F484322

General Info

Members Datasets Scaffolds Average Seq Length
875 391 1750 303

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100016139|Ga0075363_1000161393
Length 327
Sequence MTSTSLTADTQADAREGAVAERVRKIRENQGAGVSRAEGWRRRGPLLPALIFMIVVTQIPFLFTLYYSTLSWNLVRPGSRQFVGLNNYIAVAKDSQFWRVGLNTVILIVGVVLISAFLGLLLALLLDRAFLGRGVVRTLLITPFLVTPVAAALIWKTTILDPTNGILNWVLSLVGIGPVDWIGQFPLTMVMVELIWQWTPFMMLLILAGLQSMPRDILEAGRVDGAGAFQLFRELTLPHLRRFIELGVVLGAVYLVNTFDAIYMMTQGGPGIASANLPFYIYQRAFLGFDMGQAAAMGVVVVIFTMFIASFALRLIFKSFSGKEEAA

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
194 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
206 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
207 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
208 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
209 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
230 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
231 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
232 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
233 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
234 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
235 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
236 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
237 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
238 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
239 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
248 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
249 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
250 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
266 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
267 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
268 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
269 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
278 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
279 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
280 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
281 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
282 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
283 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
284 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
288 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
289 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
290 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
291 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
292 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
310 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
311 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
312 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
313 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
316 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
319 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
330 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
331 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
332 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
335 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
336 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
337 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
338 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
342 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
345 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
346 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
349 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
350 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
351 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
352 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
353 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
354 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
355 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
356 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
357 2582580736 Prauserella sp. Am3 Isolate Unclassified
358 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
359 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
360 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
361 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
362 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
363 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
364 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
365 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
366 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
367 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
368 2808606394 Promicromonospora sp. C35 Isolate Unclassified
369 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
370 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
371 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
372 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
373 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
374 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
375 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
376 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
377 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
378 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
379 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
380 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
381 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
382 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
383 2922554459 Rhodococcus sp. 66b Isolate Unclassified
384 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
385 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
386 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
387 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
388 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
389 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
390 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
391 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.31
Metatranscriptomes 0.11
Isolates 4.57

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 6.51
Nodule 0.11
Rhizoplane 10.4
Rhizosphere 77.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100016139 3300006048 Bacteria 3684
2 LJQas_1000960 3300000549 Bacteria 4435
3 JGI24746J21847_1000498 3300001977 Bacteria 5899
4 JGI24746J21847_1000616 3300001977 Bacteria 5423
5 JGI24747J21853_1000476 3300001978 Bacteria 2507
6 JGI24747J21853_1007729 3300001978 Bacteria 1039
7 JGI24743J22301_10000693 3300001991 Bacteria 4155
8 JGI24750J21931_1001011 3300002070 Bacteria 3690
9 JGI24750J21931_1001409 3300002070 Bacteria 3010
10 JGI24750J21931_1004899 3300002070 Bacteria 1634
11 JGI24745J21846_1000218 3300002073 Bacteria 4688
12 JGI24745J21846_1000375 3300002073 Bacteria 3909
13 JGI24748J21848_1000341 3300002074 Bacteria 5377
14 JGI24738J21930_10002720 3300002075 Bacteria 4551
15 JGI24749J21850_1000662 3300002076 Bacteria 4998
16 JGI24744J21845_10001427 3300002077 Bacteria 4741
17 JGI24744J21845_10002829 3300002077 Bacteria 3547
18 JGI24034J26672_10000514 3300002239 Bacteria 5006
19 JGI25406J46586_10006156 3300003203 Bacteria 5540
20 JGI25406J46586_10022519 3300003203 Bacteria 2507
21 JGI25406J46586_10022578 3300003203 Bacteria 2503
22 JGI25407J50210_10000161 3300003373 Bacteria 10687
23 JGI25407J50210_10002355 3300003373 Bacteria 4439
24 JGI25407J50210_10002796 3300003373 Bacteria 4148
25 Ga0055540_1002047 3300003792 Bacteria 11157
26 Ga0070658_10137459 3300005327 Bacteria 2040
27 Ga0070676_10009535 3300005328 Bacteria 5243
28 Ga0070690_100018186 3300005330 Bacteria 4241
29 Ga0070690_100183519 3300005330 Bacteria 1447
30 Ga0070670_100179317 3300005331 Bacteria 1839
31 Ga0068869_100079280 3300005334 Bacteria 2447
32 Ga0070666_10109462 3300005335 Bacteria 1910
33 Ga0070666_10219228 3300005335 Bacteria 1341
34 Ga0070682_100001259 3300005337 Bacteria 14382
35 Ga0070682_100008605 3300005337 Bacteria 5761
36 Ga0070682_100048547 3300005337 Bacteria 2643
37 Ga0070682_100300503 3300005337 Bacteria 1178
38 Ga0068868_100124331 3300005338 Bacteria 2106
39 Ga0068868_100324732 3300005338 Bacteria 1312
40 Ga0070660_100219165 3300005339 Bacteria 1546
41 Ga0070689_100035434 3300005340 Bacteria 3813
42 Ga0070691_10002926 3300005341 Bacteria 7659
43 Ga0070687_100005625 3300005343 Bacteria 5083
44 Ga0070668_100001165 3300005347 Bacteria 18582
45 Ga0070668_100001855 3300005347 Bacteria 15420
46 Ga0070668_100043544 3300005347 Bacteria 3443
47 Ga0070668_100181765 3300005347 Bacteria 1718
48 Ga0070668_100256367 3300005347 Bacteria 1453
49 Ga0070669_100018342 3300005353 Bacteria 5002
50 Ga0070675_100127114 3300005354 Bacteria 2169
51 Ga0070671_100003987 3300005355 Bacteria 11629
52 Ga0070671_100011350 3300005355 Bacteria 7161
53 Ga0070671_100012680 3300005355 Bacteria 6794
54 Ga0070671_100204753 3300005355 Bacteria 1674
55 Ga0070674_100012380 3300005356 Bacteria 5238
56 Ga0070673_100029239 3300005364 Bacteria 4107
57 Ga0070688_100002117 3300005365 Bacteria 10011
58 Ga0070659_100018966 3300005366 Bacteria 5200
59 Ga0070659_100028949 3300005366 Bacteria 4279
60 Ga0070659_100164538 3300005366 Bacteria 1815
61 Ga0070667_100000468 3300005367 Bacteria 41520
62 Ga0070667_100015390 3300005367 Bacteria 6324
63 Ga0070703_10006058 3300005406 Bacteria 3385
64 Ga0070709_10010224 3300005434 Bacteria 5188
65 Ga0070709_10020192 3300005434 Bacteria 3862
66 Ga0070714_100046442 3300005435 Bacteria 3685
67 Ga0070714_100103473 3300005435 Bacteria 2512
68 Ga0070714_100106541 3300005435 Bacteria 2477
69 Ga0070714_100364770 3300005435 Bacteria 1359
70 Ga0070710_10027723 3300005437 Bacteria 3023
71 Ga0070701_10000617 3300005438 Bacteria 12440
72 Ga0070711_100078694 3300005439 Bacteria 2343
73 Ga0070711_100137340 3300005439 Bacteria 1829
74 Ga0070705_100009026 3300005440 Bacteria 4949
75 Ga0070705_100032890 3300005440 Bacteria 2886
76 Ga0070700_100002857 3300005441 Bacteria 8860
77 Ga0070700_100135606 3300005441 Bacteria 1666
78 Ga0070700_100251765 3300005441 Bacteria 1267
79 Ga0070694_100012620 3300005444 Bacteria 5259
80 Ga0070708_100215008 3300005445 Bacteria 1802
81 Ga0070708_100327320 3300005445 Bacteria 1444
82 Ga0070663_100003517 3300005455 Bacteria 9043
83 Ga0070663_100015294 3300005455 Bacteria 4949
84 Ga0070663_100256443 3300005455 Bacteria 1386
85 Ga0070678_100004949 3300005456 Bacteria 7626
86 Ga0070678_100139002 3300005456 Bacteria 1941
87 Ga0070681_10157058 3300005458 Bacteria 2199
88 Ga0070685_10001600 3300005466 Bacteria 11938
89 Ga0070685_10009454 3300005466 Bacteria 5038
90 Ga0070685_10034348 3300005466 Bacteria 2856
91 Ga0070685_10119212 3300005466 Bacteria 1637
92 Ga0070706_100019073 3300005467 Bacteria 6327
93 Ga0070707_100026830 3300005468 Bacteria 5473
94 Ga0070707_100043795 3300005468 Bacteria 4283
95 Ga0070707_100151768 3300005468 Bacteria 2256
96 Ga0070698_100016760 3300005471 Bacteria 7729
97 Ga0070698_100193781 3300005471 Bacteria 1969
98 Ga0070698_100473134 3300005471 Bacteria 1189
99 Ga0070699_100008999 3300005518 Bacteria 8649
100 Ga0070699_100268479 3300005518 Bacteria 1526
101 Ga0070699_100285158 3300005518 Bacteria 1480
102 Ga0070679_100194817 3300005530 Bacteria 1994
103 Ga0070697_100038352 3300005536 Bacteria 3871
104 Ga0070697_100547925 3300005536 Bacteria 1014
105 Ga0068853_100018224 3300005539 Bacteria 5808
106 Ga0068853_100021473 3300005539 Bacteria 5384
107 Ga0070672_100186466 3300005543 Bacteria 1730
108 Ga0070686_100010943 3300005544 Bacteria 5136
109 Ga0070686_100107966 3300005544 Bacteria 1891
110 Ga0070695_100007358 3300005545 Bacteria 6526
111 Ga0070695_100068541 3300005545 Bacteria 2317
112 Ga0070695_100095874 3300005545 Bacteria 1989
113 Ga0070693_100008993 3300005547 Bacteria 4957
114 Ga0070693_100025938 3300005547 Bacteria 3158
115 Ga0070665_100004640 3300005548 Bacteria 14364
116 Ga0070665_100005624 3300005548 Bacteria 12892
117 Ga0070665_100079251 3300005548 Bacteria 3291
118 Ga0070704_100094735 3300005549 Bacteria 2234
119 Ga0070704_100537253 3300005549 Bacteria 1020
120 Ga0068856_100052713 3300005614 Bacteria 4012
121 Ga0070702_100029771 3300005615 Bacteria 2972
122 Ga0068852_100112979 3300005616 Bacteria 2473
123 Ga0068859_100003567 3300005617 Bacteria 15855
124 Ga0068859_100028179 3300005617 Bacteria 5631
125 Ga0068864_100012164 3300005618 Bacteria 7113
126 Ga0068866_10004444 3300005718 Bacteria 5756
127 Ga0068861_100051091 3300005719 Bacteria 3137
128 Ga0068861_100056955 3300005719 Bacteria 2985
129 Ga0068861_100105274 3300005719 Bacteria 2252
130 Ga0068863_100009877 3300005841 Bacteria 9294
131 Ga0068863_100013617 3300005841 Bacteria 7845
132 Ga0068863_100338869 3300005841 Bacteria 1463
133 Ga0068858_100005179 3300005842 Bacteria 12770
134 Ga0068858_100381452 3300005842 Bacteria 1353
135 Ga0068860_100000162 3300005843 Bacteria 109869
136 Ga0068860_100064242 3300005843 Bacteria 3486
137 Ga0068860_100095237 3300005843 Bacteria 2838
138 Ga0068860_100117557 3300005843 Bacteria 2544
139 Ga0068860_100519443 3300005843 Bacteria 1191
140 Ga0068862_100000373 3300005844 Bacteria 48546
141 Ga0068862_100290613 3300005844 Bacteria 1501
142 Ga0068862_100491813 3300005844 Bacteria 1163
143 Ga0081455_10004355 3300005937 Bacteria 15937
144 Ga0081455_10077520 3300005937 Bacteria 2734
145 Ga0081455_10166767 3300005937 Bacteria 1682
146 Ga0081538_10000016 3300005981 Bacteria 147022
147 Ga0081538_10000689 3300005981 Bacteria 37088
148 Ga0081538_10004047 3300005981 Bacteria 13637
149 Ga0081538_10010693 3300005981 Bacteria 7511
150 Ga0081538_10028847 3300005981 Bacteria 3806
151 Ga0081540_1000672 3300005983 Bacteria 32148
152 Ga0081539_10000473 3300005985 Bacteria 85174
153 Ga0081539_10002003 3300005985 Bacteria 30898
154 Ga0081539_10005624 3300005985 Bacteria 12608
155 Ga0070717_10274210 3300006028 Bacteria 1494
156 Ga0075365_10028659 3300006038 Bacteria 3552
157 Ga0075365_10050794 3300006038 Bacteria 2737
158 Ga0075363_100010049 3300006048 Bacteria 4474
159 Ga0075363_100039578 3300006048 Bacteria 2482
160 Ga0075363_100113166 3300006048 Bacteria 1510
161 Ga0075364_10005595 3300006051 Bacteria 7323
162 Ga0075364_10008577 3300006051 Bacteria 6114
163 Ga0075364_10025508 3300006051 Bacteria 3763
164 Ga0075364_10226531 3300006051 Bacteria 1269
165 Ga0070715_10002160 3300006163 Bacteria 5961
166 Ga0070715_10005623 3300006163 Bacteria 4196
167 Ga0070715_10023821 3300006163 Bacteria 2403
168 Ga0070716_100004804 3300006173 Bacteria 6489
169 Ga0070712_100000457 3300006175 Bacteria 23417
170 Ga0070712_100010040 3300006175 Bacteria 5968
171 Ga0075362_10007045 3300006177 Bacteria 4226
172 Ga0075362_10016171 3300006177 Bacteria 3051
173 Ga0075362_10018230 3300006177 Bacteria 2901
174 Ga0075367_10065059 3300006178 Bacteria 2183
175 Ga0075369_10007854 3300006186 Bacteria 4082
176 Ga0075369_10009484 3300006186 Bacteria 3783
177 Ga0075369_10023442 3300006186 Bacteria 2551
178 Ga0075366_10129291 3300006195 Bacteria 1524
179 Ga0097621_100002586 3300006237 Bacteria 12400
180 Ga0097621_100009467 3300006237 Bacteria 7072
181 Ga0097621_100014025 3300006237 Bacteria 5988
182 Ga0075370_10003318 3300006353 Bacteria 7645
183 Ga0075370_10011114 3300006353 Bacteria 4721
184 Ga0075370_10016689 3300006353 Bacteria 3953
185 Ga0075370_10016905 3300006353 Bacteria 3933
186 Ga0075370_10017518 3300006353 Bacteria 3872
187 Ga0075370_10026776 3300006353 Bacteria 3196
188 Ga0075370_10173326 3300006353 Bacteria 1268
189 Ga0068871_100194905 3300006358 Bacteria 1747
190 Ga0075428_100030957 3300006844 Bacteria 5917
191 Ga0075428_100121239 3300006844 Bacteria 2847
192 Ga0075430_100041879 3300006846 Bacteria 3874
193 Ga0075430_100050876 3300006846 Bacteria 3492
194 Ga0075430_100069815 3300006846 Bacteria 2947
195 Ga0075431_100141728 3300006847 Bacteria 2478
196 Ga0075433_10007344 3300006852 Bacteria 8744
197 Ga0075433_10025121 3300006852 Bacteria 5036
198 Ga0075434_100055191 3300006871 Bacteria 3948
199 Ga0075434_100068928 3300006871 Bacteria 3525
200 Ga0075434_100071810 3300006871 Bacteria 3453
201 Ga0075434_100423274 3300006871 Bacteria 1353
202 Ga0075429_100423054 3300006880 Bacteria 1167
203 Ga0068865_100002260 3300006881 Bacteria 11338
204 Ga0075436_100020623 3300006914 Bacteria 4523
205 Ga0097620_100003567 3300006931 Bacteria 15855
206 Ga0097620_100028179 3300006931 Bacteria 5631
207 Ga0075435_100016666 3300007076 Bacteria 5542
208 Ga0075435_100095458 3300007076 Bacteria 2459
209 Ga0099795_10009068 3300007788 Bacteria 2870
210 Ga0099795_10027342 3300007788 Bacteria 1929
211 Ga0105250_10009359 3300009092 Bacteria 4130
212 Ga0111539_10172596 3300009094 Bacteria 2526
213 Ga0111539_10390645 3300009094 Bacteria 1620
214 Ga0105245_10056439 3300009098 Bacteria 3530
215 Ga0105245_10304902 3300009098 Bacteria 1564
216 Ga0105247_10000079 3300009101 Bacteria 110309
217 Ga0105247_10050758 3300009101 Bacteria 2553
218 Ga0105247_10053743 3300009101 Bacteria 2485
219 Ga0105247_10322885 3300009101 Bacteria 1078
220 Ga0114129_10006035 3300009147 Bacteria 17179
221 Ga0114129_10009275 3300009147 Bacteria 14030
222 Ga0114129_10035738 3300009147 Bacteria 7018
223 Ga0114129_10048133 3300009147 Bacteria 5991
224 Ga0114129_10175878 3300009147 Bacteria 2915
225 Ga0105243_10059404 3300009148 Bacteria 3051
226 Ga0105241_10005880 3300009174 Bacteria 9054
227 Ga0105241_10074070 3300009174 Bacteria 2651
228 Ga0105242_10006380 3300009176 Bacteria 9079
229 Ga0105242_10062755 3300009176 Bacteria 3059
230 Ga0105248_10000827 3300009177 Bacteria 34797
231 Ga0105248_10042193 3300009177 Bacteria 5116
232 Ga0105248_10063895 3300009177 Bacteria 4132
233 Ga0105248_10093205 3300009177 Bacteria 3392
234 Ga0105248_10404642 3300009177 Bacteria 1537
235 Ga0105237_10004991 3300009545 Bacteria 15119
236 Ga0105237_10043563 3300009545 Bacteria 4521
237 Ga0105237_10129585 3300009545 Bacteria 2517
238 Ga0105238_10029035 3300009551 Bacteria 5634
239 Ga0105238_10142393 3300009551 Bacteria 2374
240 Ga0105249_10000098 3300009553 Bacteria 120091
241 Ga0105249_10004019 3300009553 Bacteria 12688
242 Ga0105249_10010991 3300009553 Bacteria 7952
243 Ga0105249_10212766 3300009553 Bacteria 1898
244 Ga0099796_10000539 3300010159 Bacteria 6471
245 Ga0105239_10056552 3300010375 Bacteria 4303
246 Ga0105239_10178515 3300010375 Bacteria 2375
247 Ga0105239_10216429 3300010375 Bacteria 2148
248 Ga0105246_10003571 3300011119 Bacteria 9408
249 Ga0105246_10061056 3300011119 Bacteria 2621
250 Ga0157371_10045063 3300013102 Bacteria 3140
251 Ga0157369_10045974 3300013105 Bacteria 4746
252 Ga0157374_10005982 3300013296 Bacteria 10294
253 Ga0157374_10033291 3300013296 Bacteria 4702
254 Ga0157378_10002762 3300013297 Bacteria 15641
255 Ga0157378_10029547 3300013297 Bacteria 4840
256 Ga0157378_10043774 3300013297 Bacteria 3974
257 Ga0163162_10020021 3300013306 Bacteria 6572
258 Ga0163162_10087064 3300013306 Bacteria 3202
259 Ga0163162_10118515 3300013306 Bacteria 2749
260 Ga0163162_10193683 3300013306 Bacteria 2161
261 Ga0163162_10249706 3300013306 Bacteria 1906
262 Ga0163162_10355421 3300013306 Bacteria 1598
263 Ga0157372_10048650 3300013307 Bacteria 4713
264 Ga0157372_10352980 3300013307 Bacteria 1713
265 Ga0157375_10284512 3300013308 Bacteria 1817
266 Ga0157375_10569919 3300013308 Bacteria 1293
267 Ga0163163_10043510 3300014325 Bacteria 4403
268 Ga0163163_10169799 3300014325 Bacteria 2228
269 Ga0163163_10337839 3300014325 Bacteria 1561
270 Ga0157380_10007667 3300014326 Bacteria 7679
271 Ga0157380_10030175 3300014326 Bacteria 4151
272 Ga0157377_10013154 3300014745 Bacteria 4181
273 Ga0157377_10015443 3300014745 Bacteria 3907
274 Ga0157379_10063162 3300014968 Bacteria 3311
275 Ga0157376_10004627 3300014969 Bacteria 9585
276 Ga0157376_10051774 3300014969 Bacteria 3411
277 Ga0163161_10200668 3300017792 Bacteria 1537
278 Ga0209051_1000539 3300025303 Bacteria 46616
279 Ga0209051_1001358 3300025303 Bacteria 21222
280 Ga0209051_1008208 3300025303 Bacteria 5563
281 Ga0207696_1009721 3300025711 Bacteria 3570
282 Ga0207653_10003334 3300025885 Bacteria 5071
283 Ga0207692_10001625 3300025898 Bacteria 8476
284 Ga0207692_10036730 3300025898 Bacteria 2391
285 Ga0207642_10000593 3300025899 Bacteria 11140
286 Ga0207710_10000022 3300025900 Bacteria 335632
287 Ga0207710_10005837 3300025900 Bacteria 5280
288 Ga0207688_10001754 3300025901 Bacteria 11514
289 Ga0207688_10017263 3300025901 Bacteria 3921
290 Ga0207680_10059954 3300025903 Bacteria 2314
291 Ga0207647_10016233 3300025904 Bacteria 5084
292 Ga0207647_10092973 3300025904 Bacteria 1798
293 Ga0207685_10000084 3300025905 Bacteria 17469
294 Ga0207685_10007018 3300025905 Bacteria 3110
295 Ga0207699_10004982 3300025906 Bacteria 6350
296 Ga0207645_10008761 3300025907 Bacteria 7037
297 Ga0207684_10013292 3300025910 Bacteria 7122
298 Ga0207654_10048355 3300025911 Bacteria 2434
299 Ga0207671_10012324 3300025914 Bacteria 6881
300 Ga0207671_10074839 3300025914 Bacteria 2532
301 Ga0207693_10000670 3300025915 Bacteria 30783
302 Ga0207693_10067119 3300025915 Bacteria 2808
303 Ga0207663_10002342 3300025916 Bacteria 9098
304 Ga0207663_10115587 3300025916 Bacteria 1828
305 Ga0207660_10011508 3300025917 Bacteria 5763
306 Ga0207660_10079080 3300025917 Bacteria 2411
307 Ga0207662_10010107 3300025918 Bacteria 5201
308 Ga0207662_10073832 3300025918 Bacteria 2070
309 Ga0207657_10023385 3300025919 Bacteria 5755
310 Ga0207657_10142782 3300025919 Bacteria 1955
311 Ga0207652_10029963 3300025921 Bacteria 4555
312 Ga0207646_10063429 3300025922 Bacteria 3299
313 Ga0207681_10009873 3300025923 Bacteria 5840
314 Ga0207681_10165682 3300025923 Bacteria 1670
315 Ga0207650_10150017 3300025925 Bacteria 1839
316 Ga0207687_10026499 3300025927 Bacteria 3882
317 Ga0207687_10026712 3300025927 Bacteria 3868
318 Ga0207687_10242909 3300025927 Bacteria 1428
319 Ga0207700_10004729 3300025928 Bacteria 8076
320 Ga0207700_10007267 3300025928 Bacteria 6758
321 Ga0207700_10179471 3300025928 Bacteria 1772
322 Ga0207664_10001469 3300025929 Bacteria 15461
323 Ga0207664_10006181 3300025929 Bacteria 8216
324 Ga0207664_10075349 3300025929 Bacteria 2728
325 Ga0207644_10003245 3300025931 Bacteria 10489
326 Ga0207644_10007403 3300025931 Bacteria 7154
327 Ga0207644_10075147 3300025931 Bacteria 2482
328 Ga0207644_10132536 3300025931 Bacteria 1910
329 Ga0207644_10135036 3300025931 Bacteria 1893
330 Ga0207690_10359956 3300025932 Bacteria 1152
331 Ga0207706_10040444 3300025933 Bacteria 4132
332 Ga0207706_10199546 3300025933 Bacteria 1755
333 Ga0207706_10262713 3300025933 Bacteria 1507
334 Ga0207686_10005080 3300025934 Bacteria 7077
335 Ga0207686_10019694 3300025934 Bacteria 3842
336 Ga0207686_10068349 3300025934 Bacteria 2276
337 Ga0207709_10008531 3300025935 Bacteria 5666
338 Ga0207670_10006823 3300025936 Bacteria 6352
339 Ga0207669_10003581 3300025937 Bacteria 6734
340 Ga0207704_10001501 3300025938 Bacteria 10464
341 Ga0207704_10133529 3300025938 Bacteria 1723
342 Ga0207665_10015966 3300025939 Bacteria 4931
343 Ga0207665_10119046 3300025939 Bacteria 1864
344 Ga0207665_10121858 3300025939 Bacteria 1843
345 Ga0207691_10018296 3300025940 Bacteria 6637
346 Ga0207711_10000404 3300025941 Bacteria 45690
347 Ga0207711_10006841 3300025941 Bacteria 9579
348 Ga0207711_10026567 3300025941 Bacteria 4858
349 Ga0207711_10165617 3300025941 Bacteria 2003
350 Ga0207689_10023474 3300025942 Bacteria 5177
351 Ga0207689_10104677 3300025942 Bacteria 2325
352 Ga0207661_10300047 3300025944 Bacteria 1440
353 Ga0207667_10262170 3300025949 Bacteria 1767
354 Ga0207667_10601979 3300025949 Bacteria 1108
355 Ga0207667_10639444 3300025949 Bacteria 1070
356 Ga0207651_10062993 3300025960 Bacteria 2587
357 Ga0207712_10000076 3300025961 Bacteria 120445
358 Ga0207712_10004461 3300025961 Bacteria 8838
359 Ga0207712_10062806 3300025961 Bacteria 2642
360 Ga0207712_10142265 3300025961 Bacteria 1843
361 Ga0207668_10013992 3300025972 Bacteria 4957
362 Ga0207668_10025220 3300025972 Bacteria 3845
363 Ga0207668_10032618 3300025972 Bacteria 3444
364 Ga0207668_10082354 3300025972 Bacteria 2337
365 Ga0207668_10161284 3300025972 Bacteria 1747
366 Ga0207668_10275669 3300025972 Bacteria 1377
367 Ga0207658_10000821 3300025986 Bacteria 25967
368 Ga0207677_10002902 3300026023 Bacteria 9057
369 Ga0207677_10215197 3300026023 Bacteria 1537
370 Ga0207677_10451124 3300026023 Bacteria 1102
371 Ga0207703_10006399 3300026035 Bacteria 9416
372 Ga0207703_10069033 3300026035 Bacteria 2913
373 Ga0207703_10261373 3300026035 Bacteria 1565
374 Ga0207639_10038395 3300026041 Bacteria 3561
375 Ga0207639_10172673 3300026041 Bacteria 1832
376 Ga0207639_10231259 3300026041 Bacteria 1602
377 Ga0207639_10407297 3300026041 Bacteria 1226
378 Ga0207678_10003523 3300026067 Bacteria 14079
379 Ga0207678_10016735 3300026067 Bacteria 6440
380 Ga0207708_10001232 3300026075 Bacteria 19288
381 Ga0207708_10011608 3300026075 Bacteria 6566
382 Ga0207702_10074384 3300026078 Bacteria 2932
383 Ga0207702_10445376 3300026078 Bacteria 1256
384 Ga0207641_10002622 3300026088 Bacteria 16486
385 Ga0207641_10004801 3300026088 Bacteria 11649
386 Ga0207641_10056732 3300026088 Bacteria 3329
387 Ga0207641_10118121 3300026088 Bacteria 2362
388 Ga0207648_10006703 3300026089 Bacteria 11423
389 Ga0207676_10010661 3300026095 Bacteria 6555
390 Ga0207675_100006346 3300026118 Bacteria 11210
391 Ga0207675_100058819 3300026118 Bacteria 3587
392 Ga0207675_100150315 3300026118 Bacteria 2216
393 Ga0207675_100162814 3300026118 Bacteria 2129
394 Ga0207675_100309781 3300026118 Bacteria 1540
395 Ga0207683_10000111 3300026121 Bacteria 66523
396 Ga0207683_10000252 3300026121 Bacteria 47809
397 Ga0207683_10026842 3300026121 Bacteria 4974
398 Ga0207683_10164325 3300026121 Bacteria 2008
399 Ga0207698_10195900 3300026142 Bacteria 1805
400 Ga0209179_1003876 3300027512 Bacteria 2203
401 Ga0207428_10331186 3300027907 Bacteria 1123
402 Ga0268266_10022049 3300028379 Bacteria 5429
403 Ga0268266_10023683 3300028379 Bacteria 5226
404 Ga0268266_10060816 3300028379 Bacteria 3257
405 Ga0268266_10275322 3300028379 Bacteria 1563
406 Ga0268265_10000368 3300028380 Bacteria 48834
407 Ga0268265_10018475 3300028380 Bacteria 4832
408 Ga0268265_10372366 3300028380 Bacteria 1311
409 Ga0268264_10000017 3300028381 Bacteria 498037
410 Ga0268264_10021985 3300028381 Bacteria 5205
411 Ga0268264_10056691 3300028381 Bacteria 3275
412 Ga0268264_10094037 3300028381 Bacteria 2591
413 Ga0268264_10221883 3300028381 Bacteria 1740
414 Ga0265319_1006706 3300028563 Bacteria 5292
415 Ga0265760_10034700 3300031090 Bacteria 1492
416 Ga0307513_10273927 3300031456 Bacteria 1469
417 Ga0307405_10077187 3300031731 Bacteria 2164
418 Ga0307518_10002006 3300031838 Bacteria 14952
419 Ga0307410_10099905 3300031852 Bacteria 2078
420 Ga0307406_10068567 3300031901 Bacteria 2316
421 Ga0307412_10069486 3300031911 Bacteria 2398
422 Ga0307409_100014560 3300031995 Bacteria 5123
423 Ga0307416_100040466 3300032002 Bacteria 3621
424 Ga0307416_100143117 3300032002 Bacteria 2177
425 Ga0307416_100245953 3300032002 Bacteria 1737
426 Ga0307411_10035845 3300032005 Bacteria 3103
427 Ga0307415_100112340 3300032126 Bacteria 2024
428 Ga0307507_10029505 3300033179 Bacteria 5813
429 Ga0307510_10018502 3300033180 Bacteria 8197
430 Ga0373928_0010127 3300035084 Bacteria 1848
431 Ga0373940_0005513 3300035088 Bacteria 2747
432 Ga0373951_0009031 3300035091 Bacteria 2247
433 Ga0373923_0006939 3300035111 Bacteria 3949
434 Ga0373932_0078881 3300035112 Bacteria 1036
435 Ga0373936_0003887 3300035113 Bacteria 5630
436 Ga0373941_0026896 3300035115 Bacteria 1674
437 Ga0373945_0016230 3300035116 Bacteria 2508
438 Ga0373946_0050101 3300035171 Bacteria 1743
439 Ga0373924_0032783 3300035410 Bacteria 2094
440 Ga0373931_0018099 3300035691 Bacteria 3498
441 Ga0373931_0075210 3300035691 Bacteria 1852
442 Ga0373931_0077301 3300035691 Bacteria 1829
443 Ga0373935_0055434 3300035692 Bacteria 2525
444 Ga0373935_0071955 3300035692 Bacteria 2232
445 Ga0373927_0020945 3300035695 Bacteria 4286
446 Ga0373933_0263868 3300035724 Bacteria 1111
447 Ga0373947_0034554 3300035725 Bacteria 2990
448 Ga0373947_0111071 3300035725 Bacteria 1732
449 Ga0373925_0026479 3300037068 Bacteria 4242
450 Ga0373925_0029100 3300037068 Bacteria 4052
451 Ga0395899_0003336 3300037312 Bacteria 12729
452 Ga0395899_0021812 3300037312 Bacteria 4858
453 Ga0395899_0026222 3300037312 Bacteria 4398
454 Ga0395899_0031790 3300037312 Bacteria 3966
455 Ga0395899_0041967 3300037312 Bacteria 3416
456 Ga0395899_0044366 3300037312 Bacteria 3313
457 Ga0395899_0090940 3300037312 Bacteria 2212
458 Ga0395899_0102694 3300037312 Bacteria 2063
459 Ga0395899_0104588 3300037312 Bacteria 2040
460 Ga0395899_0112110 3300037312 Bacteria 1960
461 Ga0395899_0120107 3300037312 Bacteria 1883
462 Ga0395899_0212982 3300037312 Bacteria 1342
463 Ga0395899_0264921 3300037312 Bacteria 1174
464 Ga0395900_0006560 3300037418 Bacteria 12123
465 Ga0395900_0011651 3300037418 Bacteria 8996
466 Ga0395900_0012286 3300037418 Bacteria 8757
467 Ga0395900_0015379 3300037418 Bacteria 7799
468 Ga0395900_0032309 3300037418 Bacteria 5381
469 Ga0395900_0034103 3300037418 Bacteria 5239
470 Ga0395900_0034752 3300037418 Bacteria 5192
471 Ga0395900_0035869 3300037418 Bacteria 5109
472 Ga0395900_0036906 3300037418 Bacteria 5037
473 Ga0395900_0037044 3300037418 Bacteria 5029
474 Ga0395900_0041050 3300037418 Bacteria 4771
475 Ga0395900_0048276 3300037418 Bacteria 4385
476 Ga0395900_0067230 3300037418 Bacteria 3682
477 Ga0395900_0084539 3300037418 Bacteria 3261
478 Ga0395900_0087716 3300037418 Bacteria 3197
479 Ga0395900_0092720 3300037418 Bacteria 3103
480 Ga0395900_0098431 3300037418 Bacteria 3005
481 Ga0395900_0171943 3300037418 Bacteria 2205
482 Ga0395900_0193437 3300037418 Bacteria 2062
483 Ga0395900_0217842 3300037418 Bacteria 1925
484 Ga0395900_0229740 3300037418 Bacteria 1866
485 Ga0395900_0260228 3300037418 Bacteria 1733
486 Ga0395900_0351265 3300037418 Bacteria 1448
487 Ga0395898_0004675 3300037466 Bacteria 14919
488 Ga0395898_0005170 3300037466 Bacteria 14117
489 Ga0395898_0008629 3300037466 Bacteria 10754
490 Ga0395898_0011863 3300037466 Bacteria 9024
491 Ga0395898_0012164 3300037466 Bacteria 8902
492 Ga0395898_0015585 3300037466 Bacteria 7792
493 Ga0395898_0017293 3300037466 Bacteria 7366
494 Ga0395898_0021431 3300037466 Bacteria 6554
495 Ga0395898_0023169 3300037466 Bacteria 6276
496 Ga0395898_0026636 3300037466 Bacteria 5814
497 Ga0395898_0030416 3300037466 Bacteria 5403
498 Ga0395898_0081061 3300037466 Bacteria 3129
499 Ga0395898_0085590 3300037466 Bacteria 3038
500 Ga0395898_0092794 3300037466 Bacteria 2903
501 Ga0395898_0104570 3300037466 Bacteria 2715
502 Ga0395898_0112887 3300037466 Bacteria 2604
503 Ga0395898_0156590 3300037466 Bacteria 2179
504 Ga0395898_0195168 3300037466 Bacteria 1934
505 Ga0395898_0211215 3300037466 Bacteria 1851
506 Ga0395898_0221362 3300037466 Bacteria 1805
507 Ga0395898_0347925 3300037466 Bacteria 1413
508 Ga0395898_0358761 3300037466 Bacteria 1390
509 Ga0395898_0484286 3300037466 Bacteria 1177
510 Ga0395898_0666674 3300037466 Bacteria 982
511 Ga0395905_0005356 3300037471 Bacteria 13110
512 Ga0395905_0005405 3300037471 Bacteria 13055
513 Ga0395905_0007227 3300037471 Bacteria 11072
514 Ga0395905_0009125 3300037471 Bacteria 9716
515 Ga0395905_0017394 3300037471 Bacteria 6827
516 Ga0395905_0019112 3300037471 Bacteria 6499
517 Ga0395905_0021364 3300037471 Bacteria 6121
518 Ga0395905_0022935 3300037471 Bacteria 5899
519 Ga0395905_0023760 3300037471 Bacteria 5787
520 Ga0395905_0027596 3300037471 Bacteria 5353
521 Ga0395905_0029167 3300037471 Bacteria 5200
522 Ga0395905_0030109 3300037471 Bacteria 5115
523 Ga0395905_0051964 3300037471 Bacteria 3838
524 Ga0395905_0053704 3300037471 Bacteria 3771
525 Ga0395905_0054812 3300037471 Bacteria 3731
526 Ga0395905_0084453 3300037471 Bacteria 2974
527 Ga0395905_0115358 3300037471 Bacteria 2524
528 Ga0395905_0303864 3300037471 Bacteria 1483
529 Ga0395905_0355371 3300037471 Bacteria 1357
530 Ga0395905_0476122 3300037471 Bacteria 1148
531 Ga0436364_0258924 3300037853 Bacteria 15643
532 Ga0436364_0935170 3300037853 Bacteria 2018
533 Ga0436364_1133240 3300037853 Bacteria 1259
534 Ga0395901_0001195 3300038443 Bacteria 27615
535 Ga0395901_0006581 3300038443 Bacteria 11744
536 Ga0395901_0006722 3300038443 Bacteria 11621
537 Ga0395901_0007177 3300038443 Bacteria 11238
538 Ga0395901_0009708 3300038443 Bacteria 9759
539 Ga0395901_0010611 3300038443 Bacteria 9332
540 Ga0395901_0012790 3300038443 Bacteria 8511
541 Ga0395901_0014259 3300038443 Bacteria 8091
542 Ga0395901_0016637 3300038443 Bacteria 7492
543 Ga0395901_0016691 3300038443 Bacteria 7480
544 Ga0395901_0020745 3300038443 Bacteria 6726
545 Ga0395901_0021773 3300038443 Bacteria 6569
546 Ga0395901_0026489 3300038443 Bacteria 5953
547 Ga0395901_0030244 3300038443 Bacteria 5579
548 Ga0395901_0033524 3300038443 Bacteria 5301
549 Ga0395901_0045914 3300038443 Bacteria 4535
550 Ga0395901_0062480 3300038443 Bacteria 3875
551 Ga0395901_0066153 3300038443 Bacteria 3765
552 Ga0395901_0088757 3300038443 Bacteria 3234
553 Ga0395901_0100349 3300038443 Bacteria 3036
554 Ga0395901_0102083 3300038443 Bacteria 3009
555 Ga0395901_0137682 3300038443 Bacteria 2566
556 Ga0395901_0145697 3300038443 Bacteria 2489
557 Ga0395901_0182661 3300038443 Bacteria 2200
558 Ga0395901_0245547 3300038443 Bacteria 1866
559 Ga0395901_0283918 3300038443 Bacteria 1719
560 Ga0395901_0407314 3300038443 Bacteria 1396
561 Ga0395901_0479407 3300038443 Bacteria 1269
562 Ga0395901_0569715 3300038443 Bacteria 1145
563 Ga0439466_0029263 3300041411 Bacteria 1896
564 Ga0439465_0002064 3300041413 Bacteria 6586
565 Ga0439465_0002174 3300041413 Bacteria 6433
566 Ga0439465_0016313 3300041413 Bacteria 2317
567 Ga0451841_0812662 3300041498 Bacteria 1354
568 Ga0439431_0044450 3300041997 Bacteria 1139
569 Ga0439445_0022877 3300042004 Bacteria 1579
570 Ga0439448_0002878 3300042005 Bacteria 4715
571 Ga0439448_0030956 3300042005 Bacteria 1699
572 Ga0439450_000648 3300042008 Bacteria 4632
573 Ga0439451_017316 3300042009 Bacteria 1452
574 Ga0439455_0009135 3300042012 Bacteria 2143
575 Ga0439463_000926 3300042016 Bacteria 8048
576 Ga0439444_0001800 3300042437 Bacteria 2836
577 Ga0439464_0008797 3300042439 Bacteria 2647
578 Ga0439440_0001901 3300042993 Bacteria 3881
579 Ga0466972_0002072 3300044658 Bacteria 9812
580 Ga0466972_0002500 3300044658 Bacteria 9091
581 Ga0466972_0018178 3300044658 Bacteria 3516
582 Ga0466972_0024771 3300044658 Bacteria 2978
583 Ga0466972_0032778 3300044658 Bacteria 2550
584 Ga0466965_0004079 3300044683 Bacteria 6481
585 Ga0466965_0007858 3300044683 Bacteria 4918
586 Ga0466965_0017974 3300044683 Bacteria 3383
587 Ga0466965_0118838 3300044683 Bacteria 1363
588 Ga0466966_0015602 3300044684 Bacteria 5021
589 Ga0466966_0108138 3300044684 Bacteria 1716
590 Ga0466961_0031897 3300044693 Bacteria 3386
591 Ga0466963_0145277 3300044694 Bacteria 1645
592 Ga0466970_0003109 3300044765 Bacteria 8060
593 Ga0466970_0019637 3300044765 Bacteria 3504
594 Ga0466957_0016862 3300044842 Bacteria 4274
595 Ga0466957_0097828 3300044842 Bacteria 1846
596 Ga0466960_0000238 3300044901 Bacteria 19096
597 Ga0466960_0026776 3300044901 Bacteria 2622
598 Ga0466958_0012637 3300045836 Bacteria 4786
599 Ga0466967_0013429 3300045976 Bacteria 6328
600 Ga0466967_0018684 3300045976 Bacteria 5549
601 Ga0466967_0102077 3300045976 Bacteria 2623
602 Ga0466967_0201417 3300045976 Bacteria 1886
603 Ga0466967_0223166 3300045976 Bacteria 1792
604 Ga0495603_0056427 3300046455 Bacteria 2325
605 Ga0495629_0018923 3300046459 Bacteria 4924
606 Ga0495629_0057356 3300046459 Bacteria 2723
607 Ga0495638_0001626 3300046460 Bacteria 19998
608 Ga0495641_0019344 3300046461 Bacteria 3487
609 Ga0495580_0290478 3300046472 Bacteria 1114
610 Ga0495582_0039529 3300046473 Bacteria 2597
611 Ga0495582_0042163 3300046473 Bacteria 2514
612 Ga0495639_0013535 3300046475 Bacteria 3525
613 Ga0495662_0162589 3300046476 Bacteria 1100
614 Ga0495594_0107046 3300046499 Bacteria 1575
615 Ga0495607_0028236 3300046501 Bacteria 3463
616 Ga0495607_0108285 3300046501 Bacteria 1477
617 Ga0495630_0110401 3300046517 Bacteria 2083
618 Ga0495644_0035317 3300046523 Bacteria 1888
619 Ga0495648_0003500 3300046524 Bacteria 13766
620 Ga0495666_0018688 3300046526 Bacteria 3444
621 Ga0495642_0027887 3300046528 Bacteria 2248
622 Ga0495654_0033319 3300046530 Bacteria 2608
623 Ga0495665_0021183 3300046531 Bacteria 3492
624 Ga0495609_0051314 3300046538 Bacteria 1837
625 Ga0495645_0016917 3300046543 Bacteria 5219
626 Ga0495645_0097207 3300046543 Bacteria 2097
627 Ga0495667_0213348 3300046559 Bacteria 1233
628 Ga0495656_0031116 3300046615 Bacteria 2162
629 Ga0495668_0000043 3300046616 Bacteria 227636
630 Ga0495611_0033069 3300046648 Bacteria 2282
631 Ga0495588_0021242 3300046674 Bacteria 3197
632 Ga0495599_0135086 3300046678 Bacteria 1531
633 Ga0495613_0130151 3300046689 Bacteria 1802
634 Ga0495671_0103066 3300046692 Bacteria 1394
635 Ga0495589_0057590 3300046794 Bacteria 1911
636 Ga0495660_0191986 3300046810 Bacteria 981
637 Ga0495581_0022849 3300047315 Bacteria 3622
638 Ga0495581_0105942 3300047315 Bacteria 1634
639 Ga0495604_0188501 3300047317 Bacteria 1439
640 Ga0495674_0002886 3300047319 Bacteria 16724
641 Ga0495672_0003728 3300047320 Bacteria 12851
642 Ga0495676_0074453 3300047321 Bacteria 2600
643 Ga0495676_0083108 3300047321 Bacteria 2421
644 Ga0495676_0149160 3300047321 Bacteria 1667
645 Ga0495680_0135328 3300047322 Bacteria 1807
646 Ga0495683_0002342 3300047323 Bacteria 11506
647 Ga0495683_0095641 3300047323 Bacteria 1434
648 Ga0495673_0003932 3300047469 Bacteria 9524
649 Ga0495684_0166327 3300047471 Bacteria 1642
650 Ga0495686_0000930 3300047472 Bacteria 36471
651 Ga0495593_0021728 3300047673 Bacteria 3580
652 Ga0495593_0074653 3300047673 Bacteria 1758
653 Ga0495626_0041717 3300048091 Bacteria 2159
654 Ga0496100_0000960 3300048903 Bacteria 13806
655 Ga0496100_0001591 3300048903 Bacteria 11186
656 Ga0496100_0028475 3300048903 Bacteria 3446
657 Ga0496100_0031682 3300048903 Bacteria 3289
658 Ga0496100_0058911 3300048903 Bacteria 2522
659 Ga0496100_0104053 3300048903 Bacteria 1961
660 Ga0496101_0000049 3300048904 Bacteria 146432
661 Ga0496101_0001902 3300048904 Bacteria 12613
662 Ga0496101_0002184 3300048904 Bacteria 11948
663 Ga0496101_0004825 3300048904 Bacteria 8552
664 Ga0496101_0009937 3300048904 Bacteria 6270
665 Ga0496101_0027142 3300048904 Bacteria 3985
666 Ga0496101_0042557 3300048904 Bacteria 3242
667 Ga0496101_0046183 3300048904 Bacteria 3122
668 Ga0496102_0000011 3300048905 Bacteria 321716
669 Ga0496102_0001591 3300048905 Bacteria 20026
670 Ga0496102_0003839 3300048905 Bacteria 12716
671 Ga0496102_0008601 3300048905 Bacteria 8758
672 Ga0496102_0015388 3300048905 Bacteria 6663
673 Ga0496102_0042388 3300048905 Bacteria 4124
674 Ga0496102_0102421 3300048905 Bacteria 2662
675 Ga0496102_0113660 3300048905 Bacteria 2526
676 Ga0496102_0155143 3300048905 Bacteria 2152
677 Ga0496102_0205131 3300048905 Bacteria 1858
678 Ga0496103_0000032 3300048906 Bacteria 201453
679 Ga0496103_0003321 3300048906 Bacteria 9839
680 Ga0496103_0012601 3300048906 Bacteria 5015
681 Ga0496104_0005333 3300048907 Bacteria 11248
682 Ga0496104_0012533 3300048907 Bacteria 7626
683 Ga0496104_0040252 3300048907 Bacteria 4380
684 Ga0496104_0042055 3300048907 Bacteria 4286
685 Ga0496104_0047670 3300048907 Bacteria 4038
686 Ga0496104_0279232 3300048907 Bacteria 1583
687 Ga0496105_0004137 3300048908 Bacteria 10883
688 Ga0496105_0006255 3300048908 Bacteria 9143
689 Ga0496105_0028476 3300048908 Bacteria 4568
690 Ga0496105_0152460 3300048908 Bacteria 1899
691 Ga0496105_0229004 3300048908 Bacteria 1511
692 Ga0496106_0000341 3300048909 Bacteria 32846
693 Ga0496106_0004881 3300048909 Bacteria 9930
694 Ga0496106_0007534 3300048909 Bacteria 8052
695 Ga0496106_0011173 3300048909 Bacteria 6643
696 Ga0496106_0014951 3300048909 Bacteria 5742
697 Ga0496106_0098119 3300048909 Bacteria 2269
698 Ga0496107_0000587 3300048910 Bacteria 20311
699 Ga0496107_0003049 3300048910 Bacteria 11113
700 Ga0496107_0009076 3300048910 Bacteria 6894
701 Ga0496107_0025423 3300048910 Bacteria 4192
702 Ga0496107_0041896 3300048910 Bacteria 3289
703 Ga0496107_0059028 3300048910 Bacteria 2775
704 Ga0496107_0119333 3300048910 Bacteria 1942
705 Ga0496107_0121627 3300048910 Bacteria 1923
706 Ga0496107_0227502 3300048910 Bacteria 1388
707 Ga0496108_0002245 3300048911 Bacteria 15463
708 Ga0496108_0002487 3300048911 Bacteria 14750
709 Ga0496108_0090338 3300048911 Bacteria 2604
710 Ga0496108_0149231 3300048911 Bacteria 2017
711 Ga0496108_0161442 3300048911 Bacteria 1937
712 Ga0496108_0174129 3300048911 Bacteria 1862
713 Ga0496108_0417111 3300048911 Bacteria 1172
714 Ga0496109_0000632 3300048912 Bacteria 29339
715 Ga0496109_0003108 3300048912 Bacteria 13847
716 Ga0496109_0138522 3300048912 Bacteria 2275
717 Ga0496110_0009789 3300048913 Bacteria 7762
718 Ga0496110_0041103 3300048913 Bacteria 4033
719 Ga0496110_0188774 3300048913 Bacteria 1871
720 Ga0496110_0338779 3300048913 Bacteria 1370
721 Ga0496110_0473237 3300048913 Bacteria 1141
722 Ga0496111_0155416 3300048914 Bacteria 1697
723 Ga0496111_0245471 3300048914 Bacteria 1329
724 Ga0496112_0005972 3300048915 Bacteria 10623
725 Ga0496112_0018835 3300048915 Bacteria 6505
726 Ga0496112_0020730 3300048915 Bacteria 6236
727 Ga0496112_0028238 3300048915 Bacteria 5414
728 Ga0496112_0070765 3300048915 Bacteria 3447
729 Ga0496112_0080617 3300048915 Bacteria 3218
730 Ga0496112_0703829 3300048915 Bacteria 938
731 Ga0496113_0038560 3300048916 Bacteria 3514
732 Ga0496113_0064014 3300048916 Bacteria 2780
733 Ga0496113_0116570 3300048916 Bacteria 2084
734 Ga0496114_0002202 3300048917 Bacteria 14834
735 Ga0496114_0002779 3300048917 Bacteria 13400
736 Ga0496114_0004261 3300048917 Bacteria 11072
737 Ga0496114_0008630 3300048917 Bacteria 8076
738 Ga0496114_0017313 3300048917 Bacteria 5815
739 Ga0496114_0018592 3300048917 Bacteria 5622
740 Ga0496115_0019843 3300048918 Bacteria 5179
741 Ga0496115_0029770 3300048918 Bacteria 4291
742 Ga0496115_0046801 3300048918 Bacteria 3458
743 Ga0496115_0055592 3300048918 Bacteria 3179
744 Ga0496115_0062613 3300048918 Bacteria 3001
745 Ga0496116_0000072 3300048919 Bacteria 238158
746 Ga0496116_0008569 3300048919 Bacteria 8851
747 Ga0496117_0000039 3300048920 Bacteria 322143
748 Ga0496117_0002717 3300048920 Bacteria 21755
749 Ga0496118_0000035 3300048921 Bacteria 322143
750 Ga0496118_0004669 3300048921 Bacteria 16062
751 Ga0496119_0000326 3300048922 Bacteria 66943
752 Ga0496119_0005551 3300048922 Bacteria 12004
753 Ga0496120_0000190 3300048923 Bacteria 105211
754 Ga0496120_0002518 3300048923 Bacteria 18325
755 Ga0496121_0000546 3300048924 Bacteria 71177
756 Ga0496121_0005473 3300048924 Bacteria 16258
757 Ga0496124_0045301 3300048927 Bacteria 3771
758 Ga0496125_0033433 3300048928 Bacteria 4550
759 Ga0496125_0078699 3300048928 Bacteria 2532
760 Ga0496125_0123588 3300048928 Bacteria 1840
761 Ga0496126_0000282 3300048929 Bacteria 107567
762 Ga0496126_0006945 3300048929 Bacteria 12532
763 Ga0495682_0039927 3300049460 Bacteria 1722
764 Ga0501032_0002501 3300049569 Bacteria 14354
765 Ga0501034_0005291 3300049571 Bacteria 14156
766 Ga0501038_0002320 3300049574 Bacteria 17693
767 Ga0501039_0067137 3300049575 Bacteria 2785
768 Ga0501043_0004391 3300049579 Bacteria 11463
769 Ga0501067_0018684 3300049583 Bacteria 3837
770 Ga0501069_0008480 3300049585 Bacteria 5405
771 Ga0501070_0006500 3300049586 Bacteria 9940
772 Ga0501080_0056217 3300049742 Bacteria 3666
773 Ga0501044_0042992 3300049823 Bacteria 4696
774 nmdc:mga03683_36767_c1 3300050489 Bacteria 1993
775 nmdc:mga03683_8676_c1 3300050489 Bacteria 3583
776 nmdc:mga03n38_2529_c1 3300050490 Bacteria 4890
777 nmdc:mga03n38_4306_c1 3300050490 Bacteria 4693
778 nmdc:mga03n38_50301_c1 3300050490 Bacteria 1857
779 nmdc:mga03n38_71708_c1 3300050490 Bacteria 1604
780 nmdc:mga00v17_165751_c1 3300050491 Bacteria 1424
781 nmdc:mga00v17_20017_c1 3300050491 Bacteria 3828
782 nmdc:mga00v17_50911_c1 3300050491 Bacteria 2518
783 nmdc:mga00v17_51976_c1 3300050491 Bacteria 2492
784 nmdc:mga00v17_6103_c1 3300050491 Bacteria 6379
785 nmdc:mga00v17_90824_c1 3300050491 Bacteria 1918
786 nmdc:mga00v17_9818_c1 3300050491 Bacteria 5199
787 nmdc:mga0yw44_20481_c1 3300050492 Bacteria 3671
788 nmdc:mga0yw44_35435_c1 3300050492 Bacteria 2932
789 nmdc:mga06z11_90139_c1 3300050494 Bacteria 1663
790 nmdc:mga07m45_103158_c1 3300050496 Bacteria 1639
791 nmdc:mga07m45_16658_c1 3300050496 Bacteria 3936
792 nmdc:mga07m45_20738_c2 3300050496 Bacteria 3173
793 nmdc:mga07m45_24649_c1 3300050496 Bacteria 3297
794 nmdc:mga05p37_141531_c1 3300050507 Bacteria 2947
795 nmdc:mga05p37_186819_c1 3300050507 Bacteria 2519
796 nmdc:mga05p37_33256_c1 3300050507 Bacteria 6315
797 nmdc:mga05p37_35343_c1 3300050507 Bacteria 6126
798 nmdc:mga05p37_44936_c1 3300050507 Bacteria 5434
799 nmdc:mga05p37_92119_c1 3300050507 Bacteria 3735
800 nmdc:mga09592_507444_c1 3300050508 Bacteria 1038
801 nmdc:mga0qj67_177802_c1 3300050509 Bacteria 1728
802 nmdc:mga0qj67_35750_c1 3300050509 Bacteria 3885
803 nmdc:mga0qj67_77454_c1 3300050509 Bacteria 2660
804 nmdc:mga06r32_139904_c1 3300050510 Bacteria 2396
805 nmdc:mga06r32_295753_c1 3300050510 Bacteria 1605
806 nmdc:mga06r32_441290_c1 3300050510 Bacteria 1282
807 nmdc:mga06r32_685022_c1 3300050510 Bacteria 991
808 nmdc:mga08y16_311844_c1 3300050511 Bacteria 1620
809 nmdc:mga0n895_124605_c1 3300050512 Bacteria 2600
810 nmdc:mga0n895_12610_c1 3300050512 Bacteria 7587
811 nmdc:mga0n895_18195_c1 3300050512 Bacteria 6496
812 nmdc:mga0n895_185673_c1 3300050512 Bacteria 2110
813 nmdc:mga0n895_438233_c1 3300050512 Bacteria 1320
814 nmdc:mga0n895_78909_c1 3300050512 Bacteria 3277
815 nmdc:mga0rr50_51509_c1 3300050513 Bacteria 3055
816 nmdc:mga0rr50_55676_c1 3300050513 Bacteria 2952
817 nmdc:mga08x19_161818_c1 3300050514 Bacteria 1520
818 nmdc:mga08x19_251679_c1 3300050514 Bacteria 1220
819 nmdc:mga08x19_9746_c1 3300050514 Bacteria 5754
820 nmdc:mga0a205_108463_c1 3300050515 Bacteria 2675
821 nmdc:mga0a205_116673_c1 3300050515 Bacteria 2568
822 nmdc:mga0a205_231675_c1 3300050515 Bacteria 1730
823 nmdc:mga0sz30_15564_c1 3300050516 Bacteria 3007
824 nmdc:mga0sz30_31066_c1 3300050516 Bacteria 2209
825 nmdc:mga0sz30_41712_c1 3300050516 Bacteria 1930
826 Ga0495601_0073134 3300053077 Bacteria 2191
827 Ga0495655_0003419 3300053083 Bacteria 2619
828 Ga0495619_0140259 3300053085 Bacteria 1664
829 Ga0500556_0002686 3300053104 Bacteria 5524
830 Ga0500562_005324 3300053108 Bacteria 3231
831 Ga0500628_006203 3300053129 Bacteria 2015
832 Ga0500652_000524 3300053131 Bacteria 13546
833 Ga0500616_0024486 3300053153 Bacteria 3353
834 Ga0466962_0037352 3300061719 Bacteria 2325
835 Ga0530510_0024658 3300061734 Bacteria 4295
836 2558910956 2558860112 Bacteria 9931328
837 2566994140 2565956761 Bacteria 6601618
838 2583152071 2582580736 Bacteria 5325865
839 2586064322 2585427649 Bacteria 9053857
840 2644486884 2643221687 Bacteria 6500351
841 2738889842 2738541308 Bacteria 7020677
842 2739324526 2738543027 Bacteria 6409078
843 2739365159 2738543034 Bacteria 6084756
844 2753038639 2751185725 Bacteria 5740550
845 2753327151 2751185792 Bacteria 5739090
846 2760306634 2758568522 Bacteria 5953541
847 2760624893 2758568621 Bacteria 5967089
848 2776374442 2775506925 Bacteria 7237746
849 2776376225 2775506925 Bacteria 7237746
850 2809029794 2808606394 Bacteria 6248540
851 2809586428 2808606522 Bacteria 9488490
852 2842139710 2842134933 Bacteria 5847019
853 2863067968 2863067949 Bacteria 8541735
854 2863071995 2863067949 Bacteria 8541735
855 2863074240 2863067949 Bacteria 8541735
856 2870789127 2870782633 Bacteria 9624083
857 2902797535 2902792274 Bacteria 7270173
858 2902843153 2902837492 Bacteria 6697721
859 2904539908 2904535858 Bacteria 6308016
860 2904768986 2904765812 Bacteria 5369154
861 2904771735 2904770941 Bacteria 5580202
862 2908811774 2908811453 Bacteria 5478616
863 2915361707 2915358134 Bacteria 6050864
864 2915775906 2915768154 Bacteria 8424322
865 2919420101 2919420072 Bacteria 5390363
866 2919434140 2919432681 Bacteria 5390474
867 2922560482 2922554459 Bacteria 6683962
868 2929217619 2929212328 Bacteria 7708288
869 2939584844 2939582691 Bacteria 7088898
870 2974320034 2974315732 Bacteria 4602776
871 2984523901 2984523437 Bacteria 4508481
872 8003323256 8003314358 Bacteria 10575343
873 8054477128 8054472261 Bacteria 7464355
874 8056208129 8056207758 Bacteria 8639239
875 8056582898 8056579771 Bacteria 5840325
876 Ga0075363_100016139
877 LJQas_1000960
878 JGI24746J21847_1000498
879 JGI24746J21847_1000616
880 JGI24747J21853_1000476
881 JGI24747J21853_1007729
882 JGI24743J22301_10000693
883 JGI24750J21931_1001011
884 JGI24750J21931_1001409
885 JGI24750J21931_1004899
886 JGI24745J21846_1000218
887 JGI24745J21846_1000375
888 JGI24748J21848_1000341
889 JGI24738J21930_10002720
890 JGI24749J21850_1000662
891 JGI24744J21845_10001427
892 JGI24744J21845_10002829
893 JGI24034J26672_10000514
894 JGI25406J46586_10006156
895 JGI25406J46586_10022519
896 JGI25406J46586_10022578
897 JGI25407J50210_10000161
898 JGI25407J50210_10002355
899 JGI25407J50210_10002796
900 Ga0055540_1002047
901 Ga0070658_10137459
902 Ga0070676_10009535
903 Ga0070690_100018186
904 Ga0070690_100183519
905 Ga0070670_100179317
906 Ga0068869_100079280
907 Ga0070666_10109462
908 Ga0070666_10219228
909 Ga0070682_100001259
910 Ga0070682_100008605
911 Ga0070682_100048547
912 Ga0070682_100300503
913 Ga0068868_100124331
914 Ga0068868_100324732
915 Ga0070660_100219165
916 Ga0070689_100035434
917 Ga0070691_10002926
918 Ga0070687_100005625
919 Ga0070668_100001165
920 Ga0070668_100001855
921 Ga0070668_100043544
922 Ga0070668_100181765
923 Ga0070668_100256367
924 Ga0070669_100018342
925 Ga0070675_100127114
926 Ga0070671_100003987
927 Ga0070671_100011350
928 Ga0070671_100012680
929 Ga0070671_100204753
930 Ga0070674_100012380
931 Ga0070673_100029239
932 Ga0070688_100002117
933 Ga0070659_100018966
934 Ga0070659_100028949
935 Ga0070659_100164538
936 Ga0070667_100000468
937 Ga0070667_100015390
938 Ga0070703_10006058
939 Ga0070709_10010224
940 Ga0070709_10020192
941 Ga0070714_100046442
942 Ga0070714_100103473
943 Ga0070714_100106541
944 Ga0070714_100364770
945 Ga0070710_10027723
946 Ga0070701_10000617
947 Ga0070711_100078694
948 Ga0070711_100137340
949 Ga0070705_100009026
950 Ga0070705_100032890
951 Ga0070700_100002857
952 Ga0070700_100135606
953 Ga0070700_100251765
954 Ga0070694_100012620
955 Ga0070708_100215008
956 Ga0070708_100327320
957 Ga0070663_100003517
958 Ga0070663_100015294
959 Ga0070663_100256443
960 Ga0070678_100004949
961 Ga0070678_100139002
962 Ga0070681_10157058
963 Ga0070685_10001600
964 Ga0070685_10009454
965 Ga0070685_10034348
966 Ga0070685_10119212
967 Ga0070706_100019073
968 Ga0070707_100026830
969 Ga0070707_100043795
970 Ga0070707_100151768
971 Ga0070698_100016760
972 Ga0070698_100193781
973 Ga0070698_100473134
974 Ga0070699_100008999
975 Ga0070699_100268479
976 Ga0070699_100285158
977 Ga0070679_100194817
978 Ga0070697_100038352
979 Ga0070697_100547925
980 Ga0068853_100018224
981 Ga0068853_100021473
982 Ga0070672_100186466
983 Ga0070686_100010943
984 Ga0070686_100107966
985 Ga0070695_100007358
986 Ga0070695_100068541
987 Ga0070695_100095874
988 Ga0070693_100008993
989 Ga0070693_100025938
990 Ga0070665_100004640
991 Ga0070665_100005624
992 Ga0070665_100079251
993 Ga0070704_100094735
994 Ga0070704_100537253
995 Ga0068856_100052713
996 Ga0070702_100029771
997 Ga0068852_100112979
998 Ga0068859_100003567
999 Ga0068859_100028179
1000 Ga0068864_100012164
1001 Ga0068866_10004444
1002 Ga0068861_100051091
1003 Ga0068861_100056955
1004 Ga0068861_100105274
1005 Ga0068863_100009877
1006 Ga0068863_100013617
1007 Ga0068863_100338869
1008 Ga0068858_100005179
1009 Ga0068858_100381452
1010 Ga0068860_100000162
1011 Ga0068860_100064242
1012 Ga0068860_100095237
1013 Ga0068860_100117557
1014 Ga0068860_100519443
1015 Ga0068862_100000373
1016 Ga0068862_100290613
1017 Ga0068862_100491813
1018 Ga0081455_10004355
1019 Ga0081455_10077520
1020 Ga0081455_10166767
1021 Ga0081538_10000016
1022 Ga0081538_10000689
1023 Ga0081538_10004047
1024 Ga0081538_10010693
1025 Ga0081538_10028847
1026 Ga0081540_1000672
1027 Ga0081539_10000473
1028 Ga0081539_10002003
1029 Ga0081539_10005624
1030 Ga0070717_10274210
1031 Ga0075365_10028659
1032 Ga0075365_10050794
1033 Ga0075363_100010049
1034 Ga0075363_100039578
1035 Ga0075363_100113166
1036 Ga0075364_10005595
1037 Ga0075364_10008577
1038 Ga0075364_10025508
1039 Ga0075364_10226531
1040 Ga0070715_10002160
1041 Ga0070715_10005623
1042 Ga0070715_10023821
1043 Ga0070716_100004804
1044 Ga0070712_100000457
1045 Ga0070712_100010040
1046 Ga0075362_10007045
1047 Ga0075362_10016171
1048 Ga0075362_10018230
1049 Ga0075367_10065059
1050 Ga0075369_10007854
1051 Ga0075369_10009484
1052 Ga0075369_10023442
1053 Ga0075366_10129291
1054 Ga0097621_100002586
1055 Ga0097621_100009467
1056 Ga0097621_100014025
1057 Ga0075370_10003318
1058 Ga0075370_10011114
1059 Ga0075370_10016689
1060 Ga0075370_10016905
1061 Ga0075370_10017518
1062 Ga0075370_10026776
1063 Ga0075370_10173326
1064 Ga0068871_100194905
1065 Ga0075428_100030957
1066 Ga0075428_100121239
1067 Ga0075430_100041879
1068 Ga0075430_100050876
1069 Ga0075430_100069815
1070 Ga0075431_100141728
1071 Ga0075433_10007344
1072 Ga0075433_10025121
1073 Ga0075434_100055191
1074 Ga0075434_100068928
1075 Ga0075434_100071810
1076 Ga0075434_100423274
1077 Ga0075429_100423054
1078 Ga0068865_100002260
1079 Ga0075436_100020623
1080 Ga0097620_100003567
1081 Ga0097620_100028179
1082 Ga0075435_100016666
1083 Ga0075435_100095458
1084 Ga0099795_10009068
1085 Ga0099795_10027342
1086 Ga0105250_10009359
1087 Ga0111539_10172596
1088 Ga0111539_10390645
1089 Ga0105245_10056439
1090 Ga0105245_10304902
1091 Ga0105247_10000079
1092 Ga0105247_10050758
1093 Ga0105247_10053743
1094 Ga0105247_10322885
1095 Ga0114129_10006035
1096 Ga0114129_10009275
1097 Ga0114129_10035738
1098 Ga0114129_10048133
1099 Ga0114129_10175878
1100 Ga0105243_10059404
1101 Ga0105241_10005880
1102 Ga0105241_10074070
1103 Ga0105242_10006380
1104 Ga0105242_10062755
1105 Ga0105248_10000827
1106 Ga0105248_10042193
1107 Ga0105248_10063895
1108 Ga0105248_10093205
1109 Ga0105248_10404642
1110 Ga0105237_10004991
1111 Ga0105237_10043563
1112 Ga0105237_10129585
1113 Ga0105238_10029035
1114 Ga0105238_10142393
1115 Ga0105249_10000098
1116 Ga0105249_10004019
1117 Ga0105249_10010991
1118 Ga0105249_10212766
1119 Ga0099796_10000539
1120 Ga0105239_10056552
1121 Ga0105239_10178515
1122 Ga0105239_10216429
1123 Ga0105246_10003571
1124 Ga0105246_10061056
1125 Ga0157371_10045063
1126 Ga0157369_10045974
1127 Ga0157374_10005982
1128 Ga0157374_10033291
1129 Ga0157378_10002762
1130 Ga0157378_10029547
1131 Ga0157378_10043774
1132 Ga0163162_10020021
1133 Ga0163162_10087064
1134 Ga0163162_10118515
1135 Ga0163162_10193683
1136 Ga0163162_10249706
1137 Ga0163162_10355421
1138 Ga0157372_10048650
1139 Ga0157372_10352980
1140 Ga0157375_10284512
1141 Ga0157375_10569919
1142 Ga0163163_10043510
1143 Ga0163163_10169799
1144 Ga0163163_10337839
1145 Ga0157380_10007667
1146 Ga0157380_10030175
1147 Ga0157377_10013154
1148 Ga0157377_10015443
1149 Ga0157379_10063162
1150 Ga0157376_10004627
1151 Ga0157376_10051774
1152 Ga0163161_10200668
1153 Ga0209051_1000539
1154 Ga0209051_1001358
1155 Ga0209051_1008208
1156 Ga0207696_1009721
1157 Ga0207653_10003334
1158 Ga0207692_10001625
1159 Ga0207692_10036730
1160 Ga0207642_10000593
1161 Ga0207710_10000022
1162 Ga0207710_10005837
1163 Ga0207688_10001754
1164 Ga0207688_10017263
1165 Ga0207680_10059954
1166 Ga0207647_10016233
1167 Ga0207647_10092973
1168 Ga0207685_10000084
1169 Ga0207685_10007018
1170 Ga0207699_10004982
1171 Ga0207645_10008761
1172 Ga0207684_10013292
1173 Ga0207654_10048355
1174 Ga0207671_10012324
1175 Ga0207671_10074839
1176 Ga0207693_10000670
1177 Ga0207693_10067119
1178 Ga0207663_10002342
1179 Ga0207663_10115587
1180 Ga0207660_10011508
1181 Ga0207660_10079080
1182 Ga0207662_10010107
1183 Ga0207662_10073832
1184 Ga0207657_10023385
1185 Ga0207657_10142782
1186 Ga0207652_10029963
1187 Ga0207646_10063429
1188 Ga0207681_10009873
1189 Ga0207681_10165682
1190 Ga0207650_10150017
1191 Ga0207687_10026499
1192 Ga0207687_10026712
1193 Ga0207687_10242909
1194 Ga0207700_10004729
1195 Ga0207700_10007267
1196 Ga0207700_10179471
1197 Ga0207664_10001469
1198 Ga0207664_10006181
1199 Ga0207664_10075349
1200 Ga0207644_10003245
1201 Ga0207644_10007403
1202 Ga0207644_10075147
1203 Ga0207644_10132536
1204 Ga0207644_10135036
1205 Ga0207690_10359956
1206 Ga0207706_10040444
1207 Ga0207706_10199546
1208 Ga0207706_10262713
1209 Ga0207686_10005080
1210 Ga0207686_10019694
1211 Ga0207686_10068349
1212 Ga0207709_10008531
1213 Ga0207670_10006823
1214 Ga0207669_10003581
1215 Ga0207704_10001501
1216 Ga0207704_10133529
1217 Ga0207665_10015966
1218 Ga0207665_10119046
1219 Ga0207665_10121858
1220 Ga0207691_10018296
1221 Ga0207711_10000404
1222 Ga0207711_10006841
1223 Ga0207711_10026567
1224 Ga0207711_10165617
1225 Ga0207689_10023474
1226 Ga0207689_10104677
1227 Ga0207661_10300047
1228 Ga0207667_10262170
1229 Ga0207667_10601979
1230 Ga0207667_10639444
1231 Ga0207651_10062993
1232 Ga0207712_10000076
1233 Ga0207712_10004461
1234 Ga0207712_10062806
1235 Ga0207712_10142265
1236 Ga0207668_10013992
1237 Ga0207668_10025220
1238 Ga0207668_10032618
1239 Ga0207668_10082354
1240 Ga0207668_10161284
1241 Ga0207668_10275669
1242 Ga0207658_10000821
1243 Ga0207677_10002902
1244 Ga0207677_10215197
1245 Ga0207677_10451124
1246 Ga0207703_10006399
1247 Ga0207703_10069033
1248 Ga0207703_10261373
1249 Ga0207639_10038395
1250 Ga0207639_10172673
1251 Ga0207639_10231259
1252 Ga0207639_10407297
1253 Ga0207678_10003523
1254 Ga0207678_10016735
1255 Ga0207708_10001232
1256 Ga0207708_10011608
1257 Ga0207702_10074384
1258 Ga0207702_10445376
1259 Ga0207641_10002622
1260 Ga0207641_10004801
1261 Ga0207641_10056732
1262 Ga0207641_10118121
1263 Ga0207648_10006703
1264 Ga0207676_10010661
1265 Ga0207675_100006346
1266 Ga0207675_100058819
1267 Ga0207675_100150315
1268 Ga0207675_100162814
1269 Ga0207675_100309781
1270 Ga0207683_10000111
1271 Ga0207683_10000252
1272 Ga0207683_10026842
1273 Ga0207683_10164325
1274 Ga0207698_10195900
1275 Ga0209179_1003876
1276 Ga0207428_10331186
1277 Ga0268266_10022049
1278 Ga0268266_10023683
1279 Ga0268266_10060816
1280 Ga0268266_10275322
1281 Ga0268265_10000368
1282 Ga0268265_10018475
1283 Ga0268265_10372366
1284 Ga0268264_10000017
1285 Ga0268264_10021985
1286 Ga0268264_10056691
1287 Ga0268264_10094037
1288 Ga0268264_10221883
1289 Ga0265319_1006706
1290 Ga0265760_10034700
1291 Ga0307513_10273927
1292 Ga0307405_10077187
1293 Ga0307518_10002006
1294 Ga0307410_10099905
1295 Ga0307406_10068567
1296 Ga0307412_10069486
1297 Ga0307409_100014560
1298 Ga0307416_100040466
1299 Ga0307416_100143117
1300 Ga0307416_100245953
1301 Ga0307411_10035845
1302 Ga0307415_100112340
1303 Ga0307507_10029505
1304 Ga0307510_10018502
1305 Ga0373928_0010127
1306 Ga0373940_0005513
1307 Ga0373951_0009031
1308 Ga0373923_0006939
1309 Ga0373932_0078881
1310 Ga0373936_0003887
1311 Ga0373941_0026896
1312 Ga0373945_0016230
1313 Ga0373946_0050101
1314 Ga0373924_0032783
1315 Ga0373931_0018099
1316 Ga0373931_0075210
1317 Ga0373931_0077301
1318 Ga0373935_0055434
1319 Ga0373935_0071955
1320 Ga0373927_0020945
1321 Ga0373933_0263868
1322 Ga0373947_0034554
1323 Ga0373947_0111071
1324 Ga0373925_0026479
1325 Ga0373925_0029100
1326 Ga0395899_0003336
1327 Ga0395899_0021812
1328 Ga0395899_0026222
1329 Ga0395899_0031790
1330 Ga0395899_0041967
1331 Ga0395899_0044366
1332 Ga0395899_0090940
1333 Ga0395899_0102694
1334 Ga0395899_0104588
1335 Ga0395899_0112110
1336 Ga0395899_0120107
1337 Ga0395899_0212982
1338 Ga0395899_0264921
1339 Ga0395900_0006560
1340 Ga0395900_0011651
1341 Ga0395900_0012286
1342 Ga0395900_0015379
1343 Ga0395900_0032309
1344 Ga0395900_0034103
1345 Ga0395900_0034752
1346 Ga0395900_0035869
1347 Ga0395900_0036906
1348 Ga0395900_0037044
1349 Ga0395900_0041050
1350 Ga0395900_0048276
1351 Ga0395900_0067230
1352 Ga0395900_0084539
1353 Ga0395900_0087716
1354 Ga0395900_0092720
1355 Ga0395900_0098431
1356 Ga0395900_0171943
1357 Ga0395900_0193437
1358 Ga0395900_0217842
1359 Ga0395900_0229740
1360 Ga0395900_0260228
1361 Ga0395900_0351265
1362 Ga0395898_0004675
1363 Ga0395898_0005170
1364 Ga0395898_0008629
1365 Ga0395898_0011863
1366 Ga0395898_0012164
1367 Ga0395898_0015585
1368 Ga0395898_0017293
1369 Ga0395898_0021431
1370 Ga0395898_0023169
1371 Ga0395898_0026636
1372 Ga0395898_0030416
1373 Ga0395898_0081061
1374 Ga0395898_0085590
1375 Ga0395898_0092794
1376 Ga0395898_0104570
1377 Ga0395898_0112887
1378 Ga0395898_0156590
1379 Ga0395898_0195168
1380 Ga0395898_0211215
1381 Ga0395898_0221362
1382 Ga0395898_0347925
1383 Ga0395898_0358761
1384 Ga0395898_0484286
1385 Ga0395898_0666674
1386 Ga0395905_0005356
1387 Ga0395905_0005405
1388 Ga0395905_0007227
1389 Ga0395905_0009125
1390 Ga0395905_0017394
1391 Ga0395905_0019112
1392 Ga0395905_0021364
1393 Ga0395905_0022935
1394 Ga0395905_0023760
1395 Ga0395905_0027596
1396 Ga0395905_0029167
1397 Ga0395905_0030109
1398 Ga0395905_0051964
1399 Ga0395905_0053704
1400 Ga0395905_0054812
1401 Ga0395905_0084453
1402 Ga0395905_0115358
1403 Ga0395905_0303864
1404 Ga0395905_0355371
1405 Ga0395905_0476122
1406 Ga0436364_0258924
1407 Ga0436364_0935170
1408 Ga0436364_1133240
1409 Ga0395901_0001195
1410 Ga0395901_0006581
1411 Ga0395901_0006722
1412 Ga0395901_0007177
1413 Ga0395901_0009708
1414 Ga0395901_0010611
1415 Ga0395901_0012790
1416 Ga0395901_0014259
1417 Ga0395901_0016637
1418 Ga0395901_0016691
1419 Ga0395901_0020745
1420 Ga0395901_0021773
1421 Ga0395901_0026489
1422 Ga0395901_0030244
1423 Ga0395901_0033524
1424 Ga0395901_0045914
1425 Ga0395901_0062480
1426 Ga0395901_0066153
1427 Ga0395901_0088757
1428 Ga0395901_0100349
1429 Ga0395901_0102083
1430 Ga0395901_0137682
1431 Ga0395901_0145697
1432 Ga0395901_0182661
1433 Ga0395901_0245547
1434 Ga0395901_0283918
1435 Ga0395901_0407314
1436 Ga0395901_0479407
1437 Ga0395901_0569715
1438 Ga0439466_0029263
1439 Ga0439465_0002064
1440 Ga0439465_0002174
1441 Ga0439465_0016313
1442 Ga0451841_0812662
1443 Ga0439431_0044450
1444 Ga0439445_0022877
1445 Ga0439448_0002878
1446 Ga0439448_0030956
1447 Ga0439450_000648
1448 Ga0439451_017316
1449 Ga0439455_0009135
1450 Ga0439463_000926
1451 Ga0439444_0001800
1452 Ga0439464_0008797
1453 Ga0439440_0001901
1454 Ga0466972_0002072
1455 Ga0466972_0002500
1456 Ga0466972_0018178
1457 Ga0466972_0024771
1458 Ga0466972_0032778
1459 Ga0466965_0004079
1460 Ga0466965_0007858
1461 Ga0466965_0017974
1462 Ga0466965_0118838
1463 Ga0466966_0015602
1464 Ga0466966_0108138
1465 Ga0466961_0031897
1466 Ga0466963_0145277
1467 Ga0466970_0003109
1468 Ga0466970_0019637
1469 Ga0466957_0016862
1470 Ga0466957_0097828
1471 Ga0466960_0000238
1472 Ga0466960_0026776
1473 Ga0466958_0012637
1474 Ga0466967_0013429
1475 Ga0466967_0018684
1476 Ga0466967_0102077
1477 Ga0466967_0201417
1478 Ga0466967_0223166
1479 Ga0495603_0056427
1480 Ga0495629_0018923
1481 Ga0495629_0057356
1482 Ga0495638_0001626
1483 Ga0495641_0019344
1484 Ga0495580_0290478
1485 Ga0495582_0039529
1486 Ga0495582_0042163
1487 Ga0495639_0013535
1488 Ga0495662_0162589
1489 Ga0495594_0107046
1490 Ga0495607_0028236
1491 Ga0495607_0108285
1492 Ga0495630_0110401
1493 Ga0495644_0035317
1494 Ga0495648_0003500
1495 Ga0495666_0018688
1496 Ga0495642_0027887
1497 Ga0495654_0033319
1498 Ga0495665_0021183
1499 Ga0495609_0051314
1500 Ga0495645_0016917
1501 Ga0495645_0097207
1502 Ga0495667_0213348
1503 Ga0495656_0031116
1504 Ga0495668_0000043
1505 Ga0495611_0033069
1506 Ga0495588_0021242
1507 Ga0495599_0135086
1508 Ga0495613_0130151
1509 Ga0495671_0103066
1510 Ga0495589_0057590
1511 Ga0495660_0191986
1512 Ga0495581_0022849
1513 Ga0495581_0105942
1514 Ga0495604_0188501
1515 Ga0495674_0002886
1516 Ga0495672_0003728
1517 Ga0495676_0074453
1518 Ga0495676_0083108
1519 Ga0495676_0149160
1520 Ga0495680_0135328
1521 Ga0495683_0002342
1522 Ga0495683_0095641
1523 Ga0495673_0003932
1524 Ga0495684_0166327
1525 Ga0495686_0000930
1526 Ga0495593_0021728
1527 Ga0495593_0074653
1528 Ga0495626_0041717
1529 Ga0496100_0000960
1530 Ga0496100_0001591
1531 Ga0496100_0028475
1532 Ga0496100_0031682
1533 Ga0496100_0058911
1534 Ga0496100_0104053
1535 Ga0496101_0000049
1536 Ga0496101_0001902
1537 Ga0496101_0002184
1538 Ga0496101_0004825
1539 Ga0496101_0009937
1540 Ga0496101_0027142
1541 Ga0496101_0042557
1542 Ga0496101_0046183
1543 Ga0496102_0000011
1544 Ga0496102_0001591
1545 Ga0496102_0003839
1546 Ga0496102_0008601
1547 Ga0496102_0015388
1548 Ga0496102_0042388
1549 Ga0496102_0102421
1550 Ga0496102_0113660
1551 Ga0496102_0155143
1552 Ga0496102_0205131
1553 Ga0496103_0000032
1554 Ga0496103_0003321
1555 Ga0496103_0012601
1556 Ga0496104_0005333
1557 Ga0496104_0012533
1558 Ga0496104_0040252
1559 Ga0496104_0042055
1560 Ga0496104_0047670
1561 Ga0496104_0279232
1562 Ga0496105_0004137
1563 Ga0496105_0006255
1564 Ga0496105_0028476
1565 Ga0496105_0152460
1566 Ga0496105_0229004
1567 Ga0496106_0000341
1568 Ga0496106_0004881
1569 Ga0496106_0007534
1570 Ga0496106_0011173
1571 Ga0496106_0014951
1572 Ga0496106_0098119
1573 Ga0496107_0000587
1574 Ga0496107_0003049
1575 Ga0496107_0009076
1576 Ga0496107_0025423
1577 Ga0496107_0041896
1578 Ga0496107_0059028
1579 Ga0496107_0119333
1580 Ga0496107_0121627
1581 Ga0496107_0227502
1582 Ga0496108_0002245
1583 Ga0496108_0002487
1584 Ga0496108_0090338
1585 Ga0496108_0149231
1586 Ga0496108_0161442
1587 Ga0496108_0174129
1588 Ga0496108_0417111
1589 Ga0496109_0000632
1590 Ga0496109_0003108
1591 Ga0496109_0138522
1592 Ga0496110_0009789
1593 Ga0496110_0041103
1594 Ga0496110_0188774
1595 Ga0496110_0338779
1596 Ga0496110_0473237
1597 Ga0496111_0155416
1598 Ga0496111_0245471
1599 Ga0496112_0005972
1600 Ga0496112_0018835
1601 Ga0496112_0020730
1602 Ga0496112_0028238
1603 Ga0496112_0070765
1604 Ga0496112_0080617
1605 Ga0496112_0703829
1606 Ga0496113_0038560
1607 Ga0496113_0064014
1608 Ga0496113_0116570
1609 Ga0496114_0002202
1610 Ga0496114_0002779
1611 Ga0496114_0004261
1612 Ga0496114_0008630
1613 Ga0496114_0017313
1614 Ga0496114_0018592
1615 Ga0496115_0019843
1616 Ga0496115_0029770
1617 Ga0496115_0046801
1618 Ga0496115_0055592
1619 Ga0496115_0062613
1620 Ga0496116_0000072
1621 Ga0496116_0008569
1622 Ga0496117_0000039
1623 Ga0496117_0002717
1624 Ga0496118_0000035
1625 Ga0496118_0004669
1626 Ga0496119_0000326
1627 Ga0496119_0005551
1628 Ga0496120_0000190
1629 Ga0496120_0002518
1630 Ga0496121_0000546
1631 Ga0496121_0005473
1632 Ga0496124_0045301
1633 Ga0496125_0033433
1634 Ga0496125_0078699
1635 Ga0496125_0123588
1636 Ga0496126_0000282
1637 Ga0496126_0006945
1638 Ga0495682_0039927
1639 Ga0501032_0002501
1640 Ga0501034_0005291
1641 Ga0501038_0002320
1642 Ga0501039_0067137
1643 Ga0501043_0004391
1644 Ga0501067_0018684
1645 Ga0501069_0008480
1646 Ga0501070_0006500
1647 Ga0501080_0056217
1648 Ga0501044_0042992
1649 nmdc:mga03683_36767_c1
1650 nmdc:mga03683_8676_c1
1651 nmdc:mga03n38_2529_c1
1652 nmdc:mga03n38_4306_c1
1653 nmdc:mga03n38_50301_c1
1654 nmdc:mga03n38_71708_c1
1655 nmdc:mga00v17_165751_c1
1656 nmdc:mga00v17_20017_c1
1657 nmdc:mga00v17_50911_c1
1658 nmdc:mga00v17_51976_c1
1659 nmdc:mga00v17_6103_c1
1660 nmdc:mga00v17_90824_c1
1661 nmdc:mga00v17_9818_c1
1662 nmdc:mga0yw44_20481_c1
1663 nmdc:mga0yw44_35435_c1
1664 nmdc:mga06z11_90139_c1
1665 nmdc:mga07m45_103158_c1
1666 nmdc:mga07m45_16658_c1
1667 nmdc:mga07m45_20738_c2
1668 nmdc:mga07m45_24649_c1
1669 nmdc:mga05p37_141531_c1
1670 nmdc:mga05p37_186819_c1
1671 nmdc:mga05p37_33256_c1
1672 nmdc:mga05p37_35343_c1
1673 nmdc:mga05p37_44936_c1
1674 nmdc:mga05p37_92119_c1
1675 nmdc:mga09592_507444_c1
1676 nmdc:mga0qj67_177802_c1
1677 nmdc:mga0qj67_35750_c1
1678 nmdc:mga0qj67_77454_c1
1679 nmdc:mga06r32_139904_c1
1680 nmdc:mga06r32_295753_c1
1681 nmdc:mga06r32_441290_c1
1682 nmdc:mga06r32_685022_c1
1683 nmdc:mga08y16_311844_c1
1684 nmdc:mga0n895_124605_c1
1685 nmdc:mga0n895_12610_c1
1686 nmdc:mga0n895_18195_c1
1687 nmdc:mga0n895_185673_c1
1688 nmdc:mga0n895_438233_c1
1689 nmdc:mga0n895_78909_c1
1690 nmdc:mga0rr50_51509_c1
1691 nmdc:mga0rr50_55676_c1
1692 nmdc:mga08x19_161818_c1
1693 nmdc:mga08x19_251679_c1
1694 nmdc:mga08x19_9746_c1
1695 nmdc:mga0a205_108463_c1
1696 nmdc:mga0a205_116673_c1
1697 nmdc:mga0a205_231675_c1
1698 nmdc:mga0sz30_15564_c1
1699 nmdc:mga0sz30_31066_c1
1700 nmdc:mga0sz30_41712_c1
1701 Ga0495601_0073134
1702 Ga0495655_0003419
1703 Ga0495619_0140259
1704 Ga0500556_0002686
1705 Ga0500562_005324
1706 Ga0500628_006203
1707 Ga0500652_000524
1708 Ga0500616_0024486
1709 Ga0466962_0037352
1710 Ga0530510_0024658
1711 2558910956
1712 2566994140
1713 2583152071
1714 2586064322
1715 2644486884
1716 2738889842
1717 2739324526
1718 2739365159
1719 2753038639
1720 2753327151
1721 2760306634
1722 2760624893
1723 2776374442
1724 2776376225
1725 2809029794
1726 2809586428
1727 2842139710
1728 2863067968
1729 2863071995
1730 2863074240
1731 2870789127
1732 2902797535
1733 2902843153
1734 2904539908
1735 2904768986
1736 2904771735
1737 2908811774
1738 2915361707
1739 2915775906
1740 2919420101
1741 2919434140
1742 2922560482
1743 2929217619
1744 2939584844
1745 2974320034
1746 2984523901
1747 8003323256
1748 8054477128
1749 8056208129
1750 8056582898

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

115

322

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8052 22 286
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8014 22 287
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7928 24 296
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.7903 24 286
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7724 22 286
ID Description Score Start End Superfamily
af_P10905_52_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8589 68 289 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8386 68 290 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8309 68 289 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8135 68 290 1.10.3720.10
af_P9WG03_18_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8036 24 282 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A5B0IYT9-F1-model_v4 Sugar ABC transporter permease 0.885 29 295 GO:0005886
GO:0055085
AF-A0A557YIU6-F1-model_v4 deleted 0.8825 39 291
AF-A0A318HAR5-F1-model_v4 Carbohydrate ABC transporter membrane protein 1 (CUT1 family) 0.8778 22 295 GO:0005886
GO:0055085
AF-A0A172YKT1-F1-model_v4 Sugar ABC transporter permease 0.8776 38 287 GO:0005886
GO:0055085
AF-F6EMT7-F1-model_v4 Putative ABC transporter permease protein 0.8775 22 295 GO:0005886
GO:0055085

Map