F484324
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 875 | 559 | 701 | 232 |
Family's Representative Sequence
| Representative Sequence | 3300025944|Ga0207661_10309168|Ga0207661_103091682 |
| Length | 270 |
| Sequence | MIELRPFAKLGGADHGWLKAKHHFSFASYYDPNNMSHGALRVWNDDEIAPNTGFPAHPHANMEIITYVREGAITHQDSLGNKGRTEAGDVQVMSAGSGIRHSEYNLEPTLTRIFQIWIEPTTHGGQPTWGSKPFPKSNRSGKLVTIASGLPGDTDALPIRADARVLATTLKAGESAQYAADKARNLYLVPAAGSVEVNGVRVNARDGAAISGHNHVDHRCSHAEQRYPGTDRISARHRRSAPDQGTQINRPDQGQMESGVVHAVSPRPQC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 8 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 9 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 10 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 11 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 12 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 16 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 17 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 18 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 19 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 20 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 21 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 22 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 23 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 24 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 25 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 26 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 27 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 28 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 29 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 30 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 31 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 32 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 33 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 34 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 35 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 36 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 37 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 38 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 39 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 40 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 41 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 42 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 43 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 44 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 45 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 46 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 47 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 48 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 49 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 50 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 51 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 52 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 53 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 54 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 55 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 56 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 57 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 58 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 59 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 60 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 61 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 62 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 63 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 64 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 65 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 66 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 67 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 68 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 69 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 70 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 71 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 72 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 73 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 74 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 75 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 76 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 77 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 78 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 79 | 2922368715 | |||
| 80 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 81 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 82 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 83 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 84 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 85 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 86 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 87 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 88 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 89 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 90 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 91 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 92 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 93 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 94 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 95 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 96 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 97 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 98 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 99 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 100 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 101 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 102 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 103 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 104 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 105 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 106 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 107 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 108 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 109 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 110 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 111 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 112 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 113 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 114 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 115 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 116 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 117 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 118 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 119 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 120 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 121 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 122 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 123 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 124 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 125 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 126 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 127 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 128 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 129 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 130 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 131 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 132 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 133 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 134 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 135 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 136 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 137 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 138 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 139 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 140 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 141 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 142 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 143 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 144 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 145 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 146 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 147 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 148 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 150 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 152 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 154 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 155 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 163 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 165 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 167 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 168 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 174 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 175 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 176 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 177 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 178 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 181 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 182 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 183 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 184 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 185 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 186 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 187 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 188 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 189 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 190 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 191 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 192 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 193 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 194 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 196 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 197 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 198 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 199 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 200 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 201 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 202 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 203 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 204 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 205 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 207 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 208 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 209 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 210 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 211 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 212 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 221 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 222 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 224 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 229 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 230 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 231 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 232 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 233 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 234 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 235 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 236 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 237 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 242 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 244 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 246 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 296 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 297 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 298 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 299 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 300 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 304 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 305 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 307 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 308 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 309 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 310 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 311 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 312 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 313 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 314 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 315 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 316 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 317 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 318 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 319 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 320 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 321 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 322 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 323 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 324 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 325 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 326 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 327 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 328 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 329 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 330 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 331 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 332 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 333 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 334 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 335 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 336 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 337 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 338 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 339 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 340 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 341 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 342 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 343 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 344 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 345 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 346 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 347 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 348 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 349 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 350 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 351 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 352 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 353 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 354 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 355 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 356 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 357 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 358 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 359 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 360 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 361 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 362 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 424 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 425 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 426 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 427 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 428 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 429 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 430 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 432 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 433 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 434 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 435 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 436 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 437 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 438 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 439 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 440 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 441 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 442 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 443 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 444 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 445 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 446 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 447 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 448 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 463 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 464 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 465 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 466 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 467 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 472 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 473 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 477 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 478 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 479 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 480 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 481 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 482 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 483 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 484 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 485 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 486 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 487 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 488 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 489 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 490 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 491 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 492 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 493 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 494 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 495 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 496 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 497 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 498 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 499 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 500 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 501 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 502 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 503 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 504 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 505 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 506 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 507 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 508 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 509 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 510 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 511 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 512 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 513 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 514 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 515 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 516 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 517 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 518 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 519 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 520 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 521 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 522 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 523 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 524 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 528 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 529 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 530 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 531 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 532 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 533 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 534 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 535 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 536 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 537 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 538 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 539 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 540 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 541 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 542 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 543 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 544 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 545 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 546 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 547 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 548 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 549 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 550 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 551 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 552 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 553 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 554 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 555 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 556 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 557 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 558 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 559 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.6 |
| Metatranscriptomes | 1.6 |
| Isolates | 19.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.17 |
| Nodule | 15.89 |
| Rhizoplane | 4.34 |
| Rhizosphere | 53.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10001255 | 3300003203 | Bacteria | 11909 |
| 2 | JGI25153J46596_10000371 | 3300003215 | Bacteria | 30777 |
| 3 | JGI25153J46596_10000865 | 3300003215 | Bacteria | 18448 |
| 4 | JGI25153J46596_10018801 | 3300003215 | Bacteria | 2669 |
| 5 | JGI25404J52841_10001741 | 3300003659 | Bacteria | 3938 |
| 6 | JGI25404J52841_10017197 | 3300003659 | Bacteria | 1568 |
| 7 | JGI25404J52841_10027769 | 3300003659 | Bacteria | 1216 |
| 8 | Ga0055531_10005980 | 3300003794 | Bacteria | 6988 |
| 9 | JGI25405J52794_10010489 | 3300003911 | Bacteria | 1762 |
| 10 | Ga0055543_1023154 | 3300004625 | Bacteria | 1123 |
| 11 | Ga0058863_11849786 | 3300004799 | Bacteria | 829 |
| 12 | Ga0065165_1001685 | 3300005262 | Bacteria | 22303 |
| 13 | Ga0065165_1004072 | 3300005262 | Bacteria | 9480 |
| 14 | Ga0070676_10021570 | 3300005328 | Bacteria | 3606 |
| 15 | Ga0070683_100003434 | 3300005329 | Bacteria | 12861 |
| 16 | Ga0070670_100078460 | 3300005331 | Bacteria | 2837 |
| 17 | Ga0070680_100361829 | 3300005336 | Bacteria | 1234 |
| 18 | Ga0068868_100099670 | 3300005338 | Bacteria | 2350 |
| 19 | Ga0070660_100227359 | 3300005339 | Bacteria | 1517 |
| 20 | Ga0070661_100504538 | 3300005344 | Bacteria | 969 |
| 21 | Ga0070668_100033480 | 3300005347 | Bacteria | 3913 |
| 22 | Ga0070668_100107901 | 3300005347 | Bacteria | 2213 |
| 23 | Ga0070668_100136903 | 3300005347 | Bacteria | 1970 |
| 24 | Ga0070668_100352102 | 3300005347 | Bacteria | 1247 |
| 25 | Ga0070668_100407157 | 3300005347 | Bacteria | 1162 |
| 26 | Ga0070669_100025831 | 3300005353 | Bacteria | 4221 |
| 27 | Ga0070671_100038198 | 3300005355 | Bacteria | 3985 |
| 28 | Ga0070674_100177310 | 3300005356 | Bacteria | 1629 |
| 29 | Ga0070674_100179268 | 3300005356 | Bacteria | 1621 |
| 30 | Ga0070673_100168033 | 3300005364 | Bacteria | 1870 |
| 31 | Ga0070688_100233004 | 3300005365 | Bacteria | 1303 |
| 32 | Ga0070659_100411099 | 3300005366 | Bacteria | 1143 |
| 33 | Ga0070709_10025034 | 3300005434 | Bacteria | 3521 |
| 34 | Ga0070709_10556118 | 3300005434 | Bacteria | 878 |
| 35 | Ga0070714_100745237 | 3300005435 | Bacteria | 947 |
| 36 | Ga0070714_100826716 | 3300005435 | Bacteria | 898 |
| 37 | Ga0070713_100019302 | 3300005436 | Bacteria | 5201 |
| 38 | Ga0070713_100203137 | 3300005436 | Bacteria | 1791 |
| 39 | Ga0070713_100264165 | 3300005436 | Bacteria | 1574 |
| 40 | Ga0070713_100312293 | 3300005436 | Bacteria | 1450 |
| 41 | Ga0070713_100417458 | 3300005436 | Bacteria | 1255 |
| 42 | Ga0070710_10008635 | 3300005437 | Bacteria | 4963 |
| 43 | Ga0070711_100005721 | 3300005439 | Bacteria | 7455 |
| 44 | Ga0070711_100014790 | 3300005439 | Bacteria | 4926 |
| 45 | Ga0070711_100174538 | 3300005439 | Bacteria | 1641 |
| 46 | Ga0070705_100256037 | 3300005440 | Bacteria | 1231 |
| 47 | Ga0070663_100003220 | 3300005455 | Bacteria | 9382 |
| 48 | Ga0070663_100055736 | 3300005455 | Bacteria | 2830 |
| 49 | Ga0070663_100156640 | 3300005455 | Bacteria | 1750 |
| 50 | Ga0070663_100335065 | 3300005455 | Bacteria | 1221 |
| 51 | Ga0070663_100402282 | 3300005455 | Bacteria | 1119 |
| 52 | Ga0070678_100108988 | 3300005456 | Bacteria | 2162 |
| 53 | Ga0070662_100245819 | 3300005457 | Bacteria | 1436 |
| 54 | Ga0070681_10243463 | 3300005458 | Bacteria | 1712 |
| 55 | Ga0070706_100055109 | 3300005467 | Bacteria | 3670 |
| 56 | Ga0070698_100056809 | 3300005471 | Bacteria | 3963 |
| 57 | Ga0070698_100844106 | 3300005471 | Bacteria | 861 |
| 58 | Ga0070679_100030709 | 3300005530 | Bacteria | 5306 |
| 59 | Ga0070679_100460981 | 3300005530 | Bacteria | 1216 |
| 60 | Ga0068853_100283155 | 3300005539 | Bacteria | 1528 |
| 61 | Ga0068853_100286916 | 3300005539 | Bacteria | 1518 |
| 62 | Ga0070672_100328487 | 3300005543 | Bacteria | 1301 |
| 63 | Ga0070665_100004774 | 3300005548 | Bacteria | 14113 |
| 64 | Ga0070665_100093542 | 3300005548 | Bacteria | 3011 |
| 65 | Ga0070665_100129223 | 3300005548 | Bacteria | 2529 |
| 66 | Ga0070665_100268135 | 3300005548 | Bacteria | 1709 |
| 67 | Ga0068855_100134381 | 3300005563 | Bacteria | 2822 |
| 68 | Ga0068855_100184191 | 3300005563 | Bacteria | 2360 |
| 69 | Ga0068857_100307253 | 3300005577 | Bacteria | 1463 |
| 70 | Ga0068854_100112009 | 3300005578 | Bacteria | 2060 |
| 71 | Ga0068856_100000046 | 3300005614 | Bacteria | 109174 |
| 72 | Ga0068852_100199867 | 3300005616 | Bacteria | 1891 |
| 73 | Ga0068852_100375094 | 3300005616 | Bacteria | 1394 |
| 74 | Ga0068852_100392911 | 3300005616 | Bacteria | 1363 |
| 75 | Ga0068864_101016699 | 3300005618 | Bacteria | 823 |
| 76 | Ga0068861_100043439 | 3300005719 | Bacteria | 3374 |
| 77 | Ga0068861_100052910 | 3300005719 | Bacteria | 3087 |
| 78 | Ga0068861_100273488 | 3300005719 | Bacteria | 1451 |
| 79 | Ga0068861_100353766 | 3300005719 | Bacteria | 1289 |
| 80 | Ga0068851_10151085 | 3300005834 | Bacteria | 1269 |
| 81 | Ga0068851_10218067 | 3300005834 | Bacteria | 1071 |
| 82 | Ga0068858_100088777 | 3300005842 | Bacteria | 2876 |
| 83 | Ga0068860_100002690 | 3300005843 | Bacteria | 18501 |
| 84 | Ga0068860_100020202 | 3300005843 | Bacteria | 6455 |
| 85 | Ga0068860_100393060 | 3300005843 | Bacteria | 1371 |
| 86 | Ga0068862_100052654 | 3300005844 | Bacteria | 3483 |
| 87 | Ga0068862_100116002 | 3300005844 | Bacteria | 2355 |
| 88 | Ga0068862_100540425 | 3300005844 | Bacteria | 1111 |
| 89 | Ga0081455_10001281 | 3300005937 | Bacteria | 31263 |
| 90 | Ga0081455_10005322 | 3300005937 | Bacteria | 14133 |
| 91 | Ga0081455_10022178 | 3300005937 | Bacteria | 5942 |
| 92 | Ga0081455_10038296 | 3300005937 | Bacteria | 4247 |
| 93 | Ga0081540_1000593 | 3300005983 | Bacteria | 34646 |
| 94 | Ga0081540_1004374 | 3300005983 | Bacteria | 10802 |
| 95 | Ga0081540_1005482 | 3300005983 | Bacteria | 9468 |
| 96 | Ga0081540_1006150 | 3300005983 | Bacteria | 8811 |
| 97 | Ga0081540_1025136 | 3300005983 | Bacteria | 3437 |
| 98 | Ga0081539_10000540 | 3300005985 | Bacteria | 78243 |
| 99 | Ga0081539_10024335 | 3300005985 | Bacteria | 3933 |
| 100 | Ga0070717_10226496 | 3300006028 | Bacteria | 1645 |
| 101 | Ga0070717_10331363 | 3300006028 | Bacteria | 1358 |
| 102 | Ga0070717_10332431 | 3300006028 | Bacteria | 1355 |
| 103 | Ga0070717_10496535 | 3300006028 | Bacteria | 1103 |
| 104 | Ga0075365_10012254 | 3300006038 | Bacteria | 5083 |
| 105 | Ga0075365_10027550 | 3300006038 | Bacteria | 3617 |
| 106 | Ga0075365_10050798 | 3300006038 | Bacteria | 2736 |
| 107 | Ga0075365_10253508 | 3300006038 | Bacteria | 1237 |
| 108 | Ga0075363_100009873 | 3300006048 | Bacteria | 4504 |
| 109 | Ga0075363_100145191 | 3300006048 | Bacteria | 1337 |
| 110 | Ga0075364_10031364 | 3300006051 | Bacteria | 3415 |
| 111 | Ga0070715_10281387 | 3300006163 | Bacteria | 882 |
| 112 | Ga0070716_100010123 | 3300006173 | Bacteria | 4721 |
| 113 | Ga0070712_100030277 | 3300006175 | Bacteria | 3635 |
| 114 | Ga0070712_100049612 | 3300006175 | Bacteria | 2916 |
| 115 | Ga0070712_100157673 | 3300006175 | Bacteria | 1750 |
| 116 | Ga0070712_100221964 | 3300006175 | Bacteria | 1497 |
| 117 | Ga0070712_100335717 | 3300006175 | Bacteria | 1233 |
| 118 | Ga0075362_10058214 | 3300006177 | Bacteria | 1742 |
| 119 | Ga0075367_10050906 | 3300006178 | Bacteria | 2447 |
| 120 | Ga0075367_10099002 | 3300006178 | Bacteria | 1780 |
| 121 | Ga0075369_10014471 | 3300006186 | Bacteria | 3151 |
| 122 | Ga0075369_10091574 | 3300006186 | Bacteria | 1357 |
| 123 | Ga0075366_10056073 | 3300006195 | Bacteria | 2340 |
| 124 | Ga0075366_10089421 | 3300006195 | Bacteria | 1844 |
| 125 | Ga0097621_100042019 | 3300006237 | Bacteria | 3682 |
| 126 | Ga0075370_10009873 | 3300006353 | Bacteria | 4973 |
| 127 | Ga0075429_100350803 | 3300006880 | Bacteria | 1292 |
| 128 | Ga0068865_100371000 | 3300006881 | Bacteria | 1165 |
| 129 | Ga0099823_1038597 | 3300006944 | Bacteria | 3554 |
| 130 | Ga0099794_10099064 | 3300007265 | Bacteria | 1453 |
| 131 | Ga0099794_10143822 | 3300007265 | Bacteria | 1209 |
| 132 | Ga0099795_10032792 | 3300007788 | Bacteria | 1799 |
| 133 | Ga0105240_10011485 | 3300009093 | Bacteria | 12332 |
| 134 | Ga0105240_10754591 | 3300009093 | Bacteria | 1057 |
| 135 | Ga0105245_10052348 | 3300009098 | Bacteria | 3662 |
| 136 | Ga0105245_10095059 | 3300009098 | Bacteria | 2748 |
| 137 | Ga0114129_10277201 | 3300009147 | Bacteria | 2241 |
| 138 | Ga0105243_10161981 | 3300009148 | Bacteria | 1930 |
| 139 | Ga0105241_10084517 | 3300009174 | Bacteria | 2492 |
| 140 | Ga0105241_10268606 | 3300009174 | Bacteria | 1452 |
| 141 | Ga0105242_10248379 | 3300009176 | Bacteria | 1602 |
| 142 | Ga0105237_10008240 | 3300009545 | Bacteria | 11316 |
| 143 | Ga0105237_10011626 | 3300009545 | Bacteria | 9317 |
| 144 | Ga0105237_10870849 | 3300009545 | Bacteria | 908 |
| 145 | Ga0105238_10013383 | 3300009551 | Bacteria | 8280 |
| 146 | Ga0105238_10901567 | 3300009551 | Bacteria | 902 |
| 147 | Ga0105249_10189989 | 3300009553 | Bacteria | 2004 |
| 148 | Ga0105249_10257187 | 3300009553 | Bacteria | 1733 |
| 149 | Ga0099796_10005934 | 3300010159 | Bacteria | 3088 |
| 150 | Ga0105239_10125179 | 3300010375 | Bacteria | 2856 |
| 151 | Ga0105239_10547284 | 3300010375 | Bacteria | 1318 |
| 152 | Ga0105239_10763716 | 3300010375 | Bacteria | 1107 |
| 153 | Ga0105246_10011337 | 3300011119 | Bacteria | 5533 |
| 154 | Ga0157369_10053866 | 3300013105 | Bacteria | 4345 |
| 155 | Ga0157374_10165358 | 3300013296 | Bacteria | 2156 |
| 156 | Ga0163162_10258025 | 3300013306 | Bacteria | 1875 |
| 157 | Ga0157372_10140742 | 3300013307 | Bacteria | 2779 |
| 158 | Ga0157375_10827678 | 3300013308 | Bacteria | 1073 |
| 159 | Ga0163163_10030936 | 3300014325 | Bacteria | 5161 |
| 160 | Ga0163163_10065889 | 3300014325 | Bacteria | 3596 |
| 161 | Ga0157380_10055300 | 3300014326 | Bacteria | 3151 |
| 162 | Ga0157376_10236788 | 3300014969 | Bacteria | 1699 |
| 163 | Ga0163161_10002299 | 3300017792 | Bacteria | 13707 |
| 164 | Ga0163161_10276177 | 3300017792 | Bacteria | 1316 |
| 165 | Ga0206350_10194348 | 3300020080 | Bacteria | 850 |
| 166 | Ga0206353_11188210 | 3300020082 | Bacteria | 2219 |
| 167 | Ga0213874_10063486 | 3300021377 | Bacteria | 1162 |
| 168 | Ga0213876_10009405 | 3300021384 | Bacteria | 5262 |
| 169 | Ga0213876_10069367 | 3300021384 | Bacteria | 1862 |
| 170 | Ga0209563_105359 | 3300025230 | Bacteria | 2336 |
| 171 | Ga0209148_1000335 | 3300025254 | Bacteria | 63754 |
| 172 | Ga0209233_1021523 | 3300025261 | Bacteria | 1667 |
| 173 | Ga0209455_1002543 | 3300025272 | Bacteria | 6976 |
| 174 | Ga0209455_1018248 | 3300025272 | Bacteria | 1446 |
| 175 | Ga0209564_1005823 | 3300025295 | Bacteria | 6873 |
| 176 | Ga0209564_1009493 | 3300025295 | Bacteria | 4621 |
| 177 | Ga0209758_1000106 | 3300025297 | Bacteria | 218450 |
| 178 | Ga0209758_1000344 | 3300025297 | Bacteria | 85133 |
| 179 | Ga0209758_1001326 | 3300025297 | Bacteria | 30016 |
| 180 | Ga0209758_1009962 | 3300025297 | Bacteria | 5783 |
| 181 | Ga0209758_1017145 | 3300025297 | Bacteria | 3628 |
| 182 | Ga0209758_1056592 | 3300025297 | Bacteria | 1323 |
| 183 | Ga0209256_1034875 | 3300025299 | Bacteria | 1334 |
| 184 | Ga0209256_1038893 | 3300025299 | Bacteria | 1228 |
| 185 | Ga0207426_1009980 | 3300025302 | Bacteria | 3716 |
| 186 | Ga0209051_1033895 | 3300025303 | Bacteria | 1922 |
| 187 | Ga0209257_1000819 | 3300025304 | Bacteria | 45046 |
| 188 | Ga0209257_1044522 | 3300025304 | Bacteria | 1294 |
| 189 | Ga0207697_10209518 | 3300025315 | Bacteria | 859 |
| 190 | Ga0207653_10084345 | 3300025885 | Bacteria | 1104 |
| 191 | Ga0207682_10043964 | 3300025893 | Bacteria | 1830 |
| 192 | Ga0207692_10015203 | 3300025898 | Bacteria | 3382 |
| 193 | Ga0207688_10146939 | 3300025901 | Bacteria | 1390 |
| 194 | Ga0207688_10150220 | 3300025901 | Bacteria | 1376 |
| 195 | Ga0207647_10289090 | 3300025904 | Bacteria | 935 |
| 196 | Ga0207685_10029506 | 3300025905 | Bacteria | 1942 |
| 197 | Ga0207699_10001790 | 3300025906 | Bacteria | 10088 |
| 198 | Ga0207645_10031981 | 3300025907 | Bacteria | 3383 |
| 199 | Ga0207645_10198471 | 3300025907 | Bacteria | 1320 |
| 200 | Ga0207684_10279585 | 3300025910 | Bacteria | 1439 |
| 201 | Ga0207707_10165205 | 3300025912 | Bacteria | 1934 |
| 202 | Ga0207695_10000123 | 3300025913 | Bacteria | 232059 |
| 203 | Ga0207695_10156146 | 3300025913 | Bacteria | 2216 |
| 204 | Ga0207695_10551270 | 3300025913 | Bacteria | 1034 |
| 205 | Ga0207671_10041194 | 3300025914 | Bacteria | 3418 |
| 206 | Ga0207693_10004353 | 3300025915 | Bacteria | 11975 |
| 207 | Ga0207693_10042871 | 3300025915 | Bacteria | 3561 |
| 208 | Ga0207693_10132712 | 3300025915 | Bacteria | 1957 |
| 209 | Ga0207693_10186073 | 3300025915 | Bacteria | 1635 |
| 210 | Ga0207693_10361141 | 3300025915 | Bacteria | 1136 |
| 211 | Ga0207663_10022584 | 3300025916 | Bacteria | 3599 |
| 212 | Ga0207663_10305492 | 3300025916 | Bacteria | 1190 |
| 213 | Ga0207662_10202663 | 3300025918 | Bacteria | 1285 |
| 214 | Ga0207657_10030146 | 3300025919 | Bacteria | 4928 |
| 215 | Ga0207652_10477417 | 3300025921 | Bacteria | 1123 |
| 216 | Ga0207646_10181300 | 3300025922 | Bacteria | 1902 |
| 217 | Ga0207646_10951818 | 3300025922 | Bacteria | 760 |
| 218 | Ga0207681_10397718 | 3300025923 | Bacteria | 1112 |
| 219 | Ga0207650_10253003 | 3300025925 | Bacteria | 1427 |
| 220 | Ga0207687_10008542 | 3300025927 | Bacteria | 6698 |
| 221 | Ga0207687_10058231 | 3300025927 | Bacteria | 2717 |
| 222 | Ga0207700_10016987 | 3300025928 | Bacteria | 4848 |
| 223 | Ga0207700_10201366 | 3300025928 | Bacteria | 1678 |
| 224 | Ga0207700_10416549 | 3300025928 | Bacteria | 1179 |
| 225 | Ga0207700_10660271 | 3300025928 | Bacteria | 932 |
| 226 | Ga0207664_10214528 | 3300025929 | Bacteria | 1667 |
| 227 | Ga0207664_10355056 | 3300025929 | Bacteria | 1298 |
| 228 | Ga0207664_10406422 | 3300025929 | Bacteria | 1211 |
| 229 | Ga0207664_10458158 | 3300025929 | Bacteria | 1139 |
| 230 | Ga0207690_10102914 | 3300025932 | Bacteria | 2043 |
| 231 | Ga0207706_10279321 | 3300025933 | Bacteria | 1456 |
| 232 | Ga0207709_10068831 | 3300025935 | Bacteria | 2239 |
| 233 | Ga0207669_10057902 | 3300025937 | Bacteria | 2362 |
| 234 | Ga0207669_10059328 | 3300025937 | Bacteria | 2340 |
| 235 | Ga0207669_10074082 | 3300025937 | Bacteria | 2151 |
| 236 | Ga0207665_10041526 | 3300025939 | Bacteria | 3072 |
| 237 | Ga0207665_10281321 | 3300025939 | Bacteria | 1238 |
| 238 | Ga0207691_10126957 | 3300025940 | Bacteria | 2256 |
| 239 | Ga0207711_10057836 | 3300025941 | Bacteria | 3334 |
| 240 | Ga0207711_10063179 | 3300025941 | Bacteria | 3196 |
| 241 | Ga0207689_10035445 | 3300025942 | Bacteria | 4145 |
| 242 | Ga0207661_10002953 | 3300025944 | Bacteria | 11757 |
| 243 | Ga0207661_10309168 | 3300025944 | Bacteria | 1419 |
| 244 | Ga0207661_10399297 | 3300025944 | Bacteria | 1246 |
| 245 | Ga0207679_10195604 | 3300025945 | Bacteria | 1685 |
| 246 | Ga0207667_10105644 | 3300025949 | Bacteria | 2905 |
| 247 | Ga0207667_10183972 | 3300025949 | Bacteria | 2145 |
| 248 | Ga0207668_10022000 | 3300025972 | Bacteria | 4074 |
| 249 | Ga0207668_10034680 | 3300025972 | Bacteria | 3352 |
| 250 | Ga0207668_10101833 | 3300025972 | Bacteria | 2135 |
| 251 | Ga0207668_10395182 | 3300025972 | Bacteria | 1167 |
| 252 | Ga0207640_10213733 | 3300025981 | Bacteria | 1471 |
| 253 | Ga0207677_10594685 | 3300026023 | Bacteria | 970 |
| 254 | Ga0207703_10215104 | 3300026035 | Bacteria | 1715 |
| 255 | Ga0207703_10707198 | 3300026035 | Bacteria | 958 |
| 256 | Ga0207639_10041924 | 3300026041 | Bacteria | 3428 |
| 257 | Ga0207639_10632708 | 3300026041 | Bacteria | 989 |
| 258 | Ga0207678_10014071 | 3300026067 | Bacteria | 7036 |
| 259 | Ga0207678_10071921 | 3300026067 | Bacteria | 2964 |
| 260 | Ga0207678_10116637 | 3300026067 | Bacteria | 2278 |
| 261 | Ga0207678_10210686 | 3300026067 | Bacteria | 1662 |
| 262 | Ga0207678_10346093 | 3300026067 | Bacteria | 1282 |
| 263 | Ga0207702_10000014 | 3300026078 | Bacteria | 253304 |
| 264 | Ga0207702_10245405 | 3300026078 | Bacteria | 1679 |
| 265 | Ga0207641_10676818 | 3300026088 | Bacteria | 1015 |
| 266 | Ga0207676_11021605 | 3300026095 | Bacteria | 815 |
| 267 | Ga0207674_10072022 | 3300026116 | Bacteria | 3472 |
| 268 | Ga0207674_10091426 | 3300026116 | Bacteria | 3033 |
| 269 | Ga0207675_100131229 | 3300026118 | Bacteria | 2376 |
| 270 | Ga0207675_100279300 | 3300026118 | Bacteria | 1622 |
| 271 | Ga0207675_100290212 | 3300026118 | Bacteria | 1591 |
| 272 | Ga0207683_10010057 | 3300026121 | Bacteria | 8073 |
| 273 | Ga0207683_10135865 | 3300026121 | Bacteria | 2213 |
| 274 | Ga0207683_10221960 | 3300026121 | Bacteria | 1722 |
| 275 | Ga0207683_10260461 | 3300026121 | Bacteria | 1583 |
| 276 | Ga0207698_10170153 | 3300026142 | Bacteria | 1917 |
| 277 | Ga0207698_10368307 | 3300026142 | Bacteria | 1363 |
| 278 | Ga0209389_1000016 | 3300027296 | Bacteria | 184844 |
| 279 | Ga0209389_1000027 | 3300027296 | Bacteria | 146917 |
| 280 | Ga0209589_1000031 | 3300027357 | Bacteria | 147054 |
| 281 | Ga0209489_100057 | 3300027361 | Bacteria | 147398 |
| 282 | Ga0209489_100063 | 3300027361 | Bacteria | 144408 |
| 283 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 284 | Ga0207428_10061061 | 3300027907 | Bacteria | 2985 |
| 285 | Ga0268266_10003152 | 3300028379 | Bacteria | 16738 |
| 286 | Ga0268266_10003898 | 3300028379 | Bacteria | 14509 |
| 287 | Ga0268266_10116461 | 3300028379 | Bacteria | 2373 |
| 288 | Ga0268265_10103699 | 3300028380 | Bacteria | 2304 |
| 289 | Ga0268265_10173890 | 3300028380 | Bacteria | 1843 |
| 290 | Ga0268265_10325869 | 3300028380 | Bacteria | 1393 |
| 291 | Ga0268265_11212369 | 3300028380 | Bacteria | 752 |
| 292 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 293 | Ga0268264_10186255 | 3300028381 | Bacteria | 1889 |
| 294 | Ga0268264_10252105 | 3300028381 | Bacteria | 1640 |
| 295 | Ga0307517_10000176 | 3300028786 | Bacteria | 105402 |
| 296 | Ga0307512_10201851 | 3300030522 | Bacteria | 1075 |
| 297 | Ga0265766_1003936 | 3300030863 | Bacteria | 888 |
| 298 | Ga0265332_10024877 | 3300031238 | Bacteria | 2632 |
| 299 | Ga0265332_10094353 | 3300031238 | Bacteria | 1264 |
| 300 | Ga0265328_10067062 | 3300031239 | Bacteria | 1318 |
| 301 | Ga0265328_10155337 | 3300031239 | Bacteria | 861 |
| 302 | Ga0265340_10059768 | 3300031247 | Bacteria | 1827 |
| 303 | Ga0265339_10001372 | 3300031249 | Bacteria | 18190 |
| 304 | Ga0265339_10033300 | 3300031249 | Bacteria | 2902 |
| 305 | Ga0265339_10048940 | 3300031249 | Bacteria | 2316 |
| 306 | Ga0265331_10210947 | 3300031250 | Bacteria | 874 |
| 307 | Ga0265331_10247064 | 3300031250 | Bacteria | 800 |
| 308 | Ga0307509_10142209 | 3300031507 | Bacteria | 2332 |
| 309 | Ga0307508_10062521 | 3300031616 | Bacteria | 3286 |
| 310 | Ga0265314_10016415 | 3300031711 | Bacteria | 5849 |
| 311 | Ga0265314_10050084 | 3300031711 | Bacteria | 2920 |
| 312 | Ga0265342_10009595 | 3300031712 | Bacteria | 6796 |
| 313 | Ga0307516_10020012 | 3300031730 | Bacteria | 6920 |
| 314 | Ga0307516_10107016 | 3300031730 | Bacteria | 2606 |
| 315 | Ga0307516_10112661 | 3300031730 | Bacteria | 2520 |
| 316 | Ga0307412_10056255 | 3300031911 | Bacteria | 2621 |
| 317 | Ga0307409_100101192 | 3300031995 | Bacteria | 2391 |
| 318 | Ga0307409_100585515 | 3300031995 | Bacteria | 1100 |
| 319 | Ga0307416_100440886 | 3300032002 | Bacteria | 1352 |
| 320 | Ga0307411_10259343 | 3300032005 | Bacteria | 1372 |
| 321 | Ga0307415_100088088 | 3300032126 | Bacteria | 2239 |
| 322 | Ga0307510_10007730 | 3300033180 | Bacteria | 12823 |
| 323 | Ga0307510_10037836 | 3300033180 | Bacteria | 5347 |
| 324 | Ga0307510_10187488 | 3300033180 | Bacteria | 1621 |
| 325 | Ga0307510_10242427 | 3300033180 | Bacteria | 1296 |
| 326 | Ga0307510_10326208 | 3300033180 | Bacteria | 991 |
| 327 | Ga0373950_0047760 | 3300034818 | Bacteria | 834 |
| 328 | Ga0373929_0037043 | 3300035085 | Bacteria | 1068 |
| 329 | Ga0373934_0002178 | 3300035086 | Bacteria | 7205 |
| 330 | Ga0373923_0001946 | 3300035111 | Bacteria | 6191 |
| 331 | Ga0373953_0001243 | 3300035117 | Bacteria | 7270 |
| 332 | Ga0373954_0002355 | 3300035118 | Bacteria | 7899 |
| 333 | Ga0373957_0000527 | 3300035120 | Bacteria | 9628 |
| 334 | Ga0373955_0000535 | 3300035172 | Bacteria | 16084 |
| 335 | Ga0373942_0020097 | 3300035207 | Bacteria | 1674 |
| 336 | Ga0373924_0004005 | 3300035410 | Bacteria | 5117 |
| 337 | Ga0373931_0014148 | 3300035691 | Bacteria | 3896 |
| 338 | Ga0373935_0023018 | 3300035692 | Bacteria | 3826 |
| 339 | Ga0373927_0012684 | 3300035695 | Bacteria | 5606 |
| 340 | Ga0373933_0002165 | 3300035724 | Bacteria | 11241 |
| 341 | Ga0373947_0066854 | 3300035725 | Bacteria | 2194 |
| 342 | Ga0310104_11013 | 3300036242 | Bacteria | 730 |
| 343 | Ga0373937_0033007 | 3300036401 | Bacteria | 4697 |
| 344 | Ga0373937_0184350 | 3300036401 | Bacteria | 1960 |
| 345 | Ga0373937_0236682 | 3300036401 | Bacteria | 1720 |
| 346 | Ga0310109_001672 | 3300036534 | Bacteria | 2312 |
| 347 | Ga0373925_0219459 | 3300037068 | Bacteria | 1517 |
| 348 | Ga0395899_0066265 | 3300037312 | Bacteria | 2652 |
| 349 | Ga0395899_0088186 | 3300037312 | Bacteria | 2251 |
| 350 | Ga0395900_0001282 | 3300037418 | Bacteria | 30694 |
| 351 | Ga0395900_0219351 | 3300037418 | Bacteria | 1918 |
| 352 | Ga0395898_0037345 | 3300037466 | Bacteria | 4820 |
| 353 | Ga0395898_0043652 | 3300037466 | Bacteria | 4417 |
| 354 | Ga0395898_0048844 | 3300037466 | Bacteria | 4148 |
| 355 | Ga0395905_0004232 | 3300037471 | Bacteria | 15003 |
| 356 | Ga0395905_0534219 | 3300037471 | Bacteria | 1073 |
| 357 | Ga0395905_0904549 | 3300037471 | Bacteria | 785 |
| 358 | Ga0436364_0641210 | 3300037853 | Bacteria | 1520 |
| 359 | Ga0436364_0800356 | 3300037853 | Bacteria | 991 |
| 360 | Ga0395901_0006277 | 3300038443 | Bacteria | 12045 |
| 361 | Ga0395901_0227382 | 3300038443 | Bacteria | 1948 |
| 362 | Ga0436365_0119504 | 3300039437 | Bacteria | 1527 |
| 363 | Ga0436365_0279031 | 3300039437 | Bacteria | 3587 |
| 364 | Ga0436365_0838143 | 3300039437 | Bacteria | 2836 |
| 365 | Ga0436365_1138701 | 3300039437 | Bacteria | 28644 |
| 366 | Ga0436361_0334533 | 3300039447 | Bacteria | 1134 |
| 367 | Ga0436361_0849478 | 3300039447 | Bacteria | 2474 |
| 368 | Ga0436363_0830766 | 3300039450 | Bacteria | 2248 |
| 369 | Ga0436362_0546910 | 3300039453 | Bacteria | 3042 |
| 370 | Ga0436362_0740954 | 3300039453 | Bacteria | 1064 |
| 371 | Ga0439465_0114781 | 3300041413 | Bacteria | 940 |
| 372 | Ga0451789_0163036 | 3300041443 | Bacteria | 1003 |
| 373 | Ga0466972_0000179 | 3300044658 | Bacteria | 49010 |
| 374 | Ga0466972_0000516 | 3300044658 | Bacteria | 19219 |
| 375 | Ga0466972_0085873 | 3300044658 | Bacteria | 1496 |
| 376 | Ga0466965_0072218 | 3300044683 | Bacteria | 1736 |
| 377 | Ga0466963_0038559 | 3300044694 | Bacteria | 3125 |
| 378 | Ga0466963_0080254 | 3300044694 | Bacteria | 2208 |
| 379 | Ga0466964_0014197 | 3300044706 | Bacteria | 3026 |
| 380 | Ga0466968_0008321 | 3300044735 | Bacteria | 3970 |
| 381 | Ga0466957_0071003 | 3300044842 | Bacteria | 2153 |
| 382 | Ga0466957_0261651 | 3300044842 | Bacteria | 1153 |
| 383 | Ga0466960_0052697 | 3300044901 | Bacteria | 1969 |
| 384 | Ga0466958_0140344 | 3300045836 | Bacteria | 1521 |
| 385 | Ga0466967_0459294 | 3300045976 | Bacteria | 1245 |
| 386 | Ga0466967_0564918 | 3300045976 | Bacteria | 1120 |
| 387 | Ga0495617_006222 | 3300046452 | Bacteria | 4200 |
| 388 | Ga0495617_059017 | 3300046452 | Bacteria | 1271 |
| 389 | Ga0495592_0021832 | 3300046454 | Bacteria | 4870 |
| 390 | Ga0495592_0085595 | 3300046454 | Bacteria | 2272 |
| 391 | Ga0495592_0268273 | 3300046454 | Bacteria | 1121 |
| 392 | Ga0495603_0046487 | 3300046455 | Bacteria | 2586 |
| 393 | Ga0495603_0079540 | 3300046455 | Bacteria | 1921 |
| 394 | Ga0495603_0156284 | 3300046455 | Bacteria | 1323 |
| 395 | Ga0495629_0001841 | 3300046459 | Bacteria | 16607 |
| 396 | Ga0495629_0132485 | 3300046459 | Bacteria | 1736 |
| 397 | Ga0495629_0195513 | 3300046459 | Bacteria | 1399 |
| 398 | Ga0495638_0001078 | 3300046460 | Bacteria | 26592 |
| 399 | Ga0495638_0011310 | 3300046460 | Bacteria | 6150 |
| 400 | Ga0495638_0235426 | 3300046460 | Bacteria | 1016 |
| 401 | Ga0495641_0220237 | 3300046461 | Bacteria | 851 |
| 402 | Ga0495651_0001119 | 3300046462 | Bacteria | 20724 |
| 403 | Ga0495651_0046362 | 3300046462 | Bacteria | 3364 |
| 404 | Ga0495651_0167779 | 3300046462 | Bacteria | 1566 |
| 405 | Ga0495653_0050502 | 3300046463 | Bacteria | 3198 |
| 406 | Ga0495650_0030020 | 3300046471 | Bacteria | 2469 |
| 407 | Ga0495582_0310421 | 3300046473 | Bacteria | 907 |
| 408 | Ga0495605_0070755 | 3300046474 | Bacteria | 1649 |
| 409 | Ga0495639_0272068 | 3300046475 | Bacteria | 841 |
| 410 | Ga0495664_0003810 | 3300046477 | Bacteria | 8225 |
| 411 | Ga0495584_0061495 | 3300046491 | Bacteria | 1888 |
| 412 | Ga0495584_0237281 | 3300046491 | Bacteria | 927 |
| 413 | Ga0495585_0200282 | 3300046492 | Bacteria | 1017 |
| 414 | Ga0495594_0089576 | 3300046499 | Bacteria | 1723 |
| 415 | Ga0495594_0163685 | 3300046499 | Bacteria | 1265 |
| 416 | Ga0495596_0028449 | 3300046500 | Bacteria | 2244 |
| 417 | Ga0495596_0136340 | 3300046500 | Bacteria | 953 |
| 418 | Ga0495583_0069764 | 3300046506 | Bacteria | 1547 |
| 419 | Ga0495606_0000357 | 3300046507 | Bacteria | 78015 |
| 420 | Ga0495606_0089364 | 3300046507 | Bacteria | 1898 |
| 421 | Ga0495606_0236277 | 3300046507 | Bacteria | 1021 |
| 422 | Ga0495620_0016755 | 3300046515 | Bacteria | 3669 |
| 423 | Ga0495620_0062706 | 3300046515 | Bacteria | 1543 |
| 424 | Ga0495620_0079786 | 3300046515 | Bacteria | 1325 |
| 425 | Ga0495628_0073716 | 3300046516 | Bacteria | 2659 |
| 426 | Ga0495628_0161204 | 3300046516 | Bacteria | 1704 |
| 427 | Ga0495628_0391214 | 3300046516 | Bacteria | 1017 |
| 428 | Ga0495631_0032716 | 3300046518 | Bacteria | 2343 |
| 429 | Ga0495632_0061929 | 3300046519 | Bacteria | 1815 |
| 430 | Ga0495632_0137761 | 3300046519 | Bacteria | 1133 |
| 431 | Ga0495643_0252041 | 3300046522 | Bacteria | 823 |
| 432 | Ga0495648_0000649 | 3300046524 | Bacteria | 37131 |
| 433 | Ga0495648_0001411 | 3300046524 | Bacteria | 23498 |
| 434 | Ga0495648_0006902 | 3300046524 | Bacteria | 9160 |
| 435 | Ga0495648_0103070 | 3300046524 | Bacteria | 1570 |
| 436 | Ga0495648_0122851 | 3300046524 | Bacteria | 1392 |
| 437 | Ga0495648_0204434 | 3300046524 | Bacteria | 986 |
| 438 | Ga0495652_0011196 | 3300046529 | Bacteria | 8122 |
| 439 | Ga0495652_0016077 | 3300046529 | Bacteria | 6694 |
| 440 | Ga0495654_0094692 | 3300046530 | Bacteria | 1381 |
| 441 | Ga0495587_0037215 | 3300046536 | Bacteria | 2922 |
| 442 | Ga0495587_0093185 | 3300046536 | Bacteria | 1739 |
| 443 | Ga0495598_0139471 | 3300046537 | Bacteria | 838 |
| 444 | Ga0495621_0041833 | 3300046539 | Bacteria | 1610 |
| 445 | Ga0495621_0126418 | 3300046539 | Bacteria | 992 |
| 446 | Ga0495597_0085789 | 3300046542 | Bacteria | 1341 |
| 447 | Ga0495622_0018451 | 3300046557 | Bacteria | 3249 |
| 448 | Ga0495622_0080083 | 3300046557 | Bacteria | 1503 |
| 449 | Ga0495622_0082546 | 3300046557 | Bacteria | 1478 |
| 450 | Ga0495656_0003804 | 3300046615 | Bacteria | 5129 |
| 451 | Ga0495656_0050337 | 3300046615 | Bacteria | 1778 |
| 452 | Ga0495656_0066365 | 3300046615 | Bacteria | 1589 |
| 453 | Ga0495668_0069727 | 3300046616 | Bacteria | 1933 |
| 454 | Ga0495668_0073504 | 3300046616 | Bacteria | 1877 |
| 455 | Ga0495634_0009918 | 3300046642 | Bacteria | 7000 |
| 456 | Ga0495634_0040892 | 3300046642 | Bacteria | 3150 |
| 457 | Ga0495611_0133936 | 3300046648 | Bacteria | 1156 |
| 458 | Ga0495611_0170118 | 3300046648 | Bacteria | 1018 |
| 459 | Ga0495625_0076145 | 3300046660 | Bacteria | 2346 |
| 460 | Ga0495625_0196316 | 3300046660 | Bacteria | 1334 |
| 461 | Ga0495635_0002477 | 3300046663 | Bacteria | 12604 |
| 462 | Ga0495635_0063953 | 3300046663 | Bacteria | 2526 |
| 463 | Ga0495661_0130267 | 3300046665 | Bacteria | 1379 |
| 464 | Ga0495661_0234929 | 3300046665 | Bacteria | 943 |
| 465 | Ga0495588_0010104 | 3300046674 | Bacteria | 4379 |
| 466 | Ga0495588_0022019 | 3300046674 | Bacteria | 3147 |
| 467 | Ga0495657_0039033 | 3300046675 | Bacteria | 3264 |
| 468 | Ga0495623_0002992 | 3300046679 | Bacteria | 11118 |
| 469 | Ga0495623_0010731 | 3300046679 | Bacteria | 5931 |
| 470 | Ga0495623_0203330 | 3300046679 | Bacteria | 1138 |
| 471 | Ga0495646_0087280 | 3300046680 | Bacteria | 1808 |
| 472 | Ga0495646_0229868 | 3300046680 | Bacteria | 1000 |
| 473 | Ga0495669_0062815 | 3300046684 | Bacteria | 1683 |
| 474 | Ga0495613_0033023 | 3300046689 | Bacteria | 3846 |
| 475 | Ga0495671_0232995 | 3300046692 | Bacteria | 890 |
| 476 | Ga0495649_0287298 | 3300046694 | Bacteria | 839 |
| 477 | Ga0495600_0008391 | 3300046809 | Bacteria | 6343 |
| 478 | Ga0495581_0188053 | 3300047315 | Bacteria | 1208 |
| 479 | Ga0495604_0024142 | 3300047317 | Bacteria | 4853 |
| 480 | Ga0495674_0012072 | 3300047319 | Bacteria | 8141 |
| 481 | Ga0495674_0065589 | 3300047319 | Bacteria | 3153 |
| 482 | Ga0495674_0111894 | 3300047319 | Bacteria | 2314 |
| 483 | Ga0495674_0407610 | 3300047319 | Bacteria | 1097 |
| 484 | Ga0495672_0003965 | 3300047320 | Bacteria | 12392 |
| 485 | Ga0495676_0055040 | 3300047321 | Bacteria | 3158 |
| 486 | Ga0495676_0107620 | 3300047321 | Bacteria | 2052 |
| 487 | Ga0495680_0001426 | 3300047322 | Bacteria | 25752 |
| 488 | Ga0495680_0012571 | 3300047322 | Bacteria | 7441 |
| 489 | Ga0495675_0032501 | 3300047444 | Bacteria | 3330 |
| 490 | Ga0495675_0298645 | 3300047444 | Bacteria | 957 |
| 491 | Ga0495673_0064649 | 3300047469 | Bacteria | 1555 |
| 492 | Ga0495684_0001145 | 3300047471 | Bacteria | 21346 |
| 493 | Ga0495684_0045526 | 3300047471 | Bacteria | 3358 |
| 494 | Ga0495686_0049064 | 3300047472 | Bacteria | 2658 |
| 495 | Ga0495686_0066337 | 3300047472 | Bacteria | 2230 |
| 496 | Ga0495686_0115920 | 3300047472 | Bacteria | 1602 |
| 497 | Ga0495686_0121289 | 3300047472 | Bacteria | 1558 |
| 498 | Ga0495686_0178291 | 3300047472 | Bacteria | 1232 |
| 499 | Ga0495686_0225781 | 3300047472 | Bacteria | 1063 |
| 500 | Ga0495686_0355551 | 3300047472 | Bacteria | 795 |
| 501 | Ga0495593_0000526 | 3300047673 | Bacteria | 21677 |
| 502 | Ga0495602_0007749 | 3300048088 | Bacteria | 11224 |
| 503 | Ga0495602_0009427 | 3300048088 | Bacteria | 10154 |
| 504 | Ga0495626_0041435 | 3300048091 | Bacteria | 2169 |
| 505 | Ga0496100_0744548 | 3300048903 | Bacteria | 766 |
| 506 | Ga0496101_0276206 | 3300048904 | Bacteria | 1312 |
| 507 | Ga0496101_0578241 | 3300048904 | Bacteria | 888 |
| 508 | Ga0496102_0201668 | 3300048905 | Bacteria | 1875 |
| 509 | Ga0496102_0299368 | 3300048905 | Bacteria | 1516 |
| 510 | Ga0496103_0228109 | 3300048906 | Bacteria | 1198 |
| 511 | Ga0496103_0447461 | 3300048906 | Bacteria | 829 |
| 512 | Ga0496105_0021342 | 3300048908 | Bacteria | 5241 |
| 513 | Ga0496106_0057184 | 3300048909 | Bacteria | 2949 |
| 514 | Ga0496106_0262067 | 3300048909 | Bacteria | 1383 |
| 515 | Ga0496106_0331802 | 3300048909 | Bacteria | 1221 |
| 516 | Ga0496107_0073000 | 3300048910 | Bacteria | 2495 |
| 517 | Ga0496107_0481273 | 3300048910 | Bacteria | 921 |
| 518 | Ga0496108_0138636 | 3300048911 | Bacteria | 2095 |
| 519 | Ga0496108_0280518 | 3300048911 | Bacteria | 1451 |
| 520 | Ga0496110_0019461 | 3300048913 | Bacteria | 5714 |
| 521 | Ga0496110_0064838 | 3300048913 | Bacteria | 3229 |
| 522 | Ga0496110_0392551 | 3300048913 | Bacteria | 1265 |
| 523 | Ga0496110_0685768 | 3300048913 | Bacteria | 925 |
| 524 | Ga0496110_1021236 | 3300048913 | Bacteria | 734 |
| 525 | Ga0496111_0216554 | 3300048914 | Bacteria | 1423 |
| 526 | Ga0496111_0254823 | 3300048914 | Bacteria | 1302 |
| 527 | Ga0496112_0112393 | 3300048915 | Bacteria | 2694 |
| 528 | Ga0496112_0163495 | 3300048915 | Bacteria | 2192 |
| 529 | Ga0496112_0228310 | 3300048915 | Bacteria | 1816 |
| 530 | Ga0496112_0831861 | 3300048915 | Bacteria | 847 |
| 531 | Ga0496113_0035965 | 3300048916 | Bacteria | 3626 |
| 532 | Ga0496113_0059803 | 3300048916 | Bacteria | 2871 |
| 533 | Ga0496114_0237114 | 3300048917 | Bacteria | 1603 |
| 534 | Ga0496114_0580249 | 3300048917 | Bacteria | 989 |
| 535 | Ga0496115_0048409 | 3300048918 | Bacteria | 3400 |
| 536 | Ga0496115_0199628 | 3300048918 | Bacteria | 1652 |
| 537 | Ga0496115_0220474 | 3300048918 | Bacteria | 1565 |
| 538 | Ga0496115_0264144 | 3300048918 | Bacteria | 1415 |
| 539 | Ga0496115_0316810 | 3300048918 | Bacteria | 1276 |
| 540 | Ga0496116_0001611 | 3300048919 | Bacteria | 24820 |
| 541 | Ga0496117_0013012 | 3300048920 | Bacteria | 7287 |
| 542 | Ga0496117_0103192 | 3300048920 | Bacteria | 1798 |
| 543 | Ga0496118_0024435 | 3300048921 | Bacteria | 5213 |
| 544 | Ga0496118_0025336 | 3300048921 | Bacteria | 5090 |
| 545 | Ga0496118_0025358 | 3300048921 | Bacteria | 5087 |
| 546 | Ga0496118_0118021 | 3300048921 | Bacteria | 1739 |
| 547 | Ga0496118_0194671 | 3300048921 | Bacteria | 1208 |
| 548 | Ga0496118_0278507 | 3300048921 | Bacteria | 932 |
| 549 | Ga0496118_0319732 | 3300048921 | Bacteria | 843 |
| 550 | Ga0496119_0076813 | 3300048922 | Bacteria | 1937 |
| 551 | Ga0496119_0131793 | 3300048922 | Bacteria | 1361 |
| 552 | Ga0496120_0079676 | 3300048923 | Bacteria | 1777 |
| 553 | Ga0496120_0250569 | 3300048923 | Bacteria | 831 |
| 554 | Ga0496121_0000753 | 3300048924 | Bacteria | 59517 |
| 555 | Ga0496121_0028031 | 3300048924 | Bacteria | 5253 |
| 556 | Ga0496121_0030771 | 3300048924 | Bacteria | 4923 |
| 557 | Ga0496121_0035853 | 3300048924 | Bacteria | 4433 |
| 558 | Ga0496121_0045179 | 3300048924 | Bacteria | 3787 |
| 559 | Ga0496121_0057369 | 3300048924 | Bacteria | 3228 |
| 560 | Ga0496121_0204063 | 3300048924 | Bacteria | 1406 |
| 561 | Ga0496121_0236320 | 3300048924 | Bacteria | 1276 |
| 562 | Ga0496121_0439637 | 3300048924 | Bacteria | 843 |
| 563 | Ga0496122_0049475 | 3300048925 | Bacteria | 3218 |
| 564 | Ga0496123_0068547 | 3300048926 | Bacteria | 2233 |
| 565 | Ga0496124_0025489 | 3300048927 | Bacteria | 5355 |
| 566 | Ga0496124_0124166 | 3300048927 | Bacteria | 2059 |
| 567 | Ga0496124_0319628 | 3300048927 | Bacteria | 1112 |
| 568 | Ga0496125_0000099 | 3300048928 | Bacteria | 203333 |
| 569 | Ga0496125_0001860 | 3300048928 | Bacteria | 29047 |
| 570 | Ga0496125_0002962 | 3300048928 | Bacteria | 21340 |
| 571 | Ga0496125_0004213 | 3300048928 | Bacteria | 16756 |
| 572 | Ga0496125_0047595 | 3300048928 | Bacteria | 3583 |
| 573 | Ga0496125_0227797 | 3300048928 | Bacteria | 1195 |
| 574 | Ga0496126_0012065 | 3300048929 | Bacteria | 8879 |
| 575 | Ga0496126_0047881 | 3300048929 | Bacteria | 3912 |
| 576 | Ga0496126_0054808 | 3300048929 | Bacteria | 3609 |
| 577 | Ga0496126_0094761 | 3300048929 | Bacteria | 2619 |
| 578 | Ga0496126_0109600 | 3300048929 | Bacteria | 2406 |
| 579 | Ga0496126_0215062 | 3300048929 | Bacteria | 1617 |
| 580 | Ga0496126_0244805 | 3300048929 | Bacteria | 1496 |
| 581 | Ga0495682_0015377 | 3300049460 | Bacteria | 2900 |
| 582 | Ga0495682_0033863 | 3300049460 | Bacteria | 1885 |
| 583 | Ga0501315_019595 | 3300049531 | Bacteria | 901 |
| 584 | Ga0501034_0290711 | 3300049571 | Bacteria | 1572 |
| 585 | Ga0501034_0493805 | 3300049571 | Bacteria | 1138 |
| 586 | Ga0501039_0306765 | 3300049575 | Bacteria | 1248 |
| 587 | Ga0501039_0360235 | 3300049575 | Bacteria | 1143 |
| 588 | Ga0501043_0579757 | 3300049579 | Bacteria | 830 |
| 589 | Ga0501046_0035855 | 3300049580 | Bacteria | 3995 |
| 590 | Ga0501047_0406704 | 3300049581 | Bacteria | 1194 |
| 591 | Ga0501048_0224413 | 3300049582 | Bacteria | 1333 |
| 592 | Ga0501068_0163553 | 3300049584 | Bacteria | 1403 |
| 593 | Ga0501073_0233250 | 3300049589 | Bacteria | 1271 |
| 594 | Ga0501076_0317412 | 3300049592 | Bacteria | 1278 |
| 595 | Ga0501081_0092718 | 3300049743 | Bacteria | 2126 |
| 596 | Ga0501035_0170187 | 3300049822 | Bacteria | 1882 |
| 597 | Ga0501035_0170606 | 3300049822 | Bacteria | 1880 |
| 598 | Ga0501035_0316879 | 3300049822 | Bacteria | 1311 |
| 599 | Ga0501045_0131473 | 3300049824 | Bacteria | 1861 |
| 600 | nmdc:mga03683_83933_c1 | 3300050489 | Bacteria | 1380 |
| 601 | nmdc:mga03n38_448_c1 | 3300050490 | Bacteria | 10279 |
| 602 | nmdc:mga0yw44_179531_c1 | 3300050492 | Bacteria | 1393 |
| 603 | nmdc:mga0yw44_19940_c1 | 3300050492 | Bacteria | 3709 |
| 604 | nmdc:mga0yw44_81744_c1 | 3300050492 | Bacteria | 2026 |
| 605 | nmdc:mga0yw44_9263_c1 | 3300050492 | Bacteria | 4962 |
| 606 | nmdc:mga0yw44_98500_c1 | 3300050492 | Bacteria | 1859 |
| 607 | nmdc:mga06z11_28144_c1 | 3300050494 | Bacteria | 2694 |
| 608 | nmdc:mga07m45_17174_c1 | 3300050496 | Bacteria | 3881 |
| 609 | nmdc:mga05p37_755549_c1 | 3300050507 | Bacteria | 1071 |
| 610 | nmdc:mga09592_55761_c1 | 3300050508 | Bacteria | 3339 |
| 611 | nmdc:mga0qj67_57292_c1 | 3300050509 | Bacteria | 3089 |
| 612 | nmdc:mga08y16_152915_c1 | 3300050511 | Bacteria | 2398 |
| 613 | nmdc:mga0sz30_42624_c1 | 3300050516 | Bacteria | 1910 |
| 614 | nmdc:mga0sz30_61380_c1 | 3300050516 | Bacteria | 1606 |
| 615 | Ga0500635_0081216 | 3300053080 | Bacteria | 1165 |
| 616 | Ga0495655_0006964 | 3300053083 | Bacteria | 2081 |
| 617 | Ga0495655_0012784 | 3300053083 | Bacteria | 1720 |
| 618 | Ga0495595_0001351 | 3300053084 | Bacteria | 9525 |
| 619 | Ga0495595_0009072 | 3300053084 | Bacteria | 4108 |
| 620 | Ga0495619_0001695 | 3300053085 | Bacteria | 14587 |
| 621 | Ga0495619_0063683 | 3300053085 | Bacteria | 2457 |
| 622 | Ga0495619_0298751 | 3300053085 | Bacteria | 1116 |
| 623 | Ga0500578_0073181 | 3300053086 | Bacteria | 2183 |
| 624 | Ga0500643_000180 | 3300053087 | Bacteria | 61907 |
| 625 | Ga0500651_0005715 | 3300053093 | Bacteria | 7122 |
| 626 | Ga0500651_0021885 | 3300053093 | Bacteria | 3990 |
| 627 | Ga0500566_0002520 | 3300053094 | Bacteria | 10882 |
| 628 | Ga0500566_0004614 | 3300053094 | Bacteria | 8202 |
| 629 | Ga0500640_028305 | 3300053095 | Bacteria | 2446 |
| 630 | Ga0500641_0005375 | 3300053096 | Bacteria | 4538 |
| 631 | Ga0500641_0017766 | 3300053096 | Bacteria | 2666 |
| 632 | Ga0500641_0058901 | 3300053096 | Bacteria | 1595 |
| 633 | Ga0500641_0175098 | 3300053096 | Bacteria | 923 |
| 634 | Ga0500650_0073574 | 3300053098 | Bacteria | 1597 |
| 635 | Ga0500554_016601 | 3300053102 | Bacteria | 1950 |
| 636 | Ga0500555_059751 | 3300053103 | Bacteria | 1028 |
| 637 | Ga0500556_0000012 | 3300053104 | Bacteria | 250391 |
| 638 | Ga0500557_000046 | 3300053105 | Bacteria | 59508 |
| 639 | Ga0500569_005217 | 3300053109 | Bacteria | 2782 |
| 640 | Ga0500569_014721 | 3300053109 | Bacteria | 1943 |
| 641 | Ga0500572_000471 | 3300053111 | Bacteria | 13998 |
| 642 | Ga0500582_122829 | 3300053114 | Bacteria | 905 |
| 643 | Ga0500592_000542 | 3300053116 | Bacteria | 6235 |
| 644 | Ga0500592_030190 | 3300053116 | Bacteria | 875 |
| 645 | Ga0500594_0009826 | 3300053118 | Bacteria | 2210 |
| 646 | Ga0500594_0101994 | 3300053118 | Bacteria | 884 |
| 647 | Ga0500595_000615 | 3300053119 | Bacteria | 21276 |
| 648 | Ga0500595_007563 | 3300053119 | Bacteria | 4499 |
| 649 | Ga0500595_011345 | 3300053119 | Bacteria | 3493 |
| 650 | Ga0500607_034490 | 3300053121 | Bacteria | 2770 |
| 651 | Ga0500608_027336 | 3300053122 | Bacteria | 2688 |
| 652 | Ga0500614_070735 | 3300053123 | Bacteria | 957 |
| 653 | Ga0500618_006007 | 3300053125 | Bacteria | 3610 |
| 654 | Ga0500618_057612 | 3300053125 | Bacteria | 875 |
| 655 | Ga0500628_049242 | 3300053129 | Bacteria | 994 |
| 656 | Ga0500642_0000013 | 3300053130 | Bacteria | 197927 |
| 657 | Ga0500642_0000038 | 3300053130 | Bacteria | 98299 |
| 658 | Ga0500642_0033610 | 3300053130 | Bacteria | 2162 |
| 659 | Ga0500652_001452 | 3300053131 | Bacteria | 7354 |
| 660 | Ga0500658_0187477 | 3300053134 | Bacteria | 943 |
| 661 | Ga0500559_0000713 | 3300053136 | Bacteria | 21844 |
| 662 | Ga0500559_0001670 | 3300053136 | Bacteria | 12261 |
| 663 | Ga0500559_0026032 | 3300053136 | Bacteria | 2490 |
| 664 | Ga0500564_069907 | 3300053138 | Bacteria | 1584 |
| 665 | Ga0500568_0000676 | 3300053139 | Bacteria | 24605 |
| 666 | Ga0500568_0043586 | 3300053139 | Bacteria | 1793 |
| 667 | Ga0500568_0070629 | 3300053139 | Bacteria | 1337 |
| 668 | Ga0500568_0095835 | 3300053139 | Bacteria | 1116 |
| 669 | Ga0500590_125168 | 3300053148 | Bacteria | 1198 |
| 670 | Ga0500616_0000035 | 3300053153 | Bacteria | 394242 |
| 671 | Ga0500616_0036917 | 3300053153 | Bacteria | 2648 |
| 672 | Ga0500616_0151921 | 3300053153 | Bacteria | 1071 |
| 673 | Ga0500619_009223 | 3300053154 | Bacteria | 2438 |
| 674 | Ga0500620_079333 | 3300053155 | Bacteria | 1135 |
| 675 | Ga0500622_0005098 | 3300053156 | Bacteria | 7983 |
| 676 | Ga0500622_0055023 | 3300053156 | Bacteria | 2039 |
| 677 | Ga0500627_0046689 | 3300053158 | Bacteria | 1877 |
| 678 | Ga0500627_0083492 | 3300053158 | Bacteria | 1425 |
| 679 | Ga0500633_0085149 | 3300053160 | Bacteria | 1148 |
| 680 | Ga0500634_0020483 | 3300053161 | Bacteria | 3576 |
| 681 | Ga0500634_0037228 | 3300053161 | Bacteria | 2647 |
| 682 | Ga0500638_007258 | 3300053162 | Bacteria | 4622 |
| 683 | Ga0500638_028379 | 3300053162 | Bacteria | 2689 |
| 684 | Ga0500636_0001763 | 3300053177 | Bacteria | 11844 |
| 685 | Ga0500636_0010527 | 3300053177 | Bacteria | 5398 |
| 686 | Ga0500637_0000445 | 3300053178 | Bacteria | 15850 |
| 687 | Ga0500567_160758 | 3300053723 | Bacteria | 823 |
| 688 | Ga0500570_147811 | 3300053724 | Bacteria | 845 |
| 689 | Ga0500625_003345 | 3300053729 | Bacteria | 6318 |
| 690 | Ga0500609_018794 | 3300053731 | Bacteria | 942 |
| 691 | Ga0500599_001657 | 3300053736 | Bacteria | 2594 |
| 692 | Ga0500661_000331 | 3300055283 | Bacteria | 8597 |
| 693 | Ga0500661_037243 | 3300055283 | Bacteria | 861 |
| 694 | Ga0587073_0008925 | 3300059492 | Bacteria | 1639 |
| 695 | Ga0587083_0008267 | 3300059505 | Bacteria | 1622 |
| 696 | Ga0587088_024946 | 3300059508 | Bacteria | 1028 |
| 697 | Ga0587079_005293 | 3300059647 | Bacteria | 1814 |
| 698 | Ga0587107_018852 | 3300059652 | Bacteria | 940 |
| 699 | Ga0587071_015827 | 3300060344 | Bacteria | 1328 |
| 700 | Ga0587071_038525 | 3300060344 | Bacteria | 950 |
| 701 | Ga0466962_0207969 | 3300061719 | Bacteria | 957 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048928 | Ga0496125_0000099 | Ga0496125_0000099_27772_28485 | 224 |
| 2 | iso_pu_bacteria | 2507262055 | 2507512032 | 228 |
| 3 | iso_pu_bacteria | 2508501009 | 2508545692 | 228 |
| 4 | iso_pu_bacteria | 2508501042 | 2508694514 | 228 |
| 5 | iso_pu_bacteria | 2508501128 | 2509151231 | 228 |
| 6 | iso_pu_bacteria | 2511231028 | 2511401328 | 228 |
| 7 | iso_pu_bacteria | 2513237092 | 2513624579 | 228 |
| 8 | iso_pu_bacteria | 2513237092 | 2513625206 | 228 |
| 9 | iso_pu_bacteria | 2513237096 | 2513655550 | 228 |
| 10 | iso_pu_bacteria | 2513237101 | 2513698858 | 228 |
| 11 | iso_pu_bacteria | 2513237104 | 2513720198 | 228 |
| 12 | iso_pu_bacteria | 2513237139 | 2513874335 | 228 |
| 13 | iso_pu_bacteria | 2513237141 | 2513887896 | 228 |
| 14 | iso_pu_bacteria | 2513237145 | 2513916372 | 228 |
| 15 | iso_pu_bacteria | 2513237161 | 2514016829 | 228 |
| 16 | iso_pu_bacteria | 2515154112 | 2515624555 | 228 |
| 17 | iso_pu_bacteria | 2528768022 | 2528850232 | 228 |
| 18 | iso_pu_bacteria | 2602042107 | 2603857727 | 228 |
| 19 | iso_pu_bacteria | 2617270735 | 2617353131 | 228 |
| 20 | iso_pu_bacteria | 2643221651 | 2644287122 | 228 |
| 21 | iso_pu_bacteria | 2667528175 | 2671120944 | 228 |
| 22 | iso_pu_bacteria | 2721755755 | 2723842651 | 228 |
| 23 | iso_pu_bacteria | 2728368998 | 2728749065 | 228 |
| 24 | iso_pu_bacteria | 2744054633 | 2745078366 | 228 |
| 25 | iso_pu_bacteria | 2791355196 | 2793059471 | 228 |
| 26 | iso_pu_bacteria | 2802429603 | 2805916102 | 228 |
| 27 | iso_pu_bacteria | 2824600985 | 2824604494 | 228 |
| 28 | iso_pu_bacteria | 2824609381 | 2824614965 | 228 |
| 29 | iso_pu_bacteria | 2824653114 | 2824657512 | 228 |
| 30 | iso_pu_bacteria | 2824661429 | 2824669391 | 228 |
| 31 | iso_pu_bacteria | 2824671348 | 2824673995 | 228 |
| 32 | iso_pu_bacteria | 2824687955 | 2824691262 | 228 |
| 33 | iso_pu_bacteria | 2824696289 | 2824701373 | 228 |
| 34 | iso_pu_bacteria | 2824732956 | 2824739160 | 228 |
| 35 | iso_pu_bacteria | 2824773399 | 2824778323 | 228 |
| 36 | iso_pu_bacteria | 2838122688 | 2838128550 | 228 |
| 37 | iso_pu_bacteria | 2841941048 | 2841942406 | 228 |
| 38 | iso_pu_bacteria | 2841949485 | 2841953248 | 228 |
| 39 | iso_pu_bacteria | 2841966195 | 2841973863 | 228 |
| 40 | iso_pu_bacteria | 2841974524 | 2841982928 | 228 |
| 41 | iso_pu_bacteria | 2841983080 | 2841984423 | 228 |
| 42 | iso_pu_bacteria | 2842038055 | 2842041851 | 228 |
| 43 | iso_pu_bacteria | 2842045827 | 2842049894 | 228 |
| 44 | iso_pu_bacteria | 2844315083 | 2844321262 | 228 |
| 45 | iso_pu_bacteria | 2847930680 | 2847932152 | 228 |
| 46 | iso_pu_bacteria | 2847939898 | 2847943382 | 228 |
| 47 | iso_pu_bacteria | 2849076700 | 2849077105 | 228 |
| 48 | iso_pu_bacteria | 2857509624 | 2857514601 | 228 |
| 49 | iso_pu_bacteria | 2857524615 | 2857527100 | 228 |
| 50 | iso_pu_bacteria | 2874590934 | 2874595794 | 228 |
| 51 | iso_pu_bacteria | 2874604998 | 2874606674 | 228 |
| 52 | iso_pu_bacteria | 2874612657 | 2874614933 | 228 |
| 53 | iso_pu_bacteria | 2874620515 | 2874624159 | 228 |
| 54 | iso_pu_bacteria | 2874645413 | 2874651574 | 228 |
| 55 | iso_pu_bacteria | 2876761206 | 2876767583 | 228 |
| 56 | iso_pu_bacteria | 2876771140 | 2876775991 | 228 |
| 57 | iso_pu_bacteria | 2876808645 | 2876808727 | 228 |
| 58 | iso_pu_bacteria | 2876818435 | 2876821199 | 228 |
| 59 | iso_pu_bacteria | 2879074833 | 2879080080 | 228 |
| 60 | iso_pu_bacteria | 2879099564 | 2879106447 | 228 |
| 61 | iso_pu_bacteria | 2879110137 | 2879111991 | 228 |
| 62 | iso_pu_bacteria | 2881364244 | 2881367534 | 228 |
| 63 | iso_pu_bacteria | 2885366525 | 2885374579 | 228 |
| 64 | iso_pu_bacteria | 2885374607 | 2885377202 | 228 |
| 65 | iso_pu_bacteria | 2885409591 | 2885414040 | 228 |
| 66 | iso_pu_bacteria | 2888378607 | 2888387553 | 228 |
| 67 | iso_pu_bacteria | 2888388044 | 2888391647 | 228 |
| 68 | iso_pu_bacteria | 2888419890 | 2888426776 | 228 |
| 69 | iso_pu_bacteria | 2889033259 | 2889034053 | 228 |
| 70 | iso_pu_bacteria | 2893066018 | 2893068122 | 228 |
| 71 | iso_pu_bacteria | 2903727486 | 2903728684 | 228 |
| 72 | iso_pu_bacteria | 2904666416 | 2904670870 | 228 |
| 73 | iso_pu_bacteria | 2904690495 | 2904697652 | 228 |
| 74 | iso_pu_bacteria | 2906602504 | 2906607876 | 228 |
| 75 | iso_pu_bacteria | 2906626472 | 2906634863 | 228 |
| 76 | iso_pu_bacteria | 2906643746 | 2906645724 | 228 |
| 77 | iso_pu_bacteria | 2908739725 | 2908740236 | 228 |
| 78 | iso_pu_bacteria | 2908756301 | 2908757758 | 228 |
| 79 | iso_pu_bacteria | 2919073203 | 2919078214 | 228 |
| 80 | iso_pu_bacteria | 2922361189 | 2922367453 | 228 |
| 81 | iso_pu_bacteria | 2922368715 | 2922376528 | 228 |
| 82 | iso_pu_bacteria | 2922386360 | 2922391444 | 228 |
| 83 | iso_pu_bacteria | 2929615660 | 2929619968 | 228 |
| 84 | iso_pu_bacteria | 2929624759 | 2929629280 | 228 |
| 85 | iso_pu_bacteria | 2932784394 | 2932789592 | 228 |
| 86 | iso_pu_bacteria | 2932801729 | 2932802486 | 228 |
| 87 | iso_pu_bacteria | 2932809354 | 2932814901 | 228 |
| 88 | iso_pu_bacteria | 2932818245 | 2932824243 | 228 |
| 89 | iso_pu_bacteria | 2932828146 | 2932834030 | 228 |
| 90 | iso_pu_bacteria | 2933577622 | 2933581886 | 228 |
| 91 | iso_pu_bacteria | 2935608549 | 2935613322 | 228 |
| 92 | iso_pu_bacteria | 2935616580 | 2935623580 | 228 |
| 93 | iso_pu_bacteria | 2935638405 | 2935644967 | 228 |
| 94 | iso_pu_bacteria | 2935648319 | 2935653800 | 228 |
| 95 | iso_pu_bacteria | 2935656913 | 2935662549 | 228 |
| 96 | iso_pu_bacteria | 2935665750 | 2935672016 | 228 |
| 97 | iso_pu_bacteria | 2935675223 | 2935683057 | 228 |
| 98 | iso_pu_bacteria | 2935684952 | 2935689227 | 228 |
| 99 | iso_pu_bacteria | 2935694250 | 2935697514 | 228 |
| 100 | iso_pu_bacteria | 2935703347 | 2935711091 | 228 |
| 101 | iso_pu_bacteria | 2935713505 | 2935720173 | 228 |
| 102 | iso_pu_bacteria | 2935722832 | 2935728210 | 228 |
| 103 | iso_pu_bacteria | 2935732158 | 2935737193 | 228 |
| 104 | iso_pu_bacteria | 2935741537 | 2935746746 | 228 |
| 105 | iso_pu_bacteria | 2935750917 | 2935757713 | 228 |
| 106 | iso_pu_bacteria | 2935760218 | 2935764092 | 228 |
| 107 | iso_pu_bacteria | 2935769743 | 2935776376 | 228 |
| 108 | iso_pu_bacteria | 2935777560 | 2935784363 | 228 |
| 109 | iso_pu_bacteria | 2935785616 | 2935792399 | 228 |
| 110 | iso_pu_bacteria | 2935793552 | 2935800562 | 228 |
| 111 | iso_pu_bacteria | 2935801545 | 2935808680 | 228 |
| 112 | iso_pu_bacteria | 2935810662 | 2935817477 | 228 |
| 113 | iso_pu_bacteria | 2935819856 | 2935824824 | 228 |
| 114 | iso_pu_bacteria | 2935827899 | 2935834187 | 228 |
| 115 | iso_pu_bacteria | 2935837841 | 2935844789 | 228 |
| 116 | iso_pu_bacteria | 2935847175 | 2935852044 | 228 |
| 117 | iso_pu_bacteria | 2935855204 | 2935861813 | 228 |
| 118 | iso_pu_bacteria | 2935864058 | 2935868551 | 228 |
| 119 | iso_pu_bacteria | 2935873716 | 2935879325 | 228 |
| 120 | iso_pu_bacteria | 2935908558 | 2935911392 | 228 |
| 121 | iso_pu_bacteria | 2935916978 | 2935920925 | 228 |
| 122 | iso_pu_bacteria | 2935926038 | 2935928421 | 228 |
| 123 | iso_pu_bacteria | 2935934488 | 2935938066 | 228 |
| 124 | iso_pu_bacteria | 2935942939 | 2935945348 | 228 |
| 125 | iso_pu_bacteria | 2935951376 | 2935954146 | 228 |
| 126 | iso_pu_bacteria | 2935959822 | 2935965970 | 228 |
| 127 | iso_pu_bacteria | 2935967501 | 2935971586 | 228 |
| 128 | iso_pu_bacteria | 2935975950 | 2935979982 | 228 |
| 129 | iso_pu_bacteria | 2935984226 | 2935989410 | 228 |
| 130 | iso_pu_bacteria | 2936002035 | 2936009032 | 228 |
| 131 | iso_pu_bacteria | 2936011229 | 2936016803 | 228 |
| 132 | iso_pu_bacteria | 2936019824 | 2936025436 | 228 |
| 133 | iso_pu_bacteria | 2936028420 | 2936034326 | 228 |
| 134 | iso_pu_bacteria | 2936037263 | 2936044274 | 228 |
| 135 | iso_pu_bacteria | 2936046547 | 2936052383 | 228 |
| 136 | iso_pu_bacteria | 2936055302 | 2936060664 | 228 |
| 137 | iso_pu_bacteria | 2940556831 | 2940563465 | 228 |
| 138 | iso_pu_bacteria | 2941538514 | 2941545316 | 228 |
| 139 | iso_pu_bacteria | 3005483717 | 3005485875 | 228 |
| 140 | iso_pu_bacteria | 3005506211 | 3005506742 | 228 |
| 141 | iso_pu_bacteria | 3005594810 | 3005601594 | 228 |
| 142 | iso_pu_bacteria | 3005710791 | 3005717329 | 228 |
| 143 | iso_pu_bacteria | 3005718088 | 3005724286 | 228 |
| 144 | iso_pu_bacteria | 8006926726 | 8006932167 | 228 |
| 145 | iso_pu_bacteria | 8006964411 | 8006965958 | 228 |
| 146 | iso_pu_bacteria | 8006984368 | 8006989914 | 228 |
| 147 | iso_pu_bacteria | 8016511872 | 8016519311 | 228 |
| 148 | iso_pu_bacteria | 8016522445 | 8016525026 | 228 |
| 149 | iso_pu_bacteria | 8016530956 | 8016538605 | 228 |
| 150 | iso_pu_bacteria | 8016539877 | 8016542890 | 228 |
| 151 | iso_pu_bacteria | 8016548790 | 8016550399 | 228 |
| 152 | iso_pu_bacteria | 8016557553 | 8016558813 | 228 |
| 153 | iso_pu_bacteria | 8016566248 | 8016568282 | 228 |
| 154 | iso_pu_bacteria | 8016583857 | 8016587800 | 228 |
| 155 | iso_pu_bacteria | 8016595262 | 8016596781 | 228 |
| 156 | iso_pu_bacteria | 8016603502 | 8016607671 | 228 |
| 157 | iso_pu_bacteria | 8016613128 | 8016619463 | 228 |
| 158 | iso_pu_bacteria | 8016622563 | 8016630141 | 228 |
| 159 | iso_pu_bacteria | 8016630954 | 8016637022 | 228 |
| 160 | iso_pu_bacteria | 8017057580 | 8017066204 | 228 |
| 161 | iso_pu_bacteria | 8019530166 | 8019538272 | 228 |
| 162 | iso_pu_bacteria | 8019547302 | 8019549081 | 228 |
| 163 | iso_pu_bacteria | 8019576017 | 8019578423 | 228 |
| 164 | iso_pu_bacteria | 8019586578 | 8019596462 | 228 |
| 165 | iso_pu_bacteria | 8019597564 | 8019605239 | 228 |
| 166 | iso_pu_bacteria | 8019608314 | 8019613310 | 228 |
| 167 | iso_pu_bacteria | 8019619141 | 8019623978 | 228 |
| 168 | iso_pu_bacteria | 8019629233 | 8019638055 | 228 |
| 169 | iso_pu_bacteria | 8019638758 | 8019641581 | 228 |
| 170 | iso_pu_bacteria | 8019668869 | 8019675496 | 228 |
| 171 | iso_pu_bacteria | 8019678201 | 8019680604 | 228 |
| 172 | iso_pu_bacteria | 8019687851 | 8019695158 | 228 |
| 173 | iso_pu_bacteria | 8055742211 | 8055750280 | 228 |
| 174 | iso_pu_bacteria | 8056673599 | 8056677893 | 228 |
| 175 | iso_pu_bacteria | 8056967851 | 8056976059 | 228 |
| 176 | 3300060344 | Ga0587071_015827 | Ga0587071_015827_178_873 | 231 |
| 177 | 3300003215 | JGI25153J46596_10000371 | JGI25153J46596_1000037113 | 232 |
| 178 | 3300003215 | JGI25153J46596_10000865 | JGI25153J46596_1000086511 | 232 |
| 179 | 3300003215 | JGI25153J46596_10018801 | JGI25153J46596_100188013 | 232 |
| 180 | 3300003794 | Ga0055531_10005980 | Ga0055531_100059802 | 232 |
| 181 | 3300004625 | Ga0055543_1023154 | Ga0055543_10231542 | 232 |
| 182 | 3300004799 | Ga0058863_11849786 | Ga0058863_118497861 | 232 |
| 183 | 3300005262 | Ga0065165_1001685 | Ga0065165_100168513 | 232 |
| 184 | 3300005262 | Ga0065165_1004072 | Ga0065165_10040722 | 232 |
| 185 | 3300005328 | Ga0070676_10021570 | Ga0070676_100215704 | 232 |
| 186 | 3300005329 | Ga0070683_100003434 | Ga0070683_1000034349 | 232 |
| 187 | 3300005331 | Ga0070670_100078460 | Ga0070670_1000784603 | 232 |
| 188 | 3300005336 | Ga0070680_100361829 | Ga0070680_1003618292 | 232 |
| 189 | 3300005338 | Ga0068868_100099670 | Ga0068868_1000996701 | 232 |
| 190 | 3300005339 | Ga0070660_100227359 | Ga0070660_1002273591 | 232 |
| 191 | 3300005344 | Ga0070661_100504538 | Ga0070661_1005045382 | 232 |
| 192 | 3300005347 | Ga0070668_100033480 | Ga0070668_1000334802 | 232 |
| 193 | 3300005347 | Ga0070668_100107901 | Ga0070668_1001079012 | 232 |
| 194 | 3300005347 | Ga0070668_100136903 | Ga0070668_1001369032 | 232 |
| 195 | 3300005347 | Ga0070668_100352102 | Ga0070668_1003521022 | 232 |
| 196 | 3300005347 | Ga0070668_100407157 | Ga0070668_1004071572 | 232 |
| 197 | 3300005353 | Ga0070669_100025831 | Ga0070669_1000258313 | 232 |
| 198 | 3300005355 | Ga0070671_100038198 | Ga0070671_1000381984 | 232 |
| 199 | 3300005356 | Ga0070674_100177310 | Ga0070674_1001773102 | 232 |
| 200 | 3300005356 | Ga0070674_100179268 | Ga0070674_1001792682 | 232 |
| 201 | 3300005364 | Ga0070673_100168033 | Ga0070673_1001680332 | 232 |
| 202 | 3300005365 | Ga0070688_100233004 | Ga0070688_1002330042 | 232 |
| 203 | 3300005366 | Ga0070659_100411099 | Ga0070659_1004110992 | 232 |
| 204 | 3300005434 | Ga0070709_10025034 | Ga0070709_100250342 | 232 |
| 205 | 3300005434 | Ga0070709_10556118 | Ga0070709_105561181 | 232 |
| 206 | 3300005435 | Ga0070714_100745237 | Ga0070714_1007452372 | 232 |
| 207 | 3300005435 | Ga0070714_100826716 | Ga0070714_1008267162 | 232 |
| 208 | 3300005436 | Ga0070713_100019302 | Ga0070713_1000193022 | 232 |
| 209 | 3300005436 | Ga0070713_100203137 | Ga0070713_1002031372 | 232 |
| 210 | 3300005436 | Ga0070713_100264165 | Ga0070713_1002641652 | 232 |
| 211 | 3300005436 | Ga0070713_100312293 | Ga0070713_1003122932 | 232 |
| 212 | 3300005436 | Ga0070713_100417458 | Ga0070713_1004174581 | 232 |
| 213 | 3300005437 | Ga0070710_10008635 | Ga0070710_100086352 | 232 |
| 214 | 3300005439 | Ga0070711_100005721 | Ga0070711_1000057212 | 232 |
| 215 | 3300005439 | Ga0070711_100014790 | Ga0070711_1000147907 | 232 |
| 216 | 3300005439 | Ga0070711_100174538 | Ga0070711_1001745382 | 232 |
| 217 | 3300005440 | Ga0070705_100256037 | Ga0070705_1002560371 | 232 |
| 218 | 3300005455 | Ga0070663_100003220 | Ga0070663_1000032202 | 232 |
| 219 | 3300005455 | Ga0070663_100055736 | Ga0070663_1000557362 | 232 |
| 220 | 3300005455 | Ga0070663_100156640 | Ga0070663_1001566402 | 232 |
| 221 | 3300005455 | Ga0070663_100335065 | Ga0070663_1003350652 | 232 |
| 222 | 3300005455 | Ga0070663_100402282 | Ga0070663_1004022821 | 232 |
| 223 | 3300005456 | Ga0070678_100108988 | Ga0070678_1001089883 | 232 |
| 224 | 3300005457 | Ga0070662_100245819 | Ga0070662_1002458192 | 232 |
| 225 | 3300005458 | Ga0070681_10243463 | Ga0070681_102434632 | 232 |
| 226 | 3300005467 | Ga0070706_100055109 | Ga0070706_1000551095 | 232 |
| 227 | 3300005471 | Ga0070698_100056809 | Ga0070698_1000568094 | 232 |
| 228 | 3300005471 | Ga0070698_100844106 | Ga0070698_1008441061 | 232 |
| 229 | 3300005530 | Ga0070679_100030709 | Ga0070679_1000307096 | 232 |
| 230 | 3300005530 | Ga0070679_100460981 | Ga0070679_1004609811 | 232 |
| 231 | 3300005539 | Ga0068853_100283155 | Ga0068853_1002831552 | 232 |
| 232 | 3300005539 | Ga0068853_100286916 | Ga0068853_1002869162 | 232 |
| 233 | 3300005543 | Ga0070672_100328487 | Ga0070672_1003284871 | 232 |
| 234 | 3300005548 | Ga0070665_100004774 | Ga0070665_1000047742 | 232 |
| 235 | 3300005548 | Ga0070665_100093542 | Ga0070665_1000935423 | 232 |
| 236 | 3300005548 | Ga0070665_100129223 | Ga0070665_1001292231 | 232 |
| 237 | 3300005548 | Ga0070665_100268135 | Ga0070665_1002681351 | 232 |
| 238 | 3300005563 | Ga0068855_100134381 | Ga0068855_1001343813 | 232 |
| 239 | 3300005563 | Ga0068855_100184191 | Ga0068855_1001841912 | 232 |
| 240 | 3300005577 | Ga0068857_100307253 | Ga0068857_1003072532 | 232 |
| 241 | 3300005578 | Ga0068854_100112009 | Ga0068854_1001120092 | 232 |
| 242 | 3300005614 | Ga0068856_100000046 | Ga0068856_10000004642 | 232 |
| 243 | 3300005616 | Ga0068852_100199867 | Ga0068852_1001998673 | 232 |
| 244 | 3300005616 | Ga0068852_100375094 | Ga0068852_1003750941 | 232 |
| 245 | 3300005616 | Ga0068852_100392911 | Ga0068852_1003929112 | 232 |
| 246 | 3300005618 | Ga0068864_101016699 | Ga0068864_1010166991 | 232 |
| 247 | 3300005719 | Ga0068861_100043439 | Ga0068861_1000434393 | 232 |
| 248 | 3300005719 | Ga0068861_100052910 | Ga0068861_1000529103 | 232 |
| 249 | 3300005719 | Ga0068861_100273488 | Ga0068861_1002734882 | 232 |
| 250 | 3300005719 | Ga0068861_100353766 | Ga0068861_1003537663 | 232 |
| 251 | 3300005834 | Ga0068851_10151085 | Ga0068851_101510852 | 232 |
| 252 | 3300005834 | Ga0068851_10218067 | Ga0068851_102180671 | 232 |
| 253 | 3300005842 | Ga0068858_100088777 | Ga0068858_1000887774 | 232 |
| 254 | 3300005843 | Ga0068860_100002690 | Ga0068860_1000026904 | 232 |
| 255 | 3300005843 | Ga0068860_100020202 | Ga0068860_1000202028 | 232 |
| 256 | 3300005843 | Ga0068860_100393060 | Ga0068860_1003930603 | 232 |
| 257 | 3300005844 | Ga0068862_100052654 | Ga0068862_1000526542 | 232 |
| 258 | 3300005844 | Ga0068862_100116002 | Ga0068862_1001160022 | 232 |
| 259 | 3300005844 | Ga0068862_100540425 | Ga0068862_1005404252 | 232 |
| 260 | 3300005937 | Ga0081455_10001281 | Ga0081455_1000128125 | 232 |
| 261 | 3300005983 | Ga0081540_1000593 | Ga0081540_10005935 | 232 |
| 262 | 3300005983 | Ga0081540_1025136 | Ga0081540_10251363 | 232 |
| 263 | 3300006028 | Ga0070717_10226496 | Ga0070717_102264962 | 232 |
| 264 | 3300006028 | Ga0070717_10331363 | Ga0070717_103313631 | 232 |
| 265 | 3300006028 | Ga0070717_10332431 | Ga0070717_103324312 | 232 |
| 266 | 3300006028 | Ga0070717_10496535 | Ga0070717_104965352 | 232 |
| 267 | 3300006038 | Ga0075365_10012254 | Ga0075365_100122547 | 232 |
| 268 | 3300006038 | Ga0075365_10027550 | Ga0075365_100275505 | 232 |
| 269 | 3300006038 | Ga0075365_10050798 | Ga0075365_100507982 | 232 |
| 270 | 3300006038 | Ga0075365_10253508 | Ga0075365_102535082 | 232 |
| 271 | 3300006048 | Ga0075363_100009873 | Ga0075363_1000098735 | 232 |
| 272 | 3300006048 | Ga0075363_100145191 | Ga0075363_1001451911 | 232 |
| 273 | 3300006051 | Ga0075364_10031364 | Ga0075364_100313642 | 232 |
| 274 | 3300006163 | Ga0070715_10281387 | Ga0070715_102813871 | 232 |
| 275 | 3300006173 | Ga0070716_100010123 | Ga0070716_1000101231 | 232 |
| 276 | 3300006175 | Ga0070712_100030277 | Ga0070712_1000302772 | 232 |
| 277 | 3300006175 | Ga0070712_100049612 | Ga0070712_1000496122 | 232 |
| 278 | 3300006175 | Ga0070712_100157673 | Ga0070712_1001576732 | 232 |
| 279 | 3300006175 | Ga0070712_100221964 | Ga0070712_1002219642 | 232 |
| 280 | 3300006175 | Ga0070712_100335717 | Ga0070712_1003357172 | 232 |
| 281 | 3300006177 | Ga0075362_10058214 | Ga0075362_100582141 | 232 |
| 282 | 3300006178 | Ga0075367_10050906 | Ga0075367_100509062 | 232 |
| 283 | 3300006178 | Ga0075367_10099002 | Ga0075367_100990022 | 232 |
| 284 | 3300006186 | Ga0075369_10014471 | Ga0075369_100144713 | 232 |
| 285 | 3300006186 | Ga0075369_10091574 | Ga0075369_100915742 | 232 |
| 286 | 3300006195 | Ga0075366_10056073 | Ga0075366_100560732 | 232 |
| 287 | 3300006195 | Ga0075366_10089421 | Ga0075366_100894212 | 232 |
| 288 | 3300006237 | Ga0097621_100042019 | Ga0097621_1000420192 | 232 |
| 289 | 3300006353 | Ga0075370_10009873 | Ga0075370_100098737 | 232 |
| 290 | 3300006880 | Ga0075429_100350803 | Ga0075429_1003508032 | 232 |
| 291 | 3300006881 | Ga0068865_100371000 | Ga0068865_1003710002 | 232 |
| 292 | 3300006944 | Ga0099823_1038597 | Ga0099823_10385974 | 232 |
| 293 | 3300007265 | Ga0099794_10099064 | Ga0099794_100990642 | 232 |
| 294 | 3300007265 | Ga0099794_10143822 | Ga0099794_101438221 | 232 |
| 295 | 3300007788 | Ga0099795_10032792 | Ga0099795_100327922 | 232 |
| 296 | 3300009093 | Ga0105240_10011485 | Ga0105240_1001148510 | 232 |
| 297 | 3300009093 | Ga0105240_10754591 | Ga0105240_107545911 | 232 |
| 298 | 3300009098 | Ga0105245_10052348 | Ga0105245_100523482 | 232 |
| 299 | 3300009098 | Ga0105245_10095059 | Ga0105245_100950592 | 232 |
| 300 | 3300009147 | Ga0114129_10277201 | Ga0114129_102772013 | 232 |
| 301 | 3300009148 | Ga0105243_10161981 | Ga0105243_101619812 | 232 |
| 302 | 3300009174 | Ga0105241_10084517 | Ga0105241_100845173 | 232 |
| 303 | 3300009174 | Ga0105241_10268606 | Ga0105241_102686062 | 232 |
| 304 | 3300009176 | Ga0105242_10248379 | Ga0105242_102483792 | 232 |
| 305 | 3300009545 | Ga0105237_10008240 | Ga0105237_100082402 | 232 |
| 306 | 3300009545 | Ga0105237_10011626 | Ga0105237_100116269 | 232 |
| 307 | 3300009545 | Ga0105237_10870849 | Ga0105237_108708492 | 232 |
| 308 | 3300009551 | Ga0105238_10013383 | Ga0105238_100133833 | 232 |
| 309 | 3300009551 | Ga0105238_10901567 | Ga0105238_109015671 | 232 |
| 310 | 3300009553 | Ga0105249_10189989 | Ga0105249_101899892 | 232 |
| 311 | 3300009553 | Ga0105249_10257187 | Ga0105249_102571872 | 232 |
| 312 | 3300010159 | Ga0099796_10005934 | Ga0099796_100059344 | 232 |
| 313 | 3300010375 | Ga0105239_10125179 | Ga0105239_101251791 | 232 |
| 314 | 3300010375 | Ga0105239_10547284 | Ga0105239_105472842 | 232 |
| 315 | 3300010375 | Ga0105239_10763716 | Ga0105239_107637162 | 232 |
| 316 | 3300011119 | Ga0105246_10011337 | Ga0105246_100113372 | 232 |
| 317 | 3300013105 | Ga0157369_10053866 | Ga0157369_100538663 | 232 |
| 318 | 3300013296 | Ga0157374_10165358 | Ga0157374_101653582 | 232 |
| 319 | 3300013306 | Ga0163162_10258025 | Ga0163162_102580252 | 232 |
| 320 | 3300013307 | Ga0157372_10140742 | Ga0157372_101407422 | 232 |
| 321 | 3300013308 | Ga0157375_10827678 | Ga0157375_108276782 | 232 |
| 322 | 3300014325 | Ga0163163_10030936 | Ga0163163_100309365 | 232 |
| 323 | 3300014325 | Ga0163163_10065889 | Ga0163163_100658893 | 232 |
| 324 | 3300014326 | Ga0157380_10055300 | Ga0157380_100553004 | 232 |
| 325 | 3300014969 | Ga0157376_10236788 | Ga0157376_102367882 | 232 |
| 326 | 3300017792 | Ga0163161_10002299 | Ga0163161_100022992 | 232 |
| 327 | 3300017792 | Ga0163161_10276177 | Ga0163161_102761772 | 232 |
| 328 | 3300020080 | Ga0206350_10194348 | Ga0206350_101943481 | 232 |
| 329 | 3300020082 | Ga0206353_11188210 | Ga0206353_111882102 | 232 |
| 330 | 3300021377 | Ga0213874_10063486 | Ga0213874_100634861 | 232 |
| 331 | 3300021384 | Ga0213876_10009405 | Ga0213876_100094053 | 232 |
| 332 | 3300021384 | Ga0213876_10069367 | Ga0213876_100693671 | 232 |
| 333 | 3300025230 | Ga0209563_105359 | Ga0209563_1053592 | 232 |
| 334 | 3300025254 | Ga0209148_1000335 | Ga0209148_100033571 | 232 |
| 335 | 3300025261 | Ga0209233_1021523 | Ga0209233_10215232 | 232 |
| 336 | 3300025272 | Ga0209455_1002543 | Ga0209455_100254310 | 232 |
| 337 | 3300025272 | Ga0209455_1018248 | Ga0209455_10182482 | 232 |
| 338 | 3300025295 | Ga0209564_1005823 | Ga0209564_10058236 | 232 |
| 339 | 3300025295 | Ga0209564_1009493 | Ga0209564_10094932 | 232 |
| 340 | 3300025297 | Ga0209758_1000106 | Ga0209758_100010658 | 232 |
| 341 | 3300025297 | Ga0209758_1000344 | Ga0209758_100034434 | 232 |
| 342 | 3300025297 | Ga0209758_1001326 | Ga0209758_100132620 | 232 |
| 343 | 3300025297 | Ga0209758_1009962 | Ga0209758_10099623 | 232 |
| 344 | 3300025297 | Ga0209758_1017145 | Ga0209758_10171453 | 232 |
| 345 | 3300025297 | Ga0209758_1056592 | Ga0209758_10565922 | 232 |
| 346 | 3300025299 | Ga0209256_1034875 | Ga0209256_10348751 | 232 |
| 347 | 3300025299 | Ga0209256_1038893 | Ga0209256_10388932 | 232 |
| 348 | 3300025302 | Ga0207426_1009980 | Ga0207426_10099803 | 232 |
| 349 | 3300025303 | Ga0209051_1033895 | Ga0209051_10338952 | 232 |
| 350 | 3300025304 | Ga0209257_1000819 | Ga0209257_100081929 | 232 |
| 351 | 3300025304 | Ga0209257_1044522 | Ga0209257_10445221 | 232 |
| 352 | 3300025315 | Ga0207697_10209518 | Ga0207697_102095181 | 232 |
| 353 | 3300025885 | Ga0207653_10084345 | Ga0207653_100843452 | 232 |
| 354 | 3300025893 | Ga0207682_10043964 | Ga0207682_100439642 | 232 |
| 355 | 3300025898 | Ga0207692_10015203 | Ga0207692_100152034 | 232 |
| 356 | 3300025901 | Ga0207688_10146939 | Ga0207688_101469391 | 232 |
| 357 | 3300025901 | Ga0207688_10150220 | Ga0207688_101502201 | 232 |
| 358 | 3300025904 | Ga0207647_10289090 | Ga0207647_102890901 | 232 |
| 359 | 3300025905 | Ga0207685_10029506 | Ga0207685_100295061 | 232 |
| 360 | 3300025906 | Ga0207699_10001790 | Ga0207699_100017905 | 232 |
| 361 | 3300025907 | Ga0207645_10031981 | Ga0207645_100319813 | 232 |
| 362 | 3300025907 | Ga0207645_10198471 | Ga0207645_101984712 | 232 |
| 363 | 3300025910 | Ga0207684_10279585 | Ga0207684_102795852 | 232 |
| 364 | 3300025912 | Ga0207707_10165205 | Ga0207707_101652051 | 232 |
| 365 | 3300025913 | Ga0207695_10000123 | Ga0207695_10000123180 | 232 |
| 366 | 3300025913 | Ga0207695_10156146 | Ga0207695_101561462 | 232 |
| 367 | 3300025913 | Ga0207695_10551270 | Ga0207695_105512701 | 232 |
| 368 | 3300025914 | Ga0207671_10041194 | Ga0207671_100411941 | 232 |
| 369 | 3300025915 | Ga0207693_10004353 | Ga0207693_1000435310 | 232 |
| 370 | 3300025915 | Ga0207693_10042871 | Ga0207693_100428712 | 232 |
| 371 | 3300025915 | Ga0207693_10132712 | Ga0207693_101327121 | 232 |
| 372 | 3300025915 | Ga0207693_10186073 | Ga0207693_101860732 | 232 |
| 373 | 3300025915 | Ga0207693_10361141 | Ga0207693_103611411 | 232 |
| 374 | 3300025916 | Ga0207663_10022584 | Ga0207663_100225843 | 232 |
| 375 | 3300025916 | Ga0207663_10305492 | Ga0207663_103054921 | 232 |
| 376 | 3300025918 | Ga0207662_10202663 | Ga0207662_102026632 | 232 |
| 377 | 3300025919 | Ga0207657_10030146 | Ga0207657_100301464 | 232 |
| 378 | 3300025921 | Ga0207652_10477417 | Ga0207652_104774172 | 232 |
| 379 | 3300025922 | Ga0207646_10181300 | Ga0207646_101813002 | 232 |
| 380 | 3300025922 | Ga0207646_10951818 | Ga0207646_109518181 | 232 |
| 381 | 3300025923 | Ga0207681_10397718 | Ga0207681_103977182 | 232 |
| 382 | 3300025925 | Ga0207650_10253003 | Ga0207650_102530032 | 232 |
| 383 | 3300025927 | Ga0207687_10008542 | Ga0207687_100085427 | 232 |
| 384 | 3300025927 | Ga0207687_10058231 | Ga0207687_100582312 | 232 |
| 385 | 3300025928 | Ga0207700_10016987 | Ga0207700_100169872 | 232 |
| 386 | 3300025928 | Ga0207700_10201366 | Ga0207700_102013662 | 232 |
| 387 | 3300025928 | Ga0207700_10416549 | Ga0207700_104165492 | 232 |
| 388 | 3300025928 | Ga0207700_10660271 | Ga0207700_106602711 | 232 |
| 389 | 3300025929 | Ga0207664_10214528 | Ga0207664_102145282 | 232 |
| 390 | 3300025929 | Ga0207664_10355056 | Ga0207664_103550562 | 232 |
| 391 | 3300025929 | Ga0207664_10406422 | Ga0207664_104064221 | 232 |
| 392 | 3300025929 | Ga0207664_10458158 | Ga0207664_104581582 | 232 |
| 393 | 3300025932 | Ga0207690_10102914 | Ga0207690_101029142 | 232 |
| 394 | 3300025933 | Ga0207706_10279321 | Ga0207706_102793212 | 232 |
| 395 | 3300025935 | Ga0207709_10068831 | Ga0207709_100688314 | 232 |
| 396 | 3300025937 | Ga0207669_10057902 | Ga0207669_100579021 | 232 |
| 397 | 3300025937 | Ga0207669_10059328 | Ga0207669_100593282 | 232 |
| 398 | 3300025937 | Ga0207669_10074082 | Ga0207669_100740822 | 232 |
| 399 | 3300025939 | Ga0207665_10041526 | Ga0207665_100415261 | 232 |
| 400 | 3300025939 | Ga0207665_10281321 | Ga0207665_102813212 | 232 |
| 401 | 3300025940 | Ga0207691_10126957 | Ga0207691_101269572 | 232 |
| 402 | 3300025941 | Ga0207711_10057836 | Ga0207711_100578364 | 232 |
| 403 | 3300025941 | Ga0207711_10063179 | Ga0207711_100631792 | 232 |
| 404 | 3300025942 | Ga0207689_10035445 | Ga0207689_100354455 | 232 |
| 405 | 3300025944 | Ga0207661_10002953 | Ga0207661_100029538 | 232 |
| 406 | 3300025944 | Ga0207661_10309168 | Ga0207661_103091682 | 232 |
| 407 | 3300025944 | Ga0207661_10399297 | Ga0207661_103992972 | 232 |
| 408 | 3300025945 | Ga0207679_10195604 | Ga0207679_101956041 | 232 |
| 409 | 3300025949 | Ga0207667_10105644 | Ga0207667_101056443 | 232 |
| 410 | 3300025949 | Ga0207667_10183972 | Ga0207667_101839723 | 232 |
| 411 | 3300025972 | Ga0207668_10022000 | Ga0207668_100220002 | 232 |
| 412 | 3300025972 | Ga0207668_10034680 | Ga0207668_100346806 | 232 |
| 413 | 3300025972 | Ga0207668_10101833 | Ga0207668_101018332 | 232 |
| 414 | 3300025972 | Ga0207668_10395182 | Ga0207668_103951822 | 232 |
| 415 | 3300025981 | Ga0207640_10213733 | Ga0207640_102137332 | 232 |
| 416 | 3300026023 | Ga0207677_10594685 | Ga0207677_105946852 | 232 |
| 417 | 3300026035 | Ga0207703_10215104 | Ga0207703_102151042 | 232 |
| 418 | 3300026035 | Ga0207703_10707198 | Ga0207703_107071982 | 232 |
| 419 | 3300026041 | Ga0207639_10041924 | Ga0207639_100419242 | 232 |
| 420 | 3300026041 | Ga0207639_10632708 | Ga0207639_106327081 | 232 |
| 421 | 3300026067 | Ga0207678_10014071 | Ga0207678_100140718 | 232 |
| 422 | 3300026067 | Ga0207678_10071921 | Ga0207678_100719213 | 232 |
| 423 | 3300026067 | Ga0207678_10116637 | Ga0207678_101166373 | 232 |
| 424 | 3300026067 | Ga0207678_10210686 | Ga0207678_102106862 | 232 |
| 425 | 3300026067 | Ga0207678_10346093 | Ga0207678_103460932 | 232 |
| 426 | 3300026078 | Ga0207702_10000014 | Ga0207702_10000014130 | 232 |
| 427 | 3300026078 | Ga0207702_10245405 | Ga0207702_102454052 | 232 |
| 428 | 3300026088 | Ga0207641_10676818 | Ga0207641_106768182 | 232 |
| 429 | 3300026095 | Ga0207676_11021605 | Ga0207676_110216051 | 232 |
| 430 | 3300026116 | Ga0207674_10072022 | Ga0207674_100720224 | 232 |
| 431 | 3300026116 | Ga0207674_10091426 | Ga0207674_100914262 | 232 |
| 432 | 3300026118 | Ga0207675_100131229 | Ga0207675_1001312292 | 232 |
| 433 | 3300026118 | Ga0207675_100279300 | Ga0207675_1002793002 | 232 |
| 434 | 3300026118 | Ga0207675_100290212 | Ga0207675_1002902122 | 232 |
| 435 | 3300026121 | Ga0207683_10010057 | Ga0207683_100100579 | 232 |
| 436 | 3300026121 | Ga0207683_10135865 | Ga0207683_101358651 | 232 |
| 437 | 3300026121 | Ga0207683_10260461 | Ga0207683_102604612 | 232 |
| 438 | 3300026142 | Ga0207698_10170153 | Ga0207698_101701531 | 232 |
| 439 | 3300026142 | Ga0207698_10368307 | Ga0207698_103683072 | 232 |
| 440 | 3300027296 | Ga0209389_1000016 | Ga0209389_1000016152 | 232 |
| 441 | 3300027296 | Ga0209389_1000027 | Ga0209389_10000279 | 232 |
| 442 | 3300027357 | Ga0209589_1000031 | Ga0209589_100003121 | 232 |
| 443 | 3300027361 | Ga0209489_100057 | Ga0209489_100057126 | 232 |
| 444 | 3300027361 | Ga0209489_100063 | Ga0209489_100063110 | 232 |
| 445 | 3300027363 | Ga0209700_100012 | Ga0209700_100012153 | 232 |
| 446 | 3300027907 | Ga0207428_10061061 | Ga0207428_100610612 | 232 |
| 447 | 3300028379 | Ga0268266_10003152 | Ga0268266_1000315214 | 232 |
| 448 | 3300028379 | Ga0268266_10003898 | Ga0268266_1000389813 | 232 |
| 449 | 3300028379 | Ga0268266_10116461 | Ga0268266_101164612 | 232 |
| 450 | 3300028380 | Ga0268265_10103699 | Ga0268265_101036992 | 232 |
| 451 | 3300028380 | Ga0268265_10173890 | Ga0268265_101738901 | 232 |
| 452 | 3300028380 | Ga0268265_10325869 | Ga0268265_103258692 | 232 |
| 453 | 3300028380 | Ga0268265_11212369 | Ga0268265_112123691 | 232 |
| 454 | 3300028381 | Ga0268264_10000042 | Ga0268264_10000042189 | 232 |
| 455 | 3300028381 | Ga0268264_10186255 | Ga0268264_101862552 | 232 |
| 456 | 3300028381 | Ga0268264_10252105 | Ga0268264_102521052 | 232 |
| 457 | 3300028786 | Ga0307517_10000176 | Ga0307517_1000017699 | 232 |
| 458 | 3300030522 | Ga0307512_10201851 | Ga0307512_102018512 | 232 |
| 459 | 3300030863 | Ga0265766_1003936 | Ga0265766_10039361 | 232 |
| 460 | 3300031238 | Ga0265332_10024877 | Ga0265332_100248772 | 232 |
| 461 | 3300031238 | Ga0265332_10094353 | Ga0265332_100943532 | 232 |
| 462 | 3300031239 | Ga0265328_10067062 | Ga0265328_100670622 | 232 |
| 463 | 3300031239 | Ga0265328_10155337 | Ga0265328_101553371 | 232 |
| 464 | 3300031247 | Ga0265340_10059768 | Ga0265340_100597681 | 232 |
| 465 | 3300031249 | Ga0265339_10001372 | Ga0265339_100013722 | 232 |
| 466 | 3300031249 | Ga0265339_10033300 | Ga0265339_100333003 | 232 |
| 467 | 3300031249 | Ga0265339_10048940 | Ga0265339_100489402 | 232 |
| 468 | 3300031250 | Ga0265331_10210947 | Ga0265331_102109471 | 232 |
| 469 | 3300031250 | Ga0265331_10247064 | Ga0265331_102470641 | 232 |
| 470 | 3300031507 | Ga0307509_10142209 | Ga0307509_101422092 | 232 |
| 471 | 3300031616 | Ga0307508_10062521 | Ga0307508_100625212 | 232 |
| 472 | 3300031711 | Ga0265314_10016415 | Ga0265314_100164155 | 232 |
| 473 | 3300031711 | Ga0265314_10050084 | Ga0265314_100500843 | 232 |
| 474 | 3300031712 | Ga0265342_10009595 | Ga0265342_100095957 | 232 |
| 475 | 3300031730 | Ga0307516_10020012 | Ga0307516_100200125 | 232 |
| 476 | 3300031730 | Ga0307516_10107016 | Ga0307516_101070163 | 232 |
| 477 | 3300031730 | Ga0307516_10112661 | Ga0307516_101126613 | 232 |
| 478 | 3300031911 | Ga0307412_10056255 | Ga0307412_100562553 | 232 |
| 479 | 3300031995 | Ga0307409_100101192 | Ga0307409_1001011922 | 232 |
| 480 | 3300031995 | Ga0307409_100585515 | Ga0307409_1005855152 | 232 |
| 481 | 3300032002 | Ga0307416_100440886 | Ga0307416_1004408862 | 232 |
| 482 | 3300032005 | Ga0307411_10259343 | Ga0307411_102593432 | 232 |
| 483 | 3300032126 | Ga0307415_100088088 | Ga0307415_1000880882 | 232 |
| 484 | 3300033180 | Ga0307510_10007730 | Ga0307510_1000773011 | 232 |
| 485 | 3300033180 | Ga0307510_10037836 | Ga0307510_100378365 | 232 |
| 486 | 3300033180 | Ga0307510_10187488 | Ga0307510_101874881 | 232 |
| 487 | 3300033180 | Ga0307510_10242427 | Ga0307510_102424272 | 232 |
| 488 | 3300033180 | Ga0307510_10326208 | Ga0307510_103262081 | 232 |
| 489 | 3300034818 | Ga0373950_0047760 | Ga0373950_0047760_47_745 | 232 |
| 490 | 3300035085 | Ga0373929_0037043 | Ga0373929_0037043_345_1043 | 232 |
| 491 | 3300035086 | Ga0373934_0002178 | Ga0373934_0002178_4590_5288 | 232 |
| 492 | 3300035111 | Ga0373923_0001946 | Ga0373923_0001946_4821_5519 | 232 |
| 493 | 3300035117 | Ga0373953_0001243 | Ga0373953_0001243_5169_5867 | 232 |
| 494 | 3300035118 | Ga0373954_0002355 | Ga0373954_0002355_3531_4229 | 232 |
| 495 | 3300035120 | Ga0373957_0000527 | Ga0373957_0000527_8022_8720 | 232 |
| 496 | 3300035172 | Ga0373955_0000535 | Ga0373955_0000535_14506_15204 | 232 |
| 497 | 3300035207 | Ga0373942_0020097 | Ga0373942_0020097_225_923 | 232 |
| 498 | 3300035410 | Ga0373924_0004005 | Ga0373924_0004005_2982_3680 | 232 |
| 499 | 3300035691 | Ga0373931_0014148 | Ga0373931_0014148_3071_3769 | 232 |
| 500 | 3300035692 | Ga0373935_0023018 | Ga0373935_0023018_1158_1856 | 232 |
| 501 | 3300035695 | Ga0373927_0012684 | Ga0373927_0012684_3784_4482 | 232 |
| 502 | 3300035724 | Ga0373933_0002165 | Ga0373933_0002165_7001_7699 | 232 |
| 503 | 3300035725 | Ga0373947_0066854 | Ga0373947_0066854_1396_2094 | 232 |
| 504 | 3300036242 | Ga0310104_11013 | Ga0310104_11013_11_709 | 232 |
| 505 | 3300036401 | Ga0373937_0033007 | Ga0373937_0033007_2108_2806 | 232 |
| 506 | 3300036401 | Ga0373937_0184350 | Ga0373937_0184350_549_1247 | 232 |
| 507 | 3300036401 | Ga0373937_0236682 | Ga0373937_0236682_766_1464 | 232 |
| 508 | 3300036534 | Ga0310109_001672 | Ga0310109_001672_836_1534 | 232 |
| 509 | 3300037068 | Ga0373925_0219459 | Ga0373925_0219459_387_1085 | 232 |
| 510 | 3300037312 | Ga0395899_0066265 | Ga0395899_0066265_693_1391 | 232 |
| 511 | 3300037312 | Ga0395899_0088186 | Ga0395899_0088186_516_1229 | 232 |
| 512 | 3300037418 | Ga0395900_0001282 | Ga0395900_0001282_22141_22839 | 232 |
| 513 | 3300037418 | Ga0395900_0219351 | Ga0395900_0219351_23_721 | 232 |
| 514 | 3300037466 | Ga0395898_0037345 | Ga0395898_0037345_569_1267 | 232 |
| 515 | 3300037466 | Ga0395898_0048844 | Ga0395898_0048844_2442_3140 | 232 |
| 516 | 3300037471 | Ga0395905_0004232 | Ga0395905_0004232_13155_13853 | 232 |
| 517 | 3300037471 | Ga0395905_0534219 | Ga0395905_0534219_53_751 | 232 |
| 518 | 3300037471 | Ga0395905_0904549 | Ga0395905_0904549_72_770 | 232 |
| 519 | 3300037853 | Ga0436364_0641210 | Ga0436364_0641210_290_988 | 232 |
| 520 | 3300037853 | Ga0436364_0800356 | Ga0436364_0800356_198_896 | 232 |
| 521 | 3300038443 | Ga0395901_0006277 | Ga0395901_0006277_4439_5137 | 232 |
| 522 | 3300038443 | Ga0395901_0227382 | Ga0395901_0227382_1014_1727 | 232 |
| 523 | 3300039437 | Ga0436365_0119504 | Ga0436365_0119504_593_1393 | 232 |
| 524 | 3300039437 | Ga0436365_0279031 | Ga0436365_0279031_219_917 | 232 |
| 525 | 3300039437 | Ga0436365_0838143 | Ga0436365_0838143_1872_2570 | 232 |
| 526 | 3300039437 | Ga0436365_1138701 | Ga0436365_1138701_25611_26309 | 232 |
| 527 | 3300039447 | Ga0436361_0334533 | Ga0436361_0334533_260_958 | 232 |
| 528 | 3300039447 | Ga0436361_0849478 | Ga0436361_0849478_1700_2398 | 232 |
| 529 | 3300039450 | Ga0436363_0830766 | Ga0436363_0830766_1152_1850 | 232 |
| 530 | 3300039453 | Ga0436362_0546910 | Ga0436362_0546910_321_1019 | 232 |
| 531 | 3300039453 | Ga0436362_0740954 | Ga0436362_0740954_47_745 | 232 |
| 532 | 3300041413 | Ga0439465_0114781 | Ga0439465_0114781_45_743 | 232 |
| 533 | 3300041443 | Ga0451789_0163036 | Ga0451789_0163036_223_921 | 232 |
| 534 | 3300044658 | Ga0466972_0000179 | Ga0466972_0000179_38418_39116 | 232 |
| 535 | 3300044658 | Ga0466972_0000516 | Ga0466972_0000516_4355_5053 | 232 |
| 536 | 3300044658 | Ga0466972_0085873 | Ga0466972_0085873_548_1246 | 232 |
| 537 | 3300044683 | Ga0466965_0072218 | Ga0466965_0072218_10_708 | 232 |
| 538 | 3300044694 | Ga0466963_0038559 | Ga0466963_0038559_2381_3079 | 232 |
| 539 | 3300044694 | Ga0466963_0080254 | Ga0466963_0080254_472_1170 | 232 |
| 540 | 3300044706 | Ga0466964_0014197 | Ga0466964_0014197_1274_1981 | 232 |
| 541 | 3300044735 | Ga0466968_0008321 | Ga0466968_0008321_3028_3726 | 232 |
| 542 | 3300044842 | Ga0466957_0071003 | Ga0466957_0071003_387_1085 | 232 |
| 543 | 3300044842 | Ga0466957_0261651 | Ga0466957_0261651_426_1124 | 232 |
| 544 | 3300044901 | Ga0466960_0052697 | Ga0466960_0052697_1060_1758 | 232 |
| 545 | 3300045836 | Ga0466958_0140344 | Ga0466958_0140344_740_1438 | 232 |
| 546 | 3300045976 | Ga0466967_0459294 | Ga0466967_0459294_140_838 | 232 |
| 547 | 3300045976 | Ga0466967_0564918 | Ga0466967_0564918_356_1054 | 232 |
| 548 | 3300046452 | Ga0495617_006222 | Ga0495617_006222_414_1160 | 232 |
| 549 | 3300046452 | Ga0495617_059017 | Ga0495617_059017_134_832 | 232 |
| 550 | 3300046454 | Ga0495592_0021832 | Ga0495592_0021832_1141_1839 | 232 |
| 551 | 3300046454 | Ga0495592_0085595 | Ga0495592_0085595_323_1021 | 232 |
| 552 | 3300046454 | Ga0495592_0268273 | Ga0495592_0268273_55_753 | 232 |
| 553 | 3300046455 | Ga0495603_0046487 | Ga0495603_0046487_1499_2197 | 232 |
| 554 | 3300046455 | Ga0495603_0079540 | Ga0495603_0079540_145_891 | 232 |
| 555 | 3300046455 | Ga0495603_0156284 | Ga0495603_0156284_25_771 | 232 |
| 556 | 3300046459 | Ga0495629_0001841 | Ga0495629_0001841_5967_6665 | 232 |
| 557 | 3300046459 | Ga0495629_0132485 | Ga0495629_0132485_883_1629 | 232 |
| 558 | 3300046459 | Ga0495629_0195513 | Ga0495629_0195513_439_1137 | 232 |
| 559 | 3300046460 | Ga0495638_0001078 | Ga0495638_0001078_12639_13337 | 232 |
| 560 | 3300046460 | Ga0495638_0011310 | Ga0495638_0011310_1588_2286 | 232 |
| 561 | 3300046460 | Ga0495638_0235426 | Ga0495638_0235426_46_744 | 232 |
| 562 | 3300046461 | Ga0495641_0220237 | Ga0495641_0220237_130_828 | 232 |
| 563 | 3300046462 | Ga0495651_0001119 | Ga0495651_0001119_19425_20123 | 232 |
| 564 | 3300046462 | Ga0495651_0046362 | Ga0495651_0046362_937_1635 | 232 |
| 565 | 3300046462 | Ga0495651_0167779 | Ga0495651_0167779_292_990 | 232 |
| 566 | 3300046463 | Ga0495653_0050502 | Ga0495653_0050502_87_785 | 232 |
| 567 | 3300046471 | Ga0495650_0030020 | Ga0495650_0030020_1344_2042 | 232 |
| 568 | 3300046473 | Ga0495582_0310421 | Ga0495582_0310421_72_770 | 232 |
| 569 | 3300046474 | Ga0495605_0070755 | Ga0495605_0070755_861_1559 | 232 |
| 570 | 3300046475 | Ga0495639_0272068 | Ga0495639_0272068_115_813 | 232 |
| 571 | 3300046477 | Ga0495664_0003810 | Ga0495664_0003810_4764_5462 | 232 |
| 572 | 3300046491 | Ga0495584_0061495 | Ga0495584_0061495_838_1536 | 232 |
| 573 | 3300046491 | Ga0495584_0237281 | Ga0495584_0237281_20_718 | 232 |
| 574 | 3300046492 | Ga0495585_0200282 | Ga0495585_0200282_18_716 | 232 |
| 575 | 3300046499 | Ga0495594_0089576 | Ga0495594_0089576_290_1036 | 232 |
| 576 | 3300046499 | Ga0495594_0163685 | Ga0495594_0163685_20_769 | 232 |
| 577 | 3300046500 | Ga0495596_0028449 | Ga0495596_0028449_1332_2078 | 232 |
| 578 | 3300046500 | Ga0495596_0136340 | Ga0495596_0136340_227_925 | 232 |
| 579 | 3300046506 | Ga0495583_0069764 | Ga0495583_0069764_775_1473 | 232 |
| 580 | 3300046507 | Ga0495606_0000357 | Ga0495606_0000357_42039_42737 | 232 |
| 581 | 3300046507 | Ga0495606_0089364 | Ga0495606_0089364_753_1451 | 232 |
| 582 | 3300046507 | Ga0495606_0236277 | Ga0495606_0236277_260_958 | 232 |
| 583 | 3300046515 | Ga0495620_0016755 | Ga0495620_0016755_1979_2677 | 232 |
| 584 | 3300046515 | Ga0495620_0062706 | Ga0495620_0062706_46_792 | 232 |
| 585 | 3300046515 | Ga0495620_0079786 | Ga0495620_0079786_525_1271 | 232 |
| 586 | 3300046516 | Ga0495628_0073716 | Ga0495628_0073716_861_1559 | 232 |
| 587 | 3300046516 | Ga0495628_0161204 | Ga0495628_0161204_408_1106 | 232 |
| 588 | 3300046516 | Ga0495628_0391214 | Ga0495628_0391214_246_944 | 232 |
| 589 | 3300046518 | Ga0495631_0032716 | Ga0495631_0032716_852_1550 | 232 |
| 590 | 3300046519 | Ga0495632_0061929 | Ga0495632_0061929_125_871 | 232 |
| 591 | 3300046519 | Ga0495632_0137761 | Ga0495632_0137761_352_1098 | 232 |
| 592 | 3300046522 | Ga0495643_0252041 | Ga0495643_0252041_67_765 | 232 |
| 593 | 3300046524 | Ga0495648_0000649 | Ga0495648_0000649_15734_16432 | 232 |
| 594 | 3300046524 | Ga0495648_0001411 | Ga0495648_0001411_7202_7981 | 232 |
| 595 | 3300046524 | Ga0495648_0006902 | Ga0495648_0006902_3301_3999 | 232 |
| 596 | 3300046524 | Ga0495648_0103070 | Ga0495648_0103070_163_861 | 232 |
| 597 | 3300046524 | Ga0495648_0122851 | Ga0495648_0122851_382_1080 | 232 |
| 598 | 3300046524 | Ga0495648_0204434 | Ga0495648_0204434_271_969 | 232 |
| 599 | 3300046529 | Ga0495652_0011196 | Ga0495652_0011196_1776_2474 | 232 |
| 600 | 3300046529 | Ga0495652_0016077 | Ga0495652_0016077_2873_3571 | 232 |
| 601 | 3300046530 | Ga0495654_0094692 | Ga0495654_0094692_386_1084 | 232 |
| 602 | 3300046536 | Ga0495587_0037215 | Ga0495587_0037215_1979_2677 | 232 |
| 603 | 3300046536 | Ga0495587_0093185 | Ga0495587_0093185_894_1592 | 232 |
| 604 | 3300046537 | Ga0495598_0139471 | Ga0495598_0139471_115_813 | 232 |
| 605 | 3300046539 | Ga0495621_0041833 | Ga0495621_0041833_756_1547 | 232 |
| 606 | 3300046539 | Ga0495621_0126418 | Ga0495621_0126418_194_892 | 232 |
| 607 | 3300046542 | Ga0495597_0085789 | Ga0495597_0085789_236_934 | 232 |
| 608 | 3300046557 | Ga0495622_0018451 | Ga0495622_0018451_2229_2927 | 232 |
| 609 | 3300046557 | Ga0495622_0080083 | Ga0495622_0080083_310_1056 | 232 |
| 610 | 3300046557 | Ga0495622_0082546 | Ga0495622_0082546_500_1198 | 232 |
| 611 | 3300046615 | Ga0495656_0003804 | Ga0495656_0003804_2496_3194 | 232 |
| 612 | 3300046615 | Ga0495656_0050337 | Ga0495656_0050337_216_914 | 232 |
| 613 | 3300046615 | Ga0495656_0066365 | Ga0495656_0066365_280_1026 | 232 |
| 614 | 3300046616 | Ga0495668_0073504 | Ga0495668_0073504_974_1720 | 232 |
| 615 | 3300046642 | Ga0495634_0009918 | Ga0495634_0009918_3295_3993 | 232 |
| 616 | 3300046642 | Ga0495634_0040892 | Ga0495634_0040892_2303_3001 | 232 |
| 617 | 3300046648 | Ga0495611_0133936 | Ga0495611_0133936_19_810 | 232 |
| 618 | 3300046648 | Ga0495611_0170118 | Ga0495611_0170118_58_756 | 232 |
| 619 | 3300046660 | Ga0495625_0076145 | Ga0495625_0076145_1065_1811 | 232 |
| 620 | 3300046660 | Ga0495625_0196316 | Ga0495625_0196316_372_1070 | 232 |
| 621 | 3300046663 | Ga0495635_0002477 | Ga0495635_0002477_8366_9064 | 232 |
| 622 | 3300046663 | Ga0495635_0063953 | Ga0495635_0063953_148_846 | 232 |
| 623 | 3300046665 | Ga0495661_0130267 | Ga0495661_0130267_17_808 | 232 |
| 624 | 3300046665 | Ga0495661_0234929 | Ga0495661_0234929_65_763 | 232 |
| 625 | 3300046674 | Ga0495588_0010104 | Ga0495588_0010104_2612_3310 | 232 |
| 626 | 3300046674 | Ga0495588_0022019 | Ga0495588_0022019_455_1246 | 232 |
| 627 | 3300046675 | Ga0495657_0039033 | Ga0495657_0039033_1031_1729 | 232 |
| 628 | 3300046679 | Ga0495623_0002992 | Ga0495623_0002992_7239_7937 | 232 |
| 629 | 3300046679 | Ga0495623_0010731 | Ga0495623_0010731_2110_2808 | 232 |
| 630 | 3300046679 | Ga0495623_0203330 | Ga0495623_0203330_378_1076 | 232 |
| 631 | 3300046680 | Ga0495646_0087280 | Ga0495646_0087280_160_858 | 232 |
| 632 | 3300046680 | Ga0495646_0229868 | Ga0495646_0229868_235_933 | 232 |
| 633 | 3300046684 | Ga0495669_0062815 | Ga0495669_0062815_442_1140 | 232 |
| 634 | 3300046689 | Ga0495613_0033023 | Ga0495613_0033023_42_740 | 232 |
| 635 | 3300046692 | Ga0495671_0232995 | Ga0495671_0232995_86_841 | 232 |
| 636 | 3300046694 | Ga0495649_0287298 | Ga0495649_0287298_25_723 | 232 |
| 637 | 3300046809 | Ga0495600_0008391 | Ga0495600_0008391_5552_6250 | 232 |
| 638 | 3300047317 | Ga0495604_0024142 | Ga0495604_0024142_1032_1730 | 232 |
| 639 | 3300047319 | Ga0495674_0012072 | Ga0495674_0012072_1057_1755 | 232 |
| 640 | 3300047319 | Ga0495674_0065589 | Ga0495674_0065589_2009_2707 | 232 |
| 641 | 3300047319 | Ga0495674_0111894 | Ga0495674_0111894_1327_2121 | 232 |
| 642 | 3300047319 | Ga0495674_0407610 | Ga0495674_0407610_247_945 | 232 |
| 643 | 3300047320 | Ga0495672_0003965 | Ga0495672_0003965_9675_10373 | 232 |
| 644 | 3300047321 | Ga0495676_0055040 | Ga0495676_0055040_608_1399 | 232 |
| 645 | 3300047321 | Ga0495676_0107620 | Ga0495676_0107620_829_1527 | 232 |
| 646 | 3300047322 | Ga0495680_0001426 | Ga0495680_0001426_17976_18674 | 232 |
| 647 | 3300047322 | Ga0495680_0012571 | Ga0495680_0012571_683_1381 | 232 |
| 648 | 3300047444 | Ga0495675_0032501 | Ga0495675_0032501_383_1081 | 232 |
| 649 | 3300047444 | Ga0495675_0298645 | Ga0495675_0298645_183_881 | 232 |
| 650 | 3300047469 | Ga0495673_0064649 | Ga0495673_0064649_430_1128 | 232 |
| 651 | 3300047471 | Ga0495684_0001145 | Ga0495684_0001145_15746_16444 | 232 |
| 652 | 3300047471 | Ga0495684_0045526 | Ga0495684_0045526_1777_2475 | 232 |
| 653 | 3300047472 | Ga0495686_0049064 | Ga0495686_0049064_1270_1968 | 232 |
| 654 | 3300047472 | Ga0495686_0066337 | Ga0495686_0066337_1106_1804 | 232 |
| 655 | 3300047472 | Ga0495686_0115920 | Ga0495686_0115920_774_1472 | 232 |
| 656 | 3300047472 | Ga0495686_0121289 | Ga0495686_0121289_115_813 | 232 |
| 657 | 3300047472 | Ga0495686_0178291 | Ga0495686_0178291_424_1122 | 232 |
| 658 | 3300047472 | Ga0495686_0225781 | Ga0495686_0225781_229_975 | 232 |
| 659 | 3300047472 | Ga0495686_0355551 | Ga0495686_0355551_58_756 | 232 |
| 660 | 3300047673 | Ga0495593_0000526 | Ga0495593_0000526_15329_16027 | 232 |
| 661 | 3300048088 | Ga0495602_0007749 | Ga0495602_0007749_6345_7043 | 232 |
| 662 | 3300048088 | Ga0495602_0009427 | Ga0495602_0009427_8201_8899 | 232 |
| 663 | 3300048091 | Ga0495626_0041435 | Ga0495626_0041435_605_1303 | 232 |
| 664 | 3300048903 | Ga0496100_0744548 | Ga0496100_0744548_30_728 | 232 |
| 665 | 3300048904 | Ga0496101_0276206 | Ga0496101_0276206_168_866 | 232 |
| 666 | 3300048904 | Ga0496101_0578241 | Ga0496101_0578241_147_845 | 232 |
| 667 | 3300048905 | Ga0496102_0201668 | Ga0496102_0201668_186_884 | 232 |
| 668 | 3300048905 | Ga0496102_0299368 | Ga0496102_0299368_642_1340 | 232 |
| 669 | 3300048906 | Ga0496103_0228109 | Ga0496103_0228109_209_907 | 232 |
| 670 | 3300048906 | Ga0496103_0447461 | Ga0496103_0447461_35_733 | 232 |
| 671 | 3300048908 | Ga0496105_0021342 | Ga0496105_0021342_586_1284 | 232 |
| 672 | 3300048909 | Ga0496106_0057184 | Ga0496106_0057184_885_1583 | 232 |
| 673 | 3300048909 | Ga0496106_0262067 | Ga0496106_0262067_420_1118 | 232 |
| 674 | 3300048909 | Ga0496106_0331802 | Ga0496106_0331802_125_823 | 232 |
| 675 | 3300048910 | Ga0496107_0073000 | Ga0496107_0073000_671_1369 | 232 |
| 676 | 3300048910 | Ga0496107_0481273 | Ga0496107_0481273_173_871 | 232 |
| 677 | 3300048911 | Ga0496108_0138636 | Ga0496108_0138636_1060_1758 | 232 |
| 678 | 3300048911 | Ga0496108_0280518 | Ga0496108_0280518_155_853 | 232 |
| 679 | 3300048913 | Ga0496110_0019461 | Ga0496110_0019461_4039_4737 | 232 |
| 680 | 3300048913 | Ga0496110_0064838 | Ga0496110_0064838_482_1228 | 232 |
| 681 | 3300048913 | Ga0496110_0392551 | Ga0496110_0392551_455_1153 | 232 |
| 682 | 3300048913 | Ga0496110_0685768 | Ga0496110_0685768_207_905 | 232 |
| 683 | 3300048913 | Ga0496110_1021236 | Ga0496110_1021236_25_723 | 232 |
| 684 | 3300048914 | Ga0496111_0216554 | Ga0496111_0216554_375_1073 | 232 |
| 685 | 3300048914 | Ga0496111_0254823 | Ga0496111_0254823_533_1231 | 232 |
| 686 | 3300048915 | Ga0496112_0112393 | Ga0496112_0112393_1327_2025 | 232 |
| 687 | 3300048915 | Ga0496112_0163495 | Ga0496112_0163495_393_1175 | 232 |
| 688 | 3300048915 | Ga0496112_0228310 | Ga0496112_0228310_615_1313 | 232 |
| 689 | 3300048915 | Ga0496112_0831861 | Ga0496112_0831861_65_763 | 232 |
| 690 | 3300048916 | Ga0496113_0035965 | Ga0496113_0035965_2897_3595 | 232 |
| 691 | 3300048916 | Ga0496113_0059803 | Ga0496113_0059803_284_982 | 232 |
| 692 | 3300048917 | Ga0496114_0237114 | Ga0496114_0237114_858_1556 | 232 |
| 693 | 3300048917 | Ga0496114_0580249 | Ga0496114_0580249_278_976 | 232 |
| 694 | 3300048918 | Ga0496115_0048409 | Ga0496115_0048409_1934_2632 | 232 |
| 695 | 3300048918 | Ga0496115_0199628 | Ga0496115_0199628_832_1530 | 232 |
| 696 | 3300048918 | Ga0496115_0220474 | Ga0496115_0220474_101_799 | 232 |
| 697 | 3300048918 | Ga0496115_0264144 | Ga0496115_0264144_250_948 | 232 |
| 698 | 3300048918 | Ga0496115_0316810 | Ga0496115_0316810_327_1025 | 232 |
| 699 | 3300048919 | Ga0496116_0001611 | Ga0496116_0001611_2898_3638 | 232 |
| 700 | 3300048920 | Ga0496117_0013012 | Ga0496117_0013012_3895_4635 | 232 |
| 701 | 3300048920 | Ga0496117_0103192 | Ga0496117_0103192_580_1278 | 232 |
| 702 | 3300048921 | Ga0496118_0024435 | Ga0496118_0024435_900_1598 | 232 |
| 703 | 3300048921 | Ga0496118_0025336 | Ga0496118_0025336_3181_3879 | 232 |
| 704 | 3300048921 | Ga0496118_0025358 | Ga0496118_0025358_920_1660 | 232 |
| 705 | 3300048921 | Ga0496118_0118021 | Ga0496118_0118021_46_744 | 232 |
| 706 | 3300048921 | Ga0496118_0194671 | Ga0496118_0194671_96_794 | 232 |
| 707 | 3300048921 | Ga0496118_0278507 | Ga0496118_0278507_87_785 | 232 |
| 708 | 3300048921 | Ga0496118_0319732 | Ga0496118_0319732_52_750 | 232 |
| 709 | 3300048922 | Ga0496119_0076813 | Ga0496119_0076813_807_1505 | 232 |
| 710 | 3300048922 | Ga0496119_0131793 | Ga0496119_0131793_276_974 | 232 |
| 711 | 3300048923 | Ga0496120_0079676 | Ga0496120_0079676_76_774 | 232 |
| 712 | 3300048923 | Ga0496120_0250569 | Ga0496120_0250569_76_774 | 232 |
| 713 | 3300048924 | Ga0496121_0000753 | Ga0496121_0000753_4879_5577 | 232 |
| 714 | 3300048924 | Ga0496121_0028031 | Ga0496121_0028031_1166_1864 | 232 |
| 715 | 3300048924 | Ga0496121_0030771 | Ga0496121_0030771_532_1230 | 232 |
| 716 | 3300048924 | Ga0496121_0035853 | Ga0496121_0035853_3498_4196 | 232 |
| 717 | 3300048924 | Ga0496121_0045179 | Ga0496121_0045179_2501_3208 | 232 |
| 718 | 3300048924 | Ga0496121_0057369 | Ga0496121_0057369_1705_2403 | 232 |
| 719 | 3300048924 | Ga0496121_0204063 | Ga0496121_0204063_252_950 | 232 |
| 720 | 3300048924 | Ga0496121_0236320 | Ga0496121_0236320_111_809 | 232 |
| 721 | 3300048924 | Ga0496121_0439637 | Ga0496121_0439637_128_826 | 232 |
| 722 | 3300048925 | Ga0496122_0049475 | Ga0496122_0049475_536_1276 | 232 |
| 723 | 3300048926 | Ga0496123_0068547 | Ga0496123_0068547_557_1255 | 232 |
| 724 | 3300048927 | Ga0496124_0025489 | Ga0496124_0025489_292_990 | 232 |
| 725 | 3300048927 | Ga0496124_0124166 | Ga0496124_0124166_60_758 | 232 |
| 726 | 3300048927 | Ga0496124_0319628 | Ga0496124_0319628_109_867 | 232 |
| 727 | 3300048928 | Ga0496125_0001860 | Ga0496125_0001860_26751_27449 | 232 |
| 728 | 3300048928 | Ga0496125_0002962 | Ga0496125_0002962_7115_7813 | 232 |
| 729 | 3300048928 | Ga0496125_0004213 | Ga0496125_0004213_15702_16400 | 232 |
| 730 | 3300048928 | Ga0496125_0047595 | Ga0496125_0047595_99_839 | 232 |
| 731 | 3300048928 | Ga0496125_0227797 | Ga0496125_0227797_379_1077 | 232 |
| 732 | 3300048929 | Ga0496126_0012065 | Ga0496126_0012065_1219_1917 | 232 |
| 733 | 3300048929 | Ga0496126_0047881 | Ga0496126_0047881_2230_2928 | 232 |
| 734 | 3300048929 | Ga0496126_0054808 | Ga0496126_0054808_1054_1752 | 232 |
| 735 | 3300048929 | Ga0496126_0094761 | Ga0496126_0094761_56_754 | 232 |
| 736 | 3300048929 | Ga0496126_0109600 | Ga0496126_0109600_550_1248 | 232 |
| 737 | 3300048929 | Ga0496126_0215062 | Ga0496126_0215062_436_1134 | 232 |
| 738 | 3300048929 | Ga0496126_0244805 | Ga0496126_0244805_396_1094 | 232 |
| 739 | 3300049460 | Ga0495682_0015377 | Ga0495682_0015377_492_1190 | 232 |
| 740 | 3300049460 | Ga0495682_0033863 | Ga0495682_0033863_382_1080 | 232 |
| 741 | 3300049531 | Ga0501315_019595 | Ga0501315_019595_10_708 | 232 |
| 742 | 3300049571 | Ga0501034_0290711 | Ga0501034_0290711_573_1271 | 232 |
| 743 | 3300049571 | Ga0501034_0493805 | Ga0501034_0493805_374_1072 | 232 |
| 744 | 3300049575 | Ga0501039_0306765 | Ga0501039_0306765_506_1207 | 232 |
| 745 | 3300049575 | Ga0501039_0360235 | Ga0501039_0360235_417_1115 | 232 |
| 746 | 3300049579 | Ga0501043_0579757 | Ga0501043_0579757_11_712 | 232 |
| 747 | 3300049580 | Ga0501046_0035855 | Ga0501046_0035855_2039_2740 | 232 |
| 748 | 3300049581 | Ga0501047_0406704 | Ga0501047_0406704_91_789 | 232 |
| 749 | 3300049582 | Ga0501048_0224413 | Ga0501048_0224413_547_1245 | 232 |
| 750 | 3300049584 | Ga0501068_0163553 | Ga0501068_0163553_525_1223 | 232 |
| 751 | 3300049589 | Ga0501073_0233250 | Ga0501073_0233250_354_1052 | 232 |
| 752 | 3300049592 | Ga0501076_0317412 | Ga0501076_0317412_545_1243 | 232 |
| 753 | 3300049743 | Ga0501081_0092718 | Ga0501081_0092718_592_1290 | 232 |
| 754 | 3300049822 | Ga0501035_0170187 | Ga0501035_0170187_401_1114 | 232 |
| 755 | 3300049822 | Ga0501035_0170606 | Ga0501035_0170606_1142_1840 | 232 |
| 756 | 3300049822 | Ga0501035_0316879 | Ga0501035_0316879_574_1272 | 232 |
| 757 | 3300049824 | Ga0501045_0131473 | Ga0501045_0131473_510_1208 | 232 |
| 758 | 3300050489 | nmdc:mga03683_83933_c1 | nmdc:mga03683_83933_c1_504_1202 | 232 |
| 759 | 3300050490 | nmdc:mga03n38_448_c1 | nmdc:mga03n38_448_c1_7279_7977 | 232 |
| 760 | 3300050492 | nmdc:mga0yw44_179531_c1 | nmdc:mga0yw44_179531_c1_438_1136 | 232 |
| 761 | 3300050492 | nmdc:mga0yw44_19940_c1 | nmdc:mga0yw44_19940_c1_627_1325 | 232 |
| 762 | 3300050492 | nmdc:mga0yw44_81744_c1 | nmdc:mga0yw44_81744_c1_417_1157 | 232 |
| 763 | 3300050492 | nmdc:mga0yw44_9263_c1 | nmdc:mga0yw44_9263_c1_764_1462 | 232 |
| 764 | 3300050492 | nmdc:mga0yw44_98500_c1 | nmdc:mga0yw44_98500_c1_810_1508 | 232 |
| 765 | 3300050494 | nmdc:mga06z11_28144_c1 | nmdc:mga06z11_28144_c1_967_1716 | 232 |
| 766 | 3300050496 | nmdc:mga07m45_17174_c1 | nmdc:mga07m45_17174_c1_970_1668 | 232 |
| 767 | 3300050507 | nmdc:mga05p37_755549_c1 | nmdc:mga05p37_755549_c1_248_946 | 232 |
| 768 | 3300050508 | nmdc:mga09592_55761_c1 | nmdc:mga09592_55761_c1_1577_2275 | 232 |
| 769 | 3300050509 | nmdc:mga0qj67_57292_c1 | nmdc:mga0qj67_57292_c1_503_1201 | 232 |
| 770 | 3300050511 | nmdc:mga08y16_152915_c1 | nmdc:mga08y16_152915_c1_406_1104 | 232 |
| 771 | 3300050516 | nmdc:mga0sz30_42624_c1 | nmdc:mga0sz30_42624_c1_684_1424 | 232 |
| 772 | 3300050516 | nmdc:mga0sz30_61380_c1 | nmdc:mga0sz30_61380_c1_164_862 | 232 |
| 773 | 3300053080 | Ga0500635_0081216 | Ga0500635_0081216_53_751 | 232 |
| 774 | 3300053083 | Ga0495655_0006964 | Ga0495655_0006964_802_1500 | 232 |
| 775 | 3300053083 | Ga0495655_0012784 | Ga0495655_0012784_978_1676 | 232 |
| 776 | 3300053084 | Ga0495595_0001351 | Ga0495595_0001351_910_1608 | 232 |
| 777 | 3300053084 | Ga0495595_0009072 | Ga0495595_0009072_2109_2807 | 232 |
| 778 | 3300053085 | Ga0495619_0001695 | Ga0495619_0001695_6099_6797 | 232 |
| 779 | 3300053085 | Ga0495619_0063683 | Ga0495619_0063683_730_1428 | 232 |
| 780 | 3300053085 | Ga0495619_0298751 | Ga0495619_0298751_393_1091 | 232 |
| 781 | 3300053086 | Ga0500578_0073181 | Ga0500578_0073181_12_710 | 232 |
| 782 | 3300053087 | Ga0500643_000180 | Ga0500643_000180_33118_33816 | 232 |
| 783 | 3300053093 | Ga0500651_0005715 | Ga0500651_0005715_2082_2780 | 232 |
| 784 | 3300053093 | Ga0500651_0021885 | Ga0500651_0021885_1220_1918 | 232 |
| 785 | 3300053094 | Ga0500566_0002520 | Ga0500566_0002520_7085_7783 | 232 |
| 786 | 3300053094 | Ga0500566_0004614 | Ga0500566_0004614_264_962 | 232 |
| 787 | 3300053095 | Ga0500640_028305 | Ga0500640_028305_171_869 | 232 |
| 788 | 3300053096 | Ga0500641_0005375 | Ga0500641_0005375_1878_2576 | 232 |
| 789 | 3300053096 | Ga0500641_0017766 | Ga0500641_0017766_905_1603 | 232 |
| 790 | 3300053096 | Ga0500641_0058901 | Ga0500641_0058901_695_1393 | 232 |
| 791 | 3300053096 | Ga0500641_0175098 | Ga0500641_0175098_35_733 | 232 |
| 792 | 3300053098 | Ga0500650_0073574 | Ga0500650_0073574_68_766 | 232 |
| 793 | 3300053102 | Ga0500554_016601 | Ga0500554_016601_823_1521 | 232 |
| 794 | 3300053103 | Ga0500555_059751 | Ga0500555_059751_43_741 | 232 |
| 795 | 3300053104 | Ga0500556_0000012 | Ga0500556_0000012_67019_67717 | 232 |
| 796 | 3300053105 | Ga0500557_000046 | Ga0500557_000046_18071_18769 | 232 |
| 797 | 3300053109 | Ga0500569_005217 | Ga0500569_005217_1861_2559 | 232 |
| 798 | 3300053109 | Ga0500569_014721 | Ga0500569_014721_20_766 | 232 |
| 799 | 3300053111 | Ga0500572_000471 | Ga0500572_000471_11292_11990 | 232 |
| 800 | 3300053114 | Ga0500582_122829 | Ga0500582_122829_32_730 | 232 |
| 801 | 3300053116 | Ga0500592_000542 | Ga0500592_000542_4767_5465 | 232 |
| 802 | 3300053116 | Ga0500592_030190 | Ga0500592_030190_98_796 | 232 |
| 803 | 3300053118 | Ga0500594_0009826 | Ga0500594_0009826_1062_1760 | 232 |
| 804 | 3300053118 | Ga0500594_0101994 | Ga0500594_0101994_126_824 | 232 |
| 805 | 3300053119 | Ga0500595_000615 | Ga0500595_000615_17157_17855 | 232 |
| 806 | 3300053119 | Ga0500595_007563 | Ga0500595_007563_2730_3428 | 232 |
| 807 | 3300053119 | Ga0500595_011345 | Ga0500595_011345_2515_3312 | 232 |
| 808 | 3300053121 | Ga0500607_034490 | Ga0500607_034490_1032_1730 | 232 |
| 809 | 3300053122 | Ga0500608_027336 | Ga0500608_027336_1318_2016 | 232 |
| 810 | 3300053123 | Ga0500614_070735 | Ga0500614_070735_243_941 | 232 |
| 811 | 3300053125 | Ga0500618_006007 | Ga0500618_006007_1164_1862 | 232 |
| 812 | 3300053125 | Ga0500618_057612 | Ga0500618_057612_114_812 | 232 |
| 813 | 3300053129 | Ga0500628_049242 | Ga0500628_049242_68_766 | 232 |
| 814 | 3300053130 | Ga0500642_0000013 | Ga0500642_0000013_141890_142588 | 232 |
| 815 | 3300053130 | Ga0500642_0000038 | Ga0500642_0000038_65693_66391 | 232 |
| 816 | 3300053130 | Ga0500642_0033610 | Ga0500642_0033610_243_941 | 232 |
| 817 | 3300053131 | Ga0500652_001452 | Ga0500652_001452_4537_5235 | 232 |
| 818 | 3300053134 | Ga0500658_0187477 | Ga0500658_0187477_210_908 | 232 |
| 819 | 3300053136 | Ga0500559_0000713 | Ga0500559_0000713_3330_4028 | 232 |
| 820 | 3300053136 | Ga0500559_0001670 | Ga0500559_0001670_3904_4602 | 232 |
| 821 | 3300053136 | Ga0500559_0026032 | Ga0500559_0026032_984_1682 | 232 |
| 822 | 3300053138 | Ga0500564_069907 | Ga0500564_069907_535_1233 | 232 |
| 823 | 3300053139 | Ga0500568_0000676 | Ga0500568_0000676_10964_11662 | 232 |
| 824 | 3300053139 | Ga0500568_0043586 | Ga0500568_0043586_1013_1711 | 232 |
| 825 | 3300053139 | Ga0500568_0070629 | Ga0500568_0070629_133_831 | 232 |
| 826 | 3300053139 | Ga0500568_0095835 | Ga0500568_0095835_47_745 | 232 |
| 827 | 3300053148 | Ga0500590_125168 | Ga0500590_125168_291_989 | 232 |
| 828 | 3300053153 | Ga0500616_0000035 | Ga0500616_0000035_326699_327397 | 232 |
| 829 | 3300053153 | Ga0500616_0036917 | Ga0500616_0036917_1270_1968 | 232 |
| 830 | 3300053153 | Ga0500616_0151921 | Ga0500616_0151921_20_718 | 232 |
| 831 | 3300053154 | Ga0500619_009223 | Ga0500619_009223_731_1429 | 232 |
| 832 | 3300053155 | Ga0500620_079333 | Ga0500620_079333_252_950 | 232 |
| 833 | 3300053156 | Ga0500622_0005098 | Ga0500622_0005098_1639_2337 | 232 |
| 834 | 3300053156 | Ga0500622_0055023 | Ga0500622_0055023_593_1291 | 232 |
| 835 | 3300053158 | Ga0500627_0046689 | Ga0500627_0046689_215_913 | 232 |
| 836 | 3300053158 | Ga0500627_0083492 | Ga0500627_0083492_408_1106 | 232 |
| 837 | 3300053160 | Ga0500633_0085149 | Ga0500633_0085149_48_746 | 232 |
| 838 | 3300053161 | Ga0500634_0020483 | Ga0500634_0020483_1700_2398 | 232 |
| 839 | 3300053161 | Ga0500634_0037228 | Ga0500634_0037228_140_838 | 232 |
| 840 | 3300053162 | Ga0500638_007258 | Ga0500638_007258_1411_2109 | 232 |
| 841 | 3300053162 | Ga0500638_028379 | Ga0500638_028379_1571_2269 | 232 |
| 842 | 3300053177 | Ga0500636_0001763 | Ga0500636_0001763_686_1384 | 232 |
| 843 | 3300053177 | Ga0500636_0010527 | Ga0500636_0010527_1691_2389 | 232 |
| 844 | 3300053178 | Ga0500637_0000445 | Ga0500637_0000445_3509_4207 | 232 |
| 845 | 3300053723 | Ga0500567_160758 | Ga0500567_160758_94_792 | 232 |
| 846 | 3300053724 | Ga0500570_147811 | Ga0500570_147811_46_744 | 232 |
| 847 | 3300053729 | Ga0500625_003345 | Ga0500625_003345_4892_5590 | 232 |
| 848 | 3300053731 | Ga0500609_018794 | Ga0500609_018794_95_793 | 232 |
| 849 | 3300053736 | Ga0500599_001657 | Ga0500599_001657_233_931 | 232 |
| 850 | 3300055283 | Ga0500661_000331 | Ga0500661_000331_3371_4069 | 232 |
| 851 | 3300055283 | Ga0500661_037243 | Ga0500661_037243_108_806 | 232 |
| 852 | 3300059492 | Ga0587073_0008925 | Ga0587073_0008925_372_1070 | 232 |
| 853 | 3300059505 | Ga0587083_0008267 | Ga0587083_0008267_210_908 | 232 |
| 854 | 3300059508 | Ga0587088_024946 | Ga0587088_024946_247_945 | 232 |
| 855 | 3300059647 | Ga0587079_005293 | Ga0587079_005293_663_1361 | 232 |
| 856 | 3300059652 | Ga0587107_018852 | Ga0587107_018852_93_791 | 232 |
| 857 | 3300060344 | Ga0587071_038525 | Ga0587071_038525_98_796 | 232 |
| 858 | 3300061719 | Ga0466962_0207969 | Ga0466962_0207969_159_857 | 232 |
| 859 | 3300003203 | JGI25406J46586_10001255 | JGI25406J46586_100012555 | 233 |
| 860 | 3300003659 | JGI25404J52841_10001741 | JGI25404J52841_100017412 | 233 |
| 861 | 3300003659 | JGI25404J52841_10017197 | JGI25404J52841_100171972 | 233 |
| 862 | 3300003659 | JGI25404J52841_10027769 | JGI25404J52841_100277692 | 233 |
| 863 | 3300003911 | JGI25405J52794_10010489 | JGI25405J52794_100104891 | 233 |
| 864 | 3300005937 | Ga0081455_10005322 | Ga0081455_1000532210 | 233 |
| 865 | 3300005937 | Ga0081455_10022178 | Ga0081455_100221786 | 233 |
| 866 | 3300005937 | Ga0081455_10038296 | Ga0081455_100382965 | 233 |
| 867 | 3300005983 | Ga0081540_1004374 | Ga0081540_10043747 | 233 |
| 868 | 3300005983 | Ga0081540_1005482 | Ga0081540_10054828 | 233 |
| 869 | 3300005983 | Ga0081540_1006150 | Ga0081540_10061504 | 233 |
| 870 | 3300005985 | Ga0081539_10000540 | Ga0081539_1000054014 | 233 |
| 871 | 3300005985 | Ga0081539_10024335 | Ga0081539_100243353 | 233 |
| 872 | 3300026121 | Ga0207683_10221960 | Ga0207683_102219602 | 233 |
| 873 | 3300037466 | Ga0395898_0043652 | Ga0395898_0043652_1349_2149 | 233 |
| 874 | 3300046616 | Ga0495668_0069727 | Ga0495668_0069727_998_1699 | 233 |
| 875 | 3300047315 | Ga0495581_0188053 | Ga0495581_0188053_11_712 | 233 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6uts-assembly1.cif.gz_A | crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli | 0.941 | 1 | 232 |
| 1tq5-assembly1.cif.gz_A | crystal structure of yhhw from escherichia coli | 0.9333 | 1 | 233 |
| 6uts-assembly1.cif.gz_A | crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli | 0.9253 | 1 | 232 |
| 1tq5-assembly1.cif.gz_A | crystal structure of yhhw from escherichia coli | 0.914 | 1 | 233 |
| 1yhf-assembly1.cif.gz_A | crystal structure of conserved spy1581 protein of unknown function from streptococcus pyogenes | 0.8424 | 14 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WI85_16_135_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9369 | 13 | 130 | 2.60.120.10 |
| af_F1QLW3_37_119_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9298 | 40 | 119 | 2.60.120.10 |
| 1tq5A02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.918 | 11 | 134 | 2.60.120.10 |
| af_P9WI85_16_135_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9147 | 13 | 130 | 2.60.120.10 |
| 1tq5A02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9108 | 11 | 134 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0A7PEG0-F1-model_v4 | Quercetin 2,3-dioxygenase C-terminal cupin domain-containing protein | 0.9851 | 146 | 233 |
|
| AF-A0A7W5I144-F1-model_v4 | deleted | 0.9814 | 159 | 233 |
|
| AF-T0GCZ8-F1-model_v4 | Pirin | 0.9754 | 2 | 233 |
|
| AF-A0A653EB75-F1-model_v4 | Putative Quercetin 2,3-dioxygenase (EC 1.13.11.24) | 0.9734 | 140 | 233 |
GO:0008127
|
| AF-A0A7W9VBX2-F1-model_v4 | deleted | 0.9723 | 1 | 233 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar