F484322
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 875 | 391 | 1750 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300006048|Ga0075363_100016139|Ga0075363_1000161393 |
| Length | 327 |
| Sequence | MTSTSLTADTQADAREGAVAERVRKIRENQGAGVSRAEGWRRRGPLLPALIFMIVVTQIPFLFTLYYSTLSWNLVRPGSRQFVGLNNYIAVAKDSQFWRVGLNTVILIVGVVLISAFLGLLLALLLDRAFLGRGVVRTLLITPFLVTPVAAALIWKTTILDPTNGILNWVLSLVGIGPVDWIGQFPLTMVMVELIWQWTPFMMLLILAGLQSMPRDILEAGRVDGAGAFQLFRELTLPHLRRFIELGVVLGAVYLVNTFDAIYMMTQGGPGIASANLPFYIYQRAFLGFDMGQAAAMGVVVVIFTMFIASFALRLIFKSFSGKEEAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 11 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 194 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 206 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 207 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 230 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 231 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 232 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 233 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 234 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 235 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 236 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 237 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 238 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 239 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 240 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 241 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 242 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 243 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 247 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 248 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 249 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 250 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 299 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 300 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 305 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 306 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 307 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 308 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 309 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 310 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 311 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 312 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 313 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 314 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 315 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 316 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 317 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 318 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 330 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 331 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 332 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 333 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 335 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 345 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 349 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 350 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 351 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 352 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 353 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 354 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 355 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 356 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 357 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 358 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 359 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 360 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 361 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 362 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 363 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 364 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 365 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 366 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 367 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 368 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 369 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 370 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 371 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 372 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 373 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 374 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 375 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 376 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 377 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 378 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 379 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 380 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 381 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 382 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 383 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 384 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 385 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 386 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 387 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 388 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 389 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 390 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 391 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.31 |
| Metatranscriptomes | 0.11 |
| Isolates | 4.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.11 |
| Bulb | 0 |
| Endosphere | 6.51 |
| Nodule | 0.11 |
| Rhizoplane | 10.4 |
| Rhizosphere | 77.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075363_100016139 | 3300006048 | Bacteria | 3684 |
| 2 | LJQas_1000960 | 3300000549 | Bacteria | 4435 |
| 3 | JGI24746J21847_1000498 | 3300001977 | Bacteria | 5899 |
| 4 | JGI24746J21847_1000616 | 3300001977 | Bacteria | 5423 |
| 5 | JGI24747J21853_1000476 | 3300001978 | Bacteria | 2507 |
| 6 | JGI24747J21853_1007729 | 3300001978 | Bacteria | 1039 |
| 7 | JGI24743J22301_10000693 | 3300001991 | Bacteria | 4155 |
| 8 | JGI24750J21931_1001011 | 3300002070 | Bacteria | 3690 |
| 9 | JGI24750J21931_1001409 | 3300002070 | Bacteria | 3010 |
| 10 | JGI24750J21931_1004899 | 3300002070 | Bacteria | 1634 |
| 11 | JGI24745J21846_1000218 | 3300002073 | Bacteria | 4688 |
| 12 | JGI24745J21846_1000375 | 3300002073 | Bacteria | 3909 |
| 13 | JGI24748J21848_1000341 | 3300002074 | Bacteria | 5377 |
| 14 | JGI24738J21930_10002720 | 3300002075 | Bacteria | 4551 |
| 15 | JGI24749J21850_1000662 | 3300002076 | Bacteria | 4998 |
| 16 | JGI24744J21845_10001427 | 3300002077 | Bacteria | 4741 |
| 17 | JGI24744J21845_10002829 | 3300002077 | Bacteria | 3547 |
| 18 | JGI24034J26672_10000514 | 3300002239 | Bacteria | 5006 |
| 19 | JGI25406J46586_10006156 | 3300003203 | Bacteria | 5540 |
| 20 | JGI25406J46586_10022519 | 3300003203 | Bacteria | 2507 |
| 21 | JGI25406J46586_10022578 | 3300003203 | Bacteria | 2503 |
| 22 | JGI25407J50210_10000161 | 3300003373 | Bacteria | 10687 |
| 23 | JGI25407J50210_10002355 | 3300003373 | Bacteria | 4439 |
| 24 | JGI25407J50210_10002796 | 3300003373 | Bacteria | 4148 |
| 25 | Ga0055540_1002047 | 3300003792 | Bacteria | 11157 |
| 26 | Ga0070658_10137459 | 3300005327 | Bacteria | 2040 |
| 27 | Ga0070676_10009535 | 3300005328 | Bacteria | 5243 |
| 28 | Ga0070690_100018186 | 3300005330 | Bacteria | 4241 |
| 29 | Ga0070690_100183519 | 3300005330 | Bacteria | 1447 |
| 30 | Ga0070670_100179317 | 3300005331 | Bacteria | 1839 |
| 31 | Ga0068869_100079280 | 3300005334 | Bacteria | 2447 |
| 32 | Ga0070666_10109462 | 3300005335 | Bacteria | 1910 |
| 33 | Ga0070666_10219228 | 3300005335 | Bacteria | 1341 |
| 34 | Ga0070682_100001259 | 3300005337 | Bacteria | 14382 |
| 35 | Ga0070682_100008605 | 3300005337 | Bacteria | 5761 |
| 36 | Ga0070682_100048547 | 3300005337 | Bacteria | 2643 |
| 37 | Ga0070682_100300503 | 3300005337 | Bacteria | 1178 |
| 38 | Ga0068868_100124331 | 3300005338 | Bacteria | 2106 |
| 39 | Ga0068868_100324732 | 3300005338 | Bacteria | 1312 |
| 40 | Ga0070660_100219165 | 3300005339 | Bacteria | 1546 |
| 41 | Ga0070689_100035434 | 3300005340 | Bacteria | 3813 |
| 42 | Ga0070691_10002926 | 3300005341 | Bacteria | 7659 |
| 43 | Ga0070687_100005625 | 3300005343 | Bacteria | 5083 |
| 44 | Ga0070668_100001165 | 3300005347 | Bacteria | 18582 |
| 45 | Ga0070668_100001855 | 3300005347 | Bacteria | 15420 |
| 46 | Ga0070668_100043544 | 3300005347 | Bacteria | 3443 |
| 47 | Ga0070668_100181765 | 3300005347 | Bacteria | 1718 |
| 48 | Ga0070668_100256367 | 3300005347 | Bacteria | 1453 |
| 49 | Ga0070669_100018342 | 3300005353 | Bacteria | 5002 |
| 50 | Ga0070675_100127114 | 3300005354 | Bacteria | 2169 |
| 51 | Ga0070671_100003987 | 3300005355 | Bacteria | 11629 |
| 52 | Ga0070671_100011350 | 3300005355 | Bacteria | 7161 |
| 53 | Ga0070671_100012680 | 3300005355 | Bacteria | 6794 |
| 54 | Ga0070671_100204753 | 3300005355 | Bacteria | 1674 |
| 55 | Ga0070674_100012380 | 3300005356 | Bacteria | 5238 |
| 56 | Ga0070673_100029239 | 3300005364 | Bacteria | 4107 |
| 57 | Ga0070688_100002117 | 3300005365 | Bacteria | 10011 |
| 58 | Ga0070659_100018966 | 3300005366 | Bacteria | 5200 |
| 59 | Ga0070659_100028949 | 3300005366 | Bacteria | 4279 |
| 60 | Ga0070659_100164538 | 3300005366 | Bacteria | 1815 |
| 61 | Ga0070667_100000468 | 3300005367 | Bacteria | 41520 |
| 62 | Ga0070667_100015390 | 3300005367 | Bacteria | 6324 |
| 63 | Ga0070703_10006058 | 3300005406 | Bacteria | 3385 |
| 64 | Ga0070709_10010224 | 3300005434 | Bacteria | 5188 |
| 65 | Ga0070709_10020192 | 3300005434 | Bacteria | 3862 |
| 66 | Ga0070714_100046442 | 3300005435 | Bacteria | 3685 |
| 67 | Ga0070714_100103473 | 3300005435 | Bacteria | 2512 |
| 68 | Ga0070714_100106541 | 3300005435 | Bacteria | 2477 |
| 69 | Ga0070714_100364770 | 3300005435 | Bacteria | 1359 |
| 70 | Ga0070710_10027723 | 3300005437 | Bacteria | 3023 |
| 71 | Ga0070701_10000617 | 3300005438 | Bacteria | 12440 |
| 72 | Ga0070711_100078694 | 3300005439 | Bacteria | 2343 |
| 73 | Ga0070711_100137340 | 3300005439 | Bacteria | 1829 |
| 74 | Ga0070705_100009026 | 3300005440 | Bacteria | 4949 |
| 75 | Ga0070705_100032890 | 3300005440 | Bacteria | 2886 |
| 76 | Ga0070700_100002857 | 3300005441 | Bacteria | 8860 |
| 77 | Ga0070700_100135606 | 3300005441 | Bacteria | 1666 |
| 78 | Ga0070700_100251765 | 3300005441 | Bacteria | 1267 |
| 79 | Ga0070694_100012620 | 3300005444 | Bacteria | 5259 |
| 80 | Ga0070708_100215008 | 3300005445 | Bacteria | 1802 |
| 81 | Ga0070708_100327320 | 3300005445 | Bacteria | 1444 |
| 82 | Ga0070663_100003517 | 3300005455 | Bacteria | 9043 |
| 83 | Ga0070663_100015294 | 3300005455 | Bacteria | 4949 |
| 84 | Ga0070663_100256443 | 3300005455 | Bacteria | 1386 |
| 85 | Ga0070678_100004949 | 3300005456 | Bacteria | 7626 |
| 86 | Ga0070678_100139002 | 3300005456 | Bacteria | 1941 |
| 87 | Ga0070681_10157058 | 3300005458 | Bacteria | 2199 |
| 88 | Ga0070685_10001600 | 3300005466 | Bacteria | 11938 |
| 89 | Ga0070685_10009454 | 3300005466 | Bacteria | 5038 |
| 90 | Ga0070685_10034348 | 3300005466 | Bacteria | 2856 |
| 91 | Ga0070685_10119212 | 3300005466 | Bacteria | 1637 |
| 92 | Ga0070706_100019073 | 3300005467 | Bacteria | 6327 |
| 93 | Ga0070707_100026830 | 3300005468 | Bacteria | 5473 |
| 94 | Ga0070707_100043795 | 3300005468 | Bacteria | 4283 |
| 95 | Ga0070707_100151768 | 3300005468 | Bacteria | 2256 |
| 96 | Ga0070698_100016760 | 3300005471 | Bacteria | 7729 |
| 97 | Ga0070698_100193781 | 3300005471 | Bacteria | 1969 |
| 98 | Ga0070698_100473134 | 3300005471 | Bacteria | 1189 |
| 99 | Ga0070699_100008999 | 3300005518 | Bacteria | 8649 |
| 100 | Ga0070699_100268479 | 3300005518 | Bacteria | 1526 |
| 101 | Ga0070699_100285158 | 3300005518 | Bacteria | 1480 |
| 102 | Ga0070679_100194817 | 3300005530 | Bacteria | 1994 |
| 103 | Ga0070697_100038352 | 3300005536 | Bacteria | 3871 |
| 104 | Ga0070697_100547925 | 3300005536 | Bacteria | 1014 |
| 105 | Ga0068853_100018224 | 3300005539 | Bacteria | 5808 |
| 106 | Ga0068853_100021473 | 3300005539 | Bacteria | 5384 |
| 107 | Ga0070672_100186466 | 3300005543 | Bacteria | 1730 |
| 108 | Ga0070686_100010943 | 3300005544 | Bacteria | 5136 |
| 109 | Ga0070686_100107966 | 3300005544 | Bacteria | 1891 |
| 110 | Ga0070695_100007358 | 3300005545 | Bacteria | 6526 |
| 111 | Ga0070695_100068541 | 3300005545 | Bacteria | 2317 |
| 112 | Ga0070695_100095874 | 3300005545 | Bacteria | 1989 |
| 113 | Ga0070693_100008993 | 3300005547 | Bacteria | 4957 |
| 114 | Ga0070693_100025938 | 3300005547 | Bacteria | 3158 |
| 115 | Ga0070665_100004640 | 3300005548 | Bacteria | 14364 |
| 116 | Ga0070665_100005624 | 3300005548 | Bacteria | 12892 |
| 117 | Ga0070665_100079251 | 3300005548 | Bacteria | 3291 |
| 118 | Ga0070704_100094735 | 3300005549 | Bacteria | 2234 |
| 119 | Ga0070704_100537253 | 3300005549 | Bacteria | 1020 |
| 120 | Ga0068856_100052713 | 3300005614 | Bacteria | 4012 |
| 121 | Ga0070702_100029771 | 3300005615 | Bacteria | 2972 |
| 122 | Ga0068852_100112979 | 3300005616 | Bacteria | 2473 |
| 123 | Ga0068859_100003567 | 3300005617 | Bacteria | 15855 |
| 124 | Ga0068859_100028179 | 3300005617 | Bacteria | 5631 |
| 125 | Ga0068864_100012164 | 3300005618 | Bacteria | 7113 |
| 126 | Ga0068866_10004444 | 3300005718 | Bacteria | 5756 |
| 127 | Ga0068861_100051091 | 3300005719 | Bacteria | 3137 |
| 128 | Ga0068861_100056955 | 3300005719 | Bacteria | 2985 |
| 129 | Ga0068861_100105274 | 3300005719 | Bacteria | 2252 |
| 130 | Ga0068863_100009877 | 3300005841 | Bacteria | 9294 |
| 131 | Ga0068863_100013617 | 3300005841 | Bacteria | 7845 |
| 132 | Ga0068863_100338869 | 3300005841 | Bacteria | 1463 |
| 133 | Ga0068858_100005179 | 3300005842 | Bacteria | 12770 |
| 134 | Ga0068858_100381452 | 3300005842 | Bacteria | 1353 |
| 135 | Ga0068860_100000162 | 3300005843 | Bacteria | 109869 |
| 136 | Ga0068860_100064242 | 3300005843 | Bacteria | 3486 |
| 137 | Ga0068860_100095237 | 3300005843 | Bacteria | 2838 |
| 138 | Ga0068860_100117557 | 3300005843 | Bacteria | 2544 |
| 139 | Ga0068860_100519443 | 3300005843 | Bacteria | 1191 |
| 140 | Ga0068862_100000373 | 3300005844 | Bacteria | 48546 |
| 141 | Ga0068862_100290613 | 3300005844 | Bacteria | 1501 |
| 142 | Ga0068862_100491813 | 3300005844 | Bacteria | 1163 |
| 143 | Ga0081455_10004355 | 3300005937 | Bacteria | 15937 |
| 144 | Ga0081455_10077520 | 3300005937 | Bacteria | 2734 |
| 145 | Ga0081455_10166767 | 3300005937 | Bacteria | 1682 |
| 146 | Ga0081538_10000016 | 3300005981 | Bacteria | 147022 |
| 147 | Ga0081538_10000689 | 3300005981 | Bacteria | 37088 |
| 148 | Ga0081538_10004047 | 3300005981 | Bacteria | 13637 |
| 149 | Ga0081538_10010693 | 3300005981 | Bacteria | 7511 |
| 150 | Ga0081538_10028847 | 3300005981 | Bacteria | 3806 |
| 151 | Ga0081540_1000672 | 3300005983 | Bacteria | 32148 |
| 152 | Ga0081539_10000473 | 3300005985 | Bacteria | 85174 |
| 153 | Ga0081539_10002003 | 3300005985 | Bacteria | 30898 |
| 154 | Ga0081539_10005624 | 3300005985 | Bacteria | 12608 |
| 155 | Ga0070717_10274210 | 3300006028 | Bacteria | 1494 |
| 156 | Ga0075365_10028659 | 3300006038 | Bacteria | 3552 |
| 157 | Ga0075365_10050794 | 3300006038 | Bacteria | 2737 |
| 158 | Ga0075363_100010049 | 3300006048 | Bacteria | 4474 |
| 159 | Ga0075363_100039578 | 3300006048 | Bacteria | 2482 |
| 160 | Ga0075363_100113166 | 3300006048 | Bacteria | 1510 |
| 161 | Ga0075364_10005595 | 3300006051 | Bacteria | 7323 |
| 162 | Ga0075364_10008577 | 3300006051 | Bacteria | 6114 |
| 163 | Ga0075364_10025508 | 3300006051 | Bacteria | 3763 |
| 164 | Ga0075364_10226531 | 3300006051 | Bacteria | 1269 |
| 165 | Ga0070715_10002160 | 3300006163 | Bacteria | 5961 |
| 166 | Ga0070715_10005623 | 3300006163 | Bacteria | 4196 |
| 167 | Ga0070715_10023821 | 3300006163 | Bacteria | 2403 |
| 168 | Ga0070716_100004804 | 3300006173 | Bacteria | 6489 |
| 169 | Ga0070712_100000457 | 3300006175 | Bacteria | 23417 |
| 170 | Ga0070712_100010040 | 3300006175 | Bacteria | 5968 |
| 171 | Ga0075362_10007045 | 3300006177 | Bacteria | 4226 |
| 172 | Ga0075362_10016171 | 3300006177 | Bacteria | 3051 |
| 173 | Ga0075362_10018230 | 3300006177 | Bacteria | 2901 |
| 174 | Ga0075367_10065059 | 3300006178 | Bacteria | 2183 |
| 175 | Ga0075369_10007854 | 3300006186 | Bacteria | 4082 |
| 176 | Ga0075369_10009484 | 3300006186 | Bacteria | 3783 |
| 177 | Ga0075369_10023442 | 3300006186 | Bacteria | 2551 |
| 178 | Ga0075366_10129291 | 3300006195 | Bacteria | 1524 |
| 179 | Ga0097621_100002586 | 3300006237 | Bacteria | 12400 |
| 180 | Ga0097621_100009467 | 3300006237 | Bacteria | 7072 |
| 181 | Ga0097621_100014025 | 3300006237 | Bacteria | 5988 |
| 182 | Ga0075370_10003318 | 3300006353 | Bacteria | 7645 |
| 183 | Ga0075370_10011114 | 3300006353 | Bacteria | 4721 |
| 184 | Ga0075370_10016689 | 3300006353 | Bacteria | 3953 |
| 185 | Ga0075370_10016905 | 3300006353 | Bacteria | 3933 |
| 186 | Ga0075370_10017518 | 3300006353 | Bacteria | 3872 |
| 187 | Ga0075370_10026776 | 3300006353 | Bacteria | 3196 |
| 188 | Ga0075370_10173326 | 3300006353 | Bacteria | 1268 |
| 189 | Ga0068871_100194905 | 3300006358 | Bacteria | 1747 |
| 190 | Ga0075428_100030957 | 3300006844 | Bacteria | 5917 |
| 191 | Ga0075428_100121239 | 3300006844 | Bacteria | 2847 |
| 192 | Ga0075430_100041879 | 3300006846 | Bacteria | 3874 |
| 193 | Ga0075430_100050876 | 3300006846 | Bacteria | 3492 |
| 194 | Ga0075430_100069815 | 3300006846 | Bacteria | 2947 |
| 195 | Ga0075431_100141728 | 3300006847 | Bacteria | 2478 |
| 196 | Ga0075433_10007344 | 3300006852 | Bacteria | 8744 |
| 197 | Ga0075433_10025121 | 3300006852 | Bacteria | 5036 |
| 198 | Ga0075434_100055191 | 3300006871 | Bacteria | 3948 |
| 199 | Ga0075434_100068928 | 3300006871 | Bacteria | 3525 |
| 200 | Ga0075434_100071810 | 3300006871 | Bacteria | 3453 |
| 201 | Ga0075434_100423274 | 3300006871 | Bacteria | 1353 |
| 202 | Ga0075429_100423054 | 3300006880 | Bacteria | 1167 |
| 203 | Ga0068865_100002260 | 3300006881 | Bacteria | 11338 |
| 204 | Ga0075436_100020623 | 3300006914 | Bacteria | 4523 |
| 205 | Ga0097620_100003567 | 3300006931 | Bacteria | 15855 |
| 206 | Ga0097620_100028179 | 3300006931 | Bacteria | 5631 |
| 207 | Ga0075435_100016666 | 3300007076 | Bacteria | 5542 |
| 208 | Ga0075435_100095458 | 3300007076 | Bacteria | 2459 |
| 209 | Ga0099795_10009068 | 3300007788 | Bacteria | 2870 |
| 210 | Ga0099795_10027342 | 3300007788 | Bacteria | 1929 |
| 211 | Ga0105250_10009359 | 3300009092 | Bacteria | 4130 |
| 212 | Ga0111539_10172596 | 3300009094 | Bacteria | 2526 |
| 213 | Ga0111539_10390645 | 3300009094 | Bacteria | 1620 |
| 214 | Ga0105245_10056439 | 3300009098 | Bacteria | 3530 |
| 215 | Ga0105245_10304902 | 3300009098 | Bacteria | 1564 |
| 216 | Ga0105247_10000079 | 3300009101 | Bacteria | 110309 |
| 217 | Ga0105247_10050758 | 3300009101 | Bacteria | 2553 |
| 218 | Ga0105247_10053743 | 3300009101 | Bacteria | 2485 |
| 219 | Ga0105247_10322885 | 3300009101 | Bacteria | 1078 |
| 220 | Ga0114129_10006035 | 3300009147 | Bacteria | 17179 |
| 221 | Ga0114129_10009275 | 3300009147 | Bacteria | 14030 |
| 222 | Ga0114129_10035738 | 3300009147 | Bacteria | 7018 |
| 223 | Ga0114129_10048133 | 3300009147 | Bacteria | 5991 |
| 224 | Ga0114129_10175878 | 3300009147 | Bacteria | 2915 |
| 225 | Ga0105243_10059404 | 3300009148 | Bacteria | 3051 |
| 226 | Ga0105241_10005880 | 3300009174 | Bacteria | 9054 |
| 227 | Ga0105241_10074070 | 3300009174 | Bacteria | 2651 |
| 228 | Ga0105242_10006380 | 3300009176 | Bacteria | 9079 |
| 229 | Ga0105242_10062755 | 3300009176 | Bacteria | 3059 |
| 230 | Ga0105248_10000827 | 3300009177 | Bacteria | 34797 |
| 231 | Ga0105248_10042193 | 3300009177 | Bacteria | 5116 |
| 232 | Ga0105248_10063895 | 3300009177 | Bacteria | 4132 |
| 233 | Ga0105248_10093205 | 3300009177 | Bacteria | 3392 |
| 234 | Ga0105248_10404642 | 3300009177 | Bacteria | 1537 |
| 235 | Ga0105237_10004991 | 3300009545 | Bacteria | 15119 |
| 236 | Ga0105237_10043563 | 3300009545 | Bacteria | 4521 |
| 237 | Ga0105237_10129585 | 3300009545 | Bacteria | 2517 |
| 238 | Ga0105238_10029035 | 3300009551 | Bacteria | 5634 |
| 239 | Ga0105238_10142393 | 3300009551 | Bacteria | 2374 |
| 240 | Ga0105249_10000098 | 3300009553 | Bacteria | 120091 |
| 241 | Ga0105249_10004019 | 3300009553 | Bacteria | 12688 |
| 242 | Ga0105249_10010991 | 3300009553 | Bacteria | 7952 |
| 243 | Ga0105249_10212766 | 3300009553 | Bacteria | 1898 |
| 244 | Ga0099796_10000539 | 3300010159 | Bacteria | 6471 |
| 245 | Ga0105239_10056552 | 3300010375 | Bacteria | 4303 |
| 246 | Ga0105239_10178515 | 3300010375 | Bacteria | 2375 |
| 247 | Ga0105239_10216429 | 3300010375 | Bacteria | 2148 |
| 248 | Ga0105246_10003571 | 3300011119 | Bacteria | 9408 |
| 249 | Ga0105246_10061056 | 3300011119 | Bacteria | 2621 |
| 250 | Ga0157371_10045063 | 3300013102 | Bacteria | 3140 |
| 251 | Ga0157369_10045974 | 3300013105 | Bacteria | 4746 |
| 252 | Ga0157374_10005982 | 3300013296 | Bacteria | 10294 |
| 253 | Ga0157374_10033291 | 3300013296 | Bacteria | 4702 |
| 254 | Ga0157378_10002762 | 3300013297 | Bacteria | 15641 |
| 255 | Ga0157378_10029547 | 3300013297 | Bacteria | 4840 |
| 256 | Ga0157378_10043774 | 3300013297 | Bacteria | 3974 |
| 257 | Ga0163162_10020021 | 3300013306 | Bacteria | 6572 |
| 258 | Ga0163162_10087064 | 3300013306 | Bacteria | 3202 |
| 259 | Ga0163162_10118515 | 3300013306 | Bacteria | 2749 |
| 260 | Ga0163162_10193683 | 3300013306 | Bacteria | 2161 |
| 261 | Ga0163162_10249706 | 3300013306 | Bacteria | 1906 |
| 262 | Ga0163162_10355421 | 3300013306 | Bacteria | 1598 |
| 263 | Ga0157372_10048650 | 3300013307 | Bacteria | 4713 |
| 264 | Ga0157372_10352980 | 3300013307 | Bacteria | 1713 |
| 265 | Ga0157375_10284512 | 3300013308 | Bacteria | 1817 |
| 266 | Ga0157375_10569919 | 3300013308 | Bacteria | 1293 |
| 267 | Ga0163163_10043510 | 3300014325 | Bacteria | 4403 |
| 268 | Ga0163163_10169799 | 3300014325 | Bacteria | 2228 |
| 269 | Ga0163163_10337839 | 3300014325 | Bacteria | 1561 |
| 270 | Ga0157380_10007667 | 3300014326 | Bacteria | 7679 |
| 271 | Ga0157380_10030175 | 3300014326 | Bacteria | 4151 |
| 272 | Ga0157377_10013154 | 3300014745 | Bacteria | 4181 |
| 273 | Ga0157377_10015443 | 3300014745 | Bacteria | 3907 |
| 274 | Ga0157379_10063162 | 3300014968 | Bacteria | 3311 |
| 275 | Ga0157376_10004627 | 3300014969 | Bacteria | 9585 |
| 276 | Ga0157376_10051774 | 3300014969 | Bacteria | 3411 |
| 277 | Ga0163161_10200668 | 3300017792 | Bacteria | 1537 |
| 278 | Ga0209051_1000539 | 3300025303 | Bacteria | 46616 |
| 279 | Ga0209051_1001358 | 3300025303 | Bacteria | 21222 |
| 280 | Ga0209051_1008208 | 3300025303 | Bacteria | 5563 |
| 281 | Ga0207696_1009721 | 3300025711 | Bacteria | 3570 |
| 282 | Ga0207653_10003334 | 3300025885 | Bacteria | 5071 |
| 283 | Ga0207692_10001625 | 3300025898 | Bacteria | 8476 |
| 284 | Ga0207692_10036730 | 3300025898 | Bacteria | 2391 |
| 285 | Ga0207642_10000593 | 3300025899 | Bacteria | 11140 |
| 286 | Ga0207710_10000022 | 3300025900 | Bacteria | 335632 |
| 287 | Ga0207710_10005837 | 3300025900 | Bacteria | 5280 |
| 288 | Ga0207688_10001754 | 3300025901 | Bacteria | 11514 |
| 289 | Ga0207688_10017263 | 3300025901 | Bacteria | 3921 |
| 290 | Ga0207680_10059954 | 3300025903 | Bacteria | 2314 |
| 291 | Ga0207647_10016233 | 3300025904 | Bacteria | 5084 |
| 292 | Ga0207647_10092973 | 3300025904 | Bacteria | 1798 |
| 293 | Ga0207685_10000084 | 3300025905 | Bacteria | 17469 |
| 294 | Ga0207685_10007018 | 3300025905 | Bacteria | 3110 |
| 295 | Ga0207699_10004982 | 3300025906 | Bacteria | 6350 |
| 296 | Ga0207645_10008761 | 3300025907 | Bacteria | 7037 |
| 297 | Ga0207684_10013292 | 3300025910 | Bacteria | 7122 |
| 298 | Ga0207654_10048355 | 3300025911 | Bacteria | 2434 |
| 299 | Ga0207671_10012324 | 3300025914 | Bacteria | 6881 |
| 300 | Ga0207671_10074839 | 3300025914 | Bacteria | 2532 |
| 301 | Ga0207693_10000670 | 3300025915 | Bacteria | 30783 |
| 302 | Ga0207693_10067119 | 3300025915 | Bacteria | 2808 |
| 303 | Ga0207663_10002342 | 3300025916 | Bacteria | 9098 |
| 304 | Ga0207663_10115587 | 3300025916 | Bacteria | 1828 |
| 305 | Ga0207660_10011508 | 3300025917 | Bacteria | 5763 |
| 306 | Ga0207660_10079080 | 3300025917 | Bacteria | 2411 |
| 307 | Ga0207662_10010107 | 3300025918 | Bacteria | 5201 |
| 308 | Ga0207662_10073832 | 3300025918 | Bacteria | 2070 |
| 309 | Ga0207657_10023385 | 3300025919 | Bacteria | 5755 |
| 310 | Ga0207657_10142782 | 3300025919 | Bacteria | 1955 |
| 311 | Ga0207652_10029963 | 3300025921 | Bacteria | 4555 |
| 312 | Ga0207646_10063429 | 3300025922 | Bacteria | 3299 |
| 313 | Ga0207681_10009873 | 3300025923 | Bacteria | 5840 |
| 314 | Ga0207681_10165682 | 3300025923 | Bacteria | 1670 |
| 315 | Ga0207650_10150017 | 3300025925 | Bacteria | 1839 |
| 316 | Ga0207687_10026499 | 3300025927 | Bacteria | 3882 |
| 317 | Ga0207687_10026712 | 3300025927 | Bacteria | 3868 |
| 318 | Ga0207687_10242909 | 3300025927 | Bacteria | 1428 |
| 319 | Ga0207700_10004729 | 3300025928 | Bacteria | 8076 |
| 320 | Ga0207700_10007267 | 3300025928 | Bacteria | 6758 |
| 321 | Ga0207700_10179471 | 3300025928 | Bacteria | 1772 |
| 322 | Ga0207664_10001469 | 3300025929 | Bacteria | 15461 |
| 323 | Ga0207664_10006181 | 3300025929 | Bacteria | 8216 |
| 324 | Ga0207664_10075349 | 3300025929 | Bacteria | 2728 |
| 325 | Ga0207644_10003245 | 3300025931 | Bacteria | 10489 |
| 326 | Ga0207644_10007403 | 3300025931 | Bacteria | 7154 |
| 327 | Ga0207644_10075147 | 3300025931 | Bacteria | 2482 |
| 328 | Ga0207644_10132536 | 3300025931 | Bacteria | 1910 |
| 329 | Ga0207644_10135036 | 3300025931 | Bacteria | 1893 |
| 330 | Ga0207690_10359956 | 3300025932 | Bacteria | 1152 |
| 331 | Ga0207706_10040444 | 3300025933 | Bacteria | 4132 |
| 332 | Ga0207706_10199546 | 3300025933 | Bacteria | 1755 |
| 333 | Ga0207706_10262713 | 3300025933 | Bacteria | 1507 |
| 334 | Ga0207686_10005080 | 3300025934 | Bacteria | 7077 |
| 335 | Ga0207686_10019694 | 3300025934 | Bacteria | 3842 |
| 336 | Ga0207686_10068349 | 3300025934 | Bacteria | 2276 |
| 337 | Ga0207709_10008531 | 3300025935 | Bacteria | 5666 |
| 338 | Ga0207670_10006823 | 3300025936 | Bacteria | 6352 |
| 339 | Ga0207669_10003581 | 3300025937 | Bacteria | 6734 |
| 340 | Ga0207704_10001501 | 3300025938 | Bacteria | 10464 |
| 341 | Ga0207704_10133529 | 3300025938 | Bacteria | 1723 |
| 342 | Ga0207665_10015966 | 3300025939 | Bacteria | 4931 |
| 343 | Ga0207665_10119046 | 3300025939 | Bacteria | 1864 |
| 344 | Ga0207665_10121858 | 3300025939 | Bacteria | 1843 |
| 345 | Ga0207691_10018296 | 3300025940 | Bacteria | 6637 |
| 346 | Ga0207711_10000404 | 3300025941 | Bacteria | 45690 |
| 347 | Ga0207711_10006841 | 3300025941 | Bacteria | 9579 |
| 348 | Ga0207711_10026567 | 3300025941 | Bacteria | 4858 |
| 349 | Ga0207711_10165617 | 3300025941 | Bacteria | 2003 |
| 350 | Ga0207689_10023474 | 3300025942 | Bacteria | 5177 |
| 351 | Ga0207689_10104677 | 3300025942 | Bacteria | 2325 |
| 352 | Ga0207661_10300047 | 3300025944 | Bacteria | 1440 |
| 353 | Ga0207667_10262170 | 3300025949 | Bacteria | 1767 |
| 354 | Ga0207667_10601979 | 3300025949 | Bacteria | 1108 |
| 355 | Ga0207667_10639444 | 3300025949 | Bacteria | 1070 |
| 356 | Ga0207651_10062993 | 3300025960 | Bacteria | 2587 |
| 357 | Ga0207712_10000076 | 3300025961 | Bacteria | 120445 |
| 358 | Ga0207712_10004461 | 3300025961 | Bacteria | 8838 |
| 359 | Ga0207712_10062806 | 3300025961 | Bacteria | 2642 |
| 360 | Ga0207712_10142265 | 3300025961 | Bacteria | 1843 |
| 361 | Ga0207668_10013992 | 3300025972 | Bacteria | 4957 |
| 362 | Ga0207668_10025220 | 3300025972 | Bacteria | 3845 |
| 363 | Ga0207668_10032618 | 3300025972 | Bacteria | 3444 |
| 364 | Ga0207668_10082354 | 3300025972 | Bacteria | 2337 |
| 365 | Ga0207668_10161284 | 3300025972 | Bacteria | 1747 |
| 366 | Ga0207668_10275669 | 3300025972 | Bacteria | 1377 |
| 367 | Ga0207658_10000821 | 3300025986 | Bacteria | 25967 |
| 368 | Ga0207677_10002902 | 3300026023 | Bacteria | 9057 |
| 369 | Ga0207677_10215197 | 3300026023 | Bacteria | 1537 |
| 370 | Ga0207677_10451124 | 3300026023 | Bacteria | 1102 |
| 371 | Ga0207703_10006399 | 3300026035 | Bacteria | 9416 |
| 372 | Ga0207703_10069033 | 3300026035 | Bacteria | 2913 |
| 373 | Ga0207703_10261373 | 3300026035 | Bacteria | 1565 |
| 374 | Ga0207639_10038395 | 3300026041 | Bacteria | 3561 |
| 375 | Ga0207639_10172673 | 3300026041 | Bacteria | 1832 |
| 376 | Ga0207639_10231259 | 3300026041 | Bacteria | 1602 |
| 377 | Ga0207639_10407297 | 3300026041 | Bacteria | 1226 |
| 378 | Ga0207678_10003523 | 3300026067 | Bacteria | 14079 |
| 379 | Ga0207678_10016735 | 3300026067 | Bacteria | 6440 |
| 380 | Ga0207708_10001232 | 3300026075 | Bacteria | 19288 |
| 381 | Ga0207708_10011608 | 3300026075 | Bacteria | 6566 |
| 382 | Ga0207702_10074384 | 3300026078 | Bacteria | 2932 |
| 383 | Ga0207702_10445376 | 3300026078 | Bacteria | 1256 |
| 384 | Ga0207641_10002622 | 3300026088 | Bacteria | 16486 |
| 385 | Ga0207641_10004801 | 3300026088 | Bacteria | 11649 |
| 386 | Ga0207641_10056732 | 3300026088 | Bacteria | 3329 |
| 387 | Ga0207641_10118121 | 3300026088 | Bacteria | 2362 |
| 388 | Ga0207648_10006703 | 3300026089 | Bacteria | 11423 |
| 389 | Ga0207676_10010661 | 3300026095 | Bacteria | 6555 |
| 390 | Ga0207675_100006346 | 3300026118 | Bacteria | 11210 |
| 391 | Ga0207675_100058819 | 3300026118 | Bacteria | 3587 |
| 392 | Ga0207675_100150315 | 3300026118 | Bacteria | 2216 |
| 393 | Ga0207675_100162814 | 3300026118 | Bacteria | 2129 |
| 394 | Ga0207675_100309781 | 3300026118 | Bacteria | 1540 |
| 395 | Ga0207683_10000111 | 3300026121 | Bacteria | 66523 |
| 396 | Ga0207683_10000252 | 3300026121 | Bacteria | 47809 |
| 397 | Ga0207683_10026842 | 3300026121 | Bacteria | 4974 |
| 398 | Ga0207683_10164325 | 3300026121 | Bacteria | 2008 |
| 399 | Ga0207698_10195900 | 3300026142 | Bacteria | 1805 |
| 400 | Ga0209179_1003876 | 3300027512 | Bacteria | 2203 |
| 401 | Ga0207428_10331186 | 3300027907 | Bacteria | 1123 |
| 402 | Ga0268266_10022049 | 3300028379 | Bacteria | 5429 |
| 403 | Ga0268266_10023683 | 3300028379 | Bacteria | 5226 |
| 404 | Ga0268266_10060816 | 3300028379 | Bacteria | 3257 |
| 405 | Ga0268266_10275322 | 3300028379 | Bacteria | 1563 |
| 406 | Ga0268265_10000368 | 3300028380 | Bacteria | 48834 |
| 407 | Ga0268265_10018475 | 3300028380 | Bacteria | 4832 |
| 408 | Ga0268265_10372366 | 3300028380 | Bacteria | 1311 |
| 409 | Ga0268264_10000017 | 3300028381 | Bacteria | 498037 |
| 410 | Ga0268264_10021985 | 3300028381 | Bacteria | 5205 |
| 411 | Ga0268264_10056691 | 3300028381 | Bacteria | 3275 |
| 412 | Ga0268264_10094037 | 3300028381 | Bacteria | 2591 |
| 413 | Ga0268264_10221883 | 3300028381 | Bacteria | 1740 |
| 414 | Ga0265319_1006706 | 3300028563 | Bacteria | 5292 |
| 415 | Ga0265760_10034700 | 3300031090 | Bacteria | 1492 |
| 416 | Ga0307513_10273927 | 3300031456 | Bacteria | 1469 |
| 417 | Ga0307405_10077187 | 3300031731 | Bacteria | 2164 |
| 418 | Ga0307518_10002006 | 3300031838 | Bacteria | 14952 |
| 419 | Ga0307410_10099905 | 3300031852 | Bacteria | 2078 |
| 420 | Ga0307406_10068567 | 3300031901 | Bacteria | 2316 |
| 421 | Ga0307412_10069486 | 3300031911 | Bacteria | 2398 |
| 422 | Ga0307409_100014560 | 3300031995 | Bacteria | 5123 |
| 423 | Ga0307416_100040466 | 3300032002 | Bacteria | 3621 |
| 424 | Ga0307416_100143117 | 3300032002 | Bacteria | 2177 |
| 425 | Ga0307416_100245953 | 3300032002 | Bacteria | 1737 |
| 426 | Ga0307411_10035845 | 3300032005 | Bacteria | 3103 |
| 427 | Ga0307415_100112340 | 3300032126 | Bacteria | 2024 |
| 428 | Ga0307507_10029505 | 3300033179 | Bacteria | 5813 |
| 429 | Ga0307510_10018502 | 3300033180 | Bacteria | 8197 |
| 430 | Ga0373928_0010127 | 3300035084 | Bacteria | 1848 |
| 431 | Ga0373940_0005513 | 3300035088 | Bacteria | 2747 |
| 432 | Ga0373951_0009031 | 3300035091 | Bacteria | 2247 |
| 433 | Ga0373923_0006939 | 3300035111 | Bacteria | 3949 |
| 434 | Ga0373932_0078881 | 3300035112 | Bacteria | 1036 |
| 435 | Ga0373936_0003887 | 3300035113 | Bacteria | 5630 |
| 436 | Ga0373941_0026896 | 3300035115 | Bacteria | 1674 |
| 437 | Ga0373945_0016230 | 3300035116 | Bacteria | 2508 |
| 438 | Ga0373946_0050101 | 3300035171 | Bacteria | 1743 |
| 439 | Ga0373924_0032783 | 3300035410 | Bacteria | 2094 |
| 440 | Ga0373931_0018099 | 3300035691 | Bacteria | 3498 |
| 441 | Ga0373931_0075210 | 3300035691 | Bacteria | 1852 |
| 442 | Ga0373931_0077301 | 3300035691 | Bacteria | 1829 |
| 443 | Ga0373935_0055434 | 3300035692 | Bacteria | 2525 |
| 444 | Ga0373935_0071955 | 3300035692 | Bacteria | 2232 |
| 445 | Ga0373927_0020945 | 3300035695 | Bacteria | 4286 |
| 446 | Ga0373933_0263868 | 3300035724 | Bacteria | 1111 |
| 447 | Ga0373947_0034554 | 3300035725 | Bacteria | 2990 |
| 448 | Ga0373947_0111071 | 3300035725 | Bacteria | 1732 |
| 449 | Ga0373925_0026479 | 3300037068 | Bacteria | 4242 |
| 450 | Ga0373925_0029100 | 3300037068 | Bacteria | 4052 |
| 451 | Ga0395899_0003336 | 3300037312 | Bacteria | 12729 |
| 452 | Ga0395899_0021812 | 3300037312 | Bacteria | 4858 |
| 453 | Ga0395899_0026222 | 3300037312 | Bacteria | 4398 |
| 454 | Ga0395899_0031790 | 3300037312 | Bacteria | 3966 |
| 455 | Ga0395899_0041967 | 3300037312 | Bacteria | 3416 |
| 456 | Ga0395899_0044366 | 3300037312 | Bacteria | 3313 |
| 457 | Ga0395899_0090940 | 3300037312 | Bacteria | 2212 |
| 458 | Ga0395899_0102694 | 3300037312 | Bacteria | 2063 |
| 459 | Ga0395899_0104588 | 3300037312 | Bacteria | 2040 |
| 460 | Ga0395899_0112110 | 3300037312 | Bacteria | 1960 |
| 461 | Ga0395899_0120107 | 3300037312 | Bacteria | 1883 |
| 462 | Ga0395899_0212982 | 3300037312 | Bacteria | 1342 |
| 463 | Ga0395899_0264921 | 3300037312 | Bacteria | 1174 |
| 464 | Ga0395900_0006560 | 3300037418 | Bacteria | 12123 |
| 465 | Ga0395900_0011651 | 3300037418 | Bacteria | 8996 |
| 466 | Ga0395900_0012286 | 3300037418 | Bacteria | 8757 |
| 467 | Ga0395900_0015379 | 3300037418 | Bacteria | 7799 |
| 468 | Ga0395900_0032309 | 3300037418 | Bacteria | 5381 |
| 469 | Ga0395900_0034103 | 3300037418 | Bacteria | 5239 |
| 470 | Ga0395900_0034752 | 3300037418 | Bacteria | 5192 |
| 471 | Ga0395900_0035869 | 3300037418 | Bacteria | 5109 |
| 472 | Ga0395900_0036906 | 3300037418 | Bacteria | 5037 |
| 473 | Ga0395900_0037044 | 3300037418 | Bacteria | 5029 |
| 474 | Ga0395900_0041050 | 3300037418 | Bacteria | 4771 |
| 475 | Ga0395900_0048276 | 3300037418 | Bacteria | 4385 |
| 476 | Ga0395900_0067230 | 3300037418 | Bacteria | 3682 |
| 477 | Ga0395900_0084539 | 3300037418 | Bacteria | 3261 |
| 478 | Ga0395900_0087716 | 3300037418 | Bacteria | 3197 |
| 479 | Ga0395900_0092720 | 3300037418 | Bacteria | 3103 |
| 480 | Ga0395900_0098431 | 3300037418 | Bacteria | 3005 |
| 481 | Ga0395900_0171943 | 3300037418 | Bacteria | 2205 |
| 482 | Ga0395900_0193437 | 3300037418 | Bacteria | 2062 |
| 483 | Ga0395900_0217842 | 3300037418 | Bacteria | 1925 |
| 484 | Ga0395900_0229740 | 3300037418 | Bacteria | 1866 |
| 485 | Ga0395900_0260228 | 3300037418 | Bacteria | 1733 |
| 486 | Ga0395900_0351265 | 3300037418 | Bacteria | 1448 |
| 487 | Ga0395898_0004675 | 3300037466 | Bacteria | 14919 |
| 488 | Ga0395898_0005170 | 3300037466 | Bacteria | 14117 |
| 489 | Ga0395898_0008629 | 3300037466 | Bacteria | 10754 |
| 490 | Ga0395898_0011863 | 3300037466 | Bacteria | 9024 |
| 491 | Ga0395898_0012164 | 3300037466 | Bacteria | 8902 |
| 492 | Ga0395898_0015585 | 3300037466 | Bacteria | 7792 |
| 493 | Ga0395898_0017293 | 3300037466 | Bacteria | 7366 |
| 494 | Ga0395898_0021431 | 3300037466 | Bacteria | 6554 |
| 495 | Ga0395898_0023169 | 3300037466 | Bacteria | 6276 |
| 496 | Ga0395898_0026636 | 3300037466 | Bacteria | 5814 |
| 497 | Ga0395898_0030416 | 3300037466 | Bacteria | 5403 |
| 498 | Ga0395898_0081061 | 3300037466 | Bacteria | 3129 |
| 499 | Ga0395898_0085590 | 3300037466 | Bacteria | 3038 |
| 500 | Ga0395898_0092794 | 3300037466 | Bacteria | 2903 |
| 501 | Ga0395898_0104570 | 3300037466 | Bacteria | 2715 |
| 502 | Ga0395898_0112887 | 3300037466 | Bacteria | 2604 |
| 503 | Ga0395898_0156590 | 3300037466 | Bacteria | 2179 |
| 504 | Ga0395898_0195168 | 3300037466 | Bacteria | 1934 |
| 505 | Ga0395898_0211215 | 3300037466 | Bacteria | 1851 |
| 506 | Ga0395898_0221362 | 3300037466 | Bacteria | 1805 |
| 507 | Ga0395898_0347925 | 3300037466 | Bacteria | 1413 |
| 508 | Ga0395898_0358761 | 3300037466 | Bacteria | 1390 |
| 509 | Ga0395898_0484286 | 3300037466 | Bacteria | 1177 |
| 510 | Ga0395898_0666674 | 3300037466 | Bacteria | 982 |
| 511 | Ga0395905_0005356 | 3300037471 | Bacteria | 13110 |
| 512 | Ga0395905_0005405 | 3300037471 | Bacteria | 13055 |
| 513 | Ga0395905_0007227 | 3300037471 | Bacteria | 11072 |
| 514 | Ga0395905_0009125 | 3300037471 | Bacteria | 9716 |
| 515 | Ga0395905_0017394 | 3300037471 | Bacteria | 6827 |
| 516 | Ga0395905_0019112 | 3300037471 | Bacteria | 6499 |
| 517 | Ga0395905_0021364 | 3300037471 | Bacteria | 6121 |
| 518 | Ga0395905_0022935 | 3300037471 | Bacteria | 5899 |
| 519 | Ga0395905_0023760 | 3300037471 | Bacteria | 5787 |
| 520 | Ga0395905_0027596 | 3300037471 | Bacteria | 5353 |
| 521 | Ga0395905_0029167 | 3300037471 | Bacteria | 5200 |
| 522 | Ga0395905_0030109 | 3300037471 | Bacteria | 5115 |
| 523 | Ga0395905_0051964 | 3300037471 | Bacteria | 3838 |
| 524 | Ga0395905_0053704 | 3300037471 | Bacteria | 3771 |
| 525 | Ga0395905_0054812 | 3300037471 | Bacteria | 3731 |
| 526 | Ga0395905_0084453 | 3300037471 | Bacteria | 2974 |
| 527 | Ga0395905_0115358 | 3300037471 | Bacteria | 2524 |
| 528 | Ga0395905_0303864 | 3300037471 | Bacteria | 1483 |
| 529 | Ga0395905_0355371 | 3300037471 | Bacteria | 1357 |
| 530 | Ga0395905_0476122 | 3300037471 | Bacteria | 1148 |
| 531 | Ga0436364_0258924 | 3300037853 | Bacteria | 15643 |
| 532 | Ga0436364_0935170 | 3300037853 | Bacteria | 2018 |
| 533 | Ga0436364_1133240 | 3300037853 | Bacteria | 1259 |
| 534 | Ga0395901_0001195 | 3300038443 | Bacteria | 27615 |
| 535 | Ga0395901_0006581 | 3300038443 | Bacteria | 11744 |
| 536 | Ga0395901_0006722 | 3300038443 | Bacteria | 11621 |
| 537 | Ga0395901_0007177 | 3300038443 | Bacteria | 11238 |
| 538 | Ga0395901_0009708 | 3300038443 | Bacteria | 9759 |
| 539 | Ga0395901_0010611 | 3300038443 | Bacteria | 9332 |
| 540 | Ga0395901_0012790 | 3300038443 | Bacteria | 8511 |
| 541 | Ga0395901_0014259 | 3300038443 | Bacteria | 8091 |
| 542 | Ga0395901_0016637 | 3300038443 | Bacteria | 7492 |
| 543 | Ga0395901_0016691 | 3300038443 | Bacteria | 7480 |
| 544 | Ga0395901_0020745 | 3300038443 | Bacteria | 6726 |
| 545 | Ga0395901_0021773 | 3300038443 | Bacteria | 6569 |
| 546 | Ga0395901_0026489 | 3300038443 | Bacteria | 5953 |
| 547 | Ga0395901_0030244 | 3300038443 | Bacteria | 5579 |
| 548 | Ga0395901_0033524 | 3300038443 | Bacteria | 5301 |
| 549 | Ga0395901_0045914 | 3300038443 | Bacteria | 4535 |
| 550 | Ga0395901_0062480 | 3300038443 | Bacteria | 3875 |
| 551 | Ga0395901_0066153 | 3300038443 | Bacteria | 3765 |
| 552 | Ga0395901_0088757 | 3300038443 | Bacteria | 3234 |
| 553 | Ga0395901_0100349 | 3300038443 | Bacteria | 3036 |
| 554 | Ga0395901_0102083 | 3300038443 | Bacteria | 3009 |
| 555 | Ga0395901_0137682 | 3300038443 | Bacteria | 2566 |
| 556 | Ga0395901_0145697 | 3300038443 | Bacteria | 2489 |
| 557 | Ga0395901_0182661 | 3300038443 | Bacteria | 2200 |
| 558 | Ga0395901_0245547 | 3300038443 | Bacteria | 1866 |
| 559 | Ga0395901_0283918 | 3300038443 | Bacteria | 1719 |
| 560 | Ga0395901_0407314 | 3300038443 | Bacteria | 1396 |
| 561 | Ga0395901_0479407 | 3300038443 | Bacteria | 1269 |
| 562 | Ga0395901_0569715 | 3300038443 | Bacteria | 1145 |
| 563 | Ga0439466_0029263 | 3300041411 | Bacteria | 1896 |
| 564 | Ga0439465_0002064 | 3300041413 | Bacteria | 6586 |
| 565 | Ga0439465_0002174 | 3300041413 | Bacteria | 6433 |
| 566 | Ga0439465_0016313 | 3300041413 | Bacteria | 2317 |
| 567 | Ga0451841_0812662 | 3300041498 | Bacteria | 1354 |
| 568 | Ga0439431_0044450 | 3300041997 | Bacteria | 1139 |
| 569 | Ga0439445_0022877 | 3300042004 | Bacteria | 1579 |
| 570 | Ga0439448_0002878 | 3300042005 | Bacteria | 4715 |
| 571 | Ga0439448_0030956 | 3300042005 | Bacteria | 1699 |
| 572 | Ga0439450_000648 | 3300042008 | Bacteria | 4632 |
| 573 | Ga0439451_017316 | 3300042009 | Bacteria | 1452 |
| 574 | Ga0439455_0009135 | 3300042012 | Bacteria | 2143 |
| 575 | Ga0439463_000926 | 3300042016 | Bacteria | 8048 |
| 576 | Ga0439444_0001800 | 3300042437 | Bacteria | 2836 |
| 577 | Ga0439464_0008797 | 3300042439 | Bacteria | 2647 |
| 578 | Ga0439440_0001901 | 3300042993 | Bacteria | 3881 |
| 579 | Ga0466972_0002072 | 3300044658 | Bacteria | 9812 |
| 580 | Ga0466972_0002500 | 3300044658 | Bacteria | 9091 |
| 581 | Ga0466972_0018178 | 3300044658 | Bacteria | 3516 |
| 582 | Ga0466972_0024771 | 3300044658 | Bacteria | 2978 |
| 583 | Ga0466972_0032778 | 3300044658 | Bacteria | 2550 |
| 584 | Ga0466965_0004079 | 3300044683 | Bacteria | 6481 |
| 585 | Ga0466965_0007858 | 3300044683 | Bacteria | 4918 |
| 586 | Ga0466965_0017974 | 3300044683 | Bacteria | 3383 |
| 587 | Ga0466965_0118838 | 3300044683 | Bacteria | 1363 |
| 588 | Ga0466966_0015602 | 3300044684 | Bacteria | 5021 |
| 589 | Ga0466966_0108138 | 3300044684 | Bacteria | 1716 |
| 590 | Ga0466961_0031897 | 3300044693 | Bacteria | 3386 |
| 591 | Ga0466963_0145277 | 3300044694 | Bacteria | 1645 |
| 592 | Ga0466970_0003109 | 3300044765 | Bacteria | 8060 |
| 593 | Ga0466970_0019637 | 3300044765 | Bacteria | 3504 |
| 594 | Ga0466957_0016862 | 3300044842 | Bacteria | 4274 |
| 595 | Ga0466957_0097828 | 3300044842 | Bacteria | 1846 |
| 596 | Ga0466960_0000238 | 3300044901 | Bacteria | 19096 |
| 597 | Ga0466960_0026776 | 3300044901 | Bacteria | 2622 |
| 598 | Ga0466958_0012637 | 3300045836 | Bacteria | 4786 |
| 599 | Ga0466967_0013429 | 3300045976 | Bacteria | 6328 |
| 600 | Ga0466967_0018684 | 3300045976 | Bacteria | 5549 |
| 601 | Ga0466967_0102077 | 3300045976 | Bacteria | 2623 |
| 602 | Ga0466967_0201417 | 3300045976 | Bacteria | 1886 |
| 603 | Ga0466967_0223166 | 3300045976 | Bacteria | 1792 |
| 604 | Ga0495603_0056427 | 3300046455 | Bacteria | 2325 |
| 605 | Ga0495629_0018923 | 3300046459 | Bacteria | 4924 |
| 606 | Ga0495629_0057356 | 3300046459 | Bacteria | 2723 |
| 607 | Ga0495638_0001626 | 3300046460 | Bacteria | 19998 |
| 608 | Ga0495641_0019344 | 3300046461 | Bacteria | 3487 |
| 609 | Ga0495580_0290478 | 3300046472 | Bacteria | 1114 |
| 610 | Ga0495582_0039529 | 3300046473 | Bacteria | 2597 |
| 611 | Ga0495582_0042163 | 3300046473 | Bacteria | 2514 |
| 612 | Ga0495639_0013535 | 3300046475 | Bacteria | 3525 |
| 613 | Ga0495662_0162589 | 3300046476 | Bacteria | 1100 |
| 614 | Ga0495594_0107046 | 3300046499 | Bacteria | 1575 |
| 615 | Ga0495607_0028236 | 3300046501 | Bacteria | 3463 |
| 616 | Ga0495607_0108285 | 3300046501 | Bacteria | 1477 |
| 617 | Ga0495630_0110401 | 3300046517 | Bacteria | 2083 |
| 618 | Ga0495644_0035317 | 3300046523 | Bacteria | 1888 |
| 619 | Ga0495648_0003500 | 3300046524 | Bacteria | 13766 |
| 620 | Ga0495666_0018688 | 3300046526 | Bacteria | 3444 |
| 621 | Ga0495642_0027887 | 3300046528 | Bacteria | 2248 |
| 622 | Ga0495654_0033319 | 3300046530 | Bacteria | 2608 |
| 623 | Ga0495665_0021183 | 3300046531 | Bacteria | 3492 |
| 624 | Ga0495609_0051314 | 3300046538 | Bacteria | 1837 |
| 625 | Ga0495645_0016917 | 3300046543 | Bacteria | 5219 |
| 626 | Ga0495645_0097207 | 3300046543 | Bacteria | 2097 |
| 627 | Ga0495667_0213348 | 3300046559 | Bacteria | 1233 |
| 628 | Ga0495656_0031116 | 3300046615 | Bacteria | 2162 |
| 629 | Ga0495668_0000043 | 3300046616 | Bacteria | 227636 |
| 630 | Ga0495611_0033069 | 3300046648 | Bacteria | 2282 |
| 631 | Ga0495588_0021242 | 3300046674 | Bacteria | 3197 |
| 632 | Ga0495599_0135086 | 3300046678 | Bacteria | 1531 |
| 633 | Ga0495613_0130151 | 3300046689 | Bacteria | 1802 |
| 634 | Ga0495671_0103066 | 3300046692 | Bacteria | 1394 |
| 635 | Ga0495589_0057590 | 3300046794 | Bacteria | 1911 |
| 636 | Ga0495660_0191986 | 3300046810 | Bacteria | 981 |
| 637 | Ga0495581_0022849 | 3300047315 | Bacteria | 3622 |
| 638 | Ga0495581_0105942 | 3300047315 | Bacteria | 1634 |
| 639 | Ga0495604_0188501 | 3300047317 | Bacteria | 1439 |
| 640 | Ga0495674_0002886 | 3300047319 | Bacteria | 16724 |
| 641 | Ga0495672_0003728 | 3300047320 | Bacteria | 12851 |
| 642 | Ga0495676_0074453 | 3300047321 | Bacteria | 2600 |
| 643 | Ga0495676_0083108 | 3300047321 | Bacteria | 2421 |
| 644 | Ga0495676_0149160 | 3300047321 | Bacteria | 1667 |
| 645 | Ga0495680_0135328 | 3300047322 | Bacteria | 1807 |
| 646 | Ga0495683_0002342 | 3300047323 | Bacteria | 11506 |
| 647 | Ga0495683_0095641 | 3300047323 | Bacteria | 1434 |
| 648 | Ga0495673_0003932 | 3300047469 | Bacteria | 9524 |
| 649 | Ga0495684_0166327 | 3300047471 | Bacteria | 1642 |
| 650 | Ga0495686_0000930 | 3300047472 | Bacteria | 36471 |
| 651 | Ga0495593_0021728 | 3300047673 | Bacteria | 3580 |
| 652 | Ga0495593_0074653 | 3300047673 | Bacteria | 1758 |
| 653 | Ga0495626_0041717 | 3300048091 | Bacteria | 2159 |
| 654 | Ga0496100_0000960 | 3300048903 | Bacteria | 13806 |
| 655 | Ga0496100_0001591 | 3300048903 | Bacteria | 11186 |
| 656 | Ga0496100_0028475 | 3300048903 | Bacteria | 3446 |
| 657 | Ga0496100_0031682 | 3300048903 | Bacteria | 3289 |
| 658 | Ga0496100_0058911 | 3300048903 | Bacteria | 2522 |
| 659 | Ga0496100_0104053 | 3300048903 | Bacteria | 1961 |
| 660 | Ga0496101_0000049 | 3300048904 | Bacteria | 146432 |
| 661 | Ga0496101_0001902 | 3300048904 | Bacteria | 12613 |
| 662 | Ga0496101_0002184 | 3300048904 | Bacteria | 11948 |
| 663 | Ga0496101_0004825 | 3300048904 | Bacteria | 8552 |
| 664 | Ga0496101_0009937 | 3300048904 | Bacteria | 6270 |
| 665 | Ga0496101_0027142 | 3300048904 | Bacteria | 3985 |
| 666 | Ga0496101_0042557 | 3300048904 | Bacteria | 3242 |
| 667 | Ga0496101_0046183 | 3300048904 | Bacteria | 3122 |
| 668 | Ga0496102_0000011 | 3300048905 | Bacteria | 321716 |
| 669 | Ga0496102_0001591 | 3300048905 | Bacteria | 20026 |
| 670 | Ga0496102_0003839 | 3300048905 | Bacteria | 12716 |
| 671 | Ga0496102_0008601 | 3300048905 | Bacteria | 8758 |
| 672 | Ga0496102_0015388 | 3300048905 | Bacteria | 6663 |
| 673 | Ga0496102_0042388 | 3300048905 | Bacteria | 4124 |
| 674 | Ga0496102_0102421 | 3300048905 | Bacteria | 2662 |
| 675 | Ga0496102_0113660 | 3300048905 | Bacteria | 2526 |
| 676 | Ga0496102_0155143 | 3300048905 | Bacteria | 2152 |
| 677 | Ga0496102_0205131 | 3300048905 | Bacteria | 1858 |
| 678 | Ga0496103_0000032 | 3300048906 | Bacteria | 201453 |
| 679 | Ga0496103_0003321 | 3300048906 | Bacteria | 9839 |
| 680 | Ga0496103_0012601 | 3300048906 | Bacteria | 5015 |
| 681 | Ga0496104_0005333 | 3300048907 | Bacteria | 11248 |
| 682 | Ga0496104_0012533 | 3300048907 | Bacteria | 7626 |
| 683 | Ga0496104_0040252 | 3300048907 | Bacteria | 4380 |
| 684 | Ga0496104_0042055 | 3300048907 | Bacteria | 4286 |
| 685 | Ga0496104_0047670 | 3300048907 | Bacteria | 4038 |
| 686 | Ga0496104_0279232 | 3300048907 | Bacteria | 1583 |
| 687 | Ga0496105_0004137 | 3300048908 | Bacteria | 10883 |
| 688 | Ga0496105_0006255 | 3300048908 | Bacteria | 9143 |
| 689 | Ga0496105_0028476 | 3300048908 | Bacteria | 4568 |
| 690 | Ga0496105_0152460 | 3300048908 | Bacteria | 1899 |
| 691 | Ga0496105_0229004 | 3300048908 | Bacteria | 1511 |
| 692 | Ga0496106_0000341 | 3300048909 | Bacteria | 32846 |
| 693 | Ga0496106_0004881 | 3300048909 | Bacteria | 9930 |
| 694 | Ga0496106_0007534 | 3300048909 | Bacteria | 8052 |
| 695 | Ga0496106_0011173 | 3300048909 | Bacteria | 6643 |
| 696 | Ga0496106_0014951 | 3300048909 | Bacteria | 5742 |
| 697 | Ga0496106_0098119 | 3300048909 | Bacteria | 2269 |
| 698 | Ga0496107_0000587 | 3300048910 | Bacteria | 20311 |
| 699 | Ga0496107_0003049 | 3300048910 | Bacteria | 11113 |
| 700 | Ga0496107_0009076 | 3300048910 | Bacteria | 6894 |
| 701 | Ga0496107_0025423 | 3300048910 | Bacteria | 4192 |
| 702 | Ga0496107_0041896 | 3300048910 | Bacteria | 3289 |
| 703 | Ga0496107_0059028 | 3300048910 | Bacteria | 2775 |
| 704 | Ga0496107_0119333 | 3300048910 | Bacteria | 1942 |
| 705 | Ga0496107_0121627 | 3300048910 | Bacteria | 1923 |
| 706 | Ga0496107_0227502 | 3300048910 | Bacteria | 1388 |
| 707 | Ga0496108_0002245 | 3300048911 | Bacteria | 15463 |
| 708 | Ga0496108_0002487 | 3300048911 | Bacteria | 14750 |
| 709 | Ga0496108_0090338 | 3300048911 | Bacteria | 2604 |
| 710 | Ga0496108_0149231 | 3300048911 | Bacteria | 2017 |
| 711 | Ga0496108_0161442 | 3300048911 | Bacteria | 1937 |
| 712 | Ga0496108_0174129 | 3300048911 | Bacteria | 1862 |
| 713 | Ga0496108_0417111 | 3300048911 | Bacteria | 1172 |
| 714 | Ga0496109_0000632 | 3300048912 | Bacteria | 29339 |
| 715 | Ga0496109_0003108 | 3300048912 | Bacteria | 13847 |
| 716 | Ga0496109_0138522 | 3300048912 | Bacteria | 2275 |
| 717 | Ga0496110_0009789 | 3300048913 | Bacteria | 7762 |
| 718 | Ga0496110_0041103 | 3300048913 | Bacteria | 4033 |
| 719 | Ga0496110_0188774 | 3300048913 | Bacteria | 1871 |
| 720 | Ga0496110_0338779 | 3300048913 | Bacteria | 1370 |
| 721 | Ga0496110_0473237 | 3300048913 | Bacteria | 1141 |
| 722 | Ga0496111_0155416 | 3300048914 | Bacteria | 1697 |
| 723 | Ga0496111_0245471 | 3300048914 | Bacteria | 1329 |
| 724 | Ga0496112_0005972 | 3300048915 | Bacteria | 10623 |
| 725 | Ga0496112_0018835 | 3300048915 | Bacteria | 6505 |
| 726 | Ga0496112_0020730 | 3300048915 | Bacteria | 6236 |
| 727 | Ga0496112_0028238 | 3300048915 | Bacteria | 5414 |
| 728 | Ga0496112_0070765 | 3300048915 | Bacteria | 3447 |
| 729 | Ga0496112_0080617 | 3300048915 | Bacteria | 3218 |
| 730 | Ga0496112_0703829 | 3300048915 | Bacteria | 938 |
| 731 | Ga0496113_0038560 | 3300048916 | Bacteria | 3514 |
| 732 | Ga0496113_0064014 | 3300048916 | Bacteria | 2780 |
| 733 | Ga0496113_0116570 | 3300048916 | Bacteria | 2084 |
| 734 | Ga0496114_0002202 | 3300048917 | Bacteria | 14834 |
| 735 | Ga0496114_0002779 | 3300048917 | Bacteria | 13400 |
| 736 | Ga0496114_0004261 | 3300048917 | Bacteria | 11072 |
| 737 | Ga0496114_0008630 | 3300048917 | Bacteria | 8076 |
| 738 | Ga0496114_0017313 | 3300048917 | Bacteria | 5815 |
| 739 | Ga0496114_0018592 | 3300048917 | Bacteria | 5622 |
| 740 | Ga0496115_0019843 | 3300048918 | Bacteria | 5179 |
| 741 | Ga0496115_0029770 | 3300048918 | Bacteria | 4291 |
| 742 | Ga0496115_0046801 | 3300048918 | Bacteria | 3458 |
| 743 | Ga0496115_0055592 | 3300048918 | Bacteria | 3179 |
| 744 | Ga0496115_0062613 | 3300048918 | Bacteria | 3001 |
| 745 | Ga0496116_0000072 | 3300048919 | Bacteria | 238158 |
| 746 | Ga0496116_0008569 | 3300048919 | Bacteria | 8851 |
| 747 | Ga0496117_0000039 | 3300048920 | Bacteria | 322143 |
| 748 | Ga0496117_0002717 | 3300048920 | Bacteria | 21755 |
| 749 | Ga0496118_0000035 | 3300048921 | Bacteria | 322143 |
| 750 | Ga0496118_0004669 | 3300048921 | Bacteria | 16062 |
| 751 | Ga0496119_0000326 | 3300048922 | Bacteria | 66943 |
| 752 | Ga0496119_0005551 | 3300048922 | Bacteria | 12004 |
| 753 | Ga0496120_0000190 | 3300048923 | Bacteria | 105211 |
| 754 | Ga0496120_0002518 | 3300048923 | Bacteria | 18325 |
| 755 | Ga0496121_0000546 | 3300048924 | Bacteria | 71177 |
| 756 | Ga0496121_0005473 | 3300048924 | Bacteria | 16258 |
| 757 | Ga0496124_0045301 | 3300048927 | Bacteria | 3771 |
| 758 | Ga0496125_0033433 | 3300048928 | Bacteria | 4550 |
| 759 | Ga0496125_0078699 | 3300048928 | Bacteria | 2532 |
| 760 | Ga0496125_0123588 | 3300048928 | Bacteria | 1840 |
| 761 | Ga0496126_0000282 | 3300048929 | Bacteria | 107567 |
| 762 | Ga0496126_0006945 | 3300048929 | Bacteria | 12532 |
| 763 | Ga0495682_0039927 | 3300049460 | Bacteria | 1722 |
| 764 | Ga0501032_0002501 | 3300049569 | Bacteria | 14354 |
| 765 | Ga0501034_0005291 | 3300049571 | Bacteria | 14156 |
| 766 | Ga0501038_0002320 | 3300049574 | Bacteria | 17693 |
| 767 | Ga0501039_0067137 | 3300049575 | Bacteria | 2785 |
| 768 | Ga0501043_0004391 | 3300049579 | Bacteria | 11463 |
| 769 | Ga0501067_0018684 | 3300049583 | Bacteria | 3837 |
| 770 | Ga0501069_0008480 | 3300049585 | Bacteria | 5405 |
| 771 | Ga0501070_0006500 | 3300049586 | Bacteria | 9940 |
| 772 | Ga0501080_0056217 | 3300049742 | Bacteria | 3666 |
| 773 | Ga0501044_0042992 | 3300049823 | Bacteria | 4696 |
| 774 | nmdc:mga03683_36767_c1 | 3300050489 | Bacteria | 1993 |
| 775 | nmdc:mga03683_8676_c1 | 3300050489 | Bacteria | 3583 |
| 776 | nmdc:mga03n38_2529_c1 | 3300050490 | Bacteria | 4890 |
| 777 | nmdc:mga03n38_4306_c1 | 3300050490 | Bacteria | 4693 |
| 778 | nmdc:mga03n38_50301_c1 | 3300050490 | Bacteria | 1857 |
| 779 | nmdc:mga03n38_71708_c1 | 3300050490 | Bacteria | 1604 |
| 780 | nmdc:mga00v17_165751_c1 | 3300050491 | Bacteria | 1424 |
| 781 | nmdc:mga00v17_20017_c1 | 3300050491 | Bacteria | 3828 |
| 782 | nmdc:mga00v17_50911_c1 | 3300050491 | Bacteria | 2518 |
| 783 | nmdc:mga00v17_51976_c1 | 3300050491 | Bacteria | 2492 |
| 784 | nmdc:mga00v17_6103_c1 | 3300050491 | Bacteria | 6379 |
| 785 | nmdc:mga00v17_90824_c1 | 3300050491 | Bacteria | 1918 |
| 786 | nmdc:mga00v17_9818_c1 | 3300050491 | Bacteria | 5199 |
| 787 | nmdc:mga0yw44_20481_c1 | 3300050492 | Bacteria | 3671 |
| 788 | nmdc:mga0yw44_35435_c1 | 3300050492 | Bacteria | 2932 |
| 789 | nmdc:mga06z11_90139_c1 | 3300050494 | Bacteria | 1663 |
| 790 | nmdc:mga07m45_103158_c1 | 3300050496 | Bacteria | 1639 |
| 791 | nmdc:mga07m45_16658_c1 | 3300050496 | Bacteria | 3936 |
| 792 | nmdc:mga07m45_20738_c2 | 3300050496 | Bacteria | 3173 |
| 793 | nmdc:mga07m45_24649_c1 | 3300050496 | Bacteria | 3297 |
| 794 | nmdc:mga05p37_141531_c1 | 3300050507 | Bacteria | 2947 |
| 795 | nmdc:mga05p37_186819_c1 | 3300050507 | Bacteria | 2519 |
| 796 | nmdc:mga05p37_33256_c1 | 3300050507 | Bacteria | 6315 |
| 797 | nmdc:mga05p37_35343_c1 | 3300050507 | Bacteria | 6126 |
| 798 | nmdc:mga05p37_44936_c1 | 3300050507 | Bacteria | 5434 |
| 799 | nmdc:mga05p37_92119_c1 | 3300050507 | Bacteria | 3735 |
| 800 | nmdc:mga09592_507444_c1 | 3300050508 | Bacteria | 1038 |
| 801 | nmdc:mga0qj67_177802_c1 | 3300050509 | Bacteria | 1728 |
| 802 | nmdc:mga0qj67_35750_c1 | 3300050509 | Bacteria | 3885 |
| 803 | nmdc:mga0qj67_77454_c1 | 3300050509 | Bacteria | 2660 |
| 804 | nmdc:mga06r32_139904_c1 | 3300050510 | Bacteria | 2396 |
| 805 | nmdc:mga06r32_295753_c1 | 3300050510 | Bacteria | 1605 |
| 806 | nmdc:mga06r32_441290_c1 | 3300050510 | Bacteria | 1282 |
| 807 | nmdc:mga06r32_685022_c1 | 3300050510 | Bacteria | 991 |
| 808 | nmdc:mga08y16_311844_c1 | 3300050511 | Bacteria | 1620 |
| 809 | nmdc:mga0n895_124605_c1 | 3300050512 | Bacteria | 2600 |
| 810 | nmdc:mga0n895_12610_c1 | 3300050512 | Bacteria | 7587 |
| 811 | nmdc:mga0n895_18195_c1 | 3300050512 | Bacteria | 6496 |
| 812 | nmdc:mga0n895_185673_c1 | 3300050512 | Bacteria | 2110 |
| 813 | nmdc:mga0n895_438233_c1 | 3300050512 | Bacteria | 1320 |
| 814 | nmdc:mga0n895_78909_c1 | 3300050512 | Bacteria | 3277 |
| 815 | nmdc:mga0rr50_51509_c1 | 3300050513 | Bacteria | 3055 |
| 816 | nmdc:mga0rr50_55676_c1 | 3300050513 | Bacteria | 2952 |
| 817 | nmdc:mga08x19_161818_c1 | 3300050514 | Bacteria | 1520 |
| 818 | nmdc:mga08x19_251679_c1 | 3300050514 | Bacteria | 1220 |
| 819 | nmdc:mga08x19_9746_c1 | 3300050514 | Bacteria | 5754 |
| 820 | nmdc:mga0a205_108463_c1 | 3300050515 | Bacteria | 2675 |
| 821 | nmdc:mga0a205_116673_c1 | 3300050515 | Bacteria | 2568 |
| 822 | nmdc:mga0a205_231675_c1 | 3300050515 | Bacteria | 1730 |
| 823 | nmdc:mga0sz30_15564_c1 | 3300050516 | Bacteria | 3007 |
| 824 | nmdc:mga0sz30_31066_c1 | 3300050516 | Bacteria | 2209 |
| 825 | nmdc:mga0sz30_41712_c1 | 3300050516 | Bacteria | 1930 |
| 826 | Ga0495601_0073134 | 3300053077 | Bacteria | 2191 |
| 827 | Ga0495655_0003419 | 3300053083 | Bacteria | 2619 |
| 828 | Ga0495619_0140259 | 3300053085 | Bacteria | 1664 |
| 829 | Ga0500556_0002686 | 3300053104 | Bacteria | 5524 |
| 830 | Ga0500562_005324 | 3300053108 | Bacteria | 3231 |
| 831 | Ga0500628_006203 | 3300053129 | Bacteria | 2015 |
| 832 | Ga0500652_000524 | 3300053131 | Bacteria | 13546 |
| 833 | Ga0500616_0024486 | 3300053153 | Bacteria | 3353 |
| 834 | Ga0466962_0037352 | 3300061719 | Bacteria | 2325 |
| 835 | Ga0530510_0024658 | 3300061734 | Bacteria | 4295 |
| 836 | 2558910956 | 2558860112 | Bacteria | 9931328 |
| 837 | 2566994140 | 2565956761 | Bacteria | 6601618 |
| 838 | 2583152071 | 2582580736 | Bacteria | 5325865 |
| 839 | 2586064322 | 2585427649 | Bacteria | 9053857 |
| 840 | 2644486884 | 2643221687 | Bacteria | 6500351 |
| 841 | 2738889842 | 2738541308 | Bacteria | 7020677 |
| 842 | 2739324526 | 2738543027 | Bacteria | 6409078 |
| 843 | 2739365159 | 2738543034 | Bacteria | 6084756 |
| 844 | 2753038639 | 2751185725 | Bacteria | 5740550 |
| 845 | 2753327151 | 2751185792 | Bacteria | 5739090 |
| 846 | 2760306634 | 2758568522 | Bacteria | 5953541 |
| 847 | 2760624893 | 2758568621 | Bacteria | 5967089 |
| 848 | 2776374442 | 2775506925 | Bacteria | 7237746 |
| 849 | 2776376225 | 2775506925 | Bacteria | 7237746 |
| 850 | 2809029794 | 2808606394 | Bacteria | 6248540 |
| 851 | 2809586428 | 2808606522 | Bacteria | 9488490 |
| 852 | 2842139710 | 2842134933 | Bacteria | 5847019 |
| 853 | 2863067968 | 2863067949 | Bacteria | 8541735 |
| 854 | 2863071995 | 2863067949 | Bacteria | 8541735 |
| 855 | 2863074240 | 2863067949 | Bacteria | 8541735 |
| 856 | 2870789127 | 2870782633 | Bacteria | 9624083 |
| 857 | 2902797535 | 2902792274 | Bacteria | 7270173 |
| 858 | 2902843153 | 2902837492 | Bacteria | 6697721 |
| 859 | 2904539908 | 2904535858 | Bacteria | 6308016 |
| 860 | 2904768986 | 2904765812 | Bacteria | 5369154 |
| 861 | 2904771735 | 2904770941 | Bacteria | 5580202 |
| 862 | 2908811774 | 2908811453 | Bacteria | 5478616 |
| 863 | 2915361707 | 2915358134 | Bacteria | 6050864 |
| 864 | 2915775906 | 2915768154 | Bacteria | 8424322 |
| 865 | 2919420101 | 2919420072 | Bacteria | 5390363 |
| 866 | 2919434140 | 2919432681 | Bacteria | 5390474 |
| 867 | 2922560482 | 2922554459 | Bacteria | 6683962 |
| 868 | 2929217619 | 2929212328 | Bacteria | 7708288 |
| 869 | 2939584844 | 2939582691 | Bacteria | 7088898 |
| 870 | 2974320034 | 2974315732 | Bacteria | 4602776 |
| 871 | 2984523901 | 2984523437 | Bacteria | 4508481 |
| 872 | 8003323256 | 8003314358 | Bacteria | 10575343 |
| 873 | 8054477128 | 8054472261 | Bacteria | 7464355 |
| 874 | 8056208129 | 8056207758 | Bacteria | 8639239 |
| 875 | 8056582898 | 8056579771 | Bacteria | 5840325 |
| 876 | Ga0075363_100016139 | |||
| 877 | LJQas_1000960 | |||
| 878 | JGI24746J21847_1000498 | |||
| 879 | JGI24746J21847_1000616 | |||
| 880 | JGI24747J21853_1000476 | |||
| 881 | JGI24747J21853_1007729 | |||
| 882 | JGI24743J22301_10000693 | |||
| 883 | JGI24750J21931_1001011 | |||
| 884 | JGI24750J21931_1001409 | |||
| 885 | JGI24750J21931_1004899 | |||
| 886 | JGI24745J21846_1000218 | |||
| 887 | JGI24745J21846_1000375 | |||
| 888 | JGI24748J21848_1000341 | |||
| 889 | JGI24738J21930_10002720 | |||
| 890 | JGI24749J21850_1000662 | |||
| 891 | JGI24744J21845_10001427 | |||
| 892 | JGI24744J21845_10002829 | |||
| 893 | JGI24034J26672_10000514 | |||
| 894 | JGI25406J46586_10006156 | |||
| 895 | JGI25406J46586_10022519 | |||
| 896 | JGI25406J46586_10022578 | |||
| 897 | JGI25407J50210_10000161 | |||
| 898 | JGI25407J50210_10002355 | |||
| 899 | JGI25407J50210_10002796 | |||
| 900 | Ga0055540_1002047 | |||
| 901 | Ga0070658_10137459 | |||
| 902 | Ga0070676_10009535 | |||
| 903 | Ga0070690_100018186 | |||
| 904 | Ga0070690_100183519 | |||
| 905 | Ga0070670_100179317 | |||
| 906 | Ga0068869_100079280 | |||
| 907 | Ga0070666_10109462 | |||
| 908 | Ga0070666_10219228 | |||
| 909 | Ga0070682_100001259 | |||
| 910 | Ga0070682_100008605 | |||
| 911 | Ga0070682_100048547 | |||
| 912 | Ga0070682_100300503 | |||
| 913 | Ga0068868_100124331 | |||
| 914 | Ga0068868_100324732 | |||
| 915 | Ga0070660_100219165 | |||
| 916 | Ga0070689_100035434 | |||
| 917 | Ga0070691_10002926 | |||
| 918 | Ga0070687_100005625 | |||
| 919 | Ga0070668_100001165 | |||
| 920 | Ga0070668_100001855 | |||
| 921 | Ga0070668_100043544 | |||
| 922 | Ga0070668_100181765 | |||
| 923 | Ga0070668_100256367 | |||
| 924 | Ga0070669_100018342 | |||
| 925 | Ga0070675_100127114 | |||
| 926 | Ga0070671_100003987 | |||
| 927 | Ga0070671_100011350 | |||
| 928 | Ga0070671_100012680 | |||
| 929 | Ga0070671_100204753 | |||
| 930 | Ga0070674_100012380 | |||
| 931 | Ga0070673_100029239 | |||
| 932 | Ga0070688_100002117 | |||
| 933 | Ga0070659_100018966 | |||
| 934 | Ga0070659_100028949 | |||
| 935 | Ga0070659_100164538 | |||
| 936 | Ga0070667_100000468 | |||
| 937 | Ga0070667_100015390 | |||
| 938 | Ga0070703_10006058 | |||
| 939 | Ga0070709_10010224 | |||
| 940 | Ga0070709_10020192 | |||
| 941 | Ga0070714_100046442 | |||
| 942 | Ga0070714_100103473 | |||
| 943 | Ga0070714_100106541 | |||
| 944 | Ga0070714_100364770 | |||
| 945 | Ga0070710_10027723 | |||
| 946 | Ga0070701_10000617 | |||
| 947 | Ga0070711_100078694 | |||
| 948 | Ga0070711_100137340 | |||
| 949 | Ga0070705_100009026 | |||
| 950 | Ga0070705_100032890 | |||
| 951 | Ga0070700_100002857 | |||
| 952 | Ga0070700_100135606 | |||
| 953 | Ga0070700_100251765 | |||
| 954 | Ga0070694_100012620 | |||
| 955 | Ga0070708_100215008 | |||
| 956 | Ga0070708_100327320 | |||
| 957 | Ga0070663_100003517 | |||
| 958 | Ga0070663_100015294 | |||
| 959 | Ga0070663_100256443 | |||
| 960 | Ga0070678_100004949 | |||
| 961 | Ga0070678_100139002 | |||
| 962 | Ga0070681_10157058 | |||
| 963 | Ga0070685_10001600 | |||
| 964 | Ga0070685_10009454 | |||
| 965 | Ga0070685_10034348 | |||
| 966 | Ga0070685_10119212 | |||
| 967 | Ga0070706_100019073 | |||
| 968 | Ga0070707_100026830 | |||
| 969 | Ga0070707_100043795 | |||
| 970 | Ga0070707_100151768 | |||
| 971 | Ga0070698_100016760 | |||
| 972 | Ga0070698_100193781 | |||
| 973 | Ga0070698_100473134 | |||
| 974 | Ga0070699_100008999 | |||
| 975 | Ga0070699_100268479 | |||
| 976 | Ga0070699_100285158 | |||
| 977 | Ga0070679_100194817 | |||
| 978 | Ga0070697_100038352 | |||
| 979 | Ga0070697_100547925 | |||
| 980 | Ga0068853_100018224 | |||
| 981 | Ga0068853_100021473 | |||
| 982 | Ga0070672_100186466 | |||
| 983 | Ga0070686_100010943 | |||
| 984 | Ga0070686_100107966 | |||
| 985 | Ga0070695_100007358 | |||
| 986 | Ga0070695_100068541 | |||
| 987 | Ga0070695_100095874 | |||
| 988 | Ga0070693_100008993 | |||
| 989 | Ga0070693_100025938 | |||
| 990 | Ga0070665_100004640 | |||
| 991 | Ga0070665_100005624 | |||
| 992 | Ga0070665_100079251 | |||
| 993 | Ga0070704_100094735 | |||
| 994 | Ga0070704_100537253 | |||
| 995 | Ga0068856_100052713 | |||
| 996 | Ga0070702_100029771 | |||
| 997 | Ga0068852_100112979 | |||
| 998 | Ga0068859_100003567 | |||
| 999 | Ga0068859_100028179 | |||
| 1000 | Ga0068864_100012164 | |||
| 1001 | Ga0068866_10004444 | |||
| 1002 | Ga0068861_100051091 | |||
| 1003 | Ga0068861_100056955 | |||
| 1004 | Ga0068861_100105274 | |||
| 1005 | Ga0068863_100009877 | |||
| 1006 | Ga0068863_100013617 | |||
| 1007 | Ga0068863_100338869 | |||
| 1008 | Ga0068858_100005179 | |||
| 1009 | Ga0068858_100381452 | |||
| 1010 | Ga0068860_100000162 | |||
| 1011 | Ga0068860_100064242 | |||
| 1012 | Ga0068860_100095237 | |||
| 1013 | Ga0068860_100117557 | |||
| 1014 | Ga0068860_100519443 | |||
| 1015 | Ga0068862_100000373 | |||
| 1016 | Ga0068862_100290613 | |||
| 1017 | Ga0068862_100491813 | |||
| 1018 | Ga0081455_10004355 | |||
| 1019 | Ga0081455_10077520 | |||
| 1020 | Ga0081455_10166767 | |||
| 1021 | Ga0081538_10000016 | |||
| 1022 | Ga0081538_10000689 | |||
| 1023 | Ga0081538_10004047 | |||
| 1024 | Ga0081538_10010693 | |||
| 1025 | Ga0081538_10028847 | |||
| 1026 | Ga0081540_1000672 | |||
| 1027 | Ga0081539_10000473 | |||
| 1028 | Ga0081539_10002003 | |||
| 1029 | Ga0081539_10005624 | |||
| 1030 | Ga0070717_10274210 | |||
| 1031 | Ga0075365_10028659 | |||
| 1032 | Ga0075365_10050794 | |||
| 1033 | Ga0075363_100010049 | |||
| 1034 | Ga0075363_100039578 | |||
| 1035 | Ga0075363_100113166 | |||
| 1036 | Ga0075364_10005595 | |||
| 1037 | Ga0075364_10008577 | |||
| 1038 | Ga0075364_10025508 | |||
| 1039 | Ga0075364_10226531 | |||
| 1040 | Ga0070715_10002160 | |||
| 1041 | Ga0070715_10005623 | |||
| 1042 | Ga0070715_10023821 | |||
| 1043 | Ga0070716_100004804 | |||
| 1044 | Ga0070712_100000457 | |||
| 1045 | Ga0070712_100010040 | |||
| 1046 | Ga0075362_10007045 | |||
| 1047 | Ga0075362_10016171 | |||
| 1048 | Ga0075362_10018230 | |||
| 1049 | Ga0075367_10065059 | |||
| 1050 | Ga0075369_10007854 | |||
| 1051 | Ga0075369_10009484 | |||
| 1052 | Ga0075369_10023442 | |||
| 1053 | Ga0075366_10129291 | |||
| 1054 | Ga0097621_100002586 | |||
| 1055 | Ga0097621_100009467 | |||
| 1056 | Ga0097621_100014025 | |||
| 1057 | Ga0075370_10003318 | |||
| 1058 | Ga0075370_10011114 | |||
| 1059 | Ga0075370_10016689 | |||
| 1060 | Ga0075370_10016905 | |||
| 1061 | Ga0075370_10017518 | |||
| 1062 | Ga0075370_10026776 | |||
| 1063 | Ga0075370_10173326 | |||
| 1064 | Ga0068871_100194905 | |||
| 1065 | Ga0075428_100030957 | |||
| 1066 | Ga0075428_100121239 | |||
| 1067 | Ga0075430_100041879 | |||
| 1068 | Ga0075430_100050876 | |||
| 1069 | Ga0075430_100069815 | |||
| 1070 | Ga0075431_100141728 | |||
| 1071 | Ga0075433_10007344 | |||
| 1072 | Ga0075433_10025121 | |||
| 1073 | Ga0075434_100055191 | |||
| 1074 | Ga0075434_100068928 | |||
| 1075 | Ga0075434_100071810 | |||
| 1076 | Ga0075434_100423274 | |||
| 1077 | Ga0075429_100423054 | |||
| 1078 | Ga0068865_100002260 | |||
| 1079 | Ga0075436_100020623 | |||
| 1080 | Ga0097620_100003567 | |||
| 1081 | Ga0097620_100028179 | |||
| 1082 | Ga0075435_100016666 | |||
| 1083 | Ga0075435_100095458 | |||
| 1084 | Ga0099795_10009068 | |||
| 1085 | Ga0099795_10027342 | |||
| 1086 | Ga0105250_10009359 | |||
| 1087 | Ga0111539_10172596 | |||
| 1088 | Ga0111539_10390645 | |||
| 1089 | Ga0105245_10056439 | |||
| 1090 | Ga0105245_10304902 | |||
| 1091 | Ga0105247_10000079 | |||
| 1092 | Ga0105247_10050758 | |||
| 1093 | Ga0105247_10053743 | |||
| 1094 | Ga0105247_10322885 | |||
| 1095 | Ga0114129_10006035 | |||
| 1096 | Ga0114129_10009275 | |||
| 1097 | Ga0114129_10035738 | |||
| 1098 | Ga0114129_10048133 | |||
| 1099 | Ga0114129_10175878 | |||
| 1100 | Ga0105243_10059404 | |||
| 1101 | Ga0105241_10005880 | |||
| 1102 | Ga0105241_10074070 | |||
| 1103 | Ga0105242_10006380 | |||
| 1104 | Ga0105242_10062755 | |||
| 1105 | Ga0105248_10000827 | |||
| 1106 | Ga0105248_10042193 | |||
| 1107 | Ga0105248_10063895 | |||
| 1108 | Ga0105248_10093205 | |||
| 1109 | Ga0105248_10404642 | |||
| 1110 | Ga0105237_10004991 | |||
| 1111 | Ga0105237_10043563 | |||
| 1112 | Ga0105237_10129585 | |||
| 1113 | Ga0105238_10029035 | |||
| 1114 | Ga0105238_10142393 | |||
| 1115 | Ga0105249_10000098 | |||
| 1116 | Ga0105249_10004019 | |||
| 1117 | Ga0105249_10010991 | |||
| 1118 | Ga0105249_10212766 | |||
| 1119 | Ga0099796_10000539 | |||
| 1120 | Ga0105239_10056552 | |||
| 1121 | Ga0105239_10178515 | |||
| 1122 | Ga0105239_10216429 | |||
| 1123 | Ga0105246_10003571 | |||
| 1124 | Ga0105246_10061056 | |||
| 1125 | Ga0157371_10045063 | |||
| 1126 | Ga0157369_10045974 | |||
| 1127 | Ga0157374_10005982 | |||
| 1128 | Ga0157374_10033291 | |||
| 1129 | Ga0157378_10002762 | |||
| 1130 | Ga0157378_10029547 | |||
| 1131 | Ga0157378_10043774 | |||
| 1132 | Ga0163162_10020021 | |||
| 1133 | Ga0163162_10087064 | |||
| 1134 | Ga0163162_10118515 | |||
| 1135 | Ga0163162_10193683 | |||
| 1136 | Ga0163162_10249706 | |||
| 1137 | Ga0163162_10355421 | |||
| 1138 | Ga0157372_10048650 | |||
| 1139 | Ga0157372_10352980 | |||
| 1140 | Ga0157375_10284512 | |||
| 1141 | Ga0157375_10569919 | |||
| 1142 | Ga0163163_10043510 | |||
| 1143 | Ga0163163_10169799 | |||
| 1144 | Ga0163163_10337839 | |||
| 1145 | Ga0157380_10007667 | |||
| 1146 | Ga0157380_10030175 | |||
| 1147 | Ga0157377_10013154 | |||
| 1148 | Ga0157377_10015443 | |||
| 1149 | Ga0157379_10063162 | |||
| 1150 | Ga0157376_10004627 | |||
| 1151 | Ga0157376_10051774 | |||
| 1152 | Ga0163161_10200668 | |||
| 1153 | Ga0209051_1000539 | |||
| 1154 | Ga0209051_1001358 | |||
| 1155 | Ga0209051_1008208 | |||
| 1156 | Ga0207696_1009721 | |||
| 1157 | Ga0207653_10003334 | |||
| 1158 | Ga0207692_10001625 | |||
| 1159 | Ga0207692_10036730 | |||
| 1160 | Ga0207642_10000593 | |||
| 1161 | Ga0207710_10000022 | |||
| 1162 | Ga0207710_10005837 | |||
| 1163 | Ga0207688_10001754 | |||
| 1164 | Ga0207688_10017263 | |||
| 1165 | Ga0207680_10059954 | |||
| 1166 | Ga0207647_10016233 | |||
| 1167 | Ga0207647_10092973 | |||
| 1168 | Ga0207685_10000084 | |||
| 1169 | Ga0207685_10007018 | |||
| 1170 | Ga0207699_10004982 | |||
| 1171 | Ga0207645_10008761 | |||
| 1172 | Ga0207684_10013292 | |||
| 1173 | Ga0207654_10048355 | |||
| 1174 | Ga0207671_10012324 | |||
| 1175 | Ga0207671_10074839 | |||
| 1176 | Ga0207693_10000670 | |||
| 1177 | Ga0207693_10067119 | |||
| 1178 | Ga0207663_10002342 | |||
| 1179 | Ga0207663_10115587 | |||
| 1180 | Ga0207660_10011508 | |||
| 1181 | Ga0207660_10079080 | |||
| 1182 | Ga0207662_10010107 | |||
| 1183 | Ga0207662_10073832 | |||
| 1184 | Ga0207657_10023385 | |||
| 1185 | Ga0207657_10142782 | |||
| 1186 | Ga0207652_10029963 | |||
| 1187 | Ga0207646_10063429 | |||
| 1188 | Ga0207681_10009873 | |||
| 1189 | Ga0207681_10165682 | |||
| 1190 | Ga0207650_10150017 | |||
| 1191 | Ga0207687_10026499 | |||
| 1192 | Ga0207687_10026712 | |||
| 1193 | Ga0207687_10242909 | |||
| 1194 | Ga0207700_10004729 | |||
| 1195 | Ga0207700_10007267 | |||
| 1196 | Ga0207700_10179471 | |||
| 1197 | Ga0207664_10001469 | |||
| 1198 | Ga0207664_10006181 | |||
| 1199 | Ga0207664_10075349 | |||
| 1200 | Ga0207644_10003245 | |||
| 1201 | Ga0207644_10007403 | |||
| 1202 | Ga0207644_10075147 | |||
| 1203 | Ga0207644_10132536 | |||
| 1204 | Ga0207644_10135036 | |||
| 1205 | Ga0207690_10359956 | |||
| 1206 | Ga0207706_10040444 | |||
| 1207 | Ga0207706_10199546 | |||
| 1208 | Ga0207706_10262713 | |||
| 1209 | Ga0207686_10005080 | |||
| 1210 | Ga0207686_10019694 | |||
| 1211 | Ga0207686_10068349 | |||
| 1212 | Ga0207709_10008531 | |||
| 1213 | Ga0207670_10006823 | |||
| 1214 | Ga0207669_10003581 | |||
| 1215 | Ga0207704_10001501 | |||
| 1216 | Ga0207704_10133529 | |||
| 1217 | Ga0207665_10015966 | |||
| 1218 | Ga0207665_10119046 | |||
| 1219 | Ga0207665_10121858 | |||
| 1220 | Ga0207691_10018296 | |||
| 1221 | Ga0207711_10000404 | |||
| 1222 | Ga0207711_10006841 | |||
| 1223 | Ga0207711_10026567 | |||
| 1224 | Ga0207711_10165617 | |||
| 1225 | Ga0207689_10023474 | |||
| 1226 | Ga0207689_10104677 | |||
| 1227 | Ga0207661_10300047 | |||
| 1228 | Ga0207667_10262170 | |||
| 1229 | Ga0207667_10601979 | |||
| 1230 | Ga0207667_10639444 | |||
| 1231 | Ga0207651_10062993 | |||
| 1232 | Ga0207712_10000076 | |||
| 1233 | Ga0207712_10004461 | |||
| 1234 | Ga0207712_10062806 | |||
| 1235 | Ga0207712_10142265 | |||
| 1236 | Ga0207668_10013992 | |||
| 1237 | Ga0207668_10025220 | |||
| 1238 | Ga0207668_10032618 | |||
| 1239 | Ga0207668_10082354 | |||
| 1240 | Ga0207668_10161284 | |||
| 1241 | Ga0207668_10275669 | |||
| 1242 | Ga0207658_10000821 | |||
| 1243 | Ga0207677_10002902 | |||
| 1244 | Ga0207677_10215197 | |||
| 1245 | Ga0207677_10451124 | |||
| 1246 | Ga0207703_10006399 | |||
| 1247 | Ga0207703_10069033 | |||
| 1248 | Ga0207703_10261373 | |||
| 1249 | Ga0207639_10038395 | |||
| 1250 | Ga0207639_10172673 | |||
| 1251 | Ga0207639_10231259 | |||
| 1252 | Ga0207639_10407297 | |||
| 1253 | Ga0207678_10003523 | |||
| 1254 | Ga0207678_10016735 | |||
| 1255 | Ga0207708_10001232 | |||
| 1256 | Ga0207708_10011608 | |||
| 1257 | Ga0207702_10074384 | |||
| 1258 | Ga0207702_10445376 | |||
| 1259 | Ga0207641_10002622 | |||
| 1260 | Ga0207641_10004801 | |||
| 1261 | Ga0207641_10056732 | |||
| 1262 | Ga0207641_10118121 | |||
| 1263 | Ga0207648_10006703 | |||
| 1264 | Ga0207676_10010661 | |||
| 1265 | Ga0207675_100006346 | |||
| 1266 | Ga0207675_100058819 | |||
| 1267 | Ga0207675_100150315 | |||
| 1268 | Ga0207675_100162814 | |||
| 1269 | Ga0207675_100309781 | |||
| 1270 | Ga0207683_10000111 | |||
| 1271 | Ga0207683_10000252 | |||
| 1272 | Ga0207683_10026842 | |||
| 1273 | Ga0207683_10164325 | |||
| 1274 | Ga0207698_10195900 | |||
| 1275 | Ga0209179_1003876 | |||
| 1276 | Ga0207428_10331186 | |||
| 1277 | Ga0268266_10022049 | |||
| 1278 | Ga0268266_10023683 | |||
| 1279 | Ga0268266_10060816 | |||
| 1280 | Ga0268266_10275322 | |||
| 1281 | Ga0268265_10000368 | |||
| 1282 | Ga0268265_10018475 | |||
| 1283 | Ga0268265_10372366 | |||
| 1284 | Ga0268264_10000017 | |||
| 1285 | Ga0268264_10021985 | |||
| 1286 | Ga0268264_10056691 | |||
| 1287 | Ga0268264_10094037 | |||
| 1288 | Ga0268264_10221883 | |||
| 1289 | Ga0265319_1006706 | |||
| 1290 | Ga0265760_10034700 | |||
| 1291 | Ga0307513_10273927 | |||
| 1292 | Ga0307405_10077187 | |||
| 1293 | Ga0307518_10002006 | |||
| 1294 | Ga0307410_10099905 | |||
| 1295 | Ga0307406_10068567 | |||
| 1296 | Ga0307412_10069486 | |||
| 1297 | Ga0307409_100014560 | |||
| 1298 | Ga0307416_100040466 | |||
| 1299 | Ga0307416_100143117 | |||
| 1300 | Ga0307416_100245953 | |||
| 1301 | Ga0307411_10035845 | |||
| 1302 | Ga0307415_100112340 | |||
| 1303 | Ga0307507_10029505 | |||
| 1304 | Ga0307510_10018502 | |||
| 1305 | Ga0373928_0010127 | |||
| 1306 | Ga0373940_0005513 | |||
| 1307 | Ga0373951_0009031 | |||
| 1308 | Ga0373923_0006939 | |||
| 1309 | Ga0373932_0078881 | |||
| 1310 | Ga0373936_0003887 | |||
| 1311 | Ga0373941_0026896 | |||
| 1312 | Ga0373945_0016230 | |||
| 1313 | Ga0373946_0050101 | |||
| 1314 | Ga0373924_0032783 | |||
| 1315 | Ga0373931_0018099 | |||
| 1316 | Ga0373931_0075210 | |||
| 1317 | Ga0373931_0077301 | |||
| 1318 | Ga0373935_0055434 | |||
| 1319 | Ga0373935_0071955 | |||
| 1320 | Ga0373927_0020945 | |||
| 1321 | Ga0373933_0263868 | |||
| 1322 | Ga0373947_0034554 | |||
| 1323 | Ga0373947_0111071 | |||
| 1324 | Ga0373925_0026479 | |||
| 1325 | Ga0373925_0029100 | |||
| 1326 | Ga0395899_0003336 | |||
| 1327 | Ga0395899_0021812 | |||
| 1328 | Ga0395899_0026222 | |||
| 1329 | Ga0395899_0031790 | |||
| 1330 | Ga0395899_0041967 | |||
| 1331 | Ga0395899_0044366 | |||
| 1332 | Ga0395899_0090940 | |||
| 1333 | Ga0395899_0102694 | |||
| 1334 | Ga0395899_0104588 | |||
| 1335 | Ga0395899_0112110 | |||
| 1336 | Ga0395899_0120107 | |||
| 1337 | Ga0395899_0212982 | |||
| 1338 | Ga0395899_0264921 | |||
| 1339 | Ga0395900_0006560 | |||
| 1340 | Ga0395900_0011651 | |||
| 1341 | Ga0395900_0012286 | |||
| 1342 | Ga0395900_0015379 | |||
| 1343 | Ga0395900_0032309 | |||
| 1344 | Ga0395900_0034103 | |||
| 1345 | Ga0395900_0034752 | |||
| 1346 | Ga0395900_0035869 | |||
| 1347 | Ga0395900_0036906 | |||
| 1348 | Ga0395900_0037044 | |||
| 1349 | Ga0395900_0041050 | |||
| 1350 | Ga0395900_0048276 | |||
| 1351 | Ga0395900_0067230 | |||
| 1352 | Ga0395900_0084539 | |||
| 1353 | Ga0395900_0087716 | |||
| 1354 | Ga0395900_0092720 | |||
| 1355 | Ga0395900_0098431 | |||
| 1356 | Ga0395900_0171943 | |||
| 1357 | Ga0395900_0193437 | |||
| 1358 | Ga0395900_0217842 | |||
| 1359 | Ga0395900_0229740 | |||
| 1360 | Ga0395900_0260228 | |||
| 1361 | Ga0395900_0351265 | |||
| 1362 | Ga0395898_0004675 | |||
| 1363 | Ga0395898_0005170 | |||
| 1364 | Ga0395898_0008629 | |||
| 1365 | Ga0395898_0011863 | |||
| 1366 | Ga0395898_0012164 | |||
| 1367 | Ga0395898_0015585 | |||
| 1368 | Ga0395898_0017293 | |||
| 1369 | Ga0395898_0021431 | |||
| 1370 | Ga0395898_0023169 | |||
| 1371 | Ga0395898_0026636 | |||
| 1372 | Ga0395898_0030416 | |||
| 1373 | Ga0395898_0081061 | |||
| 1374 | Ga0395898_0085590 | |||
| 1375 | Ga0395898_0092794 | |||
| 1376 | Ga0395898_0104570 | |||
| 1377 | Ga0395898_0112887 | |||
| 1378 | Ga0395898_0156590 | |||
| 1379 | Ga0395898_0195168 | |||
| 1380 | Ga0395898_0211215 | |||
| 1381 | Ga0395898_0221362 | |||
| 1382 | Ga0395898_0347925 | |||
| 1383 | Ga0395898_0358761 | |||
| 1384 | Ga0395898_0484286 | |||
| 1385 | Ga0395898_0666674 | |||
| 1386 | Ga0395905_0005356 | |||
| 1387 | Ga0395905_0005405 | |||
| 1388 | Ga0395905_0007227 | |||
| 1389 | Ga0395905_0009125 | |||
| 1390 | Ga0395905_0017394 | |||
| 1391 | Ga0395905_0019112 | |||
| 1392 | Ga0395905_0021364 | |||
| 1393 | Ga0395905_0022935 | |||
| 1394 | Ga0395905_0023760 | |||
| 1395 | Ga0395905_0027596 | |||
| 1396 | Ga0395905_0029167 | |||
| 1397 | Ga0395905_0030109 | |||
| 1398 | Ga0395905_0051964 | |||
| 1399 | Ga0395905_0053704 | |||
| 1400 | Ga0395905_0054812 | |||
| 1401 | Ga0395905_0084453 | |||
| 1402 | Ga0395905_0115358 | |||
| 1403 | Ga0395905_0303864 | |||
| 1404 | Ga0395905_0355371 | |||
| 1405 | Ga0395905_0476122 | |||
| 1406 | Ga0436364_0258924 | |||
| 1407 | Ga0436364_0935170 | |||
| 1408 | Ga0436364_1133240 | |||
| 1409 | Ga0395901_0001195 | |||
| 1410 | Ga0395901_0006581 | |||
| 1411 | Ga0395901_0006722 | |||
| 1412 | Ga0395901_0007177 | |||
| 1413 | Ga0395901_0009708 | |||
| 1414 | Ga0395901_0010611 | |||
| 1415 | Ga0395901_0012790 | |||
| 1416 | Ga0395901_0014259 | |||
| 1417 | Ga0395901_0016637 | |||
| 1418 | Ga0395901_0016691 | |||
| 1419 | Ga0395901_0020745 | |||
| 1420 | Ga0395901_0021773 | |||
| 1421 | Ga0395901_0026489 | |||
| 1422 | Ga0395901_0030244 | |||
| 1423 | Ga0395901_0033524 | |||
| 1424 | Ga0395901_0045914 | |||
| 1425 | Ga0395901_0062480 | |||
| 1426 | Ga0395901_0066153 | |||
| 1427 | Ga0395901_0088757 | |||
| 1428 | Ga0395901_0100349 | |||
| 1429 | Ga0395901_0102083 | |||
| 1430 | Ga0395901_0137682 | |||
| 1431 | Ga0395901_0145697 | |||
| 1432 | Ga0395901_0182661 | |||
| 1433 | Ga0395901_0245547 | |||
| 1434 | Ga0395901_0283918 | |||
| 1435 | Ga0395901_0407314 | |||
| 1436 | Ga0395901_0479407 | |||
| 1437 | Ga0395901_0569715 | |||
| 1438 | Ga0439466_0029263 | |||
| 1439 | Ga0439465_0002064 | |||
| 1440 | Ga0439465_0002174 | |||
| 1441 | Ga0439465_0016313 | |||
| 1442 | Ga0451841_0812662 | |||
| 1443 | Ga0439431_0044450 | |||
| 1444 | Ga0439445_0022877 | |||
| 1445 | Ga0439448_0002878 | |||
| 1446 | Ga0439448_0030956 | |||
| 1447 | Ga0439450_000648 | |||
| 1448 | Ga0439451_017316 | |||
| 1449 | Ga0439455_0009135 | |||
| 1450 | Ga0439463_000926 | |||
| 1451 | Ga0439444_0001800 | |||
| 1452 | Ga0439464_0008797 | |||
| 1453 | Ga0439440_0001901 | |||
| 1454 | Ga0466972_0002072 | |||
| 1455 | Ga0466972_0002500 | |||
| 1456 | Ga0466972_0018178 | |||
| 1457 | Ga0466972_0024771 | |||
| 1458 | Ga0466972_0032778 | |||
| 1459 | Ga0466965_0004079 | |||
| 1460 | Ga0466965_0007858 | |||
| 1461 | Ga0466965_0017974 | |||
| 1462 | Ga0466965_0118838 | |||
| 1463 | Ga0466966_0015602 | |||
| 1464 | Ga0466966_0108138 | |||
| 1465 | Ga0466961_0031897 | |||
| 1466 | Ga0466963_0145277 | |||
| 1467 | Ga0466970_0003109 | |||
| 1468 | Ga0466970_0019637 | |||
| 1469 | Ga0466957_0016862 | |||
| 1470 | Ga0466957_0097828 | |||
| 1471 | Ga0466960_0000238 | |||
| 1472 | Ga0466960_0026776 | |||
| 1473 | Ga0466958_0012637 | |||
| 1474 | Ga0466967_0013429 | |||
| 1475 | Ga0466967_0018684 | |||
| 1476 | Ga0466967_0102077 | |||
| 1477 | Ga0466967_0201417 | |||
| 1478 | Ga0466967_0223166 | |||
| 1479 | Ga0495603_0056427 | |||
| 1480 | Ga0495629_0018923 | |||
| 1481 | Ga0495629_0057356 | |||
| 1482 | Ga0495638_0001626 | |||
| 1483 | Ga0495641_0019344 | |||
| 1484 | Ga0495580_0290478 | |||
| 1485 | Ga0495582_0039529 | |||
| 1486 | Ga0495582_0042163 | |||
| 1487 | Ga0495639_0013535 | |||
| 1488 | Ga0495662_0162589 | |||
| 1489 | Ga0495594_0107046 | |||
| 1490 | Ga0495607_0028236 | |||
| 1491 | Ga0495607_0108285 | |||
| 1492 | Ga0495630_0110401 | |||
| 1493 | Ga0495644_0035317 | |||
| 1494 | Ga0495648_0003500 | |||
| 1495 | Ga0495666_0018688 | |||
| 1496 | Ga0495642_0027887 | |||
| 1497 | Ga0495654_0033319 | |||
| 1498 | Ga0495665_0021183 | |||
| 1499 | Ga0495609_0051314 | |||
| 1500 | Ga0495645_0016917 | |||
| 1501 | Ga0495645_0097207 | |||
| 1502 | Ga0495667_0213348 | |||
| 1503 | Ga0495656_0031116 | |||
| 1504 | Ga0495668_0000043 | |||
| 1505 | Ga0495611_0033069 | |||
| 1506 | Ga0495588_0021242 | |||
| 1507 | Ga0495599_0135086 | |||
| 1508 | Ga0495613_0130151 | |||
| 1509 | Ga0495671_0103066 | |||
| 1510 | Ga0495589_0057590 | |||
| 1511 | Ga0495660_0191986 | |||
| 1512 | Ga0495581_0022849 | |||
| 1513 | Ga0495581_0105942 | |||
| 1514 | Ga0495604_0188501 | |||
| 1515 | Ga0495674_0002886 | |||
| 1516 | Ga0495672_0003728 | |||
| 1517 | Ga0495676_0074453 | |||
| 1518 | Ga0495676_0083108 | |||
| 1519 | Ga0495676_0149160 | |||
| 1520 | Ga0495680_0135328 | |||
| 1521 | Ga0495683_0002342 | |||
| 1522 | Ga0495683_0095641 | |||
| 1523 | Ga0495673_0003932 | |||
| 1524 | Ga0495684_0166327 | |||
| 1525 | Ga0495686_0000930 | |||
| 1526 | Ga0495593_0021728 | |||
| 1527 | Ga0495593_0074653 | |||
| 1528 | Ga0495626_0041717 | |||
| 1529 | Ga0496100_0000960 | |||
| 1530 | Ga0496100_0001591 | |||
| 1531 | Ga0496100_0028475 | |||
| 1532 | Ga0496100_0031682 | |||
| 1533 | Ga0496100_0058911 | |||
| 1534 | Ga0496100_0104053 | |||
| 1535 | Ga0496101_0000049 | |||
| 1536 | Ga0496101_0001902 | |||
| 1537 | Ga0496101_0002184 | |||
| 1538 | Ga0496101_0004825 | |||
| 1539 | Ga0496101_0009937 | |||
| 1540 | Ga0496101_0027142 | |||
| 1541 | Ga0496101_0042557 | |||
| 1542 | Ga0496101_0046183 | |||
| 1543 | Ga0496102_0000011 | |||
| 1544 | Ga0496102_0001591 | |||
| 1545 | Ga0496102_0003839 | |||
| 1546 | Ga0496102_0008601 | |||
| 1547 | Ga0496102_0015388 | |||
| 1548 | Ga0496102_0042388 | |||
| 1549 | Ga0496102_0102421 | |||
| 1550 | Ga0496102_0113660 | |||
| 1551 | Ga0496102_0155143 | |||
| 1552 | Ga0496102_0205131 | |||
| 1553 | Ga0496103_0000032 | |||
| 1554 | Ga0496103_0003321 | |||
| 1555 | Ga0496103_0012601 | |||
| 1556 | Ga0496104_0005333 | |||
| 1557 | Ga0496104_0012533 | |||
| 1558 | Ga0496104_0040252 | |||
| 1559 | Ga0496104_0042055 | |||
| 1560 | Ga0496104_0047670 | |||
| 1561 | Ga0496104_0279232 | |||
| 1562 | Ga0496105_0004137 | |||
| 1563 | Ga0496105_0006255 | |||
| 1564 | Ga0496105_0028476 | |||
| 1565 | Ga0496105_0152460 | |||
| 1566 | Ga0496105_0229004 | |||
| 1567 | Ga0496106_0000341 | |||
| 1568 | Ga0496106_0004881 | |||
| 1569 | Ga0496106_0007534 | |||
| 1570 | Ga0496106_0011173 | |||
| 1571 | Ga0496106_0014951 | |||
| 1572 | Ga0496106_0098119 | |||
| 1573 | Ga0496107_0000587 | |||
| 1574 | Ga0496107_0003049 | |||
| 1575 | Ga0496107_0009076 | |||
| 1576 | Ga0496107_0025423 | |||
| 1577 | Ga0496107_0041896 | |||
| 1578 | Ga0496107_0059028 | |||
| 1579 | Ga0496107_0119333 | |||
| 1580 | Ga0496107_0121627 | |||
| 1581 | Ga0496107_0227502 | |||
| 1582 | Ga0496108_0002245 | |||
| 1583 | Ga0496108_0002487 | |||
| 1584 | Ga0496108_0090338 | |||
| 1585 | Ga0496108_0149231 | |||
| 1586 | Ga0496108_0161442 | |||
| 1587 | Ga0496108_0174129 | |||
| 1588 | Ga0496108_0417111 | |||
| 1589 | Ga0496109_0000632 | |||
| 1590 | Ga0496109_0003108 | |||
| 1591 | Ga0496109_0138522 | |||
| 1592 | Ga0496110_0009789 | |||
| 1593 | Ga0496110_0041103 | |||
| 1594 | Ga0496110_0188774 | |||
| 1595 | Ga0496110_0338779 | |||
| 1596 | Ga0496110_0473237 | |||
| 1597 | Ga0496111_0155416 | |||
| 1598 | Ga0496111_0245471 | |||
| 1599 | Ga0496112_0005972 | |||
| 1600 | Ga0496112_0018835 | |||
| 1601 | Ga0496112_0020730 | |||
| 1602 | Ga0496112_0028238 | |||
| 1603 | Ga0496112_0070765 | |||
| 1604 | Ga0496112_0080617 | |||
| 1605 | Ga0496112_0703829 | |||
| 1606 | Ga0496113_0038560 | |||
| 1607 | Ga0496113_0064014 | |||
| 1608 | Ga0496113_0116570 | |||
| 1609 | Ga0496114_0002202 | |||
| 1610 | Ga0496114_0002779 | |||
| 1611 | Ga0496114_0004261 | |||
| 1612 | Ga0496114_0008630 | |||
| 1613 | Ga0496114_0017313 | |||
| 1614 | Ga0496114_0018592 | |||
| 1615 | Ga0496115_0019843 | |||
| 1616 | Ga0496115_0029770 | |||
| 1617 | Ga0496115_0046801 | |||
| 1618 | Ga0496115_0055592 | |||
| 1619 | Ga0496115_0062613 | |||
| 1620 | Ga0496116_0000072 | |||
| 1621 | Ga0496116_0008569 | |||
| 1622 | Ga0496117_0000039 | |||
| 1623 | Ga0496117_0002717 | |||
| 1624 | Ga0496118_0000035 | |||
| 1625 | Ga0496118_0004669 | |||
| 1626 | Ga0496119_0000326 | |||
| 1627 | Ga0496119_0005551 | |||
| 1628 | Ga0496120_0000190 | |||
| 1629 | Ga0496120_0002518 | |||
| 1630 | Ga0496121_0000546 | |||
| 1631 | Ga0496121_0005473 | |||
| 1632 | Ga0496124_0045301 | |||
| 1633 | Ga0496125_0033433 | |||
| 1634 | Ga0496125_0078699 | |||
| 1635 | Ga0496125_0123588 | |||
| 1636 | Ga0496126_0000282 | |||
| 1637 | Ga0496126_0006945 | |||
| 1638 | Ga0495682_0039927 | |||
| 1639 | Ga0501032_0002501 | |||
| 1640 | Ga0501034_0005291 | |||
| 1641 | Ga0501038_0002320 | |||
| 1642 | Ga0501039_0067137 | |||
| 1643 | Ga0501043_0004391 | |||
| 1644 | Ga0501067_0018684 | |||
| 1645 | Ga0501069_0008480 | |||
| 1646 | Ga0501070_0006500 | |||
| 1647 | Ga0501080_0056217 | |||
| 1648 | Ga0501044_0042992 | |||
| 1649 | nmdc:mga03683_36767_c1 | |||
| 1650 | nmdc:mga03683_8676_c1 | |||
| 1651 | nmdc:mga03n38_2529_c1 | |||
| 1652 | nmdc:mga03n38_4306_c1 | |||
| 1653 | nmdc:mga03n38_50301_c1 | |||
| 1654 | nmdc:mga03n38_71708_c1 | |||
| 1655 | nmdc:mga00v17_165751_c1 | |||
| 1656 | nmdc:mga00v17_20017_c1 | |||
| 1657 | nmdc:mga00v17_50911_c1 | |||
| 1658 | nmdc:mga00v17_51976_c1 | |||
| 1659 | nmdc:mga00v17_6103_c1 | |||
| 1660 | nmdc:mga00v17_90824_c1 | |||
| 1661 | nmdc:mga00v17_9818_c1 | |||
| 1662 | nmdc:mga0yw44_20481_c1 | |||
| 1663 | nmdc:mga0yw44_35435_c1 | |||
| 1664 | nmdc:mga06z11_90139_c1 | |||
| 1665 | nmdc:mga07m45_103158_c1 | |||
| 1666 | nmdc:mga07m45_16658_c1 | |||
| 1667 | nmdc:mga07m45_20738_c2 | |||
| 1668 | nmdc:mga07m45_24649_c1 | |||
| 1669 | nmdc:mga05p37_141531_c1 | |||
| 1670 | nmdc:mga05p37_186819_c1 | |||
| 1671 | nmdc:mga05p37_33256_c1 | |||
| 1672 | nmdc:mga05p37_35343_c1 | |||
| 1673 | nmdc:mga05p37_44936_c1 | |||
| 1674 | nmdc:mga05p37_92119_c1 | |||
| 1675 | nmdc:mga09592_507444_c1 | |||
| 1676 | nmdc:mga0qj67_177802_c1 | |||
| 1677 | nmdc:mga0qj67_35750_c1 | |||
| 1678 | nmdc:mga0qj67_77454_c1 | |||
| 1679 | nmdc:mga06r32_139904_c1 | |||
| 1680 | nmdc:mga06r32_295753_c1 | |||
| 1681 | nmdc:mga06r32_441290_c1 | |||
| 1682 | nmdc:mga06r32_685022_c1 | |||
| 1683 | nmdc:mga08y16_311844_c1 | |||
| 1684 | nmdc:mga0n895_124605_c1 | |||
| 1685 | nmdc:mga0n895_12610_c1 | |||
| 1686 | nmdc:mga0n895_18195_c1 | |||
| 1687 | nmdc:mga0n895_185673_c1 | |||
| 1688 | nmdc:mga0n895_438233_c1 | |||
| 1689 | nmdc:mga0n895_78909_c1 | |||
| 1690 | nmdc:mga0rr50_51509_c1 | |||
| 1691 | nmdc:mga0rr50_55676_c1 | |||
| 1692 | nmdc:mga08x19_161818_c1 | |||
| 1693 | nmdc:mga08x19_251679_c1 | |||
| 1694 | nmdc:mga08x19_9746_c1 | |||
| 1695 | nmdc:mga0a205_108463_c1 | |||
| 1696 | nmdc:mga0a205_116673_c1 | |||
| 1697 | nmdc:mga0a205_231675_c1 | |||
| 1698 | nmdc:mga0sz30_15564_c1 | |||
| 1699 | nmdc:mga0sz30_31066_c1 | |||
| 1700 | nmdc:mga0sz30_41712_c1 | |||
| 1701 | Ga0495601_0073134 | |||
| 1702 | Ga0495655_0003419 | |||
| 1703 | Ga0495619_0140259 | |||
| 1704 | Ga0500556_0002686 | |||
| 1705 | Ga0500562_005324 | |||
| 1706 | Ga0500628_006203 | |||
| 1707 | Ga0500652_000524 | |||
| 1708 | Ga0500616_0024486 | |||
| 1709 | Ga0466962_0037352 | |||
| 1710 | Ga0530510_0024658 | |||
| 1711 | 2558910956 | |||
| 1712 | 2566994140 | |||
| 1713 | 2583152071 | |||
| 1714 | 2586064322 | |||
| 1715 | 2644486884 | |||
| 1716 | 2738889842 | |||
| 1717 | 2739324526 | |||
| 1718 | 2739365159 | |||
| 1719 | 2753038639 | |||
| 1720 | 2753327151 | |||
| 1721 | 2760306634 | |||
| 1722 | 2760624893 | |||
| 1723 | 2776374442 | |||
| 1724 | 2776376225 | |||
| 1725 | 2809029794 | |||
| 1726 | 2809586428 | |||
| 1727 | 2842139710 | |||
| 1728 | 2863067968 | |||
| 1729 | 2863071995 | |||
| 1730 | 2863074240 | |||
| 1731 | 2870789127 | |||
| 1732 | 2902797535 | |||
| 1733 | 2902843153 | |||
| 1734 | 2904539908 | |||
| 1735 | 2904768986 | |||
| 1736 | 2904771735 | |||
| 1737 | 2908811774 | |||
| 1738 | 2915361707 | |||
| 1739 | 2915775906 | |||
| 1740 | 2919420101 | |||
| 1741 | 2919434140 | |||
| 1742 | 2922560482 | |||
| 1743 | 2929217619 | |||
| 1744 | 2939584844 | |||
| 1745 | 2974320034 | |||
| 1746 | 2984523901 | |||
| 1747 | 8003323256 | |||
| 1748 | 8054477128 | |||
| 1749 | 8056208129 | |||
| 1750 | 8056582898 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
115
322
0.75
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.8052 | 22 | 286 |
| 8hpl-assembly1.cif.gz_A | lpqy-sugabc in state 1 | 0.8014 | 22 | 287 |
| 8ja7-assembly1.cif.gz_A | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.7928 | 24 | 296 |
| 8hps-assembly1.cif.gz_A | lpqy-sugabc in state 5 | 0.7903 | 24 | 286 |
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.7724 | 22 | 286 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P10905_52_292_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8589 | 68 | 289 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8386 | 68 | 290 | 1.10.3720.10 |
| af_I6XFF3_60_302_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8309 | 68 | 289 | 1.10.3720.10 |
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8135 | 68 | 290 | 1.10.3720.10 |
| af_P9WG03_18_293_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8036 | 24 | 282 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5B0IYT9-F1-model_v4 | Sugar ABC transporter permease | 0.885 | 29 | 295 |
GO:0005886
GO:0055085 |
| AF-A0A557YIU6-F1-model_v4 | deleted | 0.8825 | 39 | 291 |
|
| AF-A0A318HAR5-F1-model_v4 | Carbohydrate ABC transporter membrane protein 1 (CUT1 family) | 0.8778 | 22 | 295 |
GO:0005886
GO:0055085 |
| AF-A0A172YKT1-F1-model_v4 | Sugar ABC transporter permease | 0.8776 | 38 | 287 |
GO:0005886
GO:0055085 |
| AF-F6EMT7-F1-model_v4 | Putative ABC transporter permease protein | 0.8775 | 22 | 295 |
GO:0005886
GO:0055085 |