root123D2 Isolate Unclassified
19 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
20 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
21 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
22 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
23 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
24 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
25 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
26 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
27 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
28 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
29 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
30 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
31 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
32 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
33 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
34 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
35 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
36 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
37 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
38 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
39 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
40 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
41 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
42 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
43 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
44 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
45 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
46 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
47 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
48 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
49 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
50 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
51 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
52 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
53 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
54 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
55 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
56 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
57 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
58 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
59 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
60 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
61 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
62 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
63 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
64 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
65 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
66 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
67 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
68 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
69 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
70 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
71 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
72 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
73 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
74 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
75 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
76 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
77 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
78 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
79 2922368715
80 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
81 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
82 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
83 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
84 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
85 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
86 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
87 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
88 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
89 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
90 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
91 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
92 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
93 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
94 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
95 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
96 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
97 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
98 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
99 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
100 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
101 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
102 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
103 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
104 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
105 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
106 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
107 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
108 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
109 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
110 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
111 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
112 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
113 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
114 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
115 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
116 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
117 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
118 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
119 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
120 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
121 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
122 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
123 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
124 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
125 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
126 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
127 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
128 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
129 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
130 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
131 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
132 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
133 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
134 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
135 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
136 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
137 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
138 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
139 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
140 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
141 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
142 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
143 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
144 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
145 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
146 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
147 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
148 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
150 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
151 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
152 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
153 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
154 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
155 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
156 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
157 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
158 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
159 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
160 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
161 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
162 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
163 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
164 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
165 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
166 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
167 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
168 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
169 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
170 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
171 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
172 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
173 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
174 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
175 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
176 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
177 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
178 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
179 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
180 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
181 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
182 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
183 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
184 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
185 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
186 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
187 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
188 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
189 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
190 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
191 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
192 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
193 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
194 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
195 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
196 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
197 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
198 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
199 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
200 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
201 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
202 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
203 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
204 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
205 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
206 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
207 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
208 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
209 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
210 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
211 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
212 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
213 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
214 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
215 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
216 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
217 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
218 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
219 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
220 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
221 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
222 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
223 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
224 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
225 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
226 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
227 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
228 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
229 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
230 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
231 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
232 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
233 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
234 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
235 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
236 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
237 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
240 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
242 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
243 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
244 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
245 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
296 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
297 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
298 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
299 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
300 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
304 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
305 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
307 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
308 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
309 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
310 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
311 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
312 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
313 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
314 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
315 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
316 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
317 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
318 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
319 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
320 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
321 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
322 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
323 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
324 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
325 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
326 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
327 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
328 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
329 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
330 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
331 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
332 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
333 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
334 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
335 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
336 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
337 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
338 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
339 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
340 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
341 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
342 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
343 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
344 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
345 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
346 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
347 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
348 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
349 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
350 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
351 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
352 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
353 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
354 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
355 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
356 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
357 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
358 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
359 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
360 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
361 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
362 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
363 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
364 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
365 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
366 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
367 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
368 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
369 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
370 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
371 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
372 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
373 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
374 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
375 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
376 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
377 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
378 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
379 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
380 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
381 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
382 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
383 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
384 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
385 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
386 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
387 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
388 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
389 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
390 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
391 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
392 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
393 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
394 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
395 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
396 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
397 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
398 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
399 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
400 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
401 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
402 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
403 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
404 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
405 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
406 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
407 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
408 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
409 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
410 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
411 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
412 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
413 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
414 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
415 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
416 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
417 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
418 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
419 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
420 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
421 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
422 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
423 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
424 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
425 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
426 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
427 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
428 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
429 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
430 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
431 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
432 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
433 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
434 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
435 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
436 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
437 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
438 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
439 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
440 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
441 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
442 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
443 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
444 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
445 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
446 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
447 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
448 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
449 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
457 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
458 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
459 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
460 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
462 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
463 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
464 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
465 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
466 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
467 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
468 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
469 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
470 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
471 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
472 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
473 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
474 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
475 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
476 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
477 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
478 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
479 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
480 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
481 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
482 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
483 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
484 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
485 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
486 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
487 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
488 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
489 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
490 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
491 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
492 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
493 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
494 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
495 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
496 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
497 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
498 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
499 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
500 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
501 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
502 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
503 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
504 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
505 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
506 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
507 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
508 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
509 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
510 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
511 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
512 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
513 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
514 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
515 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
516 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
517 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
518 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
519 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
520 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
521 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
528 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
529 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
530 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
531 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
532 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
533 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
534 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
535 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
536 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
537 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
538 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
539 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
540 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
541 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
542 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
543 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
544 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
545 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
546 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
547 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
548 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
549 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
550 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
551 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
552 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
553 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
554 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
555 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
556 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
557 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
558 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
559 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.6
Metatranscriptomes 1.6
Isolates 19.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.17
Nodule 15.89
Rhizoplane 4.34
Rhizosphere 53.71
Stem 0
Stem Tuber 0
Unclassified 11.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001255 3300003203 Bacteria 11909
2 JGI25153J46596_10000371 3300003215 Bacteria 30777
3 JGI25153J46596_10000865 3300003215 Bacteria 18448
4 JGI25153J46596_10018801 3300003215 Bacteria 2669
5 JGI25404J52841_10001741 3300003659 Bacteria 3938
6 JGI25404J52841_10017197 3300003659 Bacteria 1568
7 JGI25404J52841_10027769 3300003659 Bacteria 1216
8 Ga0055531_10005980 3300003794 Bacteria 6988
9 JGI25405J52794_10010489 3300003911 Bacteria 1762
10 Ga0055543_1023154 3300004625 Bacteria 1123
11 Ga0058863_11849786 3300004799 Bacteria 829
12 Ga0065165_1001685 3300005262 Bacteria 22303
13 Ga0065165_1004072 3300005262 Bacteria 9480
14 Ga0070676_10021570 3300005328 Bacteria 3606
15 Ga0070683_100003434 3300005329 Bacteria 12861
16 Ga0070670_100078460 3300005331 Bacteria 2837
17 Ga0070680_100361829 3300005336 Bacteria 1234
18 Ga0068868_100099670 3300005338 Bacteria 2350
19 Ga0070660_100227359 3300005339 Bacteria 1517
20 Ga0070661_100504538 3300005344 Bacteria 969
21 Ga0070668_100033480 3300005347 Bacteria 3913
22 Ga0070668_100107901 3300005347 Bacteria 2213
23 Ga0070668_100136903 3300005347 Bacteria 1970
24 Ga0070668_100352102 3300005347 Bacteria 1247
25 Ga0070668_100407157 3300005347 Bacteria 1162
26 Ga0070669_100025831 3300005353 Bacteria 4221
27 Ga0070671_100038198 3300005355 Bacteria 3985
28 Ga0070674_100177310 3300005356 Bacteria 1629
29 Ga0070674_100179268 3300005356 Bacteria 1621
30 Ga0070673_100168033 3300005364 Bacteria 1870
31 Ga0070688_100233004 3300005365 Bacteria 1303
32 Ga0070659_100411099 3300005366 Bacteria 1143
33 Ga0070709_10025034 3300005434 Bacteria 3521
34 Ga0070709_10556118 3300005434 Bacteria 878
35 Ga0070714_100745237 3300005435 Bacteria 947
36 Ga0070714_100826716 3300005435 Bacteria 898
37 Ga0070713_100019302 3300005436 Bacteria 5201
38 Ga0070713_100203137 3300005436 Bacteria 1791
39 Ga0070713_100264165 3300005436 Bacteria 1574
40 Ga0070713_100312293 3300005436 Bacteria 1450
41 Ga0070713_100417458 3300005436 Bacteria 1255
42 Ga0070710_10008635 3300005437 Bacteria 4963
43 Ga0070711_100005721 3300005439 Bacteria 7455
44 Ga0070711_100014790 3300005439 Bacteria 4926
45 Ga0070711_100174538 3300005439 Bacteria 1641
46 Ga0070705_100256037 3300005440 Bacteria 1231
47 Ga0070663_100003220 3300005455 Bacteria 9382
48 Ga0070663_100055736 3300005455 Bacteria 2830
49 Ga0070663_100156640 3300005455 Bacteria 1750
50 Ga0070663_100335065 3300005455 Bacteria 1221
51 Ga0070663_100402282 3300005455 Bacteria 1119
52 Ga0070678_100108988 3300005456 Bacteria 2162
53 Ga0070662_100245819 3300005457 Bacteria 1436
54 Ga0070681_10243463 3300005458 Bacteria 1712
55 Ga0070706_100055109 3300005467 Bacteria 3670
56 Ga0070698_100056809 3300005471 Bacteria 3963
57 Ga0070698_100844106 3300005471 Bacteria 861
58 Ga0070679_100030709 3300005530 Bacteria 5306
59 Ga0070679_100460981 3300005530 Bacteria 1216
60 Ga0068853_100283155 3300005539 Bacteria 1528
61 Ga0068853_100286916 3300005539 Bacteria 1518
62 Ga0070672_100328487 3300005543 Bacteria 1301
63 Ga0070665_100004774 3300005548 Bacteria 14113
64 Ga0070665_100093542 3300005548 Bacteria 3011
65 Ga0070665_100129223 3300005548 Bacteria 2529
66 Ga0070665_100268135 3300005548 Bacteria 1709
67 Ga0068855_100134381 3300005563 Bacteria 2822
68 Ga0068855_100184191 3300005563 Bacteria 2360
69 Ga0068857_100307253 3300005577 Bacteria 1463
70 Ga0068854_100112009 3300005578 Bacteria 2060
71 Ga0068856_100000046 3300005614 Bacteria 109174
72 Ga0068852_100199867 3300005616 Bacteria 1891
73 Ga0068852_100375094 3300005616 Bacteria 1394
74 Ga0068852_100392911 3300005616 Bacteria 1363
75 Ga0068864_101016699 3300005618 Bacteria 823
76 Ga0068861_100043439 3300005719 Bacteria 3374
77 Ga0068861_100052910 3300005719 Bacteria 3087
78 Ga0068861_100273488 3300005719 Bacteria 1451
79 Ga0068861_100353766 3300005719 Bacteria 1289
80 Ga0068851_10151085 3300005834 Bacteria 1269
81 Ga0068851_10218067 3300005834 Bacteria 1071
82 Ga0068858_100088777 3300005842 Bacteria 2876
83 Ga0068860_100002690 3300005843 Bacteria 18501
84 Ga0068860_100020202 3300005843 Bacteria 6455
85 Ga0068860_100393060 3300005843 Bacteria 1371
86 Ga0068862_100052654 3300005844 Bacteria 3483
87 Ga0068862_100116002 3300005844 Bacteria 2355
88 Ga0068862_100540425 3300005844 Bacteria 1111
89 Ga0081455_10001281 3300005937 Bacteria 31263
90 Ga0081455_10005322 3300005937 Bacteria 14133
91 Ga0081455_10022178 3300005937 Bacteria 5942
92 Ga0081455_10038296 3300005937 Bacteria 4247
93 Ga0081540_1000593 3300005983 Bacteria 34646
94 Ga0081540_1004374 3300005983 Bacteria 10802
95 Ga0081540_1005482 3300005983 Bacteria 9468
96 Ga0081540_1006150 3300005983 Bacteria 8811
97 Ga0081540_1025136 3300005983 Bacteria 3437
98 Ga0081539_10000540 3300005985 Bacteria 78243
99 Ga0081539_10024335 3300005985 Bacteria 3933
100 Ga0070717_10226496 3300006028 Bacteria 1645
101 Ga0070717_10331363 3300006028 Bacteria 1358
102 Ga0070717_10332431 3300006028 Bacteria 1355
103 Ga0070717_10496535 3300006028 Bacteria 1103
104 Ga0075365_10012254 3300006038 Bacteria 5083
105 Ga0075365_10027550 3300006038 Bacteria 3617
106 Ga0075365_10050798 3300006038 Bacteria 2736
107 Ga0075365_10253508 3300006038 Bacteria 1237
108 Ga0075363_100009873 3300006048 Bacteria 4504
109 Ga0075363_100145191 3300006048 Bacteria 1337
110 Ga0075364_10031364 3300006051 Bacteria 3415
111 Ga0070715_10281387 3300006163 Bacteria 882
112 Ga0070716_100010123 3300006173 Bacteria 4721
113 Ga0070712_100030277 3300006175 Bacteria 3635
114 Ga0070712_100049612 3300006175 Bacteria 2916
115 Ga0070712_100157673 3300006175 Bacteria 1750
116 Ga0070712_100221964 3300006175 Bacteria 1497
117 Ga0070712_100335717 3300006175 Bacteria 1233
118 Ga0075362_10058214 3300006177 Bacteria 1742
119 Ga0075367_10050906 3300006178 Bacteria 2447
120 Ga0075367_10099002 3300006178 Bacteria 1780
121 Ga0075369_10014471 3300006186 Bacteria 3151
122 Ga0075369_10091574 3300006186 Bacteria 1357
123 Ga0075366_10056073 3300006195 Bacteria 2340
124 Ga0075366_10089421 3300006195 Bacteria 1844
125 Ga0097621_100042019 3300006237 Bacteria 3682
126 Ga0075370_10009873 3300006353 Bacteria 4973
127 Ga0075429_100350803 3300006880 Bacteria 1292
128 Ga0068865_100371000 3300006881 Bacteria 1165
129 Ga0099823_1038597 3300006944 Bacteria 3554
130 Ga0099794_10099064 3300007265 Bacteria 1453
131 Ga0099794_10143822 3300007265 Bacteria 1209
132 Ga0099795_10032792 3300007788 Bacteria 1799
133 Ga0105240_10011485 3300009093 Bacteria 12332
134 Ga0105240_10754591 3300009093 Bacteria 1057
135 Ga0105245_10052348 3300009098 Bacteria 3662
136 Ga0105245_10095059 3300009098 Bacteria 2748
137 Ga0114129_10277201 3300009147 Bacteria 2241
138 Ga0105243_10161981 3300009148 Bacteria 1930
139 Ga0105241_10084517 3300009174 Bacteria 2492
140 Ga0105241_10268606 3300009174 Bacteria 1452
141 Ga0105242_10248379 3300009176 Bacteria 1602
142 Ga0105237_10008240 3300009545 Bacteria 11316
143 Ga0105237_10011626 3300009545 Bacteria 9317
144 Ga0105237_10870849 3300009545 Bacteria 908
145 Ga0105238_10013383 3300009551 Bacteria 8280
146 Ga0105238_10901567 3300009551 Bacteria 902
147 Ga0105249_10189989 3300009553 Bacteria 2004
148 Ga0105249_10257187 3300009553 Bacteria 1733
149 Ga0099796_10005934 3300010159 Bacteria 3088
150 Ga0105239_10125179 3300010375 Bacteria 2856
151 Ga0105239_10547284 3300010375 Bacteria 1318
152 Ga0105239_10763716 3300010375 Bacteria 1107
153 Ga0105246_10011337 3300011119 Bacteria 5533
154 Ga0157369_10053866 3300013105 Bacteria 4345
155 Ga0157374_10165358 3300013296 Bacteria 2156
156 Ga0163162_10258025 3300013306 Bacteria 1875
157 Ga0157372_10140742 3300013307 Bacteria 2779
158 Ga0157375_10827678 3300013308 Bacteria 1073
159 Ga0163163_10030936 3300014325 Bacteria 5161
160 Ga0163163_10065889 3300014325 Bacteria 3596
161 Ga0157380_10055300 3300014326 Bacteria 3151
162 Ga0157376_10236788 3300014969 Bacteria 1699
163 Ga0163161_10002299 3300017792 Bacteria 13707
164 Ga0163161_10276177 3300017792 Bacteria 1316
165 Ga0206350_10194348 3300020080 Bacteria 850
166 Ga0206353_11188210 3300020082 Bacteria 2219
167 Ga0213874_10063486 3300021377 Bacteria 1162
168 Ga0213876_10009405 3300021384 Bacteria 5262
169 Ga0213876_10069367 3300021384 Bacteria 1862
170 Ga0209563_105359 3300025230 Bacteria 2336
171 Ga0209148_1000335 3300025254 Bacteria 63754
172 Ga0209233_1021523 3300025261 Bacteria 1667
173 Ga0209455_1002543 3300025272 Bacteria 6976
174 Ga0209455_1018248 3300025272 Bacteria 1446
175 Ga0209564_1005823 3300025295 Bacteria 6873
176 Ga0209564_1009493 3300025295 Bacteria 4621
177 Ga0209758_1000106 3300025297 Bacteria 218450
178 Ga0209758_1000344 3300025297 Bacteria 85133
179 Ga0209758_1001326 3300025297 Bacteria 30016
180 Ga0209758_1009962 3300025297 Bacteria 5783
181 Ga0209758_1017145 3300025297 Bacteria 3628
182 Ga0209758_1056592 3300025297 Bacteria 1323
183 Ga0209256_1034875 3300025299 Bacteria 1334
184 Ga0209256_1038893 3300025299 Bacteria 1228
185 Ga0207426_1009980 3300025302 Bacteria 3716
186 Ga0209051_1033895 3300025303 Bacteria 1922
187 Ga0209257_1000819 3300025304 Bacteria 45046
188 Ga0209257_1044522 3300025304 Bacteria 1294
189 Ga0207697_10209518 3300025315 Bacteria 859
190 Ga0207653_10084345 3300025885 Bacteria 1104
191 Ga0207682_10043964 3300025893 Bacteria 1830
192 Ga0207692_10015203 3300025898 Bacteria 3382
193 Ga0207688_10146939 3300025901 Bacteria 1390
194 Ga0207688_10150220 3300025901 Bacteria 1376
195 Ga0207647_10289090 3300025904 Bacteria 935
196 Ga0207685_10029506 3300025905 Bacteria 1942
197 Ga0207699_10001790 3300025906 Bacteria 10088
198 Ga0207645_10031981 3300025907 Bacteria 3383
199 Ga0207645_10198471 3300025907 Bacteria 1320
200 Ga0207684_10279585 3300025910 Bacteria 1439
201 Ga0207707_10165205 3300025912 Bacteria 1934
202 Ga0207695_10000123 3300025913 Bacteria 232059
203 Ga0207695_10156146 3300025913 Bacteria 2216
204 Ga0207695_10551270 3300025913 Bacteria 1034
205 Ga0207671_10041194 3300025914 Bacteria 3418
206 Ga0207693_10004353 3300025915 Bacteria 11975
207 Ga0207693_10042871 3300025915 Bacteria 3561
208 Ga0207693_10132712 3300025915 Bacteria 1957
209 Ga0207693_10186073 3300025915 Bacteria 1635
210 Ga0207693_10361141 3300025915 Bacteria 1136
211 Ga0207663_10022584 3300025916 Bacteria 3599
212 Ga0207663_10305492 3300025916 Bacteria 1190
213 Ga0207662_10202663 3300025918 Bacteria 1285
214 Ga0207657_10030146 3300025919 Bacteria 4928
215 Ga0207652_10477417 3300025921 Bacteria 1123
216 Ga0207646_10181300 3300025922 Bacteria 1902
217 Ga0207646_10951818 3300025922 Bacteria 760
218 Ga0207681_10397718 3300025923 Bacteria 1112
219 Ga0207650_10253003 3300025925 Bacteria 1427
220 Ga0207687_10008542 3300025927 Bacteria 6698
221 Ga0207687_10058231 3300025927 Bacteria 2717
222 Ga0207700_10016987 3300025928 Bacteria 4848
223 Ga0207700_10201366 3300025928 Bacteria 1678
224 Ga0207700_10416549 3300025928 Bacteria 1179
225 Ga0207700_10660271 3300025928 Bacteria 932
226 Ga0207664_10214528 3300025929 Bacteria 1667
227 Ga0207664_10355056 3300025929 Bacteria 1298
228 Ga0207664_10406422 3300025929 Bacteria 1211
229 Ga0207664_10458158 3300025929 Bacteria 1139
230 Ga0207690_10102914 3300025932 Bacteria 2043
231 Ga0207706_10279321 3300025933 Bacteria 1456
232 Ga0207709_10068831 3300025935 Bacteria 2239
233 Ga0207669_10057902 3300025937 Bacteria 2362
234 Ga0207669_10059328 3300025937 Bacteria 2340
235 Ga0207669_10074082 3300025937 Bacteria 2151
236 Ga0207665_10041526 3300025939 Bacteria 3072
237 Ga0207665_10281321 3300025939 Bacteria 1238
238 Ga0207691_10126957 3300025940 Bacteria 2256
239 Ga0207711_10057836 3300025941 Bacteria 3334
240 Ga0207711_10063179 3300025941 Bacteria 3196
241 Ga0207689_10035445 3300025942 Bacteria 4145
242 Ga0207661_10002953 3300025944 Bacteria 11757
243 Ga0207661_10309168 3300025944 Bacteria 1419
244 Ga0207661_10399297 3300025944 Bacteria 1246
245 Ga0207679_10195604 3300025945 Bacteria 1685
246 Ga0207667_10105644 3300025949 Bacteria 2905
247 Ga0207667_10183972 3300025949 Bacteria 2145
248 Ga0207668_10022000 3300025972 Bacteria 4074
249 Ga0207668_10034680 3300025972 Bacteria 3352
250 Ga0207668_10101833 3300025972 Bacteria 2135
251 Ga0207668_10395182 3300025972 Bacteria 1167
252 Ga0207640_10213733 3300025981 Bacteria 1471
253 Ga0207677_10594685 3300026023 Bacteria 970
254 Ga0207703_10215104 3300026035 Bacteria 1715
255 Ga0207703_10707198 3300026035 Bacteria 958
256 Ga0207639_10041924 3300026041 Bacteria 3428
257 Ga0207639_10632708 3300026041 Bacteria 989
258 Ga0207678_10014071 3300026067 Bacteria 7036
259 Ga0207678_10071921 3300026067 Bacteria 2964
260 Ga0207678_10116637 3300026067 Bacteria 2278
261 Ga0207678_10210686 3300026067 Bacteria 1662
262 Ga0207678_10346093 3300026067 Bacteria 1282
263 Ga0207702_10000014 3300026078 Bacteria 253304
264 Ga0207702_10245405 3300026078 Bacteria 1679
265 Ga0207641_10676818 3300026088 Bacteria 1015
266 Ga0207676_11021605 3300026095 Bacteria 815
267 Ga0207674_10072022 3300026116 Bacteria 3472
268 Ga0207674_10091426 3300026116 Bacteria 3033
269 Ga0207675_100131229 3300026118 Bacteria 2376
270 Ga0207675_100279300 3300026118 Bacteria 1622
271 Ga0207675_100290212 3300026118 Bacteria 1591
272 Ga0207683_10010057 3300026121 Bacteria 8073
273 Ga0207683_10135865 3300026121 Bacteria 2213
274 Ga0207683_10221960 3300026121 Bacteria 1722
275 Ga0207683_10260461 3300026121 Bacteria 1583
276 Ga0207698_10170153 3300026142 Bacteria 1917
277 Ga0207698_10368307 3300026142 Bacteria 1363
278 Ga0209389_1000016 3300027296 Bacteria 184844
279 Ga0209389_1000027 3300027296 Bacteria 146917
280 Ga0209589_1000031 3300027357 Bacteria 147054
281 Ga0209489_100057 3300027361 Bacteria 147398
282 Ga0209489_100063 3300027361 Bacteria 144408
283 Ga0209700_100012 3300027363 Bacteria 357892
284 Ga0207428_10061061 3300027907 Bacteria 2985
285 Ga0268266_10003152 3300028379 Bacteria 16738
286 Ga0268266_10003898 3300028379 Bacteria 14509
287 Ga0268266_10116461 3300028379 Bacteria 2373
288 Ga0268265_10103699 3300028380 Bacteria 2304
289 Ga0268265_10173890 3300028380 Bacteria 1843
290 Ga0268265_10325869 3300028380 Bacteria 1393
291 Ga0268265_11212369 3300028380 Bacteria 752
292 Ga0268264_10000042 3300028381 Bacteria 372069
293 Ga0268264_10186255 3300028381 Bacteria 1889
294 Ga0268264_10252105 3300028381 Bacteria 1640
295 Ga0307517_10000176 3300028786 Bacteria 105402
296 Ga0307512_10201851 3300030522 Bacteria 1075
297 Ga0265766_1003936 3300030863 Bacteria 888
298 Ga0265332_10024877 3300031238 Bacteria 2632
299 Ga0265332_10094353 3300031238 Bacteria 1264
300 Ga0265328_10067062 3300031239 Bacteria 1318
301 Ga0265328_10155337 3300031239 Bacteria 861
302 Ga0265340_10059768 3300031247 Bacteria 1827
303 Ga0265339_10001372 3300031249 Bacteria 18190
304 Ga0265339_10033300 3300031249 Bacteria 2902
305 Ga0265339_10048940 3300031249 Bacteria 2316
306 Ga0265331_10210947 3300031250 Bacteria 874
307 Ga0265331_10247064 3300031250 Bacteria 800
308 Ga0307509_10142209 3300031507 Bacteria 2332
309 Ga0307508_10062521 3300031616 Bacteria 3286
310 Ga0265314_10016415 3300031711 Bacteria 5849
311 Ga0265314_10050084 3300031711 Bacteria 2920
312 Ga0265342_10009595 3300031712 Bacteria 6796
313 Ga0307516_10020012 3300031730 Bacteria 6920
314 Ga0307516_10107016 3300031730 Bacteria 2606
315 Ga0307516_10112661 3300031730 Bacteria 2520
316 Ga0307412_10056255 3300031911 Bacteria 2621
317 Ga0307409_100101192 3300031995 Bacteria 2391
318 Ga0307409_100585515 3300031995 Bacteria 1100
319 Ga0307416_100440886 3300032002 Bacteria 1352
320 Ga0307411_10259343 3300032005 Bacteria 1372
321 Ga0307415_100088088 3300032126 Bacteria 2239
322 Ga0307510_10007730 3300033180 Bacteria 12823
323 Ga0307510_10037836 3300033180 Bacteria 5347
324 Ga0307510_10187488 3300033180 Bacteria 1621
325 Ga0307510_10242427 3300033180 Bacteria 1296
326 Ga0307510_10326208 3300033180 Bacteria 991
327 Ga0373950_0047760 3300034818 Bacteria 834
328 Ga0373929_0037043 3300035085 Bacteria 1068
329 Ga0373934_0002178 3300035086 Bacteria 7205
330 Ga0373923_0001946 3300035111 Bacteria 6191
331 Ga0373953_0001243 3300035117 Bacteria 7270
332 Ga0373954_0002355 3300035118 Bacteria 7899
333 Ga0373957_0000527 3300035120 Bacteria 9628
334 Ga0373955_0000535 3300035172 Bacteria 16084
335 Ga0373942_0020097 3300035207 Bacteria 1674
336 Ga0373924_0004005 3300035410 Bacteria 5117
337 Ga0373931_0014148 3300035691 Bacteria 3896
338 Ga0373935_0023018 3300035692 Bacteria 3826
339 Ga0373927_0012684 3300035695 Bacteria 5606
340 Ga0373933_0002165 3300035724 Bacteria 11241
341 Ga0373947_0066854 3300035725 Bacteria 2194
342 Ga0310104_11013 3300036242 Bacteria 730
343 Ga0373937_0033007 3300036401 Bacteria 4697
344 Ga0373937_0184350 3300036401 Bacteria 1960
345 Ga0373937_0236682 3300036401 Bacteria 1720
346 Ga0310109_001672 3300036534 Bacteria 2312
347 Ga0373925_0219459 3300037068 Bacteria 1517
348 Ga0395899_0066265 3300037312 Bacteria 2652
349 Ga0395899_0088186 3300037312 Bacteria 2251
350 Ga0395900_0001282 3300037418 Bacteria 30694
351 Ga0395900_0219351 3300037418 Bacteria 1918
352 Ga0395898_0037345 3300037466 Bacteria 4820
353 Ga0395898_0043652 3300037466 Bacteria 4417
354 Ga0395898_0048844 3300037466 Bacteria 4148
355 Ga0395905_0004232 3300037471 Bacteria 15003
356 Ga0395905_0534219 3300037471 Bacteria 1073
357 Ga0395905_0904549 3300037471 Bacteria 785
358 Ga0436364_0641210 3300037853 Bacteria 1520
359 Ga0436364_0800356 3300037853 Bacteria 991
360 Ga0395901_0006277 3300038443 Bacteria 12045
361 Ga0395901_0227382 3300038443 Bacteria 1948
362 Ga0436365_0119504 3300039437 Bacteria 1527
363 Ga0436365_0279031 3300039437 Bacteria 3587
364 Ga0436365_0838143 3300039437 Bacteria 2836
365 Ga0436365_1138701 3300039437 Bacteria 28644
366 Ga0436361_0334533 3300039447 Bacteria 1134
367 Ga0436361_0849478 3300039447 Bacteria 2474
368 Ga0436363_0830766 3300039450 Bacteria 2248
369 Ga0436362_0546910 3300039453 Bacteria 3042
370 Ga0436362_0740954 3300039453 Bacteria 1064
371 Ga0439465_0114781 3300041413 Bacteria 940
372 Ga0451789_0163036 3300041443 Bacteria 1003
373 Ga0466972_0000179 3300044658 Bacteria 49010
374 Ga0466972_0000516 3300044658 Bacteria 19219
375 Ga0466972_0085873 3300044658 Bacteria 1496
376 Ga0466965_0072218 3300044683 Bacteria 1736
377 Ga0466963_0038559 3300044694 Bacteria 3125
378 Ga0466963_0080254 3300044694 Bacteria 2208
379 Ga0466964_0014197 3300044706 Bacteria 3026
380 Ga0466968_0008321 3300044735 Bacteria 3970
381 Ga0466957_0071003 3300044842 Bacteria 2153
382 Ga0466957_0261651 3300044842 Bacteria 1153
383 Ga0466960_0052697 3300044901 Bacteria 1969
384 Ga0466958_0140344 3300045836 Bacteria 1521
385 Ga0466967_0459294 3300045976 Bacteria 1245
386 Ga0466967_0564918 3300045976 Bacteria 1120
387 Ga0495617_006222 3300046452 Bacteria 4200
388 Ga0495617_059017 3300046452 Bacteria 1271
389 Ga0495592_0021832 3300046454 Bacteria 4870
390 Ga0495592_0085595 3300046454 Bacteria 2272
391 Ga0495592_0268273 3300046454 Bacteria 1121
392 Ga0495603_0046487 3300046455 Bacteria 2586
393 Ga0495603_0079540 3300046455 Bacteria 1921
394 Ga0495603_0156284 3300046455 Bacteria 1323
395 Ga0495629_0001841 3300046459 Bacteria 16607
396 Ga0495629_0132485 3300046459 Bacteria 1736
397 Ga0495629_0195513 3300046459 Bacteria 1399
398 Ga0495638_0001078 3300046460 Bacteria 26592
399 Ga0495638_0011310 3300046460 Bacteria 6150
400 Ga0495638_0235426 3300046460 Bacteria 1016
401 Ga0495641_0220237 3300046461 Bacteria 851
402 Ga0495651_0001119 3300046462 Bacteria 20724
403 Ga0495651_0046362 3300046462 Bacteria 3364
404 Ga0495651_0167779 3300046462 Bacteria 1566
405 Ga0495653_0050502 3300046463 Bacteria 3198
406 Ga0495650_0030020 3300046471 Bacteria 2469
407 Ga0495582_0310421 3300046473 Bacteria 907
408 Ga0495605_0070755 3300046474 Bacteria 1649
409 Ga0495639_0272068 3300046475 Bacteria 841
410 Ga0495664_0003810 3300046477 Bacteria 8225
411 Ga0495584_0061495 3300046491 Bacteria 1888
412 Ga0495584_0237281 3300046491 Bacteria 927
413 Ga0495585_0200282 3300046492 Bacteria 1017
414 Ga0495594_0089576 3300046499 Bacteria 1723
415 Ga0495594_0163685 3300046499 Bacteria 1265
416 Ga0495596_0028449 3300046500 Bacteria 2244
417 Ga0495596_0136340 3300046500 Bacteria 953
418 Ga0495583_0069764 3300046506 Bacteria 1547
419 Ga0495606_0000357 3300046507 Bacteria 78015
420 Ga0495606_0089364 3300046507 Bacteria 1898
421 Ga0495606_0236277 3300046507 Bacteria 1021
422 Ga0495620_0016755 3300046515 Bacteria 3669
423 Ga0495620_0062706 3300046515 Bacteria 1543
424 Ga0495620_0079786 3300046515 Bacteria 1325
425 Ga0495628_0073716 3300046516 Bacteria 2659
426 Ga0495628_0161204 3300046516 Bacteria 1704
427 Ga0495628_0391214 3300046516 Bacteria 1017
428 Ga0495631_0032716 3300046518 Bacteria 2343
429 Ga0495632_0061929 3300046519 Bacteria 1815
430 Ga0495632_0137761 3300046519 Bacteria 1133
431 Ga0495643_0252041 3300046522 Bacteria 823
432 Ga0495648_0000649 3300046524 Bacteria 37131
433 Ga0495648_0001411 3300046524 Bacteria 23498
434 Ga0495648_0006902 3300046524 Bacteria 9160
435 Ga0495648_0103070 3300046524 Bacteria 1570
436 Ga0495648_0122851 3300046524 Bacteria 1392
437 Ga0495648_0204434 3300046524 Bacteria 986
438 Ga0495652_0011196 3300046529 Bacteria 8122
439 Ga0495652_0016077 3300046529 Bacteria 6694
440 Ga0495654_0094692 3300046530 Bacteria 1381
441 Ga0495587_0037215 3300046536 Bacteria 2922
442 Ga0495587_0093185 3300046536 Bacteria 1739
443 Ga0495598_0139471 3300046537 Bacteria 838
444 Ga0495621_0041833 3300046539 Bacteria 1610
445 Ga0495621_0126418 3300046539 Bacteria 992
446 Ga0495597_0085789 3300046542 Bacteria 1341
447 Ga0495622_0018451 3300046557 Bacteria 3249
448 Ga0495622_0080083 3300046557 Bacteria 1503
449 Ga0495622_0082546 3300046557 Bacteria 1478
450 Ga0495656_0003804 3300046615 Bacteria 5129
451 Ga0495656_0050337 3300046615 Bacteria 1778
452 Ga0495656_0066365 3300046615 Bacteria 1589
453 Ga0495668_0069727 3300046616 Bacteria 1933
454 Ga0495668_0073504 3300046616 Bacteria 1877
455 Ga0495634_0009918 3300046642 Bacteria 7000
456 Ga0495634_0040892 3300046642 Bacteria 3150
457 Ga0495611_0133936 3300046648 Bacteria 1156
458 Ga0495611_0170118 3300046648 Bacteria 1018
459 Ga0495625_0076145 3300046660 Bacteria 2346
460 Ga0495625_0196316 3300046660 Bacteria 1334
461 Ga0495635_0002477 3300046663 Bacteria 12604
462 Ga0495635_0063953 3300046663 Bacteria 2526
463 Ga0495661_0130267 3300046665 Bacteria 1379
464 Ga0495661_0234929 3300046665 Bacteria 943
465 Ga0495588_0010104 3300046674 Bacteria 4379
466 Ga0495588_0022019 3300046674 Bacteria 3147
467 Ga0495657_0039033 3300046675 Bacteria 3264
468 Ga0495623_0002992 3300046679 Bacteria 11118
469 Ga0495623_0010731 3300046679 Bacteria 5931
470 Ga0495623_0203330 3300046679 Bacteria 1138
471 Ga0495646_0087280 3300046680 Bacteria 1808
472 Ga0495646_0229868 3300046680 Bacteria 1000
473 Ga0495669_0062815 3300046684 Bacteria 1683
474 Ga0495613_0033023 3300046689 Bacteria 3846
475 Ga0495671_0232995 3300046692 Bacteria 890
476 Ga0495649_0287298 3300046694 Bacteria 839
477 Ga0495600_0008391 3300046809 Bacteria 6343
478 Ga0495581_0188053 3300047315 Bacteria 1208
479 Ga0495604_0024142 3300047317 Bacteria 4853
480 Ga0495674_0012072 3300047319 Bacteria 8141
481 Ga0495674_0065589 3300047319 Bacteria 3153
482 Ga0495674_0111894 3300047319 Bacteria 2314
483 Ga0495674_0407610 3300047319 Bacteria 1097
484 Ga0495672_0003965 3300047320 Bacteria 12392
485 Ga0495676_0055040 3300047321 Bacteria 3158
486 Ga0495676_0107620 3300047321 Bacteria 2052
487 Ga0495680_0001426 3300047322 Bacteria 25752
488 Ga0495680_0012571 3300047322 Bacteria 7441
489 Ga0495675_0032501 3300047444 Bacteria 3330
490 Ga0495675_0298645 3300047444 Bacteria 957
491 Ga0495673_0064649 3300047469 Bacteria 1555
492 Ga0495684_0001145 3300047471 Bacteria 21346
493 Ga0495684_0045526 3300047471 Bacteria 3358
494 Ga0495686_0049064 3300047472 Bacteria 2658
495 Ga0495686_0066337 3300047472 Bacteria 2230
496 Ga0495686_0115920 3300047472 Bacteria 1602
497 Ga0495686_0121289 3300047472 Bacteria 1558
498 Ga0495686_0178291 3300047472 Bacteria 1232
499 Ga0495686_0225781 3300047472 Bacteria 1063
500 Ga0495686_0355551 3300047472 Bacteria 795
501 Ga0495593_0000526 3300047673 Bacteria 21677
502 Ga0495602_0007749 3300048088 Bacteria 11224
503 Ga0495602_0009427 3300048088 Bacteria 10154
504 Ga0495626_0041435 3300048091 Bacteria 2169
505 Ga0496100_0744548 3300048903 Bacteria 766
506 Ga0496101_0276206 3300048904 Bacteria 1312
507 Ga0496101_0578241 3300048904 Bacteria 888
508 Ga0496102_0201668 3300048905 Bacteria 1875
509 Ga0496102_0299368 3300048905 Bacteria 1516
510 Ga0496103_0228109 3300048906 Bacteria 1198
511 Ga0496103_0447461 3300048906 Bacteria 829
512 Ga0496105_0021342 3300048908 Bacteria 5241
513 Ga0496106_0057184 3300048909 Bacteria 2949
514 Ga0496106_0262067 3300048909 Bacteria 1383
515 Ga0496106_0331802 3300048909 Bacteria 1221
516 Ga0496107_0073000 3300048910 Bacteria 2495
517 Ga0496107_0481273 3300048910 Bacteria 921
518 Ga0496108_0138636 3300048911 Bacteria 2095
519 Ga0496108_0280518 3300048911 Bacteria 1451
520 Ga0496110_0019461 3300048913 Bacteria 5714
521 Ga0496110_0064838 3300048913 Bacteria 3229
522 Ga0496110_0392551 3300048913 Bacteria 1265
523 Ga0496110_0685768 3300048913 Bacteria 925
524 Ga0496110_1021236 3300048913 Bacteria 734
525 Ga0496111_0216554 3300048914 Bacteria 1423
526 Ga0496111_0254823 3300048914 Bacteria 1302
527 Ga0496112_0112393 3300048915 Bacteria 2694
528 Ga0496112_0163495 3300048915 Bacteria 2192
529 Ga0496112_0228310 3300048915 Bacteria 1816
530 Ga0496112_0831861 3300048915 Bacteria 847
531 Ga0496113_0035965 3300048916 Bacteria 3626
532 Ga0496113_0059803 3300048916 Bacteria 2871
533 Ga0496114_0237114 3300048917 Bacteria 1603
534 Ga0496114_0580249 3300048917 Bacteria 989
535 Ga0496115_0048409 3300048918 Bacteria 3400
536 Ga0496115_0199628 3300048918 Bacteria 1652
537 Ga0496115_0220474 3300048918 Bacteria 1565
538 Ga0496115_0264144 3300048918 Bacteria 1415
539 Ga0496115_0316810 3300048918 Bacteria 1276
540 Ga0496116_0001611 3300048919 Bacteria 24820
541 Ga0496117_0013012 3300048920 Bacteria 7287
542 Ga0496117_0103192 3300048920 Bacteria 1798
543 Ga0496118_0024435 3300048921 Bacteria 5213
544 Ga0496118_0025336 3300048921 Bacteria 5090
545 Ga0496118_0025358 3300048921 Bacteria 5087
546 Ga0496118_0118021 3300048921 Bacteria 1739
547 Ga0496118_0194671 3300048921 Bacteria 1208
548 Ga0496118_0278507 3300048921 Bacteria 932
549 Ga0496118_0319732 3300048921 Bacteria 843
550 Ga0496119_0076813 3300048922 Bacteria 1937
551 Ga0496119_0131793 3300048922 Bacteria 1361
552 Ga0496120_0079676 3300048923 Bacteria 1777
553 Ga0496120_0250569 3300048923 Bacteria 831
554 Ga0496121_0000753 3300048924 Bacteria 59517
555 Ga0496121_0028031 3300048924 Bacteria 5253
556 Ga0496121_0030771 3300048924 Bacteria 4923
557 Ga0496121_0035853 3300048924 Bacteria 4433
558 Ga0496121_0045179 3300048924 Bacteria 3787
559 Ga0496121_0057369 3300048924 Bacteria 3228
560 Ga0496121_0204063 3300048924 Bacteria 1406
561 Ga0496121_0236320 3300048924 Bacteria 1276
562 Ga0496121_0439637 3300048924 Bacteria 843
563 Ga0496122_0049475 3300048925 Bacteria 3218
564 Ga0496123_0068547 3300048926 Bacteria 2233
565 Ga0496124_0025489 3300048927 Bacteria 5355
566 Ga0496124_0124166 3300048927 Bacteria 2059
567 Ga0496124_0319628 3300048927 Bacteria 1112
568 Ga0496125_0000099 3300048928 Bacteria 203333
569 Ga0496125_0001860 3300048928 Bacteria 29047
570 Ga0496125_0002962 3300048928 Bacteria 21340
571 Ga0496125_0004213 3300048928 Bacteria 16756
572 Ga0496125_0047595 3300048928 Bacteria 3583
573 Ga0496125_0227797 3300048928 Bacteria 1195
574 Ga0496126_0012065 3300048929 Bacteria 8879
575 Ga0496126_0047881 3300048929 Bacteria 3912
576 Ga0496126_0054808 3300048929 Bacteria 3609
577 Ga0496126_0094761 3300048929 Bacteria 2619
578 Ga0496126_0109600 3300048929 Bacteria 2406
579 Ga0496126_0215062 3300048929 Bacteria 1617
580 Ga0496126_0244805 3300048929 Bacteria 1496
581 Ga0495682_0015377 3300049460 Bacteria 2900
582 Ga0495682_0033863 3300049460 Bacteria 1885
583 Ga0501315_019595 3300049531 Bacteria 901
584 Ga0501034_0290711 3300049571 Bacteria 1572
585 Ga0501034_0493805 3300049571 Bacteria 1138
586 Ga0501039_0306765 3300049575 Bacteria 1248
587 Ga0501039_0360235 3300049575 Bacteria 1143
588 Ga0501043_0579757 3300049579 Bacteria 830
589 Ga0501046_0035855 3300049580 Bacteria 3995
590 Ga0501047_0406704 3300049581 Bacteria 1194
591 Ga0501048_0224413 3300049582 Bacteria 1333
592 Ga0501068_0163553 3300049584 Bacteria 1403
593 Ga0501073_0233250 3300049589 Bacteria 1271
594 Ga0501076_0317412 3300049592 Bacteria 1278
595 Ga0501081_0092718 3300049743 Bacteria 2126
596 Ga0501035_0170187 3300049822 Bacteria 1882
597 Ga0501035_0170606 3300049822 Bacteria 1880
598 Ga0501035_0316879 3300049822 Bacteria 1311
599 Ga0501045_0131473 3300049824 Bacteria 1861
600 nmdc:mga03683_83933_c1 3300050489 Bacteria 1380
601 nmdc:mga03n38_448_c1 3300050490 Bacteria 10279
602 nmdc:mga0yw44_179531_c1 3300050492 Bacteria 1393
603 nmdc:mga0yw44_19940_c1 3300050492 Bacteria 3709
604 nmdc:mga0yw44_81744_c1 3300050492 Bacteria 2026
605 nmdc:mga0yw44_9263_c1 3300050492 Bacteria 4962
606 nmdc:mga0yw44_98500_c1 3300050492 Bacteria 1859
607 nmdc:mga06z11_28144_c1 3300050494 Bacteria 2694
608 nmdc:mga07m45_17174_c1 3300050496 Bacteria 3881
609 nmdc:mga05p37_755549_c1 3300050507 Bacteria 1071
610 nmdc:mga09592_55761_c1 3300050508 Bacteria 3339
611 nmdc:mga0qj67_57292_c1 3300050509 Bacteria 3089
612 nmdc:mga08y16_152915_c1 3300050511 Bacteria 2398
613 nmdc:mga0sz30_42624_c1 3300050516 Bacteria 1910
614 nmdc:mga0sz30_61380_c1 3300050516 Bacteria 1606
615 Ga0500635_0081216 3300053080 Bacteria 1165
616 Ga0495655_0006964 3300053083 Bacteria 2081
617 Ga0495655_0012784 3300053083 Bacteria 1720
618 Ga0495595_0001351 3300053084 Bacteria 9525
619 Ga0495595_0009072 3300053084 Bacteria 4108
620 Ga0495619_0001695 3300053085 Bacteria 14587
621 Ga0495619_0063683 3300053085 Bacteria 2457
622 Ga0495619_0298751 3300053085 Bacteria 1116
623 Ga0500578_0073181 3300053086 Bacteria 2183
624 Ga0500643_000180 3300053087 Bacteria 61907
625 Ga0500651_0005715 3300053093 Bacteria 7122
626 Ga0500651_0021885 3300053093 Bacteria 3990
627 Ga0500566_0002520 3300053094 Bacteria 10882
628 Ga0500566_0004614 3300053094 Bacteria 8202
629 Ga0500640_028305 3300053095 Bacteria 2446
630 Ga0500641_0005375 3300053096 Bacteria 4538
631 Ga0500641_0017766 3300053096 Bacteria 2666
632 Ga0500641_0058901 3300053096 Bacteria 1595
633 Ga0500641_0175098 3300053096 Bacteria 923
634 Ga0500650_0073574 3300053098 Bacteria 1597
635 Ga0500554_016601 3300053102 Bacteria 1950
636 Ga0500555_059751 3300053103 Bacteria 1028
637 Ga0500556_0000012 3300053104 Bacteria 250391
638 Ga0500557_000046 3300053105 Bacteria 59508
639 Ga0500569_005217 3300053109 Bacteria 2782
640 Ga0500569_014721 3300053109 Bacteria 1943
641 Ga0500572_000471 3300053111 Bacteria 13998
642 Ga0500582_122829 3300053114 Bacteria 905
643 Ga0500592_000542 3300053116 Bacteria 6235
644 Ga0500592_030190 3300053116 Bacteria 875
645 Ga0500594_0009826 3300053118 Bacteria 2210
646 Ga0500594_0101994 3300053118 Bacteria 884
647 Ga0500595_000615 3300053119 Bacteria 21276
648 Ga0500595_007563 3300053119 Bacteria 4499
649 Ga0500595_011345 3300053119 Bacteria 3493
650 Ga0500607_034490 3300053121 Bacteria 2770
651 Ga0500608_027336 3300053122 Bacteria 2688
652 Ga0500614_070735 3300053123 Bacteria 957
653 Ga0500618_006007 3300053125 Bacteria 3610
654 Ga0500618_057612 3300053125 Bacteria 875
655 Ga0500628_049242 3300053129 Bacteria 994
656 Ga0500642_0000013 3300053130 Bacteria 197927
657 Ga0500642_0000038 3300053130 Bacteria 98299
658 Ga0500642_0033610 3300053130 Bacteria 2162
659 Ga0500652_001452 3300053131 Bacteria 7354
660 Ga0500658_0187477 3300053134 Bacteria 943
661 Ga0500559_0000713 3300053136 Bacteria 21844
662 Ga0500559_0001670 3300053136 Bacteria 12261
663 Ga0500559_0026032 3300053136 Bacteria 2490
664 Ga0500564_069907 3300053138 Bacteria 1584
665 Ga0500568_0000676 3300053139 Bacteria 24605
666 Ga0500568_0043586 3300053139 Bacteria 1793
667 Ga0500568_0070629 3300053139 Bacteria 1337
668 Ga0500568_0095835 3300053139 Bacteria 1116
669 Ga0500590_125168 3300053148 Bacteria 1198
670 Ga0500616_0000035 3300053153 Bacteria 394242
671 Ga0500616_0036917 3300053153 Bacteria 2648
672 Ga0500616_0151921 3300053153 Bacteria 1071
673 Ga0500619_009223 3300053154 Bacteria 2438
674 Ga0500620_079333 3300053155 Bacteria 1135
675 Ga0500622_0005098 3300053156 Bacteria 7983
676 Ga0500622_0055023 3300053156 Bacteria 2039
677 Ga0500627_0046689 3300053158 Bacteria 1877
678 Ga0500627_0083492 3300053158 Bacteria 1425
679 Ga0500633_0085149 3300053160 Bacteria 1148
680 Ga0500634_0020483 3300053161 Bacteria 3576
681 Ga0500634_0037228 3300053161 Bacteria 2647
682 Ga0500638_007258 3300053162 Bacteria 4622
683 Ga0500638_028379 3300053162 Bacteria 2689
684 Ga0500636_0001763 3300053177 Bacteria 11844
685 Ga0500636_0010527 3300053177 Bacteria 5398
686 Ga0500637_0000445 3300053178 Bacteria 15850
687 Ga0500567_160758 3300053723 Bacteria 823
688 Ga0500570_147811 3300053724 Bacteria 845
689 Ga0500625_003345 3300053729 Bacteria 6318
690 Ga0500609_018794 3300053731 Bacteria 942
691 Ga0500599_001657 3300053736 Bacteria 2594
692 Ga0500661_000331 3300055283 Bacteria 8597
693 Ga0500661_037243 3300055283 Bacteria 861
694 Ga0587073_0008925 3300059492 Bacteria 1639
695 Ga0587083_0008267 3300059505 Bacteria 1622
696 Ga0587088_024946 3300059508 Bacteria 1028
697 Ga0587079_005293 3300059647 Bacteria 1814
698 Ga0587107_018852 3300059652 Bacteria 940
699 Ga0587071_015827 3300060344 Bacteria 1328
700 Ga0587071_038525 3300060344 Bacteria 950
701 Ga0466962_0207969 3300061719 Bacteria 957

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0000099 Ga0496125_0000099_27772_28485 224
2 iso_pu_bacteria 2507262055 2507512032 228
3 iso_pu_bacteria 2508501009 2508545692 228
4 iso_pu_bacteria 2508501042 2508694514 228
5 iso_pu_bacteria 2508501128 2509151231 228
6 iso_pu_bacteria 2511231028 2511401328 228
7 iso_pu_bacteria 2513237092 2513624579 228
8 iso_pu_bacteria 2513237092 2513625206 228
9 iso_pu_bacteria 2513237096 2513655550 228
10 iso_pu_bacteria 2513237101 2513698858 228
11 iso_pu_bacteria 2513237104 2513720198 228
12 iso_pu_bacteria 2513237139 2513874335 228
13 iso_pu_bacteria 2513237141 2513887896 228
14 iso_pu_bacteria 2513237145 2513916372 228
15 iso_pu_bacteria 2513237161 2514016829 228
16 iso_pu_bacteria 2515154112 2515624555 228
17 iso_pu_bacteria 2528768022 2528850232 228
18 iso_pu_bacteria 2602042107 2603857727 228
19 iso_pu_bacteria 2617270735 2617353131 228
20 iso_pu_bacteria 2643221651 2644287122 228
21 iso_pu_bacteria 2667528175 2671120944 228
22 iso_pu_bacteria 2721755755 2723842651 228
23 iso_pu_bacteria 2728368998 2728749065 228
24 iso_pu_bacteria 2744054633 2745078366 228
25 iso_pu_bacteria 2791355196 2793059471 228
26 iso_pu_bacteria 2802429603 2805916102 228
27 iso_pu_bacteria 2824600985 2824604494 228
28 iso_pu_bacteria 2824609381 2824614965 228
29 iso_pu_bacteria 2824653114 2824657512 228
30 iso_pu_bacteria 2824661429 2824669391 228
31 iso_pu_bacteria 2824671348 2824673995 228
32 iso_pu_bacteria 2824687955 2824691262 228
33 iso_pu_bacteria 2824696289 2824701373 228
34 iso_pu_bacteria 2824732956 2824739160 228
35 iso_pu_bacteria 2824773399 2824778323 228
36 iso_pu_bacteria 2838122688 2838128550 228
37 iso_pu_bacteria 2841941048 2841942406 228
38 iso_pu_bacteria 2841949485 2841953248 228
39 iso_pu_bacteria 2841966195 2841973863 228
40 iso_pu_bacteria 2841974524 2841982928 228
41 iso_pu_bacteria 2841983080 2841984423 228
42 iso_pu_bacteria 2842038055 2842041851 228
43 iso_pu_bacteria 2842045827 2842049894 228
44 iso_pu_bacteria 2844315083 2844321262 228
45 iso_pu_bacteria 2847930680 2847932152 228
46 iso_pu_bacteria 2847939898 2847943382 228
47 iso_pu_bacteria 2849076700 2849077105 228
48 iso_pu_bacteria 2857509624 2857514601 228
49 iso_pu_bacteria 2857524615 2857527100 228
50 iso_pu_bacteria 2874590934 2874595794 228
51 iso_pu_bacteria 2874604998 2874606674 228
52 iso_pu_bacteria 2874612657 2874614933 228
53 iso_pu_bacteria 2874620515 2874624159 228
54 iso_pu_bacteria 2874645413 2874651574 228
55 iso_pu_bacteria 2876761206 2876767583 228
56 iso_pu_bacteria 2876771140 2876775991 228
57 iso_pu_bacteria 2876808645 2876808727 228
58 iso_pu_bacteria 2876818435 2876821199 228
59 iso_pu_bacteria 2879074833 2879080080 228
60 iso_pu_bacteria 2879099564 2879106447 228
61 iso_pu_bacteria 2879110137 2879111991 228
62 iso_pu_bacteria 2881364244 2881367534 228
63 iso_pu_bacteria 2885366525 2885374579 228
64 iso_pu_bacteria 2885374607 2885377202 228
65 iso_pu_bacteria 2885409591 2885414040 228
66 iso_pu_bacteria 2888378607 2888387553 228
67 iso_pu_bacteria 2888388044 2888391647 228
68 iso_pu_bacteria 2888419890 2888426776 228
69 iso_pu_bacteria 2889033259 2889034053 228
70 iso_pu_bacteria 2893066018 2893068122 228
71 iso_pu_bacteria 2903727486 2903728684 228
72 iso_pu_bacteria 2904666416 2904670870 228
73 iso_pu_bacteria 2904690495 2904697652 228
74 iso_pu_bacteria 2906602504 2906607876 228
75 iso_pu_bacteria 2906626472 2906634863 228
76 iso_pu_bacteria 2906643746 2906645724 228
77 iso_pu_bacteria 2908739725 2908740236 228
78 iso_pu_bacteria 2908756301 2908757758 228
79 iso_pu_bacteria 2919073203 2919078214 228
80 iso_pu_bacteria 2922361189 2922367453 228
81 iso_pu_bacteria 2922368715 2922376528 228
82 iso_pu_bacteria 2922386360 2922391444 228
83 iso_pu_bacteria 2929615660 2929619968 228
84 iso_pu_bacteria 2929624759 2929629280 228
85 iso_pu_bacteria 2932784394 2932789592 228
86 iso_pu_bacteria 2932801729 2932802486 228
87 iso_pu_bacteria 2932809354 2932814901 228
88 iso_pu_bacteria 2932818245 2932824243 228
89 iso_pu_bacteria 2932828146 2932834030 228
90 iso_pu_bacteria 2933577622 2933581886 228
91 iso_pu_bacteria 2935608549 2935613322 228
92 iso_pu_bacteria 2935616580 2935623580 228
93 iso_pu_bacteria 2935638405 2935644967 228
94 iso_pu_bacteria 2935648319 2935653800 228
95 iso_pu_bacteria 2935656913 2935662549 228
96 iso_pu_bacteria 2935665750 2935672016 228
97 iso_pu_bacteria 2935675223 2935683057 228
98 iso_pu_bacteria 2935684952 2935689227 228
99 iso_pu_bacteria 2935694250 2935697514 228
100 iso_pu_bacteria 2935703347 2935711091 228
101 iso_pu_bacteria 2935713505 2935720173 228
102 iso_pu_bacteria 2935722832 2935728210 228
103 iso_pu_bacteria 2935732158 2935737193 228
104 iso_pu_bacteria 2935741537 2935746746 228
105 iso_pu_bacteria 2935750917 2935757713 228
106 iso_pu_bacteria 2935760218 2935764092 228
107 iso_pu_bacteria 2935769743 2935776376 228
108 iso_pu_bacteria 2935777560 2935784363 228
109 iso_pu_bacteria 2935785616 2935792399 228
110 iso_pu_bacteria 2935793552 2935800562 228
111 iso_pu_bacteria 2935801545 2935808680 228
112 iso_pu_bacteria 2935810662 2935817477 228
113 iso_pu_bacteria 2935819856 2935824824 228
114 iso_pu_bacteria 2935827899 2935834187 228
115 iso_pu_bacteria 2935837841 2935844789 228
116 iso_pu_bacteria 2935847175 2935852044 228
117 iso_pu_bacteria 2935855204 2935861813 228
118 iso_pu_bacteria 2935864058 2935868551 228
119 iso_pu_bacteria 2935873716 2935879325 228
120 iso_pu_bacteria 2935908558 2935911392 228
121 iso_pu_bacteria 2935916978 2935920925 228
122 iso_pu_bacteria 2935926038 2935928421 228
123 iso_pu_bacteria 2935934488 2935938066 228
124 iso_pu_bacteria 2935942939 2935945348 228
125 iso_pu_bacteria 2935951376 2935954146 228
126 iso_pu_bacteria 2935959822 2935965970 228
127 iso_pu_bacteria 2935967501 2935971586 228
128 iso_pu_bacteria 2935975950 2935979982 228
129 iso_pu_bacteria 2935984226 2935989410 228
130 iso_pu_bacteria 2936002035 2936009032 228
131 iso_pu_bacteria 2936011229 2936016803 228
132 iso_pu_bacteria 2936019824 2936025436 228
133 iso_pu_bacteria 2936028420 2936034326 228
134 iso_pu_bacteria 2936037263 2936044274 228
135 iso_pu_bacteria 2936046547 2936052383 228
136 iso_pu_bacteria 2936055302 2936060664 228
137 iso_pu_bacteria 2940556831 2940563465 228
138 iso_pu_bacteria 2941538514 2941545316 228
139 iso_pu_bacteria 3005483717 3005485875 228
140 iso_pu_bacteria 3005506211 3005506742 228
141 iso_pu_bacteria 3005594810 3005601594 228
142 iso_pu_bacteria 3005710791 3005717329 228
143 iso_pu_bacteria 3005718088 3005724286 228
144 iso_pu_bacteria 8006926726 8006932167 228
145 iso_pu_bacteria 8006964411 8006965958 228
146 iso_pu_bacteria 8006984368 8006989914 228
147 iso_pu_bacteria 8016511872 8016519311 228
148 iso_pu_bacteria 8016522445 8016525026 228
149 iso_pu_bacteria 8016530956 8016538605 228
150 iso_pu_bacteria 8016539877 8016542890 228
151 iso_pu_bacteria 8016548790 8016550399 228
152 iso_pu_bacteria 8016557553 8016558813 228
153 iso_pu_bacteria 8016566248 8016568282 228
154 iso_pu_bacteria 8016583857 8016587800 228
155 iso_pu_bacteria 8016595262 8016596781 228
156 iso_pu_bacteria 8016603502 8016607671 228
157 iso_pu_bacteria 8016613128 8016619463 228
158 iso_pu_bacteria 8016622563 8016630141 228
159 iso_pu_bacteria 8016630954 8016637022 228
160 iso_pu_bacteria 8017057580 8017066204 228
161 iso_pu_bacteria 8019530166 8019538272 228
162 iso_pu_bacteria 8019547302 8019549081 228
163 iso_pu_bacteria 8019576017 8019578423 228
164 iso_pu_bacteria 8019586578 8019596462 228
165 iso_pu_bacteria 8019597564 8019605239 228
166 iso_pu_bacteria 8019608314 8019613310 228
167 iso_pu_bacteria 8019619141 8019623978 228
168 iso_pu_bacteria 8019629233 8019638055 228
169 iso_pu_bacteria 8019638758 8019641581 228
170 iso_pu_bacteria 8019668869 8019675496 228
171 iso_pu_bacteria 8019678201 8019680604 228
172 iso_pu_bacteria 8019687851 8019695158 228
173 iso_pu_bacteria 8055742211 8055750280 228
174 iso_pu_bacteria 8056673599 8056677893 228
175 iso_pu_bacteria 8056967851 8056976059 228
176 3300060344 Ga0587071_015827 Ga0587071_015827_178_873 231
177 3300003215 JGI25153J46596_10000371 JGI25153J46596_1000037113 232
178 3300003215 JGI25153J46596_10000865 JGI25153J46596_1000086511 232
179 3300003215 JGI25153J46596_10018801 JGI25153J46596_100188013 232
180 3300003794 Ga0055531_10005980 Ga0055531_100059802 232
181 3300004625 Ga0055543_1023154 Ga0055543_10231542 232
182 3300004799 Ga0058863_11849786 Ga0058863_118497861 232
183 3300005262 Ga0065165_1001685 Ga0065165_100168513 232
184 3300005262 Ga0065165_1004072 Ga0065165_10040722 232
185 3300005328 Ga0070676_10021570 Ga0070676_100215704 232
186 3300005329 Ga0070683_100003434 Ga0070683_1000034349 232
187 3300005331 Ga0070670_100078460 Ga0070670_1000784603 232
188 3300005336 Ga0070680_100361829 Ga0070680_1003618292 232
189 3300005338 Ga0068868_100099670 Ga0068868_1000996701 232
190 3300005339 Ga0070660_100227359 Ga0070660_1002273591 232
191 3300005344 Ga0070661_100504538 Ga0070661_1005045382 232
192 3300005347 Ga0070668_100033480 Ga0070668_1000334802 232
193 3300005347 Ga0070668_100107901 Ga0070668_1001079012 232
194 3300005347 Ga0070668_100136903 Ga0070668_1001369032 232
195 3300005347 Ga0070668_100352102 Ga0070668_1003521022 232
196 3300005347 Ga0070668_100407157 Ga0070668_1004071572 232
197 3300005353 Ga0070669_100025831 Ga0070669_1000258313 232
198 3300005355 Ga0070671_100038198 Ga0070671_1000381984 232
199 3300005356 Ga0070674_100177310 Ga0070674_1001773102 232
200 3300005356 Ga0070674_100179268 Ga0070674_1001792682 232
201 3300005364 Ga0070673_100168033 Ga0070673_1001680332 232
202 3300005365 Ga0070688_100233004 Ga0070688_1002330042 232
203 3300005366 Ga0070659_100411099 Ga0070659_1004110992 232
204 3300005434 Ga0070709_10025034 Ga0070709_100250342 232
205 3300005434 Ga0070709_10556118 Ga0070709_105561181 232
206 3300005435 Ga0070714_100745237 Ga0070714_1007452372 232
207 3300005435 Ga0070714_100826716 Ga0070714_1008267162 232
208 3300005436 Ga0070713_100019302 Ga0070713_1000193022 232
209 3300005436 Ga0070713_100203137 Ga0070713_1002031372 232
210 3300005436 Ga0070713_100264165 Ga0070713_1002641652 232
211 3300005436 Ga0070713_100312293 Ga0070713_1003122932 232
212 3300005436 Ga0070713_100417458 Ga0070713_1004174581 232
213 3300005437 Ga0070710_10008635 Ga0070710_100086352 232
214 3300005439 Ga0070711_100005721 Ga0070711_1000057212 232
215 3300005439 Ga0070711_100014790 Ga0070711_1000147907 232
216 3300005439 Ga0070711_100174538 Ga0070711_1001745382 232
217 3300005440 Ga0070705_100256037 Ga0070705_1002560371 232
218 3300005455 Ga0070663_100003220 Ga0070663_1000032202 232
219 3300005455 Ga0070663_100055736 Ga0070663_1000557362 232
220 3300005455 Ga0070663_100156640 Ga0070663_1001566402 232
221 3300005455 Ga0070663_100335065 Ga0070663_1003350652 232
222 3300005455 Ga0070663_100402282 Ga0070663_1004022821 232
223 3300005456 Ga0070678_100108988 Ga0070678_1001089883 232
224 3300005457 Ga0070662_100245819 Ga0070662_1002458192 232
225 3300005458 Ga0070681_10243463 Ga0070681_102434632 232
226 3300005467 Ga0070706_100055109 Ga0070706_1000551095 232
227 3300005471 Ga0070698_100056809 Ga0070698_1000568094 232
228 3300005471 Ga0070698_100844106 Ga0070698_1008441061 232
229 3300005530 Ga0070679_100030709 Ga0070679_1000307096 232
230 3300005530 Ga0070679_100460981 Ga0070679_1004609811 232
231 3300005539 Ga0068853_100283155 Ga0068853_1002831552 232
232 3300005539 Ga0068853_100286916 Ga0068853_1002869162 232
233 3300005543 Ga0070672_100328487 Ga0070672_1003284871 232
234 3300005548 Ga0070665_100004774 Ga0070665_1000047742 232
235 3300005548 Ga0070665_100093542 Ga0070665_1000935423 232
236 3300005548 Ga0070665_100129223 Ga0070665_1001292231 232
237 3300005548 Ga0070665_100268135 Ga0070665_1002681351 232
238 3300005563 Ga0068855_100134381 Ga0068855_1001343813 232
239 3300005563 Ga0068855_100184191 Ga0068855_1001841912 232
240 3300005577 Ga0068857_100307253 Ga0068857_1003072532 232
241 3300005578 Ga0068854_100112009 Ga0068854_1001120092 232
242 3300005614 Ga0068856_100000046 Ga0068856_10000004642 232
243 3300005616 Ga0068852_100199867 Ga0068852_1001998673 232
244 3300005616 Ga0068852_100375094 Ga0068852_1003750941 232
245 3300005616 Ga0068852_100392911 Ga0068852_1003929112 232
246 3300005618 Ga0068864_101016699 Ga0068864_1010166991 232
247 3300005719 Ga0068861_100043439 Ga0068861_1000434393 232
248 3300005719 Ga0068861_100052910 Ga0068861_1000529103 232
249 3300005719 Ga0068861_100273488 Ga0068861_1002734882 232
250 3300005719 Ga0068861_100353766 Ga0068861_1003537663 232
251 3300005834 Ga0068851_10151085 Ga0068851_101510852 232
252 3300005834 Ga0068851_10218067 Ga0068851_102180671 232
253 3300005842 Ga0068858_100088777 Ga0068858_1000887774 232
254 3300005843 Ga0068860_100002690 Ga0068860_1000026904 232
255 3300005843 Ga0068860_100020202 Ga0068860_1000202028 232
256 3300005843 Ga0068860_100393060 Ga0068860_1003930603 232
257 3300005844 Ga0068862_100052654 Ga0068862_1000526542 232
258 3300005844 Ga0068862_100116002 Ga0068862_1001160022 232
259 3300005844 Ga0068862_100540425 Ga0068862_1005404252 232
260 3300005937 Ga0081455_10001281 Ga0081455_1000128125 232
261 3300005983 Ga0081540_1000593 Ga0081540_10005935 232
262 3300005983 Ga0081540_1025136 Ga0081540_10251363 232
263 3300006028 Ga0070717_10226496 Ga0070717_102264962 232
264 3300006028 Ga0070717_10331363 Ga0070717_103313631 232
265 3300006028 Ga0070717_10332431 Ga0070717_103324312 232
266 3300006028 Ga0070717_10496535 Ga0070717_104965352 232
267 3300006038 Ga0075365_10012254 Ga0075365_100122547 232
268 3300006038 Ga0075365_10027550 Ga0075365_100275505 232
269 3300006038 Ga0075365_10050798 Ga0075365_100507982 232
270 3300006038 Ga0075365_10253508 Ga0075365_102535082 232
271 3300006048 Ga0075363_100009873 Ga0075363_1000098735 232
272 3300006048 Ga0075363_100145191 Ga0075363_1001451911 232
273 3300006051 Ga0075364_10031364 Ga0075364_100313642 232
274 3300006163 Ga0070715_10281387 Ga0070715_102813871 232
275 3300006173 Ga0070716_100010123 Ga0070716_1000101231 232
276 3300006175 Ga0070712_100030277 Ga0070712_1000302772 232
277 3300006175 Ga0070712_100049612 Ga0070712_1000496122 232
278 3300006175 Ga0070712_100157673 Ga0070712_1001576732 232
279 3300006175 Ga0070712_100221964 Ga0070712_1002219642 232
280 3300006175 Ga0070712_100335717 Ga0070712_1003357172 232
281 3300006177 Ga0075362_10058214 Ga0075362_100582141 232
282 3300006178 Ga0075367_10050906 Ga0075367_100509062 232
283 3300006178 Ga0075367_10099002 Ga0075367_100990022 232
284 3300006186 Ga0075369_10014471 Ga0075369_100144713 232
285 3300006186 Ga0075369_10091574 Ga0075369_100915742 232
286 3300006195 Ga0075366_10056073 Ga0075366_100560732 232
287 3300006195 Ga0075366_10089421 Ga0075366_100894212 232
288 3300006237 Ga0097621_100042019 Ga0097621_1000420192 232
289 3300006353 Ga0075370_10009873 Ga0075370_100098737 232
290 3300006880 Ga0075429_100350803 Ga0075429_1003508032 232
291 3300006881 Ga0068865_100371000 Ga0068865_1003710002 232
292 3300006944 Ga0099823_1038597 Ga0099823_10385974 232
293 3300007265 Ga0099794_10099064 Ga0099794_100990642 232
294 3300007265 Ga0099794_10143822 Ga0099794_101438221 232
295 3300007788 Ga0099795_10032792 Ga0099795_100327922 232
296 3300009093 Ga0105240_10011485 Ga0105240_1001148510 232
297 3300009093 Ga0105240_10754591 Ga0105240_107545911 232
298 3300009098 Ga0105245_10052348 Ga0105245_100523482 232
299 3300009098 Ga0105245_10095059 Ga0105245_100950592 232
300 3300009147 Ga0114129_10277201 Ga0114129_102772013 232
301 3300009148 Ga0105243_10161981 Ga0105243_101619812 232
302 3300009174 Ga0105241_10084517 Ga0105241_100845173 232
303 3300009174 Ga0105241_10268606 Ga0105241_102686062 232
304 3300009176 Ga0105242_10248379 Ga0105242_102483792 232
305 3300009545 Ga0105237_10008240 Ga0105237_100082402 232
306 3300009545 Ga0105237_10011626 Ga0105237_100116269 232
307 3300009545 Ga0105237_10870849 Ga0105237_108708492 232
308 3300009551 Ga0105238_10013383 Ga0105238_100133833 232
309 3300009551 Ga0105238_10901567 Ga0105238_109015671 232
310 3300009553 Ga0105249_10189989 Ga0105249_101899892 232
311 3300009553 Ga0105249_10257187 Ga0105249_102571872 232
312 3300010159 Ga0099796_10005934 Ga0099796_100059344 232
313 3300010375 Ga0105239_10125179 Ga0105239_101251791 232
314 3300010375 Ga0105239_10547284 Ga0105239_105472842 232
315 3300010375 Ga0105239_10763716 Ga0105239_107637162 232
316 3300011119 Ga0105246_10011337 Ga0105246_100113372 232
317 3300013105 Ga0157369_10053866 Ga0157369_100538663 232
318 3300013296 Ga0157374_10165358 Ga0157374_101653582 232
319 3300013306 Ga0163162_10258025 Ga0163162_102580252 232
320 3300013307 Ga0157372_10140742 Ga0157372_101407422 232
321 3300013308 Ga0157375_10827678 Ga0157375_108276782 232
322 3300014325 Ga0163163_10030936 Ga0163163_100309365 232
323 3300014325 Ga0163163_10065889 Ga0163163_100658893 232
324 3300014326 Ga0157380_10055300 Ga0157380_100553004 232
325 3300014969 Ga0157376_10236788 Ga0157376_102367882 232
326 3300017792 Ga0163161_10002299 Ga0163161_100022992 232
327 3300017792 Ga0163161_10276177 Ga0163161_102761772 232
328 3300020080 Ga0206350_10194348 Ga0206350_101943481 232
329 3300020082 Ga0206353_11188210 Ga0206353_111882102 232
330 3300021377 Ga0213874_10063486 Ga0213874_100634861 232
331 3300021384 Ga0213876_10009405 Ga0213876_100094053 232
332 3300021384 Ga0213876_10069367 Ga0213876_100693671 232
333 3300025230 Ga0209563_105359 Ga0209563_1053592 232
334 3300025254 Ga0209148_1000335 Ga0209148_100033571 232
335 3300025261 Ga0209233_1021523 Ga0209233_10215232 232
336 3300025272 Ga0209455_1002543 Ga0209455_100254310 232
337 3300025272 Ga0209455_1018248 Ga0209455_10182482 232
338 3300025295 Ga0209564_1005823 Ga0209564_10058236 232
339 3300025295 Ga0209564_1009493 Ga0209564_10094932 232
340 3300025297 Ga0209758_1000106 Ga0209758_100010658 232
341 3300025297 Ga0209758_1000344 Ga0209758_100034434 232
342 3300025297 Ga0209758_1001326 Ga0209758_100132620 232
343 3300025297 Ga0209758_1009962 Ga0209758_10099623 232
344 3300025297 Ga0209758_1017145 Ga0209758_10171453 232
345 3300025297 Ga0209758_1056592 Ga0209758_10565922 232
346 3300025299 Ga0209256_1034875 Ga0209256_10348751 232
347 3300025299 Ga0209256_1038893 Ga0209256_10388932 232
348 3300025302 Ga0207426_1009980 Ga0207426_10099803 232
349 3300025303 Ga0209051_1033895 Ga0209051_10338952 232
350 3300025304 Ga0209257_1000819 Ga0209257_100081929 232
351 3300025304 Ga0209257_1044522 Ga0209257_10445221 232
352 3300025315 Ga0207697_10209518 Ga0207697_102095181 232
353 3300025885 Ga0207653_10084345 Ga0207653_100843452 232
354 3300025893 Ga0207682_10043964 Ga0207682_100439642 232
355 3300025898 Ga0207692_10015203 Ga0207692_100152034 232
356 3300025901 Ga0207688_10146939 Ga0207688_101469391 232
357 3300025901 Ga0207688_10150220 Ga0207688_101502201 232
358 3300025904 Ga0207647_10289090 Ga0207647_102890901 232
359 3300025905 Ga0207685_10029506 Ga0207685_100295061 232
360 3300025906 Ga0207699_10001790 Ga0207699_100017905 232
361 3300025907 Ga0207645_10031981 Ga0207645_100319813 232
362 3300025907 Ga0207645_10198471 Ga0207645_101984712 232
363 3300025910 Ga0207684_10279585 Ga0207684_102795852 232
364 3300025912 Ga0207707_10165205 Ga0207707_101652051 232
365 3300025913 Ga0207695_10000123 Ga0207695_10000123180 232
366 3300025913 Ga0207695_10156146 Ga0207695_101561462 232
367 3300025913 Ga0207695_10551270 Ga0207695_105512701 232
368 3300025914 Ga0207671_10041194 Ga0207671_100411941 232
369 3300025915 Ga0207693_10004353 Ga0207693_1000435310 232
370 3300025915 Ga0207693_10042871 Ga0207693_100428712 232
371 3300025915 Ga0207693_10132712 Ga0207693_101327121 232
372 3300025915 Ga0207693_10186073 Ga0207693_101860732 232
373 3300025915 Ga0207693_10361141 Ga0207693_103611411 232
374 3300025916 Ga0207663_10022584 Ga0207663_100225843 232
375 3300025916 Ga0207663_10305492 Ga0207663_103054921 232
376 3300025918 Ga0207662_10202663 Ga0207662_102026632 232
377 3300025919 Ga0207657_10030146 Ga0207657_100301464 232
378 3300025921 Ga0207652_10477417 Ga0207652_104774172 232
379 3300025922 Ga0207646_10181300 Ga0207646_101813002 232
380 3300025922 Ga0207646_10951818 Ga0207646_109518181 232
381 3300025923 Ga0207681_10397718 Ga0207681_103977182 232
382 3300025925 Ga0207650_10253003 Ga0207650_102530032 232
383 3300025927 Ga0207687_10008542 Ga0207687_100085427 232
384 3300025927 Ga0207687_10058231 Ga0207687_100582312 232
385 3300025928 Ga0207700_10016987 Ga0207700_100169872 232
386 3300025928 Ga0207700_10201366 Ga0207700_102013662 232
387 3300025928 Ga0207700_10416549 Ga0207700_104165492 232
388 3300025928 Ga0207700_10660271 Ga0207700_106602711 232
389 3300025929 Ga0207664_10214528 Ga0207664_102145282 232
390 3300025929 Ga0207664_10355056 Ga0207664_103550562 232
391 3300025929 Ga0207664_10406422 Ga0207664_104064221 232
392 3300025929 Ga0207664_10458158 Ga0207664_104581582 232
393 3300025932 Ga0207690_10102914 Ga0207690_101029142 232
394 3300025933 Ga0207706_10279321 Ga0207706_102793212 232
395 3300025935 Ga0207709_10068831 Ga0207709_100688314 232
396 3300025937 Ga0207669_10057902 Ga0207669_100579021 232
397 3300025937 Ga0207669_10059328 Ga0207669_100593282 232
398 3300025937 Ga0207669_10074082 Ga0207669_100740822 232
399 3300025939 Ga0207665_10041526 Ga0207665_100415261 232
400 3300025939 Ga0207665_10281321 Ga0207665_102813212 232
401 3300025940 Ga0207691_10126957 Ga0207691_101269572 232
402 3300025941 Ga0207711_10057836 Ga0207711_100578364 232
403 3300025941 Ga0207711_10063179 Ga0207711_100631792 232
404 3300025942 Ga0207689_10035445 Ga0207689_100354455 232
405 3300025944 Ga0207661_10002953 Ga0207661_100029538 232
406 3300025944 Ga0207661_10309168 Ga0207661_103091682 232
407 3300025944 Ga0207661_10399297 Ga0207661_103992972 232
408 3300025945 Ga0207679_10195604 Ga0207679_101956041 232
409 3300025949 Ga0207667_10105644 Ga0207667_101056443 232
410 3300025949 Ga0207667_10183972 Ga0207667_101839723 232
411 3300025972 Ga0207668_10022000 Ga0207668_100220002 232
412 3300025972 Ga0207668_10034680 Ga0207668_100346806 232
413 3300025972 Ga0207668_10101833 Ga0207668_101018332 232
414 3300025972 Ga0207668_10395182 Ga0207668_103951822 232
415 3300025981 Ga0207640_10213733 Ga0207640_102137332 232
416 3300026023 Ga0207677_10594685 Ga0207677_105946852 232
417 3300026035 Ga0207703_10215104 Ga0207703_102151042 232
418 3300026035 Ga0207703_10707198 Ga0207703_107071982 232
419 3300026041 Ga0207639_10041924 Ga0207639_100419242 232
420 3300026041 Ga0207639_10632708 Ga0207639_106327081 232
421 3300026067 Ga0207678_10014071 Ga0207678_100140718 232
422 3300026067 Ga0207678_10071921 Ga0207678_100719213 232
423 3300026067 Ga0207678_10116637 Ga0207678_101166373 232
424 3300026067 Ga0207678_10210686 Ga0207678_102106862 232
425 3300026067 Ga0207678_10346093 Ga0207678_103460932 232
426 3300026078 Ga0207702_10000014 Ga0207702_10000014130 232
427 3300026078 Ga0207702_10245405 Ga0207702_102454052 232
428 3300026088 Ga0207641_10676818 Ga0207641_106768182 232
429 3300026095 Ga0207676_11021605 Ga0207676_110216051 232
430 3300026116 Ga0207674_10072022 Ga0207674_100720224 232
431 3300026116 Ga0207674_10091426 Ga0207674_100914262 232
432 3300026118 Ga0207675_100131229 Ga0207675_1001312292 232
433 3300026118 Ga0207675_100279300 Ga0207675_1002793002 232
434 3300026118 Ga0207675_100290212 Ga0207675_1002902122 232
435 3300026121 Ga0207683_10010057 Ga0207683_100100579 232
436 3300026121 Ga0207683_10135865 Ga0207683_101358651 232
437 3300026121 Ga0207683_10260461 Ga0207683_102604612 232
438 3300026142 Ga0207698_10170153 Ga0207698_101701531 232
439 3300026142 Ga0207698_10368307 Ga0207698_103683072 232
440 3300027296 Ga0209389_1000016 Ga0209389_1000016152 232
441 3300027296 Ga0209389_1000027 Ga0209389_10000279 232
442 3300027357 Ga0209589_1000031 Ga0209589_100003121 232
443 3300027361 Ga0209489_100057 Ga0209489_100057126 232
444 3300027361 Ga0209489_100063 Ga0209489_100063110 232
445 3300027363 Ga0209700_100012 Ga0209700_100012153 232
446 3300027907 Ga0207428_10061061 Ga0207428_100610612 232
447 3300028379 Ga0268266_10003152 Ga0268266_1000315214 232
448 3300028379 Ga0268266_10003898 Ga0268266_1000389813 232
449 3300028379 Ga0268266_10116461 Ga0268266_101164612 232
450 3300028380 Ga0268265_10103699 Ga0268265_101036992 232
451 3300028380 Ga0268265_10173890 Ga0268265_101738901 232
452 3300028380 Ga0268265_10325869 Ga0268265_103258692 232
453 3300028380 Ga0268265_11212369 Ga0268265_112123691 232
454 3300028381 Ga0268264_10000042 Ga0268264_10000042189 232
455 3300028381 Ga0268264_10186255 Ga0268264_101862552 232
456 3300028381 Ga0268264_10252105 Ga0268264_102521052 232
457 3300028786 Ga0307517_10000176 Ga0307517_1000017699 232
458 3300030522 Ga0307512_10201851 Ga0307512_102018512 232
459 3300030863 Ga0265766_1003936 Ga0265766_10039361 232
460 3300031238 Ga0265332_10024877 Ga0265332_100248772 232
461 3300031238 Ga0265332_10094353 Ga0265332_100943532 232
462 3300031239 Ga0265328_10067062 Ga0265328_100670622 232
463 3300031239 Ga0265328_10155337 Ga0265328_101553371 232
464 3300031247 Ga0265340_10059768 Ga0265340_100597681 232
465 3300031249 Ga0265339_10001372 Ga0265339_100013722 232
466 3300031249 Ga0265339_10033300 Ga0265339_100333003 232
467 3300031249 Ga0265339_10048940 Ga0265339_100489402 232
468 3300031250 Ga0265331_10210947 Ga0265331_102109471 232
469 3300031250 Ga0265331_10247064 Ga0265331_102470641 232
470 3300031507 Ga0307509_10142209 Ga0307509_101422092 232
471 3300031616 Ga0307508_10062521 Ga0307508_100625212 232
472 3300031711 Ga0265314_10016415 Ga0265314_100164155 232
473 3300031711 Ga0265314_10050084 Ga0265314_100500843 232
474 3300031712 Ga0265342_10009595 Ga0265342_100095957 232
475 3300031730 Ga0307516_10020012 Ga0307516_100200125 232
476 3300031730 Ga0307516_10107016 Ga0307516_101070163 232
477 3300031730 Ga0307516_10112661 Ga0307516_101126613 232
478 3300031911 Ga0307412_10056255 Ga0307412_100562553 232
479 3300031995 Ga0307409_100101192 Ga0307409_1001011922 232
480 3300031995 Ga0307409_100585515 Ga0307409_1005855152 232
481 3300032002 Ga0307416_100440886 Ga0307416_1004408862 232
482 3300032005 Ga0307411_10259343 Ga0307411_102593432 232
483 3300032126 Ga0307415_100088088 Ga0307415_1000880882 232
484 3300033180 Ga0307510_10007730 Ga0307510_1000773011 232
485 3300033180 Ga0307510_10037836 Ga0307510_100378365 232
486 3300033180 Ga0307510_10187488 Ga0307510_101874881 232
487 3300033180 Ga0307510_10242427 Ga0307510_102424272 232
488 3300033180 Ga0307510_10326208 Ga0307510_103262081 232
489 3300034818 Ga0373950_0047760 Ga0373950_0047760_47_745 232
490 3300035085 Ga0373929_0037043 Ga0373929_0037043_345_1043 232
491 3300035086 Ga0373934_0002178 Ga0373934_0002178_4590_5288 232
492 3300035111 Ga0373923_0001946 Ga0373923_0001946_4821_5519 232
493 3300035117 Ga0373953_0001243 Ga0373953_0001243_5169_5867 232
494 3300035118 Ga0373954_0002355 Ga0373954_0002355_3531_4229 232
495 3300035120 Ga0373957_0000527 Ga0373957_0000527_8022_8720 232
496 3300035172 Ga0373955_0000535 Ga0373955_0000535_14506_15204 232
497 3300035207 Ga0373942_0020097 Ga0373942_0020097_225_923 232
498 3300035410 Ga0373924_0004005 Ga0373924_0004005_2982_3680 232
499 3300035691 Ga0373931_0014148 Ga0373931_0014148_3071_3769 232
500 3300035692 Ga0373935_0023018 Ga0373935_0023018_1158_1856 232
501 3300035695 Ga0373927_0012684 Ga0373927_0012684_3784_4482 232
502 3300035724 Ga0373933_0002165 Ga0373933_0002165_7001_7699 232
503 3300035725 Ga0373947_0066854 Ga0373947_0066854_1396_2094 232
504 3300036242 Ga0310104_11013 Ga0310104_11013_11_709 232
505 3300036401 Ga0373937_0033007 Ga0373937_0033007_2108_2806 232
506 3300036401 Ga0373937_0184350 Ga0373937_0184350_549_1247 232
507 3300036401 Ga0373937_0236682 Ga0373937_0236682_766_1464 232
508 3300036534 Ga0310109_001672 Ga0310109_001672_836_1534 232
509 3300037068 Ga0373925_0219459 Ga0373925_0219459_387_1085 232
510 3300037312 Ga0395899_0066265 Ga0395899_0066265_693_1391 232
511 3300037312 Ga0395899_0088186 Ga0395899_0088186_516_1229 232
512 3300037418 Ga0395900_0001282 Ga0395900_0001282_22141_22839 232
513 3300037418 Ga0395900_0219351 Ga0395900_0219351_23_721 232
514 3300037466 Ga0395898_0037345 Ga0395898_0037345_569_1267 232
515 3300037466 Ga0395898_0048844 Ga0395898_0048844_2442_3140 232
516 3300037471 Ga0395905_0004232 Ga0395905_0004232_13155_13853 232
517 3300037471 Ga0395905_0534219 Ga0395905_0534219_53_751 232
518 3300037471 Ga0395905_0904549 Ga0395905_0904549_72_770 232
519 3300037853 Ga0436364_0641210 Ga0436364_0641210_290_988 232
520 3300037853 Ga0436364_0800356 Ga0436364_0800356_198_896 232
521 3300038443 Ga0395901_0006277 Ga0395901_0006277_4439_5137 232
522 3300038443 Ga0395901_0227382 Ga0395901_0227382_1014_1727 232
523 3300039437 Ga0436365_0119504 Ga0436365_0119504_593_1393 232
524 3300039437 Ga0436365_0279031 Ga0436365_0279031_219_917 232
525 3300039437 Ga0436365_0838143 Ga0436365_0838143_1872_2570 232
526 3300039437 Ga0436365_1138701 Ga0436365_1138701_25611_26309 232
527 3300039447 Ga0436361_0334533 Ga0436361_0334533_260_958 232
528 3300039447 Ga0436361_0849478 Ga0436361_0849478_1700_2398 232
529 3300039450 Ga0436363_0830766 Ga0436363_0830766_1152_1850 232
530 3300039453 Ga0436362_0546910 Ga0436362_0546910_321_1019 232
531 3300039453 Ga0436362_0740954 Ga0436362_0740954_47_745 232
532 3300041413 Ga0439465_0114781 Ga0439465_0114781_45_743 232
533 3300041443 Ga0451789_0163036 Ga0451789_0163036_223_921 232
534 3300044658 Ga0466972_0000179 Ga0466972_0000179_38418_39116 232
535 3300044658 Ga0466972_0000516 Ga0466972_0000516_4355_5053 232
536 3300044658 Ga0466972_0085873 Ga0466972_0085873_548_1246 232
537 3300044683 Ga0466965_0072218 Ga0466965_0072218_10_708 232
538 3300044694 Ga0466963_0038559 Ga0466963_0038559_2381_3079 232
539 3300044694 Ga0466963_0080254 Ga0466963_0080254_472_1170 232
540 3300044706 Ga0466964_0014197 Ga0466964_0014197_1274_1981 232
541 3300044735 Ga0466968_0008321 Ga0466968_0008321_3028_3726 232
542 3300044842 Ga0466957_0071003 Ga0466957_0071003_387_1085 232
543 3300044842 Ga0466957_0261651 Ga0466957_0261651_426_1124 232
544 3300044901 Ga0466960_0052697 Ga0466960_0052697_1060_1758 232
545 3300045836 Ga0466958_0140344 Ga0466958_0140344_740_1438 232
546 3300045976 Ga0466967_0459294 Ga0466967_0459294_140_838 232
547 3300045976 Ga0466967_0564918 Ga0466967_0564918_356_1054 232
548 3300046452 Ga0495617_006222 Ga0495617_006222_414_1160 232
549 3300046452 Ga0495617_059017 Ga0495617_059017_134_832 232
550 3300046454 Ga0495592_0021832 Ga0495592_0021832_1141_1839 232
551 3300046454 Ga0495592_0085595 Ga0495592_0085595_323_1021 232
552 3300046454 Ga0495592_0268273 Ga0495592_0268273_55_753 232
553 3300046455 Ga0495603_0046487 Ga0495603_0046487_1499_2197 232
554 3300046455 Ga0495603_0079540 Ga0495603_0079540_145_891 232
555 3300046455 Ga0495603_0156284 Ga0495603_0156284_25_771 232
556 3300046459 Ga0495629_0001841 Ga0495629_0001841_5967_6665 232
557 3300046459 Ga0495629_0132485 Ga0495629_0132485_883_1629 232
558 3300046459 Ga0495629_0195513 Ga0495629_0195513_439_1137 232
559 3300046460 Ga0495638_0001078 Ga0495638_0001078_12639_13337 232
560 3300046460 Ga0495638_0011310 Ga0495638_0011310_1588_2286 232
561 3300046460 Ga0495638_0235426 Ga0495638_0235426_46_744 232
562 3300046461 Ga0495641_0220237 Ga0495641_0220237_130_828 232
563 3300046462 Ga0495651_0001119 Ga0495651_0001119_19425_20123 232
564 3300046462 Ga0495651_0046362 Ga0495651_0046362_937_1635 232
565 3300046462 Ga0495651_0167779 Ga0495651_0167779_292_990 232
566 3300046463 Ga0495653_0050502 Ga0495653_0050502_87_785 232
567 3300046471 Ga0495650_0030020 Ga0495650_0030020_1344_2042 232
568 3300046473 Ga0495582_0310421 Ga0495582_0310421_72_770 232
569 3300046474 Ga0495605_0070755 Ga0495605_0070755_861_1559 232
570 3300046475 Ga0495639_0272068 Ga0495639_0272068_115_813 232
571 3300046477 Ga0495664_0003810 Ga0495664_0003810_4764_5462 232
572 3300046491 Ga0495584_0061495 Ga0495584_0061495_838_1536 232
573 3300046491 Ga0495584_0237281 Ga0495584_0237281_20_718 232
574 3300046492 Ga0495585_0200282 Ga0495585_0200282_18_716 232
575 3300046499 Ga0495594_0089576 Ga0495594_0089576_290_1036 232
576 3300046499 Ga0495594_0163685 Ga0495594_0163685_20_769 232
577 3300046500 Ga0495596_0028449 Ga0495596_0028449_1332_2078 232
578 3300046500 Ga0495596_0136340 Ga0495596_0136340_227_925 232
579 3300046506 Ga0495583_0069764 Ga0495583_0069764_775_1473 232
580 3300046507 Ga0495606_0000357 Ga0495606_0000357_42039_42737 232
581 3300046507 Ga0495606_0089364 Ga0495606_0089364_753_1451 232
582 3300046507 Ga0495606_0236277 Ga0495606_0236277_260_958 232
583 3300046515 Ga0495620_0016755 Ga0495620_0016755_1979_2677 232
584 3300046515 Ga0495620_0062706 Ga0495620_0062706_46_792 232
585 3300046515 Ga0495620_0079786 Ga0495620_0079786_525_1271 232
586 3300046516 Ga0495628_0073716 Ga0495628_0073716_861_1559 232
587 3300046516 Ga0495628_0161204 Ga0495628_0161204_408_1106 232
588 3300046516 Ga0495628_0391214 Ga0495628_0391214_246_944 232
589 3300046518 Ga0495631_0032716 Ga0495631_0032716_852_1550 232
590 3300046519 Ga0495632_0061929 Ga0495632_0061929_125_871 232
591 3300046519 Ga0495632_0137761 Ga0495632_0137761_352_1098 232
592 3300046522 Ga0495643_0252041 Ga0495643_0252041_67_765 232
593 3300046524 Ga0495648_0000649 Ga0495648_0000649_15734_16432 232
594 3300046524 Ga0495648_0001411 Ga0495648_0001411_7202_7981 232
595 3300046524 Ga0495648_0006902 Ga0495648_0006902_3301_3999 232
596 3300046524 Ga0495648_0103070 Ga0495648_0103070_163_861 232
597 3300046524 Ga0495648_0122851 Ga0495648_0122851_382_1080 232
598 3300046524 Ga0495648_0204434 Ga0495648_0204434_271_969 232
599 3300046529 Ga0495652_0011196 Ga0495652_0011196_1776_2474 232
600 3300046529 Ga0495652_0016077 Ga0495652_0016077_2873_3571 232
601 3300046530 Ga0495654_0094692 Ga0495654_0094692_386_1084 232
602 3300046536 Ga0495587_0037215 Ga0495587_0037215_1979_2677 232
603 3300046536 Ga0495587_0093185 Ga0495587_0093185_894_1592 232
604 3300046537 Ga0495598_0139471 Ga0495598_0139471_115_813 232
605 3300046539 Ga0495621_0041833 Ga0495621_0041833_756_1547 232
606 3300046539 Ga0495621_0126418 Ga0495621_0126418_194_892 232
607 3300046542 Ga0495597_0085789 Ga0495597_0085789_236_934 232
608 3300046557 Ga0495622_0018451 Ga0495622_0018451_2229_2927 232
609 3300046557 Ga0495622_0080083 Ga0495622_0080083_310_1056 232
610 3300046557 Ga0495622_0082546 Ga0495622_0082546_500_1198 232
611 3300046615 Ga0495656_0003804 Ga0495656_0003804_2496_3194 232
612 3300046615 Ga0495656_0050337 Ga0495656_0050337_216_914 232
613 3300046615 Ga0495656_0066365 Ga0495656_0066365_280_1026 232
614 3300046616 Ga0495668_0073504 Ga0495668_0073504_974_1720 232
615 3300046642 Ga0495634_0009918 Ga0495634_0009918_3295_3993 232
616 3300046642 Ga0495634_0040892 Ga0495634_0040892_2303_3001 232
617 3300046648 Ga0495611_0133936 Ga0495611_0133936_19_810 232
618 3300046648 Ga0495611_0170118 Ga0495611_0170118_58_756 232
619 3300046660 Ga0495625_0076145 Ga0495625_0076145_1065_1811 232
620 3300046660 Ga0495625_0196316 Ga0495625_0196316_372_1070 232
621 3300046663 Ga0495635_0002477 Ga0495635_0002477_8366_9064 232
622 3300046663 Ga0495635_0063953 Ga0495635_0063953_148_846 232
623 3300046665 Ga0495661_0130267 Ga0495661_0130267_17_808 232
624 3300046665 Ga0495661_0234929 Ga0495661_0234929_65_763 232
625 3300046674 Ga0495588_0010104 Ga0495588_0010104_2612_3310 232
626 3300046674 Ga0495588_0022019 Ga0495588_0022019_455_1246 232
627 3300046675 Ga0495657_0039033 Ga0495657_0039033_1031_1729 232
628 3300046679 Ga0495623_0002992 Ga0495623_0002992_7239_7937 232
629 3300046679 Ga0495623_0010731 Ga0495623_0010731_2110_2808 232
630 3300046679 Ga0495623_0203330 Ga0495623_0203330_378_1076 232
631 3300046680 Ga0495646_0087280 Ga0495646_0087280_160_858 232
632 3300046680 Ga0495646_0229868 Ga0495646_0229868_235_933 232
633 3300046684 Ga0495669_0062815 Ga0495669_0062815_442_1140 232
634 3300046689 Ga0495613_0033023 Ga0495613_0033023_42_740 232
635 3300046692 Ga0495671_0232995 Ga0495671_0232995_86_841 232
636 3300046694 Ga0495649_0287298 Ga0495649_0287298_25_723 232
637 3300046809 Ga0495600_0008391 Ga0495600_0008391_5552_6250 232
638 3300047317 Ga0495604_0024142 Ga0495604_0024142_1032_1730 232
639 3300047319 Ga0495674_0012072 Ga0495674_0012072_1057_1755 232
640 3300047319 Ga0495674_0065589 Ga0495674_0065589_2009_2707 232
641 3300047319 Ga0495674_0111894 Ga0495674_0111894_1327_2121 232
642 3300047319 Ga0495674_0407610 Ga0495674_0407610_247_945 232
643 3300047320 Ga0495672_0003965 Ga0495672_0003965_9675_10373 232
644 3300047321 Ga0495676_0055040 Ga0495676_0055040_608_1399 232
645 3300047321 Ga0495676_0107620 Ga0495676_0107620_829_1527 232
646 3300047322 Ga0495680_0001426 Ga0495680_0001426_17976_18674 232
647 3300047322 Ga0495680_0012571 Ga0495680_0012571_683_1381 232
648 3300047444 Ga0495675_0032501 Ga0495675_0032501_383_1081 232
649 3300047444 Ga0495675_0298645 Ga0495675_0298645_183_881 232
650 3300047469 Ga0495673_0064649 Ga0495673_0064649_430_1128 232
651 3300047471 Ga0495684_0001145 Ga0495684_0001145_15746_16444 232
652 3300047471 Ga0495684_0045526 Ga0495684_0045526_1777_2475 232
653 3300047472 Ga0495686_0049064 Ga0495686_0049064_1270_1968 232
654 3300047472 Ga0495686_0066337 Ga0495686_0066337_1106_1804 232
655 3300047472 Ga0495686_0115920 Ga0495686_0115920_774_1472 232
656 3300047472 Ga0495686_0121289 Ga0495686_0121289_115_813 232
657 3300047472 Ga0495686_0178291 Ga0495686_0178291_424_1122 232
658 3300047472 Ga0495686_0225781 Ga0495686_0225781_229_975 232
659 3300047472 Ga0495686_0355551 Ga0495686_0355551_58_756 232
660 3300047673 Ga0495593_0000526 Ga0495593_0000526_15329_16027 232
661 3300048088 Ga0495602_0007749 Ga0495602_0007749_6345_7043 232
662 3300048088 Ga0495602_0009427 Ga0495602_0009427_8201_8899 232
663 3300048091 Ga0495626_0041435 Ga0495626_0041435_605_1303 232
664 3300048903 Ga0496100_0744548 Ga0496100_0744548_30_728 232
665 3300048904 Ga0496101_0276206 Ga0496101_0276206_168_866 232
666 3300048904 Ga0496101_0578241 Ga0496101_0578241_147_845 232
667 3300048905 Ga0496102_0201668 Ga0496102_0201668_186_884 232
668 3300048905 Ga0496102_0299368 Ga0496102_0299368_642_1340 232
669 3300048906 Ga0496103_0228109 Ga0496103_0228109_209_907 232
670 3300048906 Ga0496103_0447461 Ga0496103_0447461_35_733 232
671 3300048908 Ga0496105_0021342 Ga0496105_0021342_586_1284 232
672 3300048909 Ga0496106_0057184 Ga0496106_0057184_885_1583 232
673 3300048909 Ga0496106_0262067 Ga0496106_0262067_420_1118 232
674 3300048909 Ga0496106_0331802 Ga0496106_0331802_125_823 232
675 3300048910 Ga0496107_0073000 Ga0496107_0073000_671_1369 232
676 3300048910 Ga0496107_0481273 Ga0496107_0481273_173_871 232
677 3300048911 Ga0496108_0138636 Ga0496108_0138636_1060_1758 232
678 3300048911 Ga0496108_0280518 Ga0496108_0280518_155_853 232
679 3300048913 Ga0496110_0019461 Ga0496110_0019461_4039_4737 232
680 3300048913 Ga0496110_0064838 Ga0496110_0064838_482_1228 232
681 3300048913 Ga0496110_0392551 Ga0496110_0392551_455_1153 232
682 3300048913 Ga0496110_0685768 Ga0496110_0685768_207_905 232
683 3300048913 Ga0496110_1021236 Ga0496110_1021236_25_723 232
684 3300048914 Ga0496111_0216554 Ga0496111_0216554_375_1073 232
685 3300048914 Ga0496111_0254823 Ga0496111_0254823_533_1231 232
686 3300048915 Ga0496112_0112393 Ga0496112_0112393_1327_2025 232
687 3300048915 Ga0496112_0163495 Ga0496112_0163495_393_1175 232
688 3300048915 Ga0496112_0228310 Ga0496112_0228310_615_1313 232
689 3300048915 Ga0496112_0831861 Ga0496112_0831861_65_763 232
690 3300048916 Ga0496113_0035965 Ga0496113_0035965_2897_3595 232
691 3300048916 Ga0496113_0059803 Ga0496113_0059803_284_982 232
692 3300048917 Ga0496114_0237114 Ga0496114_0237114_858_1556 232
693 3300048917 Ga0496114_0580249 Ga0496114_0580249_278_976 232
694 3300048918 Ga0496115_0048409 Ga0496115_0048409_1934_2632 232
695 3300048918 Ga0496115_0199628 Ga0496115_0199628_832_1530 232
696 3300048918 Ga0496115_0220474 Ga0496115_0220474_101_799 232
697 3300048918 Ga0496115_0264144 Ga0496115_0264144_250_948 232
698 3300048918 Ga0496115_0316810 Ga0496115_0316810_327_1025 232
699 3300048919 Ga0496116_0001611 Ga0496116_0001611_2898_3638 232
700 3300048920 Ga0496117_0013012 Ga0496117_0013012_3895_4635 232
701 3300048920 Ga0496117_0103192 Ga0496117_0103192_580_1278 232
702 3300048921 Ga0496118_0024435 Ga0496118_0024435_900_1598 232
703 3300048921 Ga0496118_0025336 Ga0496118_0025336_3181_3879 232
704 3300048921 Ga0496118_0025358 Ga0496118_0025358_920_1660 232
705 3300048921 Ga0496118_0118021 Ga0496118_0118021_46_744 232
706 3300048921 Ga0496118_0194671 Ga0496118_0194671_96_794 232
707 3300048921 Ga0496118_0278507 Ga0496118_0278507_87_785 232
708 3300048921 Ga0496118_0319732 Ga0496118_0319732_52_750 232
709 3300048922 Ga0496119_0076813 Ga0496119_0076813_807_1505 232
710 3300048922 Ga0496119_0131793 Ga0496119_0131793_276_974 232
711 3300048923 Ga0496120_0079676 Ga0496120_0079676_76_774 232
712 3300048923 Ga0496120_0250569 Ga0496120_0250569_76_774 232
713 3300048924 Ga0496121_0000753 Ga0496121_0000753_4879_5577 232
714 3300048924 Ga0496121_0028031 Ga0496121_0028031_1166_1864 232
715 3300048924 Ga0496121_0030771 Ga0496121_0030771_532_1230 232
716 3300048924 Ga0496121_0035853 Ga0496121_0035853_3498_4196 232
717 3300048924 Ga0496121_0045179 Ga0496121_0045179_2501_3208 232
718 3300048924 Ga0496121_0057369 Ga0496121_0057369_1705_2403 232
719 3300048924 Ga0496121_0204063 Ga0496121_0204063_252_950 232
720 3300048924 Ga0496121_0236320 Ga0496121_0236320_111_809 232
721 3300048924 Ga0496121_0439637 Ga0496121_0439637_128_826 232
722 3300048925 Ga0496122_0049475 Ga0496122_0049475_536_1276 232
723 3300048926 Ga0496123_0068547 Ga0496123_0068547_557_1255 232
724 3300048927 Ga0496124_0025489 Ga0496124_0025489_292_990 232
725 3300048927 Ga0496124_0124166 Ga0496124_0124166_60_758 232
726 3300048927 Ga0496124_0319628 Ga0496124_0319628_109_867 232
727 3300048928 Ga0496125_0001860 Ga0496125_0001860_26751_27449 232
728 3300048928 Ga0496125_0002962 Ga0496125_0002962_7115_7813 232
729 3300048928 Ga0496125_0004213 Ga0496125_0004213_15702_16400 232
730 3300048928 Ga0496125_0047595 Ga0496125_0047595_99_839 232
731 3300048928 Ga0496125_0227797 Ga0496125_0227797_379_1077 232
732 3300048929 Ga0496126_0012065 Ga0496126_0012065_1219_1917 232
733 3300048929 Ga0496126_0047881 Ga0496126_0047881_2230_2928 232
734 3300048929 Ga0496126_0054808 Ga0496126_0054808_1054_1752 232
735 3300048929 Ga0496126_0094761 Ga0496126_0094761_56_754 232
736 3300048929 Ga0496126_0109600 Ga0496126_0109600_550_1248 232
737 3300048929 Ga0496126_0215062 Ga0496126_0215062_436_1134 232
738 3300048929 Ga0496126_0244805 Ga0496126_0244805_396_1094 232
739 3300049460 Ga0495682_0015377 Ga0495682_0015377_492_1190 232
740 3300049460 Ga0495682_0033863 Ga0495682_0033863_382_1080 232
741 3300049531 Ga0501315_019595 Ga0501315_019595_10_708 232
742 3300049571 Ga0501034_0290711 Ga0501034_0290711_573_1271 232
743 3300049571 Ga0501034_0493805 Ga0501034_0493805_374_1072 232
744 3300049575 Ga0501039_0306765 Ga0501039_0306765_506_1207 232
745 3300049575 Ga0501039_0360235 Ga0501039_0360235_417_1115 232
746 3300049579 Ga0501043_0579757 Ga0501043_0579757_11_712 232
747 3300049580 Ga0501046_0035855 Ga0501046_0035855_2039_2740 232
748 3300049581 Ga0501047_0406704 Ga0501047_0406704_91_789 232
749 3300049582 Ga0501048_0224413 Ga0501048_0224413_547_1245 232
750 3300049584 Ga0501068_0163553 Ga0501068_0163553_525_1223 232
751 3300049589 Ga0501073_0233250 Ga0501073_0233250_354_1052 232
752 3300049592 Ga0501076_0317412 Ga0501076_0317412_545_1243 232
753 3300049743 Ga0501081_0092718 Ga0501081_0092718_592_1290 232
754 3300049822 Ga0501035_0170187 Ga0501035_0170187_401_1114 232
755 3300049822 Ga0501035_0170606 Ga0501035_0170606_1142_1840 232
756 3300049822 Ga0501035_0316879 Ga0501035_0316879_574_1272 232
757 3300049824 Ga0501045_0131473 Ga0501045_0131473_510_1208 232
758 3300050489 nmdc:mga03683_83933_c1 nmdc:mga03683_83933_c1_504_1202 232
759 3300050490 nmdc:mga03n38_448_c1 nmdc:mga03n38_448_c1_7279_7977 232
760 3300050492 nmdc:mga0yw44_179531_c1 nmdc:mga0yw44_179531_c1_438_1136 232
761 3300050492 nmdc:mga0yw44_19940_c1 nmdc:mga0yw44_19940_c1_627_1325 232
762 3300050492 nmdc:mga0yw44_81744_c1 nmdc:mga0yw44_81744_c1_417_1157 232
763 3300050492 nmdc:mga0yw44_9263_c1 nmdc:mga0yw44_9263_c1_764_1462 232
764 3300050492 nmdc:mga0yw44_98500_c1 nmdc:mga0yw44_98500_c1_810_1508 232
765 3300050494 nmdc:mga06z11_28144_c1 nmdc:mga06z11_28144_c1_967_1716 232
766 3300050496 nmdc:mga07m45_17174_c1 nmdc:mga07m45_17174_c1_970_1668 232
767 3300050507 nmdc:mga05p37_755549_c1 nmdc:mga05p37_755549_c1_248_946 232
768 3300050508 nmdc:mga09592_55761_c1 nmdc:mga09592_55761_c1_1577_2275 232
769 3300050509 nmdc:mga0qj67_57292_c1 nmdc:mga0qj67_57292_c1_503_1201 232
770 3300050511 nmdc:mga08y16_152915_c1 nmdc:mga08y16_152915_c1_406_1104 232
771 3300050516 nmdc:mga0sz30_42624_c1 nmdc:mga0sz30_42624_c1_684_1424 232
772 3300050516 nmdc:mga0sz30_61380_c1 nmdc:mga0sz30_61380_c1_164_862 232
773 3300053080 Ga0500635_0081216 Ga0500635_0081216_53_751 232
774 3300053083 Ga0495655_0006964 Ga0495655_0006964_802_1500 232
775 3300053083 Ga0495655_0012784 Ga0495655_0012784_978_1676 232
776 3300053084 Ga0495595_0001351 Ga0495595_0001351_910_1608 232
777 3300053084 Ga0495595_0009072 Ga0495595_0009072_2109_2807 232
778 3300053085 Ga0495619_0001695 Ga0495619_0001695_6099_6797 232
779 3300053085 Ga0495619_0063683 Ga0495619_0063683_730_1428 232
780 3300053085 Ga0495619_0298751 Ga0495619_0298751_393_1091 232
781 3300053086 Ga0500578_0073181 Ga0500578_0073181_12_710 232
782 3300053087 Ga0500643_000180 Ga0500643_000180_33118_33816 232
783 3300053093 Ga0500651_0005715 Ga0500651_0005715_2082_2780 232
784 3300053093 Ga0500651_0021885 Ga0500651_0021885_1220_1918 232
785 3300053094 Ga0500566_0002520 Ga0500566_0002520_7085_7783 232
786 3300053094 Ga0500566_0004614 Ga0500566_0004614_264_962 232
787 3300053095 Ga0500640_028305 Ga0500640_028305_171_869 232
788 3300053096 Ga0500641_0005375 Ga0500641_0005375_1878_2576 232
789 3300053096 Ga0500641_0017766 Ga0500641_0017766_905_1603 232
790 3300053096 Ga0500641_0058901 Ga0500641_0058901_695_1393 232
791 3300053096 Ga0500641_0175098 Ga0500641_0175098_35_733 232
792 3300053098 Ga0500650_0073574 Ga0500650_0073574_68_766 232
793 3300053102 Ga0500554_016601 Ga0500554_016601_823_1521 232
794 3300053103 Ga0500555_059751 Ga0500555_059751_43_741 232
795 3300053104 Ga0500556_0000012 Ga0500556_0000012_67019_67717 232
796 3300053105 Ga0500557_000046 Ga0500557_000046_18071_18769 232
797 3300053109 Ga0500569_005217 Ga0500569_005217_1861_2559 232
798 3300053109 Ga0500569_014721 Ga0500569_014721_20_766 232
799 3300053111 Ga0500572_000471 Ga0500572_000471_11292_11990 232
800 3300053114 Ga0500582_122829 Ga0500582_122829_32_730 232
801 3300053116 Ga0500592_000542 Ga0500592_000542_4767_5465 232
802 3300053116 Ga0500592_030190 Ga0500592_030190_98_796 232
803 3300053118 Ga0500594_0009826 Ga0500594_0009826_1062_1760 232
804 3300053118 Ga0500594_0101994 Ga0500594_0101994_126_824 232
805 3300053119 Ga0500595_000615 Ga0500595_000615_17157_17855 232
806 3300053119 Ga0500595_007563 Ga0500595_007563_2730_3428 232
807 3300053119 Ga0500595_011345 Ga0500595_011345_2515_3312 232
808 3300053121 Ga0500607_034490 Ga0500607_034490_1032_1730 232
809 3300053122 Ga0500608_027336 Ga0500608_027336_1318_2016 232
810 3300053123 Ga0500614_070735 Ga0500614_070735_243_941 232
811 3300053125 Ga0500618_006007 Ga0500618_006007_1164_1862 232
812 3300053125 Ga0500618_057612 Ga0500618_057612_114_812 232
813 3300053129 Ga0500628_049242 Ga0500628_049242_68_766 232
814 3300053130 Ga0500642_0000013 Ga0500642_0000013_141890_142588 232
815 3300053130 Ga0500642_0000038 Ga0500642_0000038_65693_66391 232
816 3300053130 Ga0500642_0033610 Ga0500642_0033610_243_941 232
817 3300053131 Ga0500652_001452 Ga0500652_001452_4537_5235 232
818 3300053134 Ga0500658_0187477 Ga0500658_0187477_210_908 232
819 3300053136 Ga0500559_0000713 Ga0500559_0000713_3330_4028 232
820 3300053136 Ga0500559_0001670 Ga0500559_0001670_3904_4602 232
821 3300053136 Ga0500559_0026032 Ga0500559_0026032_984_1682 232
822 3300053138 Ga0500564_069907 Ga0500564_069907_535_1233 232
823 3300053139 Ga0500568_0000676 Ga0500568_0000676_10964_11662 232
824 3300053139 Ga0500568_0043586 Ga0500568_0043586_1013_1711 232
825 3300053139 Ga0500568_0070629 Ga0500568_0070629_133_831 232
826 3300053139 Ga0500568_0095835 Ga0500568_0095835_47_745 232
827 3300053148 Ga0500590_125168 Ga0500590_125168_291_989 232
828 3300053153 Ga0500616_0000035 Ga0500616_0000035_326699_327397 232
829 3300053153 Ga0500616_0036917 Ga0500616_0036917_1270_1968 232
830 3300053153 Ga0500616_0151921 Ga0500616_0151921_20_718 232
831 3300053154 Ga0500619_009223 Ga0500619_009223_731_1429 232
832 3300053155 Ga0500620_079333 Ga0500620_079333_252_950 232
833 3300053156 Ga0500622_0005098 Ga0500622_0005098_1639_2337 232
834 3300053156 Ga0500622_0055023 Ga0500622_0055023_593_1291 232
835 3300053158 Ga0500627_0046689 Ga0500627_0046689_215_913 232
836 3300053158 Ga0500627_0083492 Ga0500627_0083492_408_1106 232
837 3300053160 Ga0500633_0085149 Ga0500633_0085149_48_746 232
838 3300053161 Ga0500634_0020483 Ga0500634_0020483_1700_2398 232
839 3300053161 Ga0500634_0037228 Ga0500634_0037228_140_838 232
840 3300053162 Ga0500638_007258 Ga0500638_007258_1411_2109 232
841 3300053162 Ga0500638_028379 Ga0500638_028379_1571_2269 232
842 3300053177 Ga0500636_0001763 Ga0500636_0001763_686_1384 232
843 3300053177 Ga0500636_0010527 Ga0500636_0010527_1691_2389 232
844 3300053178 Ga0500637_0000445 Ga0500637_0000445_3509_4207 232
845 3300053723 Ga0500567_160758 Ga0500567_160758_94_792 232
846 3300053724 Ga0500570_147811 Ga0500570_147811_46_744 232
847 3300053729 Ga0500625_003345 Ga0500625_003345_4892_5590 232
848 3300053731 Ga0500609_018794 Ga0500609_018794_95_793 232
849 3300053736 Ga0500599_001657 Ga0500599_001657_233_931 232
850 3300055283 Ga0500661_000331 Ga0500661_000331_3371_4069 232
851 3300055283 Ga0500661_037243 Ga0500661_037243_108_806 232
852 3300059492 Ga0587073_0008925 Ga0587073_0008925_372_1070 232
853 3300059505 Ga0587083_0008267 Ga0587083_0008267_210_908 232
854 3300059508 Ga0587088_024946 Ga0587088_024946_247_945 232
855 3300059647 Ga0587079_005293 Ga0587079_005293_663_1361 232
856 3300059652 Ga0587107_018852 Ga0587107_018852_93_791 232
857 3300060344 Ga0587071_038525 Ga0587071_038525_98_796 232
858 3300061719 Ga0466962_0207969 Ga0466962_0207969_159_857 232
859 3300003203 JGI25406J46586_10001255 JGI25406J46586_100012555 233
860 3300003659 JGI25404J52841_10001741 JGI25404J52841_100017412 233
861 3300003659 JGI25404J52841_10017197 JGI25404J52841_100171972 233
862 3300003659 JGI25404J52841_10027769 JGI25404J52841_100277692 233
863 3300003911 JGI25405J52794_10010489 JGI25405J52794_100104891 233
864 3300005937 Ga0081455_10005322 Ga0081455_1000532210 233
865 3300005937 Ga0081455_10022178 Ga0081455_100221786 233
866 3300005937 Ga0081455_10038296 Ga0081455_100382965 233
867 3300005983 Ga0081540_1004374 Ga0081540_10043747 233
868 3300005983 Ga0081540_1005482 Ga0081540_10054828 233
869 3300005983 Ga0081540_1006150 Ga0081540_10061504 233
870 3300005985 Ga0081539_10000540 Ga0081539_1000054014 233
871 3300005985 Ga0081539_10024335 Ga0081539_100243353 233
872 3300026121 Ga0207683_10221960 Ga0207683_102219602 233
873 3300037466 Ga0395898_0043652 Ga0395898_0043652_1349_2149 233
874 3300046616 Ga0495668_0069727 Ga0495668_0069727_998_1699 233
875 3300047315 Ga0495581_0188053 Ga0495581_0188053_11_712 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02678

Pirin

Pirin

4

118

0.94

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

145

225

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.941 1 232
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9333 1 233
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9253 1 232
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.914 1 233
1yhf-assembly1.cif.gz_A crystal structure of conserved spy1581 protein of unknown function from streptococcus pyogenes 0.8424 14 122
ID Description Score Start End Superfamily
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9369 13 130 2.60.120.10
af_F1QLW3_37_119_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9298 40 119 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.918 11 134 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9147 13 130 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9108 11 134 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A0A7PEG0-F1-model_v4 Quercetin 2,3-dioxygenase C-terminal cupin domain-containing protein 0.9851 146 233
AF-A0A7W5I144-F1-model_v4 deleted 0.9814 159 233
AF-T0GCZ8-F1-model_v4 Pirin 0.9754 2 233
AF-A0A653EB75-F1-model_v4 Putative Quercetin 2,3-dioxygenase (EC 1.13.11.24) 0.9734 140 233 GO:0008127
AF-A0A7W9VBX2-F1-model_v4 deleted 0.9723 1 233

Feature Viewer

pLDDT pTM Quality
88.7 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map