F484261
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 873 | 289 | 871 | 184 |
Family's Representative Sequence
| Representative Sequence | 3300039450|Ga0436363_0736983|Ga0436363_0736983_1182_1799 |
| Length | 205 |
| Sequence | LVLFLKESEQTKEILNGSSNQWHSDSDLLEGCIKGDRKMQRELYNRFAPKMYAVCLRYAANAEEAEDILQEGFIKVFKKIASFRREGSFEGWVRRIFVNTAIEHYRKKTYLQPITEHEEATVEGNYLSVLDDLAERDIIRLVQQLSPGYRTVFNMYVVEGYSHKQIAEQLGISEGTSKSQLSRAKLILQDLVKTFIEERKQMPEQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 5 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 6 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 166 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 169 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 171 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 172 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 178 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 184 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 185 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 186 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 189 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 190 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 191 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 192 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 193 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 194 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 195 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 196 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 197 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 198 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 199 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 200 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 201 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 216 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 217 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 218 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 219 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 220 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 221 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 223 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 224 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 225 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 243 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 244 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 245 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 246 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 247 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 248 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 249 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 250 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 251 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 255 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 256 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 257 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 258 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 259 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 260 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 261 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 262 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 263 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 264 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 265 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 266 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 270 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 271 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 272 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 273 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 274 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 275 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 276 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 280 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 281 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 284 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 285 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 286 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 287 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 288 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 289 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0.23 |
| Isolates | 0.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.03 |
| Nodule | 0 |
| Rhizoplane | 1.03 |
| Rhizosphere | 97.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1199054 | 2162886007 | Bacteria | 1948 |
| 2 | SwRhRL2b_contig_28926 | 2162886007 | Bacteria | 897 |
| 3 | MRS1b_contig_8355847 | 2162886011 | Bacteria | 1416 |
| 4 | MBSR1b_contig_7905469 | 2162886012 | Bacteria | 848 |
| 5 | JGI24736J21556_1047717 | 3300001904 | Unclassified | 659 |
| 6 | Ga0058861_11891156 | 3300004800 | Bacteria | 1260 |
| 7 | Ga0065704_10071448 | 3300005289 | Bacteria | 11108 |
| 8 | Ga0065704_10138584 | 3300005289 | Bacteria | 1542 |
| 9 | Ga0065704_10171434 | 3300005289 | Bacteria | 1289 |
| 10 | Ga0065707_10172329 | 3300005295 | Unclassified | 1475 |
| 11 | Ga0070658_10011892 | 3300005327 | Bacteria | 6988 |
| 12 | Ga0070658_10020900 | 3300005327 | Bacteria | 5243 |
| 13 | Ga0070658_10209540 | 3300005327 | Bacteria | 1646 |
| 14 | Ga0070658_10641434 | 3300005327 | Unclassified | 921 |
| 15 | Ga0070676_10087371 | 3300005328 | Bacteria | 1903 |
| 16 | Ga0070676_10872245 | 3300005328 | Unclassified | 669 |
| 17 | Ga0070683_100049339 | 3300005329 | Bacteria | 3893 |
| 18 | Ga0070683_100469526 | 3300005329 | Bacteria | 1201 |
| 19 | Ga0070683_100704514 | 3300005329 | Unclassified | 967 |
| 20 | Ga0070683_101016471 | 3300005329 | Bacteria | 796 |
| 21 | Ga0070690_100213700 | 3300005330 | Unclassified | 1348 |
| 22 | Ga0070670_100037728 | 3300005331 | Bacteria | 4156 |
| 23 | Ga0070670_100039617 | 3300005331 | Unclassified | 4052 |
| 24 | Ga0070670_100049340 | 3300005331 | Bacteria | 3619 |
| 25 | Ga0070670_100055870 | 3300005331 | Bacteria | 3388 |
| 26 | Ga0070670_100057150 | 3300005331 | Unclassified | 3350 |
| 27 | Ga0070670_100290243 | 3300005331 | Bacteria | 1429 |
| 28 | Ga0070670_100334288 | 3300005331 | Unclassified | 1329 |
| 29 | Ga0070670_100394603 | 3300005331 | Bacteria | 1221 |
| 30 | Ga0070677_10026061 | 3300005333 | Unclassified | 2189 |
| 31 | Ga0070677_10196608 | 3300005333 | Unclassified | 970 |
| 32 | Ga0068869_100011219 | 3300005334 | Bacteria | 5870 |
| 33 | Ga0068869_100013854 | 3300005334 | Bacteria | 5375 |
| 34 | Ga0068869_100036944 | 3300005334 | Bacteria | 3471 |
| 35 | Ga0068869_100118802 | 3300005334 | Bacteria | 2019 |
| 36 | Ga0068869_100134215 | 3300005334 | Unclassified | 1905 |
| 37 | Ga0068869_100256730 | 3300005334 | Bacteria | 1398 |
| 38 | Ga0070666_10000051 | 3300005335 | Bacteria | 99740 |
| 39 | Ga0070666_10003560 | 3300005335 | Bacteria | 9444 |
| 40 | Ga0070666_10278258 | 3300005335 | Unclassified | 1189 |
| 41 | Ga0070680_100018651 | 3300005336 | Bacteria | 5486 |
| 42 | Ga0070682_100731126 | 3300005337 | Bacteria | 797 |
| 43 | Ga0068868_100002074 | 3300005338 | Bacteria | 13781 |
| 44 | Ga0068868_100004561 | 3300005338 | Bacteria | 9724 |
| 45 | Ga0068868_100040512 | 3300005338 | Bacteria | 3626 |
| 46 | Ga0068868_100097882 | 3300005338 | Bacteria | 2371 |
| 47 | Ga0068868_100105750 | 3300005338 | Bacteria | 2282 |
| 48 | Ga0068868_100127203 | 3300005338 | Unclassified | 2082 |
| 49 | Ga0068868_101492704 | 3300005338 | Bacteria | 633 |
| 50 | Ga0070660_100016234 | 3300005339 | Bacteria | 5400 |
| 51 | Ga0070660_100068070 | 3300005339 | Bacteria | 2775 |
| 52 | Ga0070660_100077930 | 3300005339 | Bacteria | 2598 |
| 53 | Ga0070660_100082873 | 3300005339 | Bacteria | 2519 |
| 54 | Ga0070660_100490433 | 3300005339 | Bacteria | 1022 |
| 55 | Ga0070660_101808317 | 3300005339 | Unclassified | 521 |
| 56 | Ga0070689_100229204 | 3300005340 | Bacteria | 1526 |
| 57 | Ga0070689_100303077 | 3300005340 | Bacteria | 1330 |
| 58 | Ga0070691_10078453 | 3300005341 | Unclassified | 1613 |
| 59 | Ga0070687_100025475 | 3300005343 | Bacteria | 2839 |
| 60 | Ga0070687_100255316 | 3300005343 | Bacteria | 1091 |
| 61 | Ga0070661_100004667 | 3300005344 | Bacteria | 9442 |
| 62 | Ga0070661_100041040 | 3300005344 | Bacteria | 3376 |
| 63 | Ga0070661_100058504 | 3300005344 | Unclassified | 2825 |
| 64 | Ga0070661_100495832 | 3300005344 | Bacteria | 977 |
| 65 | Ga0070661_100602337 | 3300005344 | Bacteria | 888 |
| 66 | Ga0070668_100017512 | 3300005347 | Bacteria | 5372 |
| 67 | Ga0070668_100094903 | 3300005347 | Unclassified | 2355 |
| 68 | Ga0070668_100171175 | 3300005347 | Bacteria | 1768 |
| 69 | Ga0070668_100389631 | 3300005347 | Bacteria | 1187 |
| 70 | Ga0070668_100806979 | 3300005347 | Unclassified | 834 |
| 71 | Ga0070669_100003262 | 3300005353 | Bacteria | 11656 |
| 72 | Ga0070669_100046045 | 3300005353 | Bacteria | 3180 |
| 73 | Ga0070669_100193469 | 3300005353 | Unclassified | 1597 |
| 74 | Ga0070669_100284817 | 3300005353 | Bacteria | 1325 |
| 75 | Ga0070669_101240856 | 3300005353 | Bacteria | 645 |
| 76 | Ga0070675_100012636 | 3300005354 | Bacteria | 6623 |
| 77 | Ga0070675_100061480 | 3300005354 | Unclassified | 3101 |
| 78 | Ga0070675_100063469 | 3300005354 | Bacteria | 3054 |
| 79 | Ga0070675_100096905 | 3300005354 | Bacteria | 2479 |
| 80 | Ga0070675_100235142 | 3300005354 | Bacteria | 1600 |
| 81 | Ga0070675_100394866 | 3300005354 | Bacteria | 1233 |
| 82 | Ga0070671_100013288 | 3300005355 | Bacteria | 6637 |
| 83 | Ga0070671_100032458 | 3300005355 | Bacteria | 4316 |
| 84 | Ga0070671_100032943 | 3300005355 | Bacteria | 4283 |
| 85 | Ga0070671_100079978 | 3300005355 | Unclassified | 2732 |
| 86 | Ga0070671_100094736 | 3300005355 | Bacteria | 2503 |
| 87 | Ga0070671_100299445 | 3300005355 | Unclassified | 1369 |
| 88 | Ga0070671_100318774 | 3300005355 | Unclassified | 1325 |
| 89 | Ga0070671_100547691 | 3300005355 | Bacteria | 997 |
| 90 | Ga0070671_101161375 | 3300005355 | Unclassified | 679 |
| 91 | Ga0070674_100058570 | 3300005356 | Unclassified | 2678 |
| 92 | Ga0070674_100203187 | 3300005356 | Bacteria | 1531 |
| 93 | Ga0070674_100348092 | 3300005356 | Bacteria | 1196 |
| 94 | Ga0070674_100542404 | 3300005356 | Bacteria | 975 |
| 95 | Ga0070673_100106373 | 3300005364 | Unclassified | 2319 |
| 96 | Ga0070673_100146744 | 3300005364 | Unclassified | 1995 |
| 97 | Ga0070673_100180695 | 3300005364 | Bacteria | 1806 |
| 98 | Ga0070673_100222059 | 3300005364 | Bacteria | 1636 |
| 99 | Ga0070673_100393138 | 3300005364 | Bacteria | 1238 |
| 100 | Ga0070673_100397109 | 3300005364 | Unclassified | 1232 |
| 101 | Ga0070673_100564948 | 3300005364 | Unclassified | 1035 |
| 102 | Ga0070673_100581162 | 3300005364 | Bacteria | 1020 |
| 103 | Ga0070673_100583868 | 3300005364 | Bacteria | 1018 |
| 104 | Ga0070673_101249987 | 3300005364 | Bacteria | 697 |
| 105 | Ga0070688_100012191 | 3300005365 | Unclassified | 4809 |
| 106 | Ga0070688_100118925 | 3300005365 | Bacteria | 1767 |
| 107 | Ga0070688_100500625 | 3300005365 | Bacteria | 916 |
| 108 | Ga0070688_100516301 | 3300005365 | Bacteria | 903 |
| 109 | Ga0070659_100003883 | 3300005366 | Bacteria | 10646 |
| 110 | Ga0070659_100056690 | 3300005366 | Bacteria | 3089 |
| 111 | Ga0070659_100147805 | 3300005366 | Bacteria | 1915 |
| 112 | Ga0070659_100430203 | 3300005366 | Bacteria | 1117 |
| 113 | Ga0070659_101401478 | 3300005366 | Bacteria | 621 |
| 114 | Ga0070667_100054486 | 3300005367 | Bacteria | 3377 |
| 115 | Ga0070667_100114151 | 3300005367 | Unclassified | 2345 |
| 116 | Ga0070667_100126539 | 3300005367 | Bacteria | 2227 |
| 117 | Ga0070667_100160204 | 3300005367 | Bacteria | 1982 |
| 118 | Ga0070667_100182203 | 3300005367 | Bacteria | 1858 |
| 119 | Ga0070667_100526854 | 3300005367 | Bacteria | 1085 |
| 120 | Ga0070701_10084495 | 3300005438 | Unclassified | 1726 |
| 121 | Ga0070701_10916206 | 3300005438 | Bacteria | 606 |
| 122 | Ga0070700_100235515 | 3300005441 | Bacteria | 1305 |
| 123 | Ga0070663_100019473 | 3300005455 | Bacteria | 4474 |
| 124 | Ga0070663_100185529 | 3300005455 | Bacteria | 1616 |
| 125 | Ga0070663_100415687 | 3300005455 | Bacteria | 1102 |
| 126 | Ga0070678_100013606 | 3300005456 | Bacteria | 5110 |
| 127 | Ga0070678_100101316 | 3300005456 | Bacteria | 2232 |
| 128 | Ga0070678_100143461 | 3300005456 | Bacteria | 1914 |
| 129 | Ga0070678_100275646 | 3300005456 | Bacteria | 1420 |
| 130 | Ga0070678_100322916 | 3300005456 | Bacteria | 1319 |
| 131 | Ga0070678_100366314 | 3300005456 | Bacteria | 1243 |
| 132 | Ga0070678_100992017 | 3300005456 | Unclassified | 772 |
| 133 | Ga0070662_100020483 | 3300005457 | Bacteria | 4504 |
| 134 | Ga0070662_100118047 | 3300005457 | Unclassified | 2030 |
| 135 | Ga0070662_100125200 | 3300005457 | Bacteria | 1975 |
| 136 | Ga0070662_100142343 | 3300005457 | Bacteria | 1860 |
| 137 | Ga0070662_101163925 | 3300005457 | Unclassified | 662 |
| 138 | Ga0070681_10044182 | 3300005458 | Bacteria | 4459 |
| 139 | Ga0070681_10101100 | 3300005458 | Bacteria | 2828 |
| 140 | Ga0070681_10503220 | 3300005458 | Bacteria | 1125 |
| 141 | Ga0068867_100015945 | 3300005459 | Bacteria | 5334 |
| 142 | Ga0068867_100033559 | 3300005459 | Unclassified | 3718 |
| 143 | Ga0068867_100124423 | 3300005459 | Bacteria | 1997 |
| 144 | Ga0068867_100143553 | 3300005459 | Bacteria | 1868 |
| 145 | Ga0068867_100366603 | 3300005459 | Bacteria | 1206 |
| 146 | Ga0068867_100455016 | 3300005459 | Bacteria | 1091 |
| 147 | Ga0068867_100555118 | 3300005459 | Bacteria | 995 |
| 148 | Ga0068867_100588509 | 3300005459 | Bacteria | 969 |
| 149 | Ga0068867_100903095 | 3300005459 | Bacteria | 795 |
| 150 | Ga0070685_10040628 | 3300005466 | Unclassified | 2647 |
| 151 | Ga0070685_10046540 | 3300005466 | Bacteria | 2491 |
| 152 | Ga0070685_10362288 | 3300005466 | Unclassified | 994 |
| 153 | Ga0070679_100005880 | 3300005530 | Bacteria | 11395 |
| 154 | Ga0070679_100117451 | 3300005530 | Bacteria | 2645 |
| 155 | Ga0070679_100277671 | 3300005530 | Bacteria | 1628 |
| 156 | Ga0070684_100000732 | 3300005535 | Bacteria | 22748 |
| 157 | Ga0070684_100057871 | 3300005535 | Unclassified | 3386 |
| 158 | Ga0070684_100063983 | 3300005535 | Bacteria | 3226 |
| 159 | Ga0068853_100046316 | 3300005539 | Bacteria | 3729 |
| 160 | Ga0068853_100122865 | 3300005539 | Unclassified | 2318 |
| 161 | Ga0068853_100186815 | 3300005539 | Bacteria | 1881 |
| 162 | Ga0068853_100387618 | 3300005539 | Bacteria | 1306 |
| 163 | Ga0068853_100390725 | 3300005539 | Bacteria | 1301 |
| 164 | Ga0068853_101198371 | 3300005539 | Bacteria | 733 |
| 165 | Ga0068853_101497357 | 3300005539 | Unclassified | 653 |
| 166 | Ga0070672_100036985 | 3300005543 | Bacteria | 3723 |
| 167 | Ga0070672_100048558 | 3300005543 | Unclassified | 3299 |
| 168 | Ga0070672_100073133 | 3300005543 | Bacteria | 2731 |
| 169 | Ga0070672_100106244 | 3300005543 | Bacteria | 2284 |
| 170 | Ga0070672_100186840 | 3300005543 | Bacteria | 1729 |
| 171 | Ga0070672_100207449 | 3300005543 | Bacteria | 1640 |
| 172 | Ga0070672_100375370 | 3300005543 | Unclassified | 1216 |
| 173 | Ga0070686_100029033 | 3300005544 | Bacteria | 3360 |
| 174 | Ga0070695_100968699 | 3300005545 | Bacteria | 690 |
| 175 | Ga0070693_100012847 | 3300005547 | Bacteria | 4250 |
| 176 | Ga0070693_100222468 | 3300005547 | Bacteria | 1237 |
| 177 | Ga0070665_100071523 | 3300005548 | Unclassified | 3475 |
| 178 | Ga0070665_100299126 | 3300005548 | Bacteria | 1612 |
| 179 | Ga0070665_100488123 | 3300005548 | Bacteria | 1243 |
| 180 | Ga0068855_100008437 | 3300005563 | Bacteria | 12460 |
| 181 | Ga0068855_100011433 | 3300005563 | Bacteria | 10723 |
| 182 | Ga0068855_100171998 | 3300005563 | Bacteria | 2453 |
| 183 | Ga0068855_100203638 | 3300005563 | Bacteria | 2227 |
| 184 | Ga0068855_100736791 | 3300005563 | Bacteria | 1052 |
| 185 | Ga0068855_101214540 | 3300005563 | Bacteria | 783 |
| 186 | Ga0070664_100004812 | 3300005564 | Bacteria | 10817 |
| 187 | Ga0070664_100005353 | 3300005564 | Bacteria | 10299 |
| 188 | Ga0070664_100089884 | 3300005564 | Unclassified | 2657 |
| 189 | Ga0070664_100105796 | 3300005564 | Unclassified | 2451 |
| 190 | Ga0070664_100147599 | 3300005564 | Bacteria | 2075 |
| 191 | Ga0070664_100346932 | 3300005564 | Bacteria | 1349 |
| 192 | Ga0070664_100427738 | 3300005564 | Bacteria | 1213 |
| 193 | Ga0070664_100452177 | 3300005564 | Bacteria | 1179 |
| 194 | Ga0068857_100015051 | 3300005577 | Bacteria | 6750 |
| 195 | Ga0068857_100046477 | 3300005577 | Bacteria | 3852 |
| 196 | Ga0068857_100089903 | 3300005577 | Bacteria | 2748 |
| 197 | Ga0068857_100100738 | 3300005577 | Bacteria | 2591 |
| 198 | Ga0068857_100183014 | 3300005577 | Bacteria | 1907 |
| 199 | Ga0068857_100298459 | 3300005577 | Bacteria | 1485 |
| 200 | Ga0068857_100323166 | 3300005577 | Unclassified | 1425 |
| 201 | Ga0068857_100646114 | 3300005577 | Bacteria | 1002 |
| 202 | Ga0068854_100275873 | 3300005578 | Bacteria | 1352 |
| 203 | Ga0068854_100328888 | 3300005578 | Bacteria | 1245 |
| 204 | Ga0068854_100495251 | 3300005578 | Bacteria | 1028 |
| 205 | Ga0068854_100744697 | 3300005578 | Bacteria | 850 |
| 206 | Ga0068856_100066740 | 3300005614 | Unclassified | 3555 |
| 207 | Ga0068856_100292744 | 3300005614 | Unclassified | 1645 |
| 208 | Ga0068856_100359274 | 3300005614 | Bacteria | 1475 |
| 209 | Ga0070702_100017096 | 3300005615 | Unclassified | 3735 |
| 210 | Ga0070702_100070832 | 3300005615 | Unclassified | 2059 |
| 211 | Ga0068852_100030388 | 3300005616 | Unclassified | 4446 |
| 212 | Ga0068852_100085281 | 3300005616 | Unclassified | 2813 |
| 213 | Ga0068852_100087517 | 3300005616 | Unclassified | 2780 |
| 214 | Ga0068852_100168494 | 3300005616 | Bacteria | 2051 |
| 215 | Ga0068852_100270575 | 3300005616 | Bacteria | 1635 |
| 216 | Ga0068852_100460814 | 3300005616 | Bacteria | 1260 |
| 217 | Ga0068852_100945341 | 3300005616 | Bacteria | 880 |
| 218 | Ga0068859_100000023 | 3300005617 | Bacteria | 221914 |
| 219 | Ga0068859_100002585 | 3300005617 | Bacteria | 18417 |
| 220 | Ga0068859_100031954 | 3300005617 | Bacteria | 5288 |
| 221 | Ga0068859_100050459 | 3300005617 | Unclassified | 4179 |
| 222 | Ga0068859_100126744 | 3300005617 | Unclassified | 2622 |
| 223 | Ga0068859_100130686 | 3300005617 | Unclassified | 2582 |
| 224 | Ga0068859_100396636 | 3300005617 | Unclassified | 1476 |
| 225 | Ga0068864_100006376 | 3300005618 | Bacteria | 9670 |
| 226 | Ga0068864_100011486 | 3300005618 | Bacteria | 7315 |
| 227 | Ga0068864_100015347 | 3300005618 | Bacteria | 6368 |
| 228 | Ga0068864_100336826 | 3300005618 | Unclassified | 1421 |
| 229 | Ga0068866_10014659 | 3300005718 | Bacteria | 3467 |
| 230 | Ga0068866_10036931 | 3300005718 | Unclassified | 2396 |
| 231 | Ga0068866_10099942 | 3300005718 | Unclassified | 1598 |
| 232 | Ga0068866_10184746 | 3300005718 | Bacteria | 1234 |
| 233 | Ga0068866_10390936 | 3300005718 | Bacteria | 894 |
| 234 | Ga0068866_10487158 | 3300005718 | Bacteria | 813 |
| 235 | Ga0068866_10607443 | 3300005718 | Bacteria | 739 |
| 236 | Ga0068861_100003939 | 3300005719 | Bacteria | 9929 |
| 237 | Ga0068861_100066558 | 3300005719 | Bacteria | 2778 |
| 238 | Ga0068861_100069663 | 3300005719 | Bacteria | 2722 |
| 239 | Ga0068861_100194982 | 3300005719 | Unclassified | 1696 |
| 240 | Ga0068861_100239966 | 3300005719 | Bacteria | 1541 |
| 241 | Ga0068861_100426056 | 3300005719 | Bacteria | 1183 |
| 242 | Ga0068861_101432993 | 3300005719 | Unclassified | 676 |
| 243 | Ga0068851_10043901 | 3300005834 | Bacteria | 2254 |
| 244 | Ga0068851_10047482 | 3300005834 | Unclassified | 2175 |
| 245 | Ga0068851_10520687 | 3300005834 | Unclassified | 715 |
| 246 | Ga0068870_10020219 | 3300005840 | Unclassified | 3238 |
| 247 | Ga0068870_10025829 | 3300005840 | Bacteria | 2921 |
| 248 | Ga0068870_10247206 | 3300005840 | Bacteria | 1104 |
| 249 | Ga0068870_10372162 | 3300005840 | Bacteria | 922 |
| 250 | Ga0068870_10539470 | 3300005840 | Unclassified | 784 |
| 251 | Ga0068863_100009644 | 3300005841 | Bacteria | 9420 |
| 252 | Ga0068863_100014587 | 3300005841 | Bacteria | 7565 |
| 253 | Ga0068863_100035327 | 3300005841 | Bacteria | 4761 |
| 254 | Ga0068863_100088765 | 3300005841 | Bacteria | 2931 |
| 255 | Ga0068863_100110665 | 3300005841 | Unclassified | 2616 |
| 256 | Ga0068858_100023286 | 3300005842 | Bacteria | 5771 |
| 257 | Ga0068858_100192007 | 3300005842 | Bacteria | 1930 |
| 258 | Ga0068858_100286764 | 3300005842 | Bacteria | 1568 |
| 259 | Ga0068858_100377487 | 3300005842 | Bacteria | 1360 |
| 260 | Ga0068860_100001475 | 3300005843 | Bacteria | 25414 |
| 261 | Ga0068860_100011162 | 3300005843 | Bacteria | 8853 |
| 262 | Ga0068860_100049889 | 3300005843 | Bacteria | 3986 |
| 263 | Ga0068860_100113037 | 3300005843 | Bacteria | 2596 |
| 264 | Ga0068860_100225752 | 3300005843 | Bacteria | 1819 |
| 265 | Ga0068860_100305483 | 3300005843 | Bacteria | 1559 |
| 266 | Ga0068860_100736682 | 3300005843 | Bacteria | 997 |
| 267 | Ga0068860_101101616 | 3300005843 | Bacteria | 813 |
| 268 | Ga0068862_100017333 | 3300005844 | Bacteria | 5996 |
| 269 | Ga0068862_100145146 | 3300005844 | Unclassified | 2109 |
| 270 | Ga0068862_100176206 | 3300005844 | Unclassified | 1917 |
| 271 | Ga0068862_100606771 | 3300005844 | Unclassified | 1051 |
| 272 | Ga0068862_100854413 | 3300005844 | Bacteria | 892 |
| 273 | Ga0068862_101262635 | 3300005844 | Bacteria | 739 |
| 274 | Ga0075366_10027426 | 3300006195 | Unclassified | 3341 |
| 275 | Ga0097621_100000423 | 3300006237 | Bacteria | 29421 |
| 276 | Ga0097621_100022999 | 3300006237 | Bacteria | 4846 |
| 277 | Ga0097621_100657470 | 3300006237 | Unclassified | 962 |
| 278 | Ga0068871_100000604 | 3300006358 | Bacteria | 24668 |
| 279 | Ga0068871_100075398 | 3300006358 | Unclassified | 2784 |
| 280 | Ga0068871_100093572 | 3300006358 | Bacteria | 2508 |
| 281 | Ga0068871_100232950 | 3300006358 | Bacteria | 1599 |
| 282 | Ga0068871_100240891 | 3300006358 | Bacteria | 1572 |
| 283 | Ga0075428_101118287 | 3300006844 | Bacteria | 832 |
| 284 | Ga0075429_100346297 | 3300006880 | Bacteria | 1301 |
| 285 | Ga0068865_100017686 | 3300006881 | Bacteria | 4589 |
| 286 | Ga0068865_100080247 | 3300006881 | Bacteria | 2339 |
| 287 | Ga0068865_100682176 | 3300006881 | Bacteria | 876 |
| 288 | Ga0097620_100000023 | 3300006931 | Bacteria | 221914 |
| 289 | Ga0097620_100000575 | 3300006931 | Bacteria | 36670 |
| 290 | Ga0097620_100002585 | 3300006931 | Bacteria | 18417 |
| 291 | Ga0097620_100031954 | 3300006931 | Bacteria | 5288 |
| 292 | Ga0097620_100050465 | 3300006931 | Unclassified | 4179 |
| 293 | Ga0097620_100126756 | 3300006931 | Unclassified | 2622 |
| 294 | Ga0097620_100130682 | 3300006931 | Unclassified | 2582 |
| 295 | Ga0097620_100383935 | 3300006931 | Bacteria | 1500 |
| 296 | Ga0097620_100396666 | 3300006931 | Unclassified | 1476 |
| 297 | Ga0105240_10058540 | 3300009093 | Bacteria | 4810 |
| 298 | Ga0111539_10021610 | 3300009094 | Bacteria | 7915 |
| 299 | Ga0111539_10139259 | 3300009094 | Bacteria | 2841 |
| 300 | Ga0105245_10523827 | 3300009098 | Unclassified | 1204 |
| 301 | Ga0105247_10004502 | 3300009101 | Bacteria | 8890 |
| 302 | Ga0105243_11300555 | 3300009148 | Bacteria | 744 |
| 303 | Ga0105241_10085795 | 3300009174 | Bacteria | 2475 |
| 304 | Ga0105241_10226034 | 3300009174 | Bacteria | 1576 |
| 305 | Ga0105241_11275136 | 3300009174 | Bacteria | 699 |
| 306 | Ga0105242_10035787 | 3300009176 | Unclassified | 3981 |
| 307 | Ga0105242_10066827 | 3300009176 | Bacteria | 2970 |
| 308 | Ga0105242_10220729 | 3300009176 | Bacteria | 1694 |
| 309 | Ga0105242_10224991 | 3300009176 | Bacteria | 1679 |
| 310 | Ga0105248_10035159 | 3300009177 | Bacteria | 5606 |
| 311 | Ga0105248_10980683 | 3300009177 | Bacteria | 955 |
| 312 | Ga0105237_10049418 | 3300009545 | Bacteria | 4228 |
| 313 | Ga0105249_10000806 | 3300009553 | Bacteria | 28220 |
| 314 | Ga0105249_10103410 | 3300009553 | Bacteria | 2682 |
| 315 | Ga0105249_10381130 | 3300009553 | Bacteria | 1436 |
| 316 | Ga0105239_10211325 | 3300010375 | Bacteria | 2175 |
| 317 | Ga0157319_1002218 | 3300012497 | Bacteria | 1095 |
| 318 | Ga0157373_10020816 | 3300013100 | Bacteria | 4762 |
| 319 | Ga0157373_10028779 | 3300013100 | Bacteria | 4007 |
| 320 | Ga0157373_10047594 | 3300013100 | Bacteria | 3058 |
| 321 | Ga0157373_10083164 | 3300013100 | Bacteria | 2256 |
| 322 | Ga0157373_10122072 | 3300013100 | Bacteria | 1831 |
| 323 | Ga0157371_10000284 | 3300013102 | Bacteria | 68549 |
| 324 | Ga0157371_10000924 | 3300013102 | Bacteria | 32978 |
| 325 | Ga0157371_10003533 | 3300013102 | Bacteria | 14106 |
| 326 | Ga0157371_10004001 | 3300013102 | Bacteria | 13061 |
| 327 | Ga0157371_10022893 | 3300013102 | Bacteria | 4570 |
| 328 | Ga0157371_10035665 | 3300013102 | Unclassified | 3564 |
| 329 | Ga0157371_10042494 | 3300013102 | Bacteria | 3239 |
| 330 | Ga0157371_10047902 | 3300013102 | Unclassified | 3038 |
| 331 | Ga0157371_10047990 | 3300013102 | Bacteria | 3035 |
| 332 | Ga0157371_10050384 | 3300013102 | Bacteria | 2959 |
| 333 | Ga0157371_10140953 | 3300013102 | Bacteria | 1717 |
| 334 | Ga0157371_10361980 | 3300013102 | Bacteria | 1057 |
| 335 | Ga0157370_10003733 | 3300013104 | Bacteria | 17802 |
| 336 | Ga0157370_10004338 | 3300013104 | Bacteria | 16292 |
| 337 | Ga0157370_10009105 | 3300013104 | Bacteria | 10650 |
| 338 | Ga0157370_10023600 | 3300013104 | Bacteria | 6105 |
| 339 | Ga0157370_10063719 | 3300013104 | Bacteria | 3491 |
| 340 | Ga0157370_10070410 | 3300013104 | Bacteria | 3301 |
| 341 | Ga0157370_10140422 | 3300013104 | Bacteria | 2251 |
| 342 | Ga0157370_10359894 | 3300013104 | Bacteria | 1341 |
| 343 | Ga0157370_10387855 | 3300013104 | Bacteria | 1286 |
| 344 | Ga0157370_10415630 | 3300013104 | Bacteria | 1238 |
| 345 | Ga0157370_10572744 | 3300013104 | Bacteria | 1035 |
| 346 | Ga0157370_10902020 | 3300013104 | Bacteria | 802 |
| 347 | Ga0157370_10903421 | 3300013104 | Bacteria | 801 |
| 348 | Ga0157369_10019696 | 3300013105 | Bacteria | 7552 |
| 349 | Ga0157369_10037231 | 3300013105 | Bacteria | 5326 |
| 350 | Ga0157369_10157991 | 3300013105 | Bacteria | 2394 |
| 351 | Ga0157369_10241722 | 3300013105 | Bacteria | 1886 |
| 352 | Ga0157369_10478167 | 3300013105 | Bacteria | 1289 |
| 353 | Ga0157369_10777074 | 3300013105 | Bacteria | 985 |
| 354 | Ga0157369_10920836 | 3300013105 | Bacteria | 896 |
| 355 | Ga0157369_10947998 | 3300013105 | Bacteria | 882 |
| 356 | Ga0157374_10001939 | 3300013296 | Bacteria | 17348 |
| 357 | Ga0157374_10088226 | 3300013296 | Unclassified | 2954 |
| 358 | Ga0157374_10365741 | 3300013296 | Bacteria | 1435 |
| 359 | Ga0157374_10661838 | 3300013296 | Bacteria | 1056 |
| 360 | Ga0157374_10934347 | 3300013296 | Bacteria | 885 |
| 361 | Ga0157378_10002625 | 3300013297 | Bacteria | 16007 |
| 362 | Ga0157378_10011662 | 3300013297 | Bacteria | 7692 |
| 363 | Ga0157378_10067120 | 3300013297 | Bacteria | 3214 |
| 364 | Ga0157378_10071982 | 3300013297 | Unclassified | 3105 |
| 365 | Ga0157378_10135010 | 3300013297 | Unclassified | 2287 |
| 366 | Ga0157378_10260607 | 3300013297 | Bacteria | 1663 |
| 367 | Ga0157378_10372245 | 3300013297 | Unclassified | 1401 |
| 368 | Ga0157378_10635436 | 3300013297 | Bacteria | 1082 |
| 369 | Ga0157378_11005930 | 3300013297 | Unclassified | 868 |
| 370 | Ga0163162_10000114 | 3300013306 | Bacteria | 71183 |
| 371 | Ga0163162_10001189 | 3300013306 | Bacteria | 24282 |
| 372 | Ga0163162_10001642 | 3300013306 | Bacteria | 20968 |
| 373 | Ga0163162_10032258 | 3300013306 | Bacteria | 5201 |
| 374 | Ga0163162_10098560 | 3300013306 | Bacteria | 3012 |
| 375 | Ga0163162_10248162 | 3300013306 | Unclassified | 1912 |
| 376 | Ga0163162_10521440 | 3300013306 | Bacteria | 1318 |
| 377 | Ga0157372_10008876 | 3300013307 | Bacteria | 10676 |
| 378 | Ga0157372_10023602 | 3300013307 | Bacteria | 6671 |
| 379 | Ga0157372_10024383 | 3300013307 | Bacteria | 6570 |
| 380 | Ga0157372_10048241 | 3300013307 | Bacteria | 4734 |
| 381 | Ga0157372_10057098 | 3300013307 | Bacteria | 4363 |
| 382 | Ga0157372_10066227 | 3300013307 | Bacteria | 4058 |
| 383 | Ga0157372_10089423 | 3300013307 | Bacteria | 3499 |
| 384 | Ga0157372_10222694 | 3300013307 | Bacteria | 2187 |
| 385 | Ga0157372_10231472 | 3300013307 | Bacteria | 2142 |
| 386 | Ga0157372_10266213 | 3300013307 | Bacteria | 1990 |
| 387 | Ga0157372_10392178 | 3300013307 | Bacteria | 1618 |
| 388 | Ga0157372_10410440 | 3300013307 | Bacteria | 1578 |
| 389 | Ga0157372_10468944 | 3300013307 | Bacteria | 1467 |
| 390 | Ga0157372_10618024 | 3300013307 | Bacteria | 1263 |
| 391 | Ga0157372_10710485 | 3300013307 | Bacteria | 1169 |
| 392 | Ga0157372_10833691 | 3300013307 | Unclassified | 1071 |
| 393 | Ga0157375_10025511 | 3300013308 | Bacteria | 5494 |
| 394 | Ga0157375_10063866 | 3300013308 | Bacteria | 3665 |
| 395 | Ga0157375_10072650 | 3300013308 | Unclassified | 3458 |
| 396 | Ga0157375_10089651 | 3300013308 | Unclassified | 3132 |
| 397 | Ga0157375_10142569 | 3300013308 | Bacteria | 2524 |
| 398 | Ga0157375_10177729 | 3300013308 | Bacteria | 2279 |
| 399 | Ga0157375_10351754 | 3300013308 | Unclassified | 1639 |
| 400 | Ga0157375_11423448 | 3300013308 | Bacteria | 817 |
| 401 | Ga0163163_10001283 | 3300014325 | Bacteria | 21227 |
| 402 | Ga0163163_10002242 | 3300014325 | Bacteria | 16284 |
| 403 | Ga0163163_10071200 | 3300014325 | Bacteria | 3464 |
| 404 | Ga0163163_10074115 | 3300014325 | Bacteria | 3395 |
| 405 | Ga0163163_10305715 | 3300014325 | Bacteria | 1643 |
| 406 | Ga0163163_10392545 | 3300014325 | Bacteria | 1446 |
| 407 | Ga0163163_10447627 | 3300014325 | Bacteria | 1351 |
| 408 | Ga0163163_10549615 | 3300014325 | Bacteria | 1217 |
| 409 | Ga0163163_10643555 | 3300014325 | Bacteria | 1124 |
| 410 | Ga0163163_11319007 | 3300014325 | Unclassified | 784 |
| 411 | Ga0157380_10043776 | 3300014326 | Bacteria | 3506 |
| 412 | Ga0157380_10387092 | 3300014326 | Bacteria | 1322 |
| 413 | Ga0157380_10788288 | 3300014326 | Bacteria | 966 |
| 414 | Ga0182008_10067865 | 3300014497 | Bacteria | 1755 |
| 415 | Ga0157377_10010475 | 3300014745 | Unclassified | 4587 |
| 416 | Ga0157377_10019607 | 3300014745 | Bacteria | 3534 |
| 417 | Ga0157377_10110006 | 3300014745 | Bacteria | 1655 |
| 418 | Ga0157379_10033404 | 3300014968 | Bacteria | 4588 |
| 419 | Ga0157379_10183882 | 3300014968 | Unclassified | 1888 |
| 420 | Ga0157379_10328993 | 3300014968 | Bacteria | 1396 |
| 421 | Ga0157379_10384706 | 3300014968 | Unclassified | 1288 |
| 422 | Ga0157379_10634104 | 3300014968 | Unclassified | 999 |
| 423 | Ga0157376_10001023 | 3300014969 | Bacteria | 18258 |
| 424 | Ga0157376_10048312 | 3300014969 | Bacteria | 3518 |
| 425 | Ga0157376_10388211 | 3300014969 | Bacteria | 1347 |
| 426 | Ga0157376_10499859 | 3300014969 | Unclassified | 1195 |
| 427 | Ga0157376_11220972 | 3300014969 | Unclassified | 780 |
| 428 | Ga0182006_1034846 | 3300015261 | Bacteria | 2011 |
| 429 | Ga0163161_10001357 | 3300017792 | Bacteria | 18206 |
| 430 | Ga0163161_10002438 | 3300017792 | Bacteria | 13288 |
| 431 | Ga0163161_10011682 | 3300017792 | Bacteria | 6093 |
| 432 | Ga0163161_10012045 | 3300017792 | Bacteria | 5998 |
| 433 | Ga0163161_10042073 | 3300017792 | Bacteria | 3285 |
| 434 | Ga0163161_11196101 | 3300017792 | Bacteria | 657 |
| 435 | Ga0207697_10217459 | 3300025315 | Bacteria | 843 |
| 436 | Ga0207697_10329511 | 3300025315 | Bacteria | 678 |
| 437 | Ga0207656_10014573 | 3300025321 | Unclassified | 3032 |
| 438 | Ga0207656_10030148 | 3300025321 | Bacteria | 2239 |
| 439 | Ga0207642_10010313 | 3300025899 | Unclassified | 3289 |
| 440 | Ga0207642_10317422 | 3300025899 | Bacteria | 909 |
| 441 | Ga0207642_10376537 | 3300025899 | Unclassified | 844 |
| 442 | Ga0207688_10008415 | 3300025901 | Bacteria | 5610 |
| 443 | Ga0207680_10000856 | 3300025903 | Bacteria | 14358 |
| 444 | Ga0207680_10085235 | 3300025903 | Unclassified | 1995 |
| 445 | Ga0207680_10091324 | 3300025903 | Unclassified | 1937 |
| 446 | Ga0207680_10135237 | 3300025903 | Unclassified | 1628 |
| 447 | Ga0207647_10000110 | 3300025904 | Bacteria | 62980 |
| 448 | Ga0207647_10022580 | 3300025904 | Bacteria | 4176 |
| 449 | Ga0207647_10052196 | 3300025904 | Bacteria | 2524 |
| 450 | Ga0207647_10475246 | 3300025904 | Bacteria | 699 |
| 451 | Ga0207645_10010260 | 3300025907 | Bacteria | 6436 |
| 452 | Ga0207645_10014403 | 3300025907 | Bacteria | 5290 |
| 453 | Ga0207645_10069140 | 3300025907 | Bacteria | 2259 |
| 454 | Ga0207645_10170420 | 3300025907 | Bacteria | 1427 |
| 455 | Ga0207643_10043706 | 3300025908 | Bacteria | 2529 |
| 456 | Ga0207643_10151961 | 3300025908 | Unclassified | 1388 |
| 457 | Ga0207643_10318655 | 3300025908 | Unclassified | 971 |
| 458 | Ga0207705_10018149 | 3300025909 | Bacteria | 5030 |
| 459 | Ga0207705_10055977 | 3300025909 | Bacteria | 2843 |
| 460 | Ga0207705_10066453 | 3300025909 | Bacteria | 2608 |
| 461 | Ga0207705_10090663 | 3300025909 | Bacteria | 2238 |
| 462 | Ga0207705_10159460 | 3300025909 | Bacteria | 1694 |
| 463 | Ga0207705_10588882 | 3300025909 | Bacteria | 865 |
| 464 | Ga0207654_10001756 | 3300025911 | Bacteria | 11258 |
| 465 | Ga0207654_10260197 | 3300025911 | Bacteria | 1166 |
| 466 | Ga0207707_10020922 | 3300025912 | Bacteria | 5715 |
| 467 | Ga0207707_10192723 | 3300025912 | Bacteria | 1778 |
| 468 | Ga0207707_10252815 | 3300025912 | Bacteria | 1530 |
| 469 | Ga0207707_10318694 | 3300025912 | Bacteria | 1343 |
| 470 | Ga0207695_10006992 | 3300025913 | Bacteria | 14485 |
| 471 | Ga0207671_10001442 | 3300025914 | Bacteria | 27518 |
| 472 | Ga0207671_10259093 | 3300025914 | Bacteria | 1368 |
| 473 | Ga0207660_10021291 | 3300025917 | Bacteria | 4359 |
| 474 | Ga0207660_10043002 | 3300025917 | Bacteria | 3173 |
| 475 | Ga0207660_10582456 | 3300025917 | Bacteria | 911 |
| 476 | Ga0207662_10112363 | 3300025918 | Bacteria | 1700 |
| 477 | Ga0207662_10511580 | 3300025918 | Bacteria | 828 |
| 478 | Ga0207662_10517268 | 3300025918 | Bacteria | 823 |
| 479 | Ga0207657_10027646 | 3300025919 | Bacteria | 5191 |
| 480 | Ga0207657_10059391 | 3300025919 | Bacteria | 3285 |
| 481 | Ga0207657_10074029 | 3300025919 | Bacteria | 2877 |
| 482 | Ga0207657_10074404 | 3300025919 | Bacteria | 2869 |
| 483 | Ga0207657_10124769 | 3300025919 | Unclassified | 2115 |
| 484 | Ga0207657_10196162 | 3300025919 | Bacteria | 1626 |
| 485 | Ga0207649_10250216 | 3300025920 | Unclassified | 1276 |
| 486 | Ga0207649_10389698 | 3300025920 | Bacteria | 1040 |
| 487 | Ga0207649_10691628 | 3300025920 | Unclassified | 790 |
| 488 | Ga0207652_10000166 | 3300025921 | Bacteria | 71226 |
| 489 | Ga0207652_10001364 | 3300025921 | Bacteria | 21700 |
| 490 | Ga0207652_10010361 | 3300025921 | Bacteria | 7506 |
| 491 | Ga0207652_10061630 | 3300025921 | Bacteria | 3239 |
| 492 | Ga0207681_10009947 | 3300025923 | Bacteria | 5822 |
| 493 | Ga0207681_10019146 | 3300025923 | Bacteria | 4322 |
| 494 | Ga0207681_10049173 | 3300025923 | Bacteria | 2849 |
| 495 | Ga0207681_10281337 | 3300025923 | Bacteria | 1310 |
| 496 | Ga0207681_10391847 | 3300025923 | Bacteria | 1120 |
| 497 | Ga0207650_10004016 | 3300025925 | Bacteria | 10066 |
| 498 | Ga0207650_10040561 | 3300025925 | Bacteria | 3407 |
| 499 | Ga0207650_10365833 | 3300025925 | Bacteria | 1189 |
| 500 | Ga0207650_10372325 | 3300025925 | Bacteria | 1178 |
| 501 | Ga0207650_10391652 | 3300025925 | Bacteria | 1149 |
| 502 | Ga0207650_10501190 | 3300025925 | Bacteria | 1015 |
| 503 | Ga0207650_10846692 | 3300025925 | Bacteria | 776 |
| 504 | Ga0207659_10003079 | 3300025926 | Bacteria | 9954 |
| 505 | Ga0207659_10032494 | 3300025926 | Bacteria | 3583 |
| 506 | Ga0207659_10049413 | 3300025926 | Unclassified | 2984 |
| 507 | Ga0207659_10077068 | 3300025926 | Bacteria | 2453 |
| 508 | Ga0207659_10194089 | 3300025926 | Unclassified | 1617 |
| 509 | Ga0207659_10227153 | 3300025926 | Bacteria | 1504 |
| 510 | Ga0207659_11092514 | 3300025926 | Unclassified | 686 |
| 511 | Ga0207664_10777185 | 3300025929 | Bacteria | 861 |
| 512 | Ga0207644_10015867 | 3300025931 | Bacteria | 5065 |
| 513 | Ga0207644_10051317 | 3300025931 | Unclassified | 2960 |
| 514 | Ga0207690_10015683 | 3300025932 | Bacteria | 4597 |
| 515 | Ga0207690_10618407 | 3300025932 | Bacteria | 885 |
| 516 | Ga0207706_10024969 | 3300025933 | Bacteria | 5358 |
| 517 | Ga0207706_10120722 | 3300025933 | Unclassified | 2304 |
| 518 | Ga0207686_10014735 | 3300025934 | Bacteria | 4361 |
| 519 | Ga0207686_10030283 | 3300025934 | Unclassified | 3202 |
| 520 | Ga0207686_10051345 | 3300025934 | Bacteria | 2568 |
| 521 | Ga0207686_10192960 | 3300025934 | Bacteria | 1453 |
| 522 | Ga0207686_10408973 | 3300025934 | Bacteria | 1035 |
| 523 | Ga0207686_10554792 | 3300025934 | Bacteria | 899 |
| 524 | Ga0207686_10889765 | 3300025934 | Bacteria | 718 |
| 525 | Ga0207709_10284760 | 3300025935 | Bacteria | 1222 |
| 526 | Ga0207670_10033313 | 3300025936 | Bacteria | 3319 |
| 527 | Ga0207669_10011405 | 3300025937 | Unclassified | 4323 |
| 528 | Ga0207669_10030753 | 3300025937 | Bacteria | 2988 |
| 529 | Ga0207669_10152439 | 3300025937 | Bacteria | 1621 |
| 530 | Ga0207669_10417488 | 3300025937 | Unclassified | 1055 |
| 531 | Ga0207704_10019095 | 3300025938 | Bacteria | 3594 |
| 532 | Ga0207704_11227896 | 3300025938 | Bacteria | 640 |
| 533 | Ga0207691_10001792 | 3300025940 | Bacteria | 21130 |
| 534 | Ga0207691_10058045 | 3300025940 | Unclassified | 3520 |
| 535 | Ga0207691_10086186 | 3300025940 | Bacteria | 2818 |
| 536 | Ga0207691_10158185 | 3300025940 | Unclassified | 1989 |
| 537 | Ga0207691_10168614 | 3300025940 | Bacteria | 1918 |
| 538 | Ga0207691_10343321 | 3300025940 | Unclassified | 1278 |
| 539 | Ga0207691_10346426 | 3300025940 | Bacteria | 1271 |
| 540 | Ga0207691_10457333 | 3300025940 | Bacteria | 1086 |
| 541 | Ga0207691_11189802 | 3300025940 | Bacteria | 632 |
| 542 | Ga0207689_10002648 | 3300025942 | Bacteria | 16557 |
| 543 | Ga0207689_10002715 | 3300025942 | Bacteria | 16372 |
| 544 | Ga0207689_10002890 | 3300025942 | Bacteria | 15844 |
| 545 | Ga0207689_10006627 | 3300025942 | Bacteria | 10214 |
| 546 | Ga0207689_10036976 | 3300025942 | Unclassified | 4052 |
| 547 | Ga0207689_10194435 | 3300025942 | Unclassified | 1674 |
| 548 | Ga0207689_10447171 | 3300025942 | Bacteria | 1080 |
| 549 | Ga0207689_10563100 | 3300025942 | Unclassified | 958 |
| 550 | Ga0207661_10009619 | 3300025944 | Bacteria | 6939 |
| 551 | Ga0207661_10048003 | 3300025944 | Bacteria | 3391 |
| 552 | Ga0207661_10176797 | 3300025944 | Bacteria | 1862 |
| 553 | Ga0207661_10929646 | 3300025944 | Bacteria | 801 |
| 554 | Ga0207679_10008767 | 3300025945 | Bacteria | 6452 |
| 555 | Ga0207679_10020432 | 3300025945 | Bacteria | 4469 |
| 556 | Ga0207679_10024202 | 3300025945 | Bacteria | 4162 |
| 557 | Ga0207679_10038291 | 3300025945 | Bacteria | 3415 |
| 558 | Ga0207679_10086137 | 3300025945 | Bacteria | 2415 |
| 559 | Ga0207679_10246651 | 3300025945 | Bacteria | 1516 |
| 560 | Ga0207679_10851736 | 3300025945 | Bacteria | 832 |
| 561 | Ga0207667_10001454 | 3300025949 | Bacteria | 29736 |
| 562 | Ga0207667_10016511 | 3300025949 | Bacteria | 8339 |
| 563 | Ga0207667_10070704 | 3300025949 | Bacteria | 3632 |
| 564 | Ga0207667_10178873 | 3300025949 | Bacteria | 2179 |
| 565 | Ga0207651_10000351 | 3300025960 | Bacteria | 19522 |
| 566 | Ga0207651_10034932 | 3300025960 | Bacteria | 3262 |
| 567 | Ga0207651_10132577 | 3300025960 | Unclassified | 1910 |
| 568 | Ga0207651_10338911 | 3300025960 | Bacteria | 1262 |
| 569 | Ga0207712_10003480 | 3300025961 | Bacteria | 9939 |
| 570 | Ga0207712_10007969 | 3300025961 | Bacteria | 6696 |
| 571 | Ga0207712_10043635 | 3300025961 | Unclassified | 3094 |
| 572 | Ga0207712_10223943 | 3300025961 | Bacteria | 1505 |
| 573 | Ga0207712_10336280 | 3300025961 | Bacteria | 1251 |
| 574 | Ga0207712_10349105 | 3300025961 | Bacteria | 1229 |
| 575 | Ga0207712_11223553 | 3300025961 | Bacteria | 670 |
| 576 | Ga0207668_10038727 | 3300025972 | Unclassified | 3203 |
| 577 | Ga0207668_10126240 | 3300025972 | Bacteria | 1946 |
| 578 | Ga0207668_10345595 | 3300025972 | Unclassified | 1242 |
| 579 | Ga0207668_10351034 | 3300025972 | Bacteria | 1233 |
| 580 | Ga0207668_10491120 | 3300025972 | Unclassified | 1054 |
| 581 | Ga0207640_10247117 | 3300025981 | Bacteria | 1382 |
| 582 | Ga0207640_10352041 | 3300025981 | Bacteria | 1184 |
| 583 | Ga0207640_10442930 | 3300025981 | Bacteria | 1068 |
| 584 | Ga0207640_10890056 | 3300025981 | Bacteria | 777 |
| 585 | Ga0207640_11185071 | 3300025981 | Bacteria | 679 |
| 586 | Ga0207658_10016630 | 3300025986 | Bacteria | 5063 |
| 587 | Ga0207658_10073893 | 3300025986 | Unclassified | 2589 |
| 588 | Ga0207658_10291639 | 3300025986 | Bacteria | 1402 |
| 589 | Ga0207658_10423335 | 3300025986 | Bacteria | 1174 |
| 590 | Ga0207658_10561782 | 3300025986 | Bacteria | 1022 |
| 591 | Ga0207658_10943740 | 3300025986 | Bacteria | 786 |
| 592 | Ga0207677_10026970 | 3300026023 | Bacteria | 3610 |
| 593 | Ga0207677_10057954 | 3300026023 | Unclassified | 2663 |
| 594 | Ga0207677_10223694 | 3300026023 | Bacteria | 1511 |
| 595 | Ga0207677_10240672 | 3300026023 | Bacteria | 1464 |
| 596 | Ga0207703_10018796 | 3300026035 | Bacteria | 5396 |
| 597 | Ga0207703_10036946 | 3300026035 | Bacteria | 3890 |
| 598 | Ga0207703_10049308 | 3300026035 | Unclassified | 3404 |
| 599 | Ga0207703_10264218 | 3300026035 | Bacteria | 1556 |
| 600 | Ga0207703_10309259 | 3300026035 | Bacteria | 1444 |
| 601 | Ga0207703_10670431 | 3300026035 | Bacteria | 985 |
| 602 | Ga0207639_10082245 | 3300026041 | Bacteria | 2552 |
| 603 | Ga0207639_10086848 | 3300026041 | Bacteria | 2492 |
| 604 | Ga0207639_10312432 | 3300026041 | Unclassified | 1393 |
| 605 | Ga0207639_10400412 | 3300026041 | Unclassified | 1236 |
| 606 | Ga0207639_10423906 | 3300026041 | Bacteria | 1203 |
| 607 | Ga0207639_10830612 | 3300026041 | Unclassified | 862 |
| 608 | Ga0207639_11380017 | 3300026041 | Bacteria | 661 |
| 609 | Ga0207639_11414216 | 3300026041 | Unclassified | 653 |
| 610 | Ga0207678_10007975 | 3300026067 | Bacteria | 9336 |
| 611 | Ga0207678_10040991 | 3300026067 | Bacteria | 4014 |
| 612 | Ga0207678_10274646 | 3300026067 | Bacteria | 1446 |
| 613 | Ga0207678_10443545 | 3300026067 | Bacteria | 1127 |
| 614 | Ga0207708_10063911 | 3300026075 | Bacteria | 2812 |
| 615 | Ga0207708_10150719 | 3300026075 | Bacteria | 1830 |
| 616 | Ga0207708_10210475 | 3300026075 | Bacteria | 1554 |
| 617 | Ga0207702_10041800 | 3300026078 | Bacteria | 3844 |
| 618 | Ga0207702_10263629 | 3300026078 | Bacteria | 1623 |
| 619 | Ga0207702_10619623 | 3300026078 | Bacteria | 1063 |
| 620 | Ga0207702_10687921 | 3300026078 | Bacteria | 1007 |
| 621 | Ga0207641_10000202 | 3300026088 | Bacteria | 79668 |
| 622 | Ga0207641_10021731 | 3300026088 | Bacteria | 5274 |
| 623 | Ga0207641_10183973 | 3300026088 | Bacteria | 1916 |
| 624 | Ga0207641_10204350 | 3300026088 | Unclassified | 1823 |
| 625 | Ga0207641_10264392 | 3300026088 | Bacteria | 1612 |
| 626 | Ga0207641_10380691 | 3300026088 | Unclassified | 1351 |
| 627 | Ga0207648_10001834 | 3300026089 | Bacteria | 23247 |
| 628 | Ga0207648_10036103 | 3300026089 | Unclassified | 4354 |
| 629 | Ga0207648_10038845 | 3300026089 | Bacteria | 4188 |
| 630 | Ga0207648_10045161 | 3300026089 | Bacteria | 3865 |
| 631 | Ga0207648_10045942 | 3300026089 | Bacteria | 3829 |
| 632 | Ga0207648_10066057 | 3300026089 | Bacteria | 3154 |
| 633 | Ga0207648_10067278 | 3300026089 | Bacteria | 3124 |
| 634 | Ga0207648_10207638 | 3300026089 | Unclassified | 1738 |
| 635 | Ga0207648_10208913 | 3300026089 | Bacteria | 1732 |
| 636 | Ga0207648_10823521 | 3300026089 | Bacteria | 865 |
| 637 | Ga0207676_10042150 | 3300026095 | Unclassified | 3509 |
| 638 | Ga0207676_10058964 | 3300026095 | Unclassified | 3030 |
| 639 | Ga0207676_10094165 | 3300026095 | Bacteria | 2467 |
| 640 | Ga0207676_10120008 | 3300026095 | Bacteria | 2215 |
| 641 | Ga0207676_10773408 | 3300026095 | Bacteria | 935 |
| 642 | Ga0207674_10010080 | 3300026116 | Bacteria | 10745 |
| 643 | Ga0207674_10029331 | 3300026116 | Bacteria | 5792 |
| 644 | Ga0207674_10040613 | 3300026116 | Bacteria | 4818 |
| 645 | Ga0207674_10058037 | 3300026116 | Bacteria | 3923 |
| 646 | Ga0207674_10065653 | 3300026116 | Bacteria | 3657 |
| 647 | Ga0207674_10210214 | 3300026116 | Bacteria | 1895 |
| 648 | Ga0207674_10434719 | 3300026116 | Unclassified | 1268 |
| 649 | Ga0207674_10533882 | 3300026116 | Bacteria | 1133 |
| 650 | Ga0207674_10738556 | 3300026116 | Unclassified | 950 |
| 651 | Ga0207675_100001207 | 3300026118 | Bacteria | 25729 |
| 652 | Ga0207675_100086651 | 3300026118 | Bacteria | 2941 |
| 653 | Ga0207675_100192852 | 3300026118 | Unclassified | 1955 |
| 654 | Ga0207675_100337527 | 3300026118 | Bacteria | 1475 |
| 655 | Ga0207675_100444784 | 3300026118 | Bacteria | 1283 |
| 656 | Ga0207675_101676701 | 3300026118 | Bacteria | 656 |
| 657 | Ga0207683_10004024 | 3300026121 | Bacteria | 12713 |
| 658 | Ga0207683_10074567 | 3300026121 | Bacteria | 3002 |
| 659 | Ga0207683_10080331 | 3300026121 | Bacteria | 2893 |
| 660 | Ga0207683_10132662 | 3300026121 | Unclassified | 2241 |
| 661 | Ga0207683_10402780 | 3300026121 | Bacteria | 1259 |
| 662 | Ga0207683_10992926 | 3300026121 | Bacteria | 779 |
| 663 | Ga0207698_10026514 | 3300026142 | Bacteria | 4100 |
| 664 | Ga0207698_10099782 | 3300026142 | Bacteria | 2403 |
| 665 | Ga0207698_10197244 | 3300026142 | Bacteria | 1799 |
| 666 | Ga0207698_10475079 | 3300026142 | Bacteria | 1212 |
| 667 | Ga0207698_10496139 | 3300026142 | Unclassified | 1187 |
| 668 | Ga0207698_10805720 | 3300026142 | Bacteria | 942 |
| 669 | Ga0209968_1029266 | 3300027526 | Bacteria | 917 |
| 670 | Ga0209999_1019113 | 3300027543 | Bacteria | 1255 |
| 671 | Ga0210002_1001946 | 3300027617 | Bacteria | 2963 |
| 672 | Ga0209974_10005287 | 3300027876 | Bacteria | 4555 |
| 673 | Ga0207428_10281497 | 3300027907 | Bacteria | 1234 |
| 674 | Ga0268266_10352900 | 3300028379 | Bacteria | 1382 |
| 675 | Ga0268265_10101182 | 3300028380 | Bacteria | 2328 |
| 676 | Ga0268265_10123415 | 3300028380 | Unclassified | 2138 |
| 677 | Ga0268265_10394202 | 3300028380 | Unclassified | 1278 |
| 678 | Ga0268265_11042494 | 3300028380 | Bacteria | 810 |
| 679 | Ga0268264_10001369 | 3300028381 | Bacteria | 22810 |
| 680 | Ga0268264_10004843 | 3300028381 | Bacteria | 11406 |
| 681 | Ga0268264_10101627 | 3300028381 | Bacteria | 2500 |
| 682 | Ga0268264_10128103 | 3300028381 | Unclassified | 2246 |
| 683 | Ga0268264_10403632 | 3300028381 | Bacteria | 1314 |
| 684 | Ga0268264_10433617 | 3300028381 | Unclassified | 1270 |
| 685 | Ga0268264_10686834 | 3300028381 | Unclassified | 1016 |
| 686 | Ga0268264_10938486 | 3300028381 | Bacteria | 870 |
| 687 | Ga0268264_11069079 | 3300028381 | Bacteria | 815 |
| 688 | Ga0268264_11282530 | 3300028381 | Unclassified | 742 |
| 689 | Ga0307515_10000076 | 3300028794 | Bacteria | 228736 |
| 690 | Ga0265338_10004606 | 3300028800 | Bacteria | 18534 |
| 691 | Ga0307408_100034097 | 3300031548 | Bacteria | 3562 |
| 692 | Ga0316576_10097357 | 3300031727 | Bacteria | 2197 |
| 693 | Ga0316576_10106021 | 3300031727 | Bacteria | 2104 |
| 694 | Ga0307405_10000001 | 3300031731 | Bacteria | 1731270 |
| 695 | Ga0307410_10455804 | 3300031852 | Bacteria | 1044 |
| 696 | Ga0307406_10001003 | 3300031901 | Bacteria | 15676 |
| 697 | Ga0307406_10224234 | 3300031901 | Bacteria | 1399 |
| 698 | Ga0307407_10007419 | 3300031903 | Bacteria | 4968 |
| 699 | Ga0307416_100242685 | 3300032002 | Bacteria | 1747 |
| 700 | Ga0307414_10017574 | 3300032004 | Bacteria | 4379 |
| 701 | Ga0307411_10762139 | 3300032005 | Unclassified | 849 |
| 702 | Ga0307415_100130429 | 3300032126 | Bacteria | 1902 |
| 703 | Ga0307415_100803122 | 3300032126 | Unclassified | 859 |
| 704 | Ga0316574_0022694 | 3300035398 | Bacteria | 3741 |
| 705 | Ga0316574_0073861 | 3300035398 | Bacteria | 2157 |
| 706 | Ga0395899_0032571 | 3300037312 | Bacteria | 3915 |
| 707 | Ga0395899_0042390 | 3300037312 | Bacteria | 3397 |
| 708 | Ga0395899_0744894 | 3300037312 | Bacteria | 610 |
| 709 | Ga0395900_0018883 | 3300037418 | Bacteria | 7032 |
| 710 | Ga0395900_0160319 | 3300037418 | Bacteria | 2295 |
| 711 | Ga0395900_0206307 | 3300037418 | Bacteria | 1986 |
| 712 | Ga0395900_0799130 | 3300037418 | Bacteria | 871 |
| 713 | Ga0395898_0001959 | 3300037466 | Bacteria | 26028 |
| 714 | Ga0395898_0011790 | 3300037466 | Bacteria | 9062 |
| 715 | Ga0395898_0158338 | 3300037466 | Bacteria | 2166 |
| 716 | Ga0395905_0066795 | 3300037471 | Bacteria | 3368 |
| 717 | Ga0395905_0236620 | 3300037471 | Bacteria | 1707 |
| 718 | Ga0395901_0009760 | 3300038443 | Bacteria | 9734 |
| 719 | Ga0395901_0049162 | 3300038443 | Bacteria | 4381 |
| 720 | Ga0436363_0736983 | 3300039450 | Bacteria | 1820 |
| 721 | Ga0439436_0019194 | 3300041404 | Unclassified | 2042 |
| 722 | Ga0439465_0087445 | 3300041413 | Bacteria | 1063 |
| 723 | Ga0451787_815422 | 3300041441 | Unclassified | 586 |
| 724 | Ga0451807_0071894 | 3300041486 | Unclassified | 1264 |
| 725 | Ga0439431_0002653 | 3300041997 | Bacteria | 3942 |
| 726 | Ga0439442_011201 | 3300042002 | Unclassified | 1824 |
| 727 | Ga0439449_0001010 | 3300042007 | Bacteria | 11093 |
| 728 | Ga0439449_0005071 | 3300042007 | Bacteria | 5065 |
| 729 | Ga0439457_002322 | 3300042014 | Bacteria | 5470 |
| 730 | Ga0439462_0097425 | 3300042015 | Unclassified | 809 |
| 731 | Ga0450894_005182 | 3300042131 | Bacteria | 1686 |
| 732 | Ga0450896_019098 | 3300042133 | Bacteria | 996 |
| 733 | Ga0450898_000625 | 3300042134 | Unclassified | 4238 |
| 734 | Ga0439434_0010938 | 3300042435 | Unclassified | 2681 |
| 735 | Ga0439434_0202377 | 3300042435 | Unclassified | 670 |
| 736 | Ga0451577_0010807 | 3300042876 | Bacteria | 8681 |
| 737 | Ga0451577_0019894 | 3300042876 | Bacteria | 6167 |
| 738 | Ga0451577_0192098 | 3300042876 | Bacteria | 1842 |
| 739 | Ga0451577_0491833 | 3300042876 | Unclassified | 1114 |
| 740 | Ga0451577_0974533 | 3300042876 | Bacteria | 762 |
| 741 | Ga0466972_0211320 | 3300044658 | Unclassified | 908 |
| 742 | Ga0453683_0147588 | 3300044673 | Unclassified | 1485 |
| 743 | Ga0466961_0161196 | 3300044693 | Bacteria | 1398 |
| 744 | Ga0453684_0001359 | 3300044712 | Bacteria | 71348 |
| 745 | Ga0453684_0019484 | 3300044712 | Bacteria | 10327 |
| 746 | Ga0453684_0046970 | 3300044712 | Bacteria | 5733 |
| 747 | Ga0466957_0790066 | 3300044842 | Bacteria | 674 |
| 748 | Ga0466959_0137635 | 3300045049 | Bacteria | 1728 |
| 749 | Ga0495627_008282 | 3300046453 | Bacteria | 3912 |
| 750 | Ga0495592_0187564 | 3300046454 | Bacteria | 1404 |
| 751 | Ga0495607_0233747 | 3300046501 | Bacteria | 893 |
| 752 | Ga0495606_0193206 | 3300046507 | Bacteria | 1165 |
| 753 | Ga0495608_0236627 | 3300046511 | Unclassified | 1142 |
| 754 | Ga0495643_0111939 | 3300046522 | Unclassified | 1387 |
| 755 | Ga0495624_0188026 | 3300046690 | Bacteria | 1257 |
| 756 | Ga0495686_0221790 | 3300047472 | Bacteria | 1075 |
| 757 | Ga0496100_0013114 | 3300048903 | Bacteria | 4772 |
| 758 | Ga0496101_0340236 | 3300048904 | Bacteria | 1178 |
| 759 | Ga0496104_0791806 | 3300048907 | Bacteria | 854 |
| 760 | Ga0496110_0895250 | 3300048913 | Bacteria | 793 |
| 761 | Ga0496112_0943998 | 3300048915 | Bacteria | 784 |
| 762 | Ga0496114_0065779 | 3300048917 | Bacteria | 3038 |
| 763 | Ga0496115_0322018 | 3300048918 | Bacteria | 1264 |
| 764 | Ga0496125_0000267 | 3300048928 | Bacteria | 107026 |
| 765 | Ga0496126_0060982 | 3300048929 | Bacteria | 3390 |
| 766 | Ga0501308_075990 | 3300049128 | Unclassified | 528 |
| 767 | Ga0501292_015915 | 3300049515 | Unclassified | 1179 |
| 768 | Ga0501297_012494 | 3300049520 | Unclassified | 987 |
| 769 | Ga0501298_005588 | 3300049521 | Unclassified | 2023 |
| 770 | Ga0501031_0020894 | 3300049568 | Unclassified | 4268 |
| 771 | Ga0501032_0004176 | 3300049569 | Bacteria | 10944 |
| 772 | Ga0501033_0070793 | 3300049570 | Unclassified | 2562 |
| 773 | Ga0501034_0021997 | 3300049571 | Bacteria | 6496 |
| 774 | Ga0501034_0119651 | 3300049571 | Unclassified | 2620 |
| 775 | Ga0501034_0147346 | 3300049571 | Bacteria | 2331 |
| 776 | Ga0501034_0150256 | 3300049571 | Bacteria | 2305 |
| 777 | Ga0501034_0245511 | 3300049571 | Bacteria | 1735 |
| 778 | Ga0501036_0015465 | 3300049572 | Bacteria | 6374 |
| 779 | Ga0501036_0032888 | 3300049572 | Bacteria | 4385 |
| 780 | Ga0501037_0057762 | 3300049573 | Unclassified | 2832 |
| 781 | Ga0501037_0081171 | 3300049573 | Unclassified | 2352 |
| 782 | Ga0501038_0006778 | 3300049574 | Bacteria | 10581 |
| 783 | Ga0501038_0127876 | 3300049574 | Bacteria | 2089 |
| 784 | Ga0501038_0181945 | 3300049574 | Unclassified | 1696 |
| 785 | Ga0501039_0039337 | 3300049575 | Unclassified | 3652 |
| 786 | Ga0501040_0304934 | 3300049576 | Bacteria | 1138 |
| 787 | Ga0501043_0013160 | 3300049579 | Bacteria | 6470 |
| 788 | Ga0501043_0033365 | 3300049579 | Unclassified | 4050 |
| 789 | Ga0501043_0056190 | 3300049579 | Bacteria | 3092 |
| 790 | Ga0501043_0082436 | 3300049579 | Bacteria | 2528 |
| 791 | Ga0501046_0129122 | 3300049580 | Bacteria | 1918 |
| 792 | Ga0501046_0145309 | 3300049580 | Bacteria | 1791 |
| 793 | Ga0501047_0046818 | 3300049581 | Bacteria | 4179 |
| 794 | Ga0501047_0117465 | 3300049581 | Bacteria | 2541 |
| 795 | Ga0501047_0528321 | 3300049581 | Bacteria | 1005 |
| 796 | Ga0501048_0125622 | 3300049582 | Bacteria | 1813 |
| 797 | Ga0501067_0123330 | 3300049583 | Bacteria | 1442 |
| 798 | Ga0501070_0013512 | 3300049586 | Bacteria | 6882 |
| 799 | Ga0501070_0251869 | 3300049586 | Bacteria | 1444 |
| 800 | Ga0501073_0013121 | 3300049589 | Bacteria | 6042 |
| 801 | Ga0501073_0304853 | 3300049589 | Bacteria | 1099 |
| 802 | Ga0501074_0002073 | 3300049590 | Bacteria | 13850 |
| 803 | Ga0501201_002129 | 3300049651 | Unclassified | 1822 |
| 804 | Ga0501202_004293 | 3300049652 | Unclassified | 2493 |
| 805 | Ga0501206_002739 | 3300049653 | Bacteria | 2220 |
| 806 | Ga0501207_009108 | 3300049654 | Unclassified | 1445 |
| 807 | Ga0501216_091741 | 3300049660 | Bacteria | 657 |
| 808 | Ga0501217_002935 | 3300049661 | Bacteria | 3410 |
| 809 | Ga0501217_024744 | 3300049661 | Unclassified | 1439 |
| 810 | Ga0501217_038486 | 3300049661 | Bacteria | 1208 |
| 811 | Ga0501222_014259 | 3300049662 | Bacteria | 1048 |
| 812 | Ga0501223_013445 | 3300049663 | Unclassified | 1630 |
| 813 | Ga0501223_029282 | 3300049663 | Unclassified | 1071 |
| 814 | Ga0501224_002914 | 3300049664 | Unclassified | 2364 |
| 815 | Ga0501227_085736 | 3300049665 | Unclassified | 828 |
| 816 | Ga0501233_032396 | 3300049668 | Unclassified | 1189 |
| 817 | Ga0501235_015206 | 3300049669 | Unclassified | 1697 |
| 818 | Ga0501235_061458 | 3300049669 | Bacteria | 880 |
| 819 | Ga0501236_083459 | 3300049670 | Unclassified | 603 |
| 820 | Ga0501240_008299 | 3300049673 | Unclassified | 1329 |
| 821 | Ga0501240_052680 | 3300049673 | Unclassified | 701 |
| 822 | Ga0501242_003822 | 3300049674 | Unclassified | 1646 |
| 823 | Ga0501242_005630 | 3300049674 | Unclassified | 1415 |
| 824 | Ga0501243_001940 | 3300049675 | Bacteria | 3007 |
| 825 | Ga0501249_031153 | 3300049679 | Bacteria | 1189 |
| 826 | Ga0501250_008966 | 3300049680 | Unclassified | 1116 |
| 827 | Ga0501259_000666 | 3300049688 | Bacteria | 5507 |
| 828 | Ga0501259_000668 | 3300049688 | Bacteria | 5495 |
| 829 | Ga0501259_070561 | 3300049688 | Unclassified | 748 |
| 830 | Ga0501261_001484 | 3300049690 | Bacteria | 2884 |
| 831 | Ga0501221_028772 | 3300049704 | Unclassified | 1145 |
| 832 | Ga0501221_053776 | 3300049704 | Unclassified | 914 |
| 833 | Ga0501225_0001259 | 3300049705 | Bacteria | 7864 |
| 834 | Ga0501225_0005639 | 3300049705 | Bacteria | 3671 |
| 835 | Ga0501234_000881 | 3300049707 | Bacteria | 4729 |
| 836 | Ga0501234_018826 | 3300049707 | Bacteria | 1093 |
| 837 | Ga0501245_004279 | 3300049708 | Unclassified | 1958 |
| 838 | Ga0501079_0152267 | 3300049741 | Bacteria | 1803 |
| 839 | Ga0501080_0015122 | 3300049742 | Bacteria | 7111 |
| 840 | Ga0501080_0204218 | 3300049742 | Unclassified | 1813 |
| 841 | Ga0501083_0004676 | 3300049744 | Bacteria | 9672 |
| 842 | Ga0501232_005930 | 3300049757 | Unclassified | 1234 |
| 843 | Ga0501232_020988 | 3300049757 | Bacteria | 841 |
| 844 | Ga0501263_027000 | 3300049760 | Unclassified | 796 |
| 845 | Ga0501267_015282 | 3300049764 | Unclassified | 811 |
| 846 | Ga0501268_026083 | 3300049765 | Unclassified | 1031 |
| 847 | Ga0501268_044650 | 3300049765 | Unclassified | 843 |
| 848 | Ga0501268_052589 | 3300049765 | Unclassified | 791 |
| 849 | Ga0501274_006948 | 3300049771 | Unclassified | 987 |
| 850 | Ga0501279_023980 | 3300049775 | Unclassified | 881 |
| 851 | Ga0501281_06286 | 3300049777 | Unclassified | 832 |
| 852 | Ga0501281_17784 | 3300049777 | Unclassified | 536 |
| 853 | Ga0501035_0015829 | 3300049822 | Bacteria | 6960 |
| 854 | Ga0501035_0053964 | 3300049822 | Bacteria | 3592 |
| 855 | Ga0501035_0104635 | 3300049822 | Bacteria | 2482 |
| 856 | Ga0501035_0117545 | 3300049822 | Unclassified | 2326 |
| 857 | Ga0501035_0399172 | 3300049822 | Bacteria | 1144 |
| 858 | Ga0501044_0055496 | 3300049823 | Bacteria | 4069 |
| 859 | Ga0501045_0170055 | 3300049824 | Bacteria | 1623 |
| 860 | Ga0501212_009308 | 3300049851 | Unclassified | 1381 |
| 861 | nmdc:mga0k408_44395_c1 | 3300050493 | Unclassified | 2563 |
| 862 | nmdc:mga09592_398074_c1 | 3300050508 | Bacteria | 1190 |
| 863 | nmdc:mga08y16_267569_c1 | 3300050511 | Bacteria | 1765 |
| 864 | Ga0500641_0003475 | 3300053096 | Bacteria | 5572 |
| 865 | Ga0500641_0022722 | 3300053096 | Bacteria | 2405 |
| 866 | Ga0500553_144538 | 3300053101 | Bacteria | 930 |
| 867 | Ga0500568_0004547 | 3300053139 | Bacteria | 7399 |
| 868 | Ga0500588_0000768 | 3300053146 | Bacteria | 5520 |
| 869 | Ga0500616_0022392 | 3300053153 | Bacteria | 3528 |
| 870 | Ga0500611_000026 | 3300053727 | Bacteria | 96342 |
| 871 | Ga0501084_0809416 | 3300054114 | Bacteria | 789 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005616 | Ga0068852_100460814 | Ga0068852_1004608142 | 147 |
| 2 | 3300013104 | Ga0157370_10063719 | Ga0157370_100637194 | 147 |
| 3 | 3300026142 | Ga0207698_10475079 | Ga0207698_104750791 | 147 |
| 4 | 3300005331 | Ga0070670_100037728 | Ga0070670_1000377282 | 148 |
| 5 | 3300005354 | Ga0070675_100096905 | Ga0070675_1000969052 | 148 |
| 6 | 3300005543 | Ga0070672_100207449 | Ga0070672_1002074492 | 148 |
| 7 | 3300005844 | Ga0068862_100854413 | Ga0068862_1008544131 | 148 |
| 8 | 3300025923 | Ga0207681_10391847 | Ga0207681_103918472 | 148 |
| 9 | 3300025925 | Ga0207650_10391652 | Ga0207650_103916522 | 148 |
| 10 | 3300025926 | Ga0207659_10032494 | Ga0207659_100324942 | 148 |
| 11 | 3300005367 | Ga0070667_100126539 | Ga0070667_1001265392 | 150 |
| 12 | 3300013308 | Ga0157375_11423448 | Ga0157375_114234481 | 153 |
| 13 | 3300001904 | JGI24736J21556_1047717 | JGI24736J21556_10477171 | 154 |
| 14 | 3300005295 | Ga0065707_10172329 | Ga0065707_101723292 | 154 |
| 15 | 3300005329 | Ga0070683_100704514 | Ga0070683_1007045141 | 154 |
| 16 | 3300005329 | Ga0070683_101016471 | Ga0070683_1010164711 | 154 |
| 17 | 3300005331 | Ga0070670_100290243 | Ga0070670_1002902432 | 154 |
| 18 | 3300005331 | Ga0070670_100394603 | Ga0070670_1003946032 | 154 |
| 19 | 3300005334 | Ga0068869_100256730 | Ga0068869_1002567301 | 154 |
| 20 | 3300005339 | Ga0070660_100077930 | Ga0070660_1000779302 | 154 |
| 21 | 3300005339 | Ga0070660_101808317 | Ga0070660_1018083171 | 154 |
| 22 | 3300005341 | Ga0070691_10078453 | Ga0070691_100784533 | 154 |
| 23 | 3300005343 | Ga0070687_100255316 | Ga0070687_1002553161 | 154 |
| 24 | 3300005344 | Ga0070661_100004667 | Ga0070661_1000046676 | 154 |
| 25 | 3300005344 | Ga0070661_100058504 | Ga0070661_1000585044 | 154 |
| 26 | 3300005347 | Ga0070668_100806979 | Ga0070668_1008069792 | 154 |
| 27 | 3300005355 | Ga0070671_101161375 | Ga0070671_1011613751 | 154 |
| 28 | 3300005356 | Ga0070674_100348092 | Ga0070674_1003480922 | 154 |
| 29 | 3300005356 | Ga0070674_100542404 | Ga0070674_1005424042 | 154 |
| 30 | 3300005365 | Ga0070688_100012191 | Ga0070688_1000121916 | 154 |
| 31 | 3300005365 | Ga0070688_100118925 | Ga0070688_1001189252 | 154 |
| 32 | 3300005441 | Ga0070700_100235515 | Ga0070700_1002355151 | 154 |
| 33 | 3300005456 | Ga0070678_100322916 | Ga0070678_1003229162 | 154 |
| 34 | 3300005457 | Ga0070662_100020483 | Ga0070662_1000204832 | 154 |
| 35 | 3300005459 | Ga0068867_100033559 | Ga0068867_1000335594 | 154 |
| 36 | 3300005459 | Ga0068867_100588509 | Ga0068867_1005885092 | 154 |
| 37 | 3300005539 | Ga0068853_100390725 | Ga0068853_1003907251 | 154 |
| 38 | 3300005539 | Ga0068853_101198371 | Ga0068853_1011983711 | 154 |
| 39 | 3300005564 | Ga0070664_100147599 | Ga0070664_1001475993 | 154 |
| 40 | 3300005577 | Ga0068857_100015051 | Ga0068857_1000150513 | 154 |
| 41 | 3300005577 | Ga0068857_100323166 | Ga0068857_1003231662 | 154 |
| 42 | 3300005578 | Ga0068854_100744697 | Ga0068854_1007446972 | 154 |
| 43 | 3300005614 | Ga0068856_100359274 | Ga0068856_1003592742 | 154 |
| 44 | 3300005616 | Ga0068852_100945341 | Ga0068852_1009453412 | 154 |
| 45 | 3300005618 | Ga0068864_100336826 | Ga0068864_1003368262 | 154 |
| 46 | 3300005718 | Ga0068866_10099942 | Ga0068866_100999422 | 154 |
| 47 | 3300005719 | Ga0068861_100194982 | Ga0068861_1001949822 | 154 |
| 48 | 3300005719 | Ga0068861_100239966 | Ga0068861_1002399663 | 154 |
| 49 | 3300005840 | Ga0068870_10247206 | Ga0068870_102472062 | 154 |
| 50 | 3300006358 | Ga0068871_100240891 | Ga0068871_1002408912 | 154 |
| 51 | 3300006844 | Ga0075428_101118287 | Ga0075428_1011182871 | 154 |
| 52 | 3300006881 | Ga0068865_100682176 | Ga0068865_1006821762 | 154 |
| 53 | 3300009176 | Ga0105242_10035787 | Ga0105242_100357873 | 154 |
| 54 | 3300009545 | Ga0105237_10049418 | Ga0105237_100494183 | 154 |
| 55 | 3300013100 | Ga0157373_10020816 | Ga0157373_100208166 | 154 |
| 56 | 3300013102 | Ga0157371_10000284 | Ga0157371_1000028444 | 154 |
| 57 | 3300013102 | Ga0157371_10004001 | Ga0157371_100040019 | 154 |
| 58 | 3300013104 | Ga0157370_10902020 | Ga0157370_109020201 | 154 |
| 59 | 3300013105 | Ga0157369_10478167 | Ga0157369_104781672 | 154 |
| 60 | 3300013105 | Ga0157369_10947998 | Ga0157369_109479982 | 154 |
| 61 | 3300013296 | Ga0157374_10661838 | Ga0157374_106618382 | 154 |
| 62 | 3300013296 | Ga0157374_10934347 | Ga0157374_109343472 | 154 |
| 63 | 3300013297 | Ga0157378_10071982 | Ga0157378_100719824 | 154 |
| 64 | 3300013297 | Ga0157378_10135010 | Ga0157378_101350102 | 154 |
| 65 | 3300013306 | Ga0163162_10001642 | Ga0163162_1000164210 | 154 |
| 66 | 3300013307 | Ga0157372_10008876 | Ga0157372_100088769 | 154 |
| 67 | 3300013307 | Ga0157372_10410440 | Ga0157372_104104402 | 154 |
| 68 | 3300013308 | Ga0157375_10025511 | Ga0157375_100255116 | 154 |
| 69 | 3300014325 | Ga0163163_10074115 | Ga0163163_100741152 | 154 |
| 70 | 3300014968 | Ga0157379_10033404 | Ga0157379_100334044 | 154 |
| 71 | 3300014968 | Ga0157379_10328993 | Ga0157379_103289933 | 154 |
| 72 | 3300014968 | Ga0157379_10384706 | Ga0157379_103847062 | 154 |
| 73 | 3300014969 | Ga0157376_10048312 | Ga0157376_100483126 | 154 |
| 74 | 3300025909 | Ga0207705_10588882 | Ga0207705_105888822 | 154 |
| 75 | 3300025914 | Ga0207671_10259093 | Ga0207671_102590932 | 154 |
| 76 | 3300025920 | Ga0207649_10691628 | Ga0207649_106916282 | 154 |
| 77 | 3300025925 | Ga0207650_10365833 | Ga0207650_103658332 | 154 |
| 78 | 3300025925 | Ga0207650_10846692 | Ga0207650_108466922 | 154 |
| 79 | 3300025934 | Ga0207686_10030283 | Ga0207686_100302832 | 154 |
| 80 | 3300025944 | Ga0207661_10929646 | Ga0207661_109296462 | 154 |
| 81 | 3300025945 | Ga0207679_10851736 | Ga0207679_108517362 | 154 |
| 82 | 3300025960 | Ga0207651_10000351 | Ga0207651_100003512 | 154 |
| 83 | 3300026089 | Ga0207648_10036103 | Ga0207648_100361033 | 154 |
| 84 | 3300026116 | Ga0207674_10434719 | Ga0207674_104347192 | 154 |
| 85 | 3300027526 | Ga0209968_1029266 | Ga0209968_10292662 | 154 |
| 86 | 3300027543 | Ga0209999_1019113 | Ga0209999_10191132 | 154 |
| 87 | 3300028381 | Ga0268264_10433617 | Ga0268264_104336172 | 154 |
| 88 | 3300037418 | Ga0395900_0799130 | Ga0395900_0799130_352_849 | 154 |
| 89 | 3300037471 | Ga0395905_0066795 | Ga0395905_0066795_11_508 | 154 |
| 90 | 3300042007 | Ga0439449_0005071 | Ga0439449_0005071_65_562 | 154 |
| 91 | 3300042876 | Ga0451577_0491833 | Ga0451577_0491833_383_880 | 154 |
| 92 | 3300044658 | Ga0466972_0211320 | Ga0466972_0211320_401_898 | 154 |
| 93 | 3300044673 | Ga0453683_0147588 | Ga0453683_0147588_20_517 | 154 |
| 94 | 3300044693 | Ga0466961_0161196 | Ga0466961_0161196_570_1067 | 154 |
| 95 | 3300044712 | Ga0453684_0019484 | Ga0453684_0019484_2406_2903 | 154 |
| 96 | 3300045049 | Ga0466959_0137635 | Ga0466959_0137635_155_652 | 154 |
| 97 | 3300049579 | Ga0501043_0082436 | Ga0501043_0082436_1283_1780 | 154 |
| 98 | 3300049660 | Ga0501216_091741 | Ga0501216_091741_95_592 | 154 |
| 99 | 3300049661 | Ga0501217_024744 | Ga0501217_024744_520_1017 | 154 |
| 100 | 3300049673 | Ga0501240_008299 | Ga0501240_008299_112_609 | 154 |
| 101 | 3300049673 | Ga0501240_052680 | Ga0501240_052680_180_677 | 154 |
| 102 | 3300049674 | Ga0501242_005630 | Ga0501242_005630_335_832 | 154 |
| 103 | 3300049688 | Ga0501259_000666 | Ga0501259_000666_971_1468 | 154 |
| 104 | 3300049771 | Ga0501274_006948 | Ga0501274_006948_151_648 | 154 |
| 105 | 3300005330 | Ga0070690_100213700 | Ga0070690_1002137002 | 155 |
| 106 | 3300005334 | Ga0068869_100036944 | Ga0068869_1000369444 | 155 |
| 107 | 3300005343 | Ga0070687_100025475 | Ga0070687_1000254753 | 155 |
| 108 | 3300005457 | Ga0070662_101163925 | Ga0070662_1011639251 | 155 |
| 109 | 3300005564 | Ga0070664_100452177 | Ga0070664_1004521772 | 155 |
| 110 | 3300005617 | Ga0068859_100396636 | Ga0068859_1003966362 | 155 |
| 111 | 3300005841 | Ga0068863_100110665 | Ga0068863_1001106653 | 155 |
| 112 | 3300005843 | Ga0068860_100225752 | Ga0068860_1002257523 | 155 |
| 113 | 3300006931 | Ga0097620_100396666 | Ga0097620_1003966662 | 155 |
| 114 | 3300009094 | Ga0111539_10139259 | Ga0111539_101392593 | 155 |
| 115 | 3300009176 | Ga0105242_10224991 | Ga0105242_102249912 | 155 |
| 116 | 3300009177 | Ga0105248_10980683 | Ga0105248_109806832 | 155 |
| 117 | 3300013297 | Ga0157378_10002625 | Ga0157378_1000262512 | 155 |
| 118 | 3300013306 | Ga0163162_10248162 | Ga0163162_102481622 | 155 |
| 119 | 3300013308 | Ga0157375_10072650 | Ga0157375_100726504 | 155 |
| 120 | 3300014326 | Ga0157380_10788288 | Ga0157380_107882882 | 155 |
| 121 | 3300025899 | Ga0207642_10376537 | Ga0207642_103765372 | 155 |
| 122 | 3300025903 | Ga0207680_10135237 | Ga0207680_101352372 | 155 |
| 123 | 3300025918 | Ga0207662_10112363 | Ga0207662_101123633 | 155 |
| 124 | 3300025940 | Ga0207691_10086186 | Ga0207691_100861863 | 155 |
| 125 | 3300026088 | Ga0207641_10183973 | Ga0207641_101839732 | 155 |
| 126 | 3300026089 | Ga0207648_10207638 | Ga0207648_102076383 | 155 |
| 127 | 3300026121 | Ga0207683_10132662 | Ga0207683_101326623 | 155 |
| 128 | 3300028381 | Ga0268264_10686834 | Ga0268264_106868342 | 155 |
| 129 | 3300032005 | Ga0307411_10762139 | Ga0307411_107621392 | 155 |
| 130 | 3300044842 | Ga0466957_0790066 | Ga0466957_0790066_153_656 | 155 |
| 131 | 3300049128 | Ga0501308_075990 | Ga0501308_075990_13_516 | 155 |
| 132 | 3300049777 | Ga0501281_17784 | Ga0501281_17784_20_523 | 155 |
| 133 | 3300050508 | nmdc:mga09592_398074_c1 | nmdc:mga09592_398074_c1_400_903 | 155 |
| 134 | 3300005459 | Ga0068867_100903095 | Ga0068867_1009030952 | 156 |
| 135 | 3300009174 | Ga0105241_10085795 | Ga0105241_100857954 | 156 |
| 136 | 3300009176 | Ga0105242_10220729 | Ga0105242_102207293 | 156 |
| 137 | 3300010375 | Ga0105239_10211325 | Ga0105239_102113252 | 156 |
| 138 | 3300013100 | Ga0157373_10047594 | Ga0157373_100475943 | 156 |
| 139 | 3300013104 | Ga0157370_10572744 | Ga0157370_105727442 | 156 |
| 140 | 3300013308 | Ga0157375_10351754 | Ga0157375_103517542 | 156 |
| 141 | 3300014325 | Ga0163163_10305715 | Ga0163163_103057152 | 156 |
| 142 | 3300014325 | Ga0163163_11319007 | Ga0163163_113190072 | 156 |
| 143 | 3300014969 | Ga0157376_11220972 | Ga0157376_112209722 | 156 |
| 144 | 3300025912 | Ga0207707_10318694 | Ga0207707_103186942 | 156 |
| 145 | 3300025925 | Ga0207650_10501190 | Ga0207650_105011902 | 156 |
| 146 | 3300025929 | Ga0207664_10777185 | Ga0207664_107771852 | 156 |
| 147 | 3300025942 | Ga0207689_10194435 | Ga0207689_101944351 | 156 |
| 148 | 3300025961 | Ga0207712_11223553 | Ga0207712_112235531 | 156 |
| 149 | 3300025986 | Ga0207658_10943740 | Ga0207658_109437401 | 156 |
| 150 | 3300026041 | Ga0207639_11380017 | Ga0207639_113800171 | 156 |
| 151 | 3300026075 | Ga0207708_10150719 | Ga0207708_101507193 | 156 |
| 152 | 3300041413 | Ga0439465_0087445 | Ga0439465_0087445_458_964 | 156 |
| 153 | 3300042876 | Ga0451577_0974533 | Ga0451577_0974533_33_530 | 156 |
| 154 | 3300053101 | Ga0500553_144538 | Ga0500553_144538_216_722 | 156 |
| 155 | 3300053153 | Ga0500616_0022392 | Ga0500616_0022392_2594_3100 | 156 |
| 156 | 3300053727 | Ga0500611_000026 | Ga0500611_000026_68384_68890 | 156 |
| 157 | 3300054114 | Ga0501084_0809416 | Ga0501084_0809416_38_544 | 156 |
| 158 | 3300005328 | Ga0070676_10872245 | Ga0070676_108722451 | 157 |
| 159 | 3300005456 | Ga0070678_100992017 | Ga0070678_1009920171 | 157 |
| 160 | 3300005459 | Ga0068867_100455016 | Ga0068867_1004550162 | 157 |
| 161 | 3300005545 | Ga0070695_100968699 | Ga0070695_1009686991 | 157 |
| 162 | 3300013307 | Ga0157372_10710485 | Ga0157372_107104852 | 157 |
| 163 | 3300026118 | Ga0207675_100337527 | Ga0207675_1003375272 | 157 |
| 164 | 3300025945 | Ga0207679_10246651 | Ga0207679_102466511 | 158 |
| 165 | 3300004800 | Ga0058861_11891156 | Ga0058861_118911562 | 159 |
| 166 | 3300005719 | Ga0068861_101432993 | Ga0068861_1014329931 | 159 |
| 167 | 3300028381 | Ga0268264_11282530 | Ga0268264_112825302 | 160 |
| 168 | 3300005329 | Ga0070683_100469526 | Ga0070683_1004695262 | 161 |
| 169 | 3300005339 | Ga0070660_100082873 | Ga0070660_1000828734 | 161 |
| 170 | 3300005539 | Ga0068853_100122865 | Ga0068853_1001228652 | 161 |
| 171 | 3300005577 | Ga0068857_100089903 | Ga0068857_1000899032 | 161 |
| 172 | 3300009174 | Ga0105241_11275136 | Ga0105241_112751361 | 161 |
| 173 | 3300025904 | Ga0207647_10475246 | Ga0207647_104752461 | 161 |
| 174 | 3300025909 | Ga0207705_10159460 | Ga0207705_101594603 | 161 |
| 175 | 3300025917 | Ga0207660_10043002 | Ga0207660_100430022 | 161 |
| 176 | 3300025919 | Ga0207657_10027646 | Ga0207657_100276465 | 161 |
| 177 | 3300025932 | Ga0207690_10618407 | Ga0207690_106184071 | 161 |
| 178 | 3300026041 | Ga0207639_10312432 | Ga0207639_103124322 | 161 |
| 179 | 3300026116 | Ga0207674_10058037 | Ga0207674_100580374 | 161 |
| 180 | 3300028800 | Ga0265338_10004606 | Ga0265338_1000460610 | 161 |
| 181 | 3300041441 | Ga0451787_815422 | Ga0451787_815422_35_556 | 161 |
| 182 | 3300005327 | Ga0070658_10641434 | Ga0070658_106414342 | 162 |
| 183 | 3300005353 | Ga0070669_100284817 | Ga0070669_1002848172 | 162 |
| 184 | 3300005365 | Ga0070688_100500625 | Ga0070688_1005006252 | 162 |
| 185 | 3300005367 | Ga0070667_100526854 | Ga0070667_1005268542 | 162 |
| 186 | 3300005577 | Ga0068857_100183014 | Ga0068857_1001830142 | 162 |
| 187 | 3300005617 | Ga0068859_100002585 | Ga0068859_10000258512 | 162 |
| 188 | 3300005618 | Ga0068864_100011486 | Ga0068864_1000114862 | 162 |
| 189 | 3300005842 | Ga0068858_100192007 | Ga0068858_1001920073 | 162 |
| 190 | 3300005843 | Ga0068860_100736682 | Ga0068860_1007366822 | 162 |
| 191 | 3300005844 | Ga0068862_100017333 | Ga0068862_1000173336 | 162 |
| 192 | 3300006931 | Ga0097620_100002585 | Ga0097620_10000258512 | 162 |
| 193 | 3300009553 | Ga0105249_10103410 | Ga0105249_101034104 | 162 |
| 194 | 3300014325 | Ga0163163_10071200 | Ga0163163_100712002 | 162 |
| 195 | 3300025923 | Ga0207681_10049173 | Ga0207681_100491734 | 162 |
| 196 | 3300025961 | Ga0207712_10336280 | Ga0207712_103362802 | 162 |
| 197 | 3300026035 | Ga0207703_10670431 | Ga0207703_106704312 | 162 |
| 198 | 3300026095 | Ga0207676_10120008 | Ga0207676_101200083 | 162 |
| 199 | 3300026116 | Ga0207674_10040613 | Ga0207674_100406135 | 162 |
| 200 | 3300028380 | Ga0268265_10101182 | Ga0268265_101011822 | 162 |
| 201 | 3300028381 | Ga0268264_10101627 | Ga0268264_101016274 | 162 |
| 202 | 3300028381 | Ga0268264_10938486 | Ga0268264_109384862 | 162 |
| 203 | 3300037312 | Ga0395899_0032571 | Ga0395899_0032571_1989_2558 | 162 |
| 204 | 3300037418 | Ga0395900_0018883 | Ga0395900_0018883_6368_6937 | 162 |
| 205 | 3300037466 | Ga0395898_0001959 | Ga0395898_0001959_16966_17535 | 162 |
| 206 | 3300038443 | Ga0395901_0009760 | Ga0395901_0009760_3459_4028 | 162 |
| 207 | 3300042435 | Ga0439434_0202377 | Ga0439434_0202377_10_534 | 162 |
| 208 | 3300042876 | Ga0451577_0010807 | Ga0451577_0010807_2712_3260 | 162 |
| 209 | 3300047472 | Ga0495686_0221790 | Ga0495686_0221790_115_639 | 162 |
| 210 | 3300025942 | Ga0207689_10563100 | Ga0207689_105631002 | 167 |
| 211 | 3300005841 | Ga0068863_100009644 | Ga0068863_1000096442 | 168 |
| 212 | 3300026088 | Ga0207641_10204350 | Ga0207641_102043503 | 168 |
| 213 | 3300049515 | Ga0501292_015915 | Ga0501292_015915_249_770 | 168 |
| 214 | 2162886011 | MRS1b_contig_8355847 | MRS1b_0147.00001540 | 170 |
| 215 | 2162886012 | MBSR1b_contig_7905469 | MBSR1b_0637.00004270 | 170 |
| 216 | 3300005327 | Ga0070658_10011892 | Ga0070658_100118924 | 170 |
| 217 | 3300005329 | Ga0070683_100049339 | Ga0070683_1000493392 | 170 |
| 218 | 3300005331 | Ga0070670_100049340 | Ga0070670_1000493402 | 170 |
| 219 | 3300005331 | Ga0070670_100055870 | Ga0070670_1000558704 | 170 |
| 220 | 3300005331 | Ga0070670_100057150 | Ga0070670_1000571501 | 170 |
| 221 | 3300005334 | Ga0068869_100011219 | Ga0068869_1000112194 | 170 |
| 222 | 3300005334 | Ga0068869_100013854 | Ga0068869_1000138544 | 170 |
| 223 | 3300005335 | Ga0070666_10003560 | Ga0070666_100035604 | 170 |
| 224 | 3300005337 | Ga0070682_100731126 | Ga0070682_1007311261 | 170 |
| 225 | 3300005338 | Ga0068868_100004561 | Ga0068868_1000045613 | 170 |
| 226 | 3300005338 | Ga0068868_100040512 | Ga0068868_1000405124 | 170 |
| 227 | 3300005338 | Ga0068868_101492704 | Ga0068868_1014927041 | 170 |
| 228 | 3300005339 | Ga0070660_100490433 | Ga0070660_1004904332 | 170 |
| 229 | 3300005340 | Ga0070689_100229204 | Ga0070689_1002292042 | 170 |
| 230 | 3300005340 | Ga0070689_100303077 | Ga0070689_1003030772 | 170 |
| 231 | 3300005344 | Ga0070661_100041040 | Ga0070661_1000410402 | 170 |
| 232 | 3300005344 | Ga0070661_100495832 | Ga0070661_1004958321 | 170 |
| 233 | 3300005344 | Ga0070661_100602337 | Ga0070661_1006023371 | 170 |
| 234 | 3300005347 | Ga0070668_100094903 | Ga0070668_1000949032 | 170 |
| 235 | 3300005353 | Ga0070669_100003262 | Ga0070669_10000326211 | 170 |
| 236 | 3300005353 | Ga0070669_101240856 | Ga0070669_1012408561 | 170 |
| 237 | 3300005354 | Ga0070675_100012636 | Ga0070675_1000126366 | 170 |
| 238 | 3300005354 | Ga0070675_100063469 | Ga0070675_1000634692 | 170 |
| 239 | 3300005354 | Ga0070675_100394866 | Ga0070675_1003948661 | 170 |
| 240 | 3300005355 | Ga0070671_100032943 | Ga0070671_1000329435 | 170 |
| 241 | 3300005355 | Ga0070671_100079978 | Ga0070671_1000799784 | 170 |
| 242 | 3300005355 | Ga0070671_100318774 | Ga0070671_1003187742 | 170 |
| 243 | 3300005355 | Ga0070671_100547691 | Ga0070671_1005476912 | 170 |
| 244 | 3300005364 | Ga0070673_100106373 | Ga0070673_1001063732 | 170 |
| 245 | 3300005364 | Ga0070673_100146744 | Ga0070673_1001467443 | 170 |
| 246 | 3300005364 | Ga0070673_100180695 | Ga0070673_1001806951 | 170 |
| 247 | 3300005364 | Ga0070673_100397109 | Ga0070673_1003971092 | 170 |
| 248 | 3300005364 | Ga0070673_100581162 | Ga0070673_1005811621 | 170 |
| 249 | 3300005364 | Ga0070673_101249987 | Ga0070673_1012499871 | 170 |
| 250 | 3300005366 | Ga0070659_100056690 | Ga0070659_1000566904 | 170 |
| 251 | 3300005366 | Ga0070659_100147805 | Ga0070659_1001478052 | 170 |
| 252 | 3300005366 | Ga0070659_101401478 | Ga0070659_1014014781 | 170 |
| 253 | 3300005367 | Ga0070667_100054486 | Ga0070667_1000544862 | 170 |
| 254 | 3300005367 | Ga0070667_100114151 | Ga0070667_1001141512 | 170 |
| 255 | 3300005438 | Ga0070701_10916206 | Ga0070701_109162061 | 170 |
| 256 | 3300005455 | Ga0070663_100415687 | Ga0070663_1004156872 | 170 |
| 257 | 3300005456 | Ga0070678_100366314 | Ga0070678_1003663142 | 170 |
| 258 | 3300005457 | Ga0070662_100118047 | Ga0070662_1001180472 | 170 |
| 259 | 3300005457 | Ga0070662_100125200 | Ga0070662_1001252002 | 170 |
| 260 | 3300005457 | Ga0070662_100142343 | Ga0070662_1001423432 | 170 |
| 261 | 3300005458 | Ga0070681_10044182 | Ga0070681_100441823 | 170 |
| 262 | 3300005459 | Ga0068867_100015945 | Ga0068867_1000159456 | 170 |
| 263 | 3300005459 | Ga0068867_100124423 | Ga0068867_1001244232 | 170 |
| 264 | 3300005466 | Ga0070685_10040628 | Ga0070685_100406283 | 170 |
| 265 | 3300005466 | Ga0070685_10046540 | Ga0070685_100465403 | 170 |
| 266 | 3300005535 | Ga0070684_100000732 | Ga0070684_10000073215 | 170 |
| 267 | 3300005535 | Ga0070684_100057871 | Ga0070684_1000578714 | 170 |
| 268 | 3300005535 | Ga0070684_100063983 | Ga0070684_1000639835 | 170 |
| 269 | 3300005539 | Ga0068853_100387618 | Ga0068853_1003876182 | 170 |
| 270 | 3300005543 | Ga0070672_100048558 | Ga0070672_1000485583 | 170 |
| 271 | 3300005543 | Ga0070672_100106244 | Ga0070672_1001062444 | 170 |
| 272 | 3300005543 | Ga0070672_100186840 | Ga0070672_1001868401 | 170 |
| 273 | 3300005543 | Ga0070672_100375370 | Ga0070672_1003753702 | 170 |
| 274 | 3300005548 | Ga0070665_100299126 | Ga0070665_1002991262 | 170 |
| 275 | 3300005548 | Ga0070665_100488123 | Ga0070665_1004881232 | 170 |
| 276 | 3300005563 | Ga0068855_100171998 | Ga0068855_1001719983 | 170 |
| 277 | 3300005563 | Ga0068855_100203638 | Ga0068855_1002036384 | 170 |
| 278 | 3300005563 | Ga0068855_100736791 | Ga0068855_1007367912 | 170 |
| 279 | 3300005564 | Ga0070664_100004812 | Ga0070664_1000048125 | 170 |
| 280 | 3300005564 | Ga0070664_100005353 | Ga0070664_1000053532 | 170 |
| 281 | 3300005564 | Ga0070664_100089884 | Ga0070664_1000898842 | 170 |
| 282 | 3300005564 | Ga0070664_100105796 | Ga0070664_1001057964 | 170 |
| 283 | 3300005564 | Ga0070664_100346932 | Ga0070664_1003469321 | 170 |
| 284 | 3300005564 | Ga0070664_100427738 | Ga0070664_1004277382 | 170 |
| 285 | 3300005577 | Ga0068857_100046477 | Ga0068857_1000464773 | 170 |
| 286 | 3300005577 | Ga0068857_100298459 | Ga0068857_1002984593 | 170 |
| 287 | 3300005578 | Ga0068854_100328888 | Ga0068854_1003288882 | 170 |
| 288 | 3300005614 | Ga0068856_100292744 | Ga0068856_1002927443 | 170 |
| 289 | 3300005615 | Ga0070702_100070832 | Ga0070702_1000708322 | 170 |
| 290 | 3300005616 | Ga0068852_100030388 | Ga0068852_1000303884 | 170 |
| 291 | 3300005616 | Ga0068852_100085281 | Ga0068852_1000852814 | 170 |
| 292 | 3300005616 | Ga0068852_100087517 | Ga0068852_1000875174 | 170 |
| 293 | 3300005617 | Ga0068859_100031954 | Ga0068859_1000319544 | 170 |
| 294 | 3300005617 | Ga0068859_100050459 | Ga0068859_1000504592 | 170 |
| 295 | 3300005617 | Ga0068859_100130686 | Ga0068859_1001306864 | 170 |
| 296 | 3300005618 | Ga0068864_100015347 | Ga0068864_1000153473 | 170 |
| 297 | 3300005718 | Ga0068866_10184746 | Ga0068866_101847462 | 170 |
| 298 | 3300005718 | Ga0068866_10607443 | Ga0068866_106074432 | 170 |
| 299 | 3300005719 | Ga0068861_100003939 | Ga0068861_1000039393 | 170 |
| 300 | 3300005834 | Ga0068851_10047482 | Ga0068851_100474822 | 170 |
| 301 | 3300005840 | Ga0068870_10020219 | Ga0068870_100202192 | 170 |
| 302 | 3300005841 | Ga0068863_100088765 | Ga0068863_1000887653 | 170 |
| 303 | 3300005842 | Ga0068858_100286764 | Ga0068858_1002867642 | 170 |
| 304 | 3300005842 | Ga0068858_100377487 | Ga0068858_1003774872 | 170 |
| 305 | 3300005843 | Ga0068860_100011162 | Ga0068860_1000111622 | 170 |
| 306 | 3300005843 | Ga0068860_100113037 | Ga0068860_1001130374 | 170 |
| 307 | 3300005843 | Ga0068860_100305483 | Ga0068860_1003054833 | 170 |
| 308 | 3300005844 | Ga0068862_100145146 | Ga0068862_1001451462 | 170 |
| 309 | 3300006237 | Ga0097621_100000423 | Ga0097621_10000042316 | 170 |
| 310 | 3300006237 | Ga0097621_100022999 | Ga0097621_1000229993 | 170 |
| 311 | 3300006358 | Ga0068871_100000604 | Ga0068871_10000060418 | 170 |
| 312 | 3300006881 | Ga0068865_100017686 | Ga0068865_1000176864 | 170 |
| 313 | 3300006931 | Ga0097620_100000575 | Ga0097620_10000057528 | 170 |
| 314 | 3300006931 | Ga0097620_100031954 | Ga0097620_1000319544 | 170 |
| 315 | 3300006931 | Ga0097620_100050465 | Ga0097620_1000504655 | 170 |
| 316 | 3300006931 | Ga0097620_100130682 | Ga0097620_1001306824 | 170 |
| 317 | 3300006931 | Ga0097620_100383935 | Ga0097620_1003839352 | 170 |
| 318 | 3300009094 | Ga0111539_10021610 | Ga0111539_100216102 | 170 |
| 319 | 3300009148 | Ga0105243_11300555 | Ga0105243_113005551 | 170 |
| 320 | 3300009177 | Ga0105248_10035159 | Ga0105248_100351595 | 170 |
| 321 | 3300009553 | Ga0105249_10000806 | Ga0105249_1000080626 | 170 |
| 322 | 3300009553 | Ga0105249_10381130 | Ga0105249_103811302 | 170 |
| 323 | 3300012497 | Ga0157319_1002218 | Ga0157319_10022182 | 170 |
| 324 | 3300013100 | Ga0157373_10122072 | Ga0157373_101220722 | 170 |
| 325 | 3300013102 | Ga0157371_10003533 | Ga0157371_100035332 | 170 |
| 326 | 3300013102 | Ga0157371_10035665 | Ga0157371_100356653 | 170 |
| 327 | 3300013102 | Ga0157371_10042494 | Ga0157371_100424944 | 170 |
| 328 | 3300013102 | Ga0157371_10047902 | Ga0157371_100479024 | 170 |
| 329 | 3300013104 | Ga0157370_10359894 | Ga0157370_103598942 | 170 |
| 330 | 3300013105 | Ga0157369_10241722 | Ga0157369_102417222 | 170 |
| 331 | 3300013105 | Ga0157369_10920836 | Ga0157369_109208361 | 170 |
| 332 | 3300013296 | Ga0157374_10001939 | Ga0157374_1000193914 | 170 |
| 333 | 3300013297 | Ga0157378_10011662 | Ga0157378_100116626 | 170 |
| 334 | 3300013297 | Ga0157378_10372245 | Ga0157378_103722452 | 170 |
| 335 | 3300013297 | Ga0157378_10635436 | Ga0157378_106354361 | 170 |
| 336 | 3300013306 | Ga0163162_10000114 | Ga0163162_1000011457 | 170 |
| 337 | 3300013306 | Ga0163162_10001189 | Ga0163162_1000118930 | 170 |
| 338 | 3300013306 | Ga0163162_10098560 | Ga0163162_100985604 | 170 |
| 339 | 3300013306 | Ga0163162_10521440 | Ga0163162_105214402 | 170 |
| 340 | 3300013307 | Ga0157372_10023602 | Ga0157372_100236022 | 170 |
| 341 | 3300013307 | Ga0157372_10024383 | Ga0157372_100243834 | 170 |
| 342 | 3300013307 | Ga0157372_10057098 | Ga0157372_100570985 | 170 |
| 343 | 3300013307 | Ga0157372_10066227 | Ga0157372_100662275 | 170 |
| 344 | 3300013307 | Ga0157372_10089423 | Ga0157372_100894235 | 170 |
| 345 | 3300013307 | Ga0157372_10468944 | Ga0157372_104689442 | 170 |
| 346 | 3300013307 | Ga0157372_10833691 | Ga0157372_108336911 | 170 |
| 347 | 3300013308 | Ga0157375_10142569 | Ga0157375_101425692 | 170 |
| 348 | 3300013308 | Ga0157375_10177729 | Ga0157375_101777293 | 170 |
| 349 | 3300014325 | Ga0163163_10001283 | Ga0163163_1000128311 | 170 |
| 350 | 3300014325 | Ga0163163_10002242 | Ga0163163_1000224211 | 170 |
| 351 | 3300014325 | Ga0163163_10447627 | Ga0163163_104476272 | 170 |
| 352 | 3300014325 | Ga0163163_10549615 | Ga0163163_105496152 | 170 |
| 353 | 3300014326 | Ga0157380_10043776 | Ga0157380_100437764 | 170 |
| 354 | 3300014326 | Ga0157380_10387092 | Ga0157380_103870922 | 170 |
| 355 | 3300014745 | Ga0157377_10010475 | Ga0157377_100104754 | 170 |
| 356 | 3300014745 | Ga0157377_10019607 | Ga0157377_100196072 | 170 |
| 357 | 3300014968 | Ga0157379_10183882 | Ga0157379_101838822 | 170 |
| 358 | 3300014969 | Ga0157376_10001023 | Ga0157376_100010239 | 170 |
| 359 | 3300014969 | Ga0157376_10388211 | Ga0157376_103882112 | 170 |
| 360 | 3300017792 | Ga0163161_10001357 | Ga0163161_100013572 | 170 |
| 361 | 3300017792 | Ga0163161_10012045 | Ga0163161_100120457 | 170 |
| 362 | 3300025315 | Ga0207697_10217459 | Ga0207697_102174592 | 170 |
| 363 | 3300025321 | Ga0207656_10014573 | Ga0207656_100145732 | 170 |
| 364 | 3300025899 | Ga0207642_10317422 | Ga0207642_103174221 | 170 |
| 365 | 3300025903 | Ga0207680_10085235 | Ga0207680_100852353 | 170 |
| 366 | 3300025904 | Ga0207647_10000110 | Ga0207647_1000011034 | 170 |
| 367 | 3300025904 | Ga0207647_10052196 | Ga0207647_100521964 | 170 |
| 368 | 3300025907 | Ga0207645_10170420 | Ga0207645_101704202 | 170 |
| 369 | 3300025908 | Ga0207643_10043706 | Ga0207643_100437064 | 170 |
| 370 | 3300025908 | Ga0207643_10151961 | Ga0207643_101519612 | 170 |
| 371 | 3300025912 | Ga0207707_10192723 | Ga0207707_101927232 | 170 |
| 372 | 3300025918 | Ga0207662_10511580 | Ga0207662_105115801 | 170 |
| 373 | 3300025918 | Ga0207662_10517268 | Ga0207662_105172681 | 170 |
| 374 | 3300025919 | Ga0207657_10074404 | Ga0207657_100744042 | 170 |
| 375 | 3300025919 | Ga0207657_10124769 | Ga0207657_101247693 | 170 |
| 376 | 3300025920 | Ga0207649_10389698 | Ga0207649_103896982 | 170 |
| 377 | 3300025923 | Ga0207681_10019146 | Ga0207681_100191466 | 170 |
| 378 | 3300025923 | Ga0207681_10281337 | Ga0207681_102813372 | 170 |
| 379 | 3300025925 | Ga0207650_10004016 | Ga0207650_1000401610 | 170 |
| 380 | 3300025925 | Ga0207650_10040561 | Ga0207650_100405614 | 170 |
| 381 | 3300025925 | Ga0207650_10372325 | Ga0207650_103723252 | 170 |
| 382 | 3300025926 | Ga0207659_10049413 | Ga0207659_100494134 | 170 |
| 383 | 3300025926 | Ga0207659_10077068 | Ga0207659_100770682 | 170 |
| 384 | 3300025926 | Ga0207659_10227153 | Ga0207659_102271532 | 170 |
| 385 | 3300025933 | Ga0207706_10024969 | Ga0207706_100249692 | 170 |
| 386 | 3300025933 | Ga0207706_10120722 | Ga0207706_101207222 | 170 |
| 387 | 3300025934 | Ga0207686_10014735 | Ga0207686_100147357 | 170 |
| 388 | 3300025936 | Ga0207670_10033313 | Ga0207670_100333133 | 170 |
| 389 | 3300025937 | Ga0207669_10152439 | Ga0207669_101524392 | 170 |
| 390 | 3300025938 | Ga0207704_10019095 | Ga0207704_100190954 | 170 |
| 391 | 3300025938 | Ga0207704_11227896 | Ga0207704_112278961 | 170 |
| 392 | 3300025940 | Ga0207691_10058045 | Ga0207691_100580454 | 170 |
| 393 | 3300025940 | Ga0207691_10158185 | Ga0207691_101581852 | 170 |
| 394 | 3300025940 | Ga0207691_10346426 | Ga0207691_103464262 | 170 |
| 395 | 3300025940 | Ga0207691_11189802 | Ga0207691_111898021 | 170 |
| 396 | 3300025942 | Ga0207689_10006627 | Ga0207689_100066279 | 170 |
| 397 | 3300025944 | Ga0207661_10009619 | Ga0207661_100096193 | 170 |
| 398 | 3300025944 | Ga0207661_10048003 | Ga0207661_100480034 | 170 |
| 399 | 3300025945 | Ga0207679_10008767 | Ga0207679_100087674 | 170 |
| 400 | 3300025945 | Ga0207679_10024202 | Ga0207679_100242022 | 170 |
| 401 | 3300025945 | Ga0207679_10038291 | Ga0207679_100382912 | 170 |
| 402 | 3300025945 | Ga0207679_10086137 | Ga0207679_100861374 | 170 |
| 403 | 3300025949 | Ga0207667_10178873 | Ga0207667_101788733 | 170 |
| 404 | 3300025960 | Ga0207651_10034932 | Ga0207651_100349323 | 170 |
| 405 | 3300025961 | Ga0207712_10003480 | Ga0207712_1000348010 | 170 |
| 406 | 3300025961 | Ga0207712_10043635 | Ga0207712_100436354 | 170 |
| 407 | 3300025961 | Ga0207712_10223943 | Ga0207712_102239432 | 170 |
| 408 | 3300025961 | Ga0207712_10349105 | Ga0207712_103491051 | 170 |
| 409 | 3300025972 | Ga0207668_10038727 | Ga0207668_100387272 | 170 |
| 410 | 3300025986 | Ga0207658_10016630 | Ga0207658_100166307 | 170 |
| 411 | 3300025986 | Ga0207658_10073893 | Ga0207658_100738932 | 170 |
| 412 | 3300025986 | Ga0207658_10291639 | Ga0207658_102916392 | 170 |
| 413 | 3300026023 | Ga0207677_10240672 | Ga0207677_102406722 | 170 |
| 414 | 3300026035 | Ga0207703_10018796 | Ga0207703_100187966 | 170 |
| 415 | 3300026035 | Ga0207703_10264218 | Ga0207703_102642182 | 170 |
| 416 | 3300026035 | Ga0207703_10309259 | Ga0207703_103092592 | 170 |
| 417 | 3300026041 | Ga0207639_10400412 | Ga0207639_104004122 | 170 |
| 418 | 3300026041 | Ga0207639_10423906 | Ga0207639_104239062 | 170 |
| 419 | 3300026067 | Ga0207678_10007975 | Ga0207678_100079754 | 170 |
| 420 | 3300026067 | Ga0207678_10443545 | Ga0207678_104435452 | 170 |
| 421 | 3300026075 | Ga0207708_10063911 | Ga0207708_100639113 | 170 |
| 422 | 3300026075 | Ga0207708_10210475 | Ga0207708_102104752 | 170 |
| 423 | 3300026078 | Ga0207702_10619623 | Ga0207702_106196232 | 170 |
| 424 | 3300026078 | Ga0207702_10687921 | Ga0207702_106879212 | 170 |
| 425 | 3300026088 | Ga0207641_10264392 | Ga0207641_102643923 | 170 |
| 426 | 3300026088 | Ga0207641_10380691 | Ga0207641_103806912 | 170 |
| 427 | 3300026089 | Ga0207648_10045161 | Ga0207648_100451612 | 170 |
| 428 | 3300026089 | Ga0207648_10066057 | Ga0207648_100660574 | 170 |
| 429 | 3300026089 | Ga0207648_10208913 | Ga0207648_102089132 | 170 |
| 430 | 3300026095 | Ga0207676_10058964 | Ga0207676_100589644 | 170 |
| 431 | 3300026095 | Ga0207676_10094165 | Ga0207676_100941652 | 170 |
| 432 | 3300026116 | Ga0207674_10010080 | Ga0207674_100100802 | 170 |
| 433 | 3300026116 | Ga0207674_10029331 | Ga0207674_100293313 | 170 |
| 434 | 3300026116 | Ga0207674_10065653 | Ga0207674_100656535 | 170 |
| 435 | 3300026116 | Ga0207674_10533882 | Ga0207674_105338822 | 170 |
| 436 | 3300026118 | Ga0207675_100001207 | Ga0207675_10000120714 | 170 |
| 437 | 3300026118 | Ga0207675_101676701 | Ga0207675_1016767011 | 170 |
| 438 | 3300026121 | Ga0207683_10080331 | Ga0207683_100803312 | 170 |
| 439 | 3300026121 | Ga0207683_10402780 | Ga0207683_104027802 | 170 |
| 440 | 3300026142 | Ga0207698_10026514 | Ga0207698_100265143 | 170 |
| 441 | 3300026142 | Ga0207698_10496139 | Ga0207698_104961391 | 170 |
| 442 | 3300027907 | Ga0207428_10281497 | Ga0207428_102814972 | 170 |
| 443 | 3300028380 | Ga0268265_10123415 | Ga0268265_101234152 | 170 |
| 444 | 3300028381 | Ga0268264_10004843 | Ga0268264_100048436 | 170 |
| 445 | 3300028381 | Ga0268264_10403632 | Ga0268264_104036322 | 170 |
| 446 | 3300032126 | Ga0307415_100130429 | Ga0307415_1001304292 | 170 |
| 447 | 3300037466 | Ga0395898_0158338 | Ga0395898_0158338_38_607 | 170 |
| 448 | 3300041404 | Ga0439436_0019194 | Ga0439436_0019194_1207_1776 | 170 |
| 449 | 3300041997 | Ga0439431_0002653 | Ga0439431_0002653_1840_2409 | 170 |
| 450 | 3300042002 | Ga0439442_011201 | Ga0439442_011201_99_668 | 170 |
| 451 | 3300042007 | Ga0439449_0001010 | Ga0439449_0001010_8248_8796 | 170 |
| 452 | 3300042014 | Ga0439457_002322 | Ga0439457_002322_2837_3385 | 170 |
| 453 | 3300042015 | Ga0439462_0097425 | Ga0439462_0097425_88_636 | 170 |
| 454 | 3300042131 | Ga0450894_005182 | Ga0450894_005182_499_1068 | 170 |
| 455 | 3300042133 | Ga0450896_019098 | Ga0450896_019098_388_957 | 170 |
| 456 | 3300042134 | Ga0450898_000625 | Ga0450898_000625_1799_2368 | 170 |
| 457 | 3300042435 | Ga0439434_0010938 | Ga0439434_0010938_589_1158 | 170 |
| 458 | 3300046454 | Ga0495592_0187564 | Ga0495592_0187564_74_637 | 170 |
| 459 | 3300046511 | Ga0495608_0236627 | Ga0495608_0236627_172_735 | 170 |
| 460 | 3300046522 | Ga0495643_0111939 | Ga0495643_0111939_737_1306 | 170 |
| 461 | 3300046690 | Ga0495624_0188026 | Ga0495624_0188026_546_1109 | 170 |
| 462 | 3300048903 | Ga0496100_0013114 | Ga0496100_0013114_1157_1717 | 170 |
| 463 | 3300048904 | Ga0496101_0340236 | Ga0496101_0340236_10_570 | 170 |
| 464 | 3300048907 | Ga0496104_0791806 | Ga0496104_0791806_193_753 | 170 |
| 465 | 3300048913 | Ga0496110_0895250 | Ga0496110_0895250_110_670 | 170 |
| 466 | 3300048915 | Ga0496112_0943998 | Ga0496112_0943998_153_716 | 170 |
| 467 | 3300048917 | Ga0496114_0065779 | Ga0496114_0065779_267_827 | 170 |
| 468 | 3300049520 | Ga0501297_012494 | Ga0501297_012494_363_911 | 170 |
| 469 | 3300049521 | Ga0501298_005588 | Ga0501298_005588_908_1456 | 170 |
| 470 | 3300049570 | Ga0501033_0070793 | Ga0501033_0070793_1065_1625 | 170 |
| 471 | 3300049571 | Ga0501034_0119651 | Ga0501034_0119651_719_1279 | 170 |
| 472 | 3300049571 | Ga0501034_0245511 | Ga0501034_0245511_777_1313 | 170 |
| 473 | 3300049573 | Ga0501037_0081171 | Ga0501037_0081171_1264_1824 | 170 |
| 474 | 3300049574 | Ga0501038_0181945 | Ga0501038_0181945_291_851 | 170 |
| 475 | 3300049579 | Ga0501043_0056190 | Ga0501043_0056190_263_823 | 170 |
| 476 | 3300049581 | Ga0501047_0046818 | Ga0501047_0046818_3572_4132 | 170 |
| 477 | 3300049651 | Ga0501201_002129 | Ga0501201_002129_908_1456 | 170 |
| 478 | 3300049652 | Ga0501202_004293 | Ga0501202_004293_1165_1713 | 170 |
| 479 | 3300049653 | Ga0501206_002739 | Ga0501206_002739_516_1064 | 170 |
| 480 | 3300049654 | Ga0501207_009108 | Ga0501207_009108_16_564 | 170 |
| 481 | 3300049661 | Ga0501217_002935 | Ga0501217_002935_716_1264 | 170 |
| 482 | 3300049661 | Ga0501217_038486 | Ga0501217_038486_460_1008 | 170 |
| 483 | 3300049662 | Ga0501222_014259 | Ga0501222_014259_189_737 | 170 |
| 484 | 3300049663 | Ga0501223_013445 | Ga0501223_013445_472_1020 | 170 |
| 485 | 3300049663 | Ga0501223_029282 | Ga0501223_029282_311_859 | 170 |
| 486 | 3300049664 | Ga0501224_002914 | Ga0501224_002914_854_1402 | 170 |
| 487 | 3300049665 | Ga0501227_085736 | Ga0501227_085736_254_802 | 170 |
| 488 | 3300049668 | Ga0501233_032396 | Ga0501233_032396_605_1153 | 170 |
| 489 | 3300049669 | Ga0501235_015206 | Ga0501235_015206_741_1289 | 170 |
| 490 | 3300049669 | Ga0501235_061458 | Ga0501235_061458_31_579 | 170 |
| 491 | 3300049670 | Ga0501236_083459 | Ga0501236_083459_33_581 | 170 |
| 492 | 3300049674 | Ga0501242_003822 | Ga0501242_003822_268_816 | 170 |
| 493 | 3300049675 | Ga0501243_001940 | Ga0501243_001940_337_885 | 170 |
| 494 | 3300049679 | Ga0501249_031153 | Ga0501249_031153_180_728 | 170 |
| 495 | 3300049680 | Ga0501250_008966 | Ga0501250_008966_458_1006 | 170 |
| 496 | 3300049688 | Ga0501259_000668 | Ga0501259_000668_1779_2327 | 170 |
| 497 | 3300049688 | Ga0501259_070561 | Ga0501259_070561_33_581 | 170 |
| 498 | 3300049690 | Ga0501261_001484 | Ga0501261_001484_1652_2200 | 170 |
| 499 | 3300049704 | Ga0501221_028772 | Ga0501221_028772_43_591 | 170 |
| 500 | 3300049704 | Ga0501221_053776 | Ga0501221_053776_218_766 | 170 |
| 501 | 3300049705 | Ga0501225_0001259 | Ga0501225_0001259_2086_2634 | 170 |
| 502 | 3300049707 | Ga0501234_000881 | Ga0501234_000881_212_760 | 170 |
| 503 | 3300049708 | Ga0501245_004279 | Ga0501245_004279_274_822 | 170 |
| 504 | 3300049757 | Ga0501232_005930 | Ga0501232_005930_24_572 | 170 |
| 505 | 3300049757 | Ga0501232_020988 | Ga0501232_020988_112_660 | 170 |
| 506 | 3300049760 | Ga0501263_027000 | Ga0501263_027000_192_761 | 170 |
| 507 | 3300049764 | Ga0501267_015282 | Ga0501267_015282_96_644 | 170 |
| 508 | 3300049765 | Ga0501268_026083 | Ga0501268_026083_205_753 | 170 |
| 509 | 3300049765 | Ga0501268_044650 | Ga0501268_044650_146_694 | 170 |
| 510 | 3300049765 | Ga0501268_052589 | Ga0501268_052589_105_674 | 170 |
| 511 | 3300049775 | Ga0501279_023980 | Ga0501279_023980_161_709 | 170 |
| 512 | 3300049777 | Ga0501281_06286 | Ga0501281_06286_240_788 | 170 |
| 513 | 3300049822 | Ga0501035_0053964 | Ga0501035_0053964_1146_1706 | 170 |
| 514 | 3300049822 | Ga0501035_0104635 | Ga0501035_0104635_1568_2128 | 170 |
| 515 | 3300049851 | Ga0501212_009308 | Ga0501212_009308_43_591 | 170 |
| 516 | 3300050511 | nmdc:mga08y16_267569_c1 | nmdc:mga08y16_267569_c1_1061_1630 | 170 |
| 517 | 3300005328 | Ga0070676_10087371 | Ga0070676_100873712 | 171 |
| 518 | 3300005331 | Ga0070670_100334288 | Ga0070670_1003342882 | 171 |
| 519 | 3300005335 | Ga0070666_10278258 | Ga0070666_102782582 | 171 |
| 520 | 3300005338 | Ga0068868_100105750 | Ga0068868_1001057504 | 171 |
| 521 | 3300005353 | Ga0070669_100193469 | Ga0070669_1001934693 | 171 |
| 522 | 3300005354 | Ga0070675_100235142 | Ga0070675_1002351423 | 171 |
| 523 | 3300005355 | Ga0070671_100032458 | Ga0070671_1000324582 | 171 |
| 524 | 3300005355 | Ga0070671_100299445 | Ga0070671_1002994452 | 171 |
| 525 | 3300005356 | Ga0070674_100203187 | Ga0070674_1002031872 | 171 |
| 526 | 3300005364 | Ga0070673_100222059 | Ga0070673_1002220591 | 171 |
| 527 | 3300005364 | Ga0070673_100393138 | Ga0070673_1003931381 | 171 |
| 528 | 3300005366 | Ga0070659_100430203 | Ga0070659_1004302032 | 171 |
| 529 | 3300005438 | Ga0070701_10084495 | Ga0070701_100844952 | 171 |
| 530 | 3300005456 | Ga0070678_100143461 | Ga0070678_1001434613 | 171 |
| 531 | 3300005459 | Ga0068867_100143553 | Ga0068867_1001435533 | 171 |
| 532 | 3300005543 | Ga0070672_100073133 | Ga0070672_1000731333 | 171 |
| 533 | 3300005544 | Ga0070686_100029033 | Ga0070686_1000290334 | 171 |
| 534 | 3300005547 | Ga0070693_100222468 | Ga0070693_1002224681 | 171 |
| 535 | 3300005615 | Ga0070702_100017096 | Ga0070702_1000170963 | 171 |
| 536 | 3300005718 | Ga0068866_10487158 | Ga0068866_104871582 | 171 |
| 537 | 3300005719 | Ga0068861_100426056 | Ga0068861_1004260562 | 171 |
| 538 | 3300005834 | Ga0068851_10520687 | Ga0068851_105206872 | 171 |
| 539 | 3300005840 | Ga0068870_10025829 | Ga0068870_100258292 | 171 |
| 540 | 3300005840 | Ga0068870_10372162 | Ga0068870_103721622 | 171 |
| 541 | 3300005844 | Ga0068862_101262635 | Ga0068862_1012626352 | 171 |
| 542 | 3300006880 | Ga0075429_100346297 | Ga0075429_1003462972 | 171 |
| 543 | 3300013104 | Ga0157370_10023600 | Ga0157370_100236008 | 171 |
| 544 | 3300013297 | Ga0157378_10260607 | Ga0157378_102606072 | 171 |
| 545 | 3300014325 | Ga0163163_10392545 | Ga0163163_103925452 | 171 |
| 546 | 3300014745 | Ga0157377_10110006 | Ga0157377_101100063 | 171 |
| 547 | 3300025315 | Ga0207697_10329511 | Ga0207697_103295111 | 171 |
| 548 | 3300025907 | Ga0207645_10010260 | Ga0207645_100102603 | 171 |
| 549 | 3300025920 | Ga0207649_10250216 | Ga0207649_102502162 | 171 |
| 550 | 3300025926 | Ga0207659_10003079 | Ga0207659_100030799 | 171 |
| 551 | 3300025926 | Ga0207659_11092514 | Ga0207659_110925141 | 171 |
| 552 | 3300025931 | Ga0207644_10051317 | Ga0207644_100513174 | 171 |
| 553 | 3300025937 | Ga0207669_10011405 | Ga0207669_100114053 | 171 |
| 554 | 3300025937 | Ga0207669_10417488 | Ga0207669_104174882 | 171 |
| 555 | 3300025940 | Ga0207691_10168614 | Ga0207691_101686143 | 171 |
| 556 | 3300025942 | Ga0207689_10036976 | Ga0207689_100369763 | 171 |
| 557 | 3300025945 | Ga0207679_10020432 | Ga0207679_100204326 | 171 |
| 558 | 3300025960 | Ga0207651_10338911 | Ga0207651_103389112 | 171 |
| 559 | 3300025972 | Ga0207668_10345595 | Ga0207668_103455952 | 171 |
| 560 | 3300026023 | Ga0207677_10057954 | Ga0207677_100579544 | 171 |
| 561 | 3300026035 | Ga0207703_10049308 | Ga0207703_100493084 | 171 |
| 562 | 3300026089 | Ga0207648_10038845 | Ga0207648_100388456 | 171 |
| 563 | 3300026089 | Ga0207648_10067278 | Ga0207648_100672784 | 171 |
| 564 | 3300026118 | Ga0207675_100192852 | Ga0207675_1001928522 | 171 |
| 565 | 3300028380 | Ga0268265_11042494 | Ga0268265_110424941 | 171 |
| 566 | 3300031548 | Ga0307408_100034097 | Ga0307408_1000340971 | 171 |
| 567 | 3300031852 | Ga0307410_10455804 | Ga0307410_104558042 | 171 |
| 568 | 3300031901 | Ga0307406_10224234 | Ga0307406_102242342 | 171 |
| 569 | 3300031903 | Ga0307407_10007419 | Ga0307407_100074196 | 171 |
| 570 | 3300032002 | Ga0307416_100242685 | Ga0307416_1002426852 | 171 |
| 571 | 3300032126 | Ga0307415_100803122 | Ga0307415_1008031222 | 171 |
| 572 | 3300039450 | Ga0436363_0736983 | Ga0436363_0736983_1182_1799 | 171 |
| 573 | 3300042876 | Ga0451577_0019894 | Ga0451577_0019894_4540_5112 | 171 |
| 574 | 3300044712 | Ga0453684_0001359 | Ga0453684_0001359_56432_57004 | 171 |
| 575 | 3300049705 | Ga0501225_0005639 | Ga0501225_0005639_3009_3584 | 171 |
| 576 | 3300049707 | Ga0501234_018826 | Ga0501234_018826_339_914 | 171 |
| 577 | 3300005327 | Ga0070658_10020900 | Ga0070658_100209004 | 172 |
| 578 | 3300005327 | Ga0070658_10209540 | Ga0070658_102095402 | 172 |
| 579 | 3300005331 | Ga0070670_100039617 | Ga0070670_1000396174 | 172 |
| 580 | 3300005333 | Ga0070677_10196608 | Ga0070677_101966082 | 172 |
| 581 | 3300005334 | Ga0068869_100118802 | Ga0068869_1001188022 | 172 |
| 582 | 3300005335 | Ga0070666_10000051 | Ga0070666_10000051104 | 172 |
| 583 | 3300005336 | Ga0070680_100018651 | Ga0070680_1000186517 | 172 |
| 584 | 3300005338 | Ga0068868_100127203 | Ga0068868_1001272033 | 172 |
| 585 | 3300005339 | Ga0070660_100016234 | Ga0070660_1000162343 | 172 |
| 586 | 3300005339 | Ga0070660_100068070 | Ga0070660_1000680702 | 172 |
| 587 | 3300005347 | Ga0070668_100171175 | Ga0070668_1001711752 | 172 |
| 588 | 3300005347 | Ga0070668_100389631 | Ga0070668_1003896312 | 172 |
| 589 | 3300005355 | Ga0070671_100013288 | Ga0070671_1000132886 | 172 |
| 590 | 3300005364 | Ga0070673_100583868 | Ga0070673_1005838681 | 172 |
| 591 | 3300005366 | Ga0070659_100003883 | Ga0070659_1000038833 | 172 |
| 592 | 3300005367 | Ga0070667_100182203 | Ga0070667_1001822032 | 172 |
| 593 | 3300005455 | Ga0070663_100019473 | Ga0070663_1000194733 | 172 |
| 594 | 3300005456 | Ga0070678_100013606 | Ga0070678_1000136063 | 172 |
| 595 | 3300005456 | Ga0070678_100275646 | Ga0070678_1002756463 | 172 |
| 596 | 3300005458 | Ga0070681_10503220 | Ga0070681_105032202 | 172 |
| 597 | 3300005459 | Ga0068867_100366603 | Ga0068867_1003666032 | 172 |
| 598 | 3300005459 | Ga0068867_100555118 | Ga0068867_1005551182 | 172 |
| 599 | 3300005530 | Ga0070679_100005880 | Ga0070679_10000588013 | 172 |
| 600 | 3300005530 | Ga0070679_100117451 | Ga0070679_1001174511 | 172 |
| 601 | 3300005539 | Ga0068853_100186815 | Ga0068853_1001868153 | 172 |
| 602 | 3300005539 | Ga0068853_101497357 | Ga0068853_1014973571 | 172 |
| 603 | 3300005543 | Ga0070672_100036985 | Ga0070672_1000369851 | 172 |
| 604 | 3300005563 | Ga0068855_100008437 | Ga0068855_10000843711 | 172 |
| 605 | 3300005563 | Ga0068855_101214540 | Ga0068855_1012145402 | 172 |
| 606 | 3300005578 | Ga0068854_100495251 | Ga0068854_1004952512 | 172 |
| 607 | 3300005614 | Ga0068856_100066740 | Ga0068856_1000667403 | 172 |
| 608 | 3300005616 | Ga0068852_100168494 | Ga0068852_1001684942 | 172 |
| 609 | 3300005616 | Ga0068852_100270575 | Ga0068852_1002705752 | 172 |
| 610 | 3300005617 | Ga0068859_100000023 | Ga0068859_100000023142 | 172 |
| 611 | 3300005618 | Ga0068864_100006376 | Ga0068864_1000063767 | 172 |
| 612 | 3300005718 | Ga0068866_10390936 | Ga0068866_103909362 | 172 |
| 613 | 3300005719 | Ga0068861_100069663 | Ga0068861_1000696633 | 172 |
| 614 | 3300005834 | Ga0068851_10043901 | Ga0068851_100439013 | 172 |
| 615 | 3300005841 | Ga0068863_100014587 | Ga0068863_1000145872 | 172 |
| 616 | 3300005842 | Ga0068858_100023286 | Ga0068858_1000232866 | 172 |
| 617 | 3300005843 | Ga0068860_100001475 | Ga0068860_10000147517 | 172 |
| 618 | 3300005843 | Ga0068860_101101616 | Ga0068860_1011016162 | 172 |
| 619 | 3300006195 | Ga0075366_10027426 | Ga0075366_100274264 | 172 |
| 620 | 3300006237 | Ga0097621_100657470 | Ga0097621_1006574702 | 172 |
| 621 | 3300006358 | Ga0068871_100075398 | Ga0068871_1000753982 | 172 |
| 622 | 3300006931 | Ga0097620_100000023 | Ga0097620_100000023142 | 172 |
| 623 | 3300009093 | Ga0105240_10058540 | Ga0105240_100585402 | 172 |
| 624 | 3300009101 | Ga0105247_10004502 | Ga0105247_100045025 | 172 |
| 625 | 3300009174 | Ga0105241_10226034 | Ga0105241_102260342 | 172 |
| 626 | 3300013100 | Ga0157373_10083164 | Ga0157373_100831642 | 172 |
| 627 | 3300013102 | Ga0157371_10000924 | Ga0157371_1000092423 | 172 |
| 628 | 3300013102 | Ga0157371_10022893 | Ga0157371_100228935 | 172 |
| 629 | 3300013102 | Ga0157371_10050384 | Ga0157371_100503845 | 172 |
| 630 | 3300013102 | Ga0157371_10140953 | Ga0157371_101409533 | 172 |
| 631 | 3300013104 | Ga0157370_10003733 | Ga0157370_100037338 | 172 |
| 632 | 3300013104 | Ga0157370_10070410 | Ga0157370_100704105 | 172 |
| 633 | 3300013105 | Ga0157369_10037231 | Ga0157369_100372316 | 172 |
| 634 | 3300013105 | Ga0157369_10157991 | Ga0157369_101579912 | 172 |
| 635 | 3300013105 | Ga0157369_10777074 | Ga0157369_107770742 | 172 |
| 636 | 3300013307 | Ga0157372_10048241 | Ga0157372_100482414 | 172 |
| 637 | 3300013307 | Ga0157372_10231472 | Ga0157372_102314722 | 172 |
| 638 | 3300013307 | Ga0157372_10618024 | Ga0157372_106180242 | 172 |
| 639 | 3300017792 | Ga0163161_10042073 | Ga0163161_100420732 | 172 |
| 640 | 3300025321 | Ga0207656_10030148 | Ga0207656_100301482 | 172 |
| 641 | 3300025903 | Ga0207680_10000856 | Ga0207680_100008567 | 172 |
| 642 | 3300025904 | Ga0207647_10022580 | Ga0207647_100225804 | 172 |
| 643 | 3300025909 | Ga0207705_10018149 | Ga0207705_100181495 | 172 |
| 644 | 3300025909 | Ga0207705_10055977 | Ga0207705_100559773 | 172 |
| 645 | 3300025909 | Ga0207705_10066453 | Ga0207705_100664532 | 172 |
| 646 | 3300025909 | Ga0207705_10090663 | Ga0207705_100906633 | 172 |
| 647 | 3300025911 | Ga0207654_10001756 | Ga0207654_100017568 | 172 |
| 648 | 3300025911 | Ga0207654_10260197 | Ga0207654_102601972 | 172 |
| 649 | 3300025912 | Ga0207707_10020922 | Ga0207707_100209223 | 172 |
| 650 | 3300025913 | Ga0207695_10006992 | Ga0207695_100069926 | 172 |
| 651 | 3300025914 | Ga0207671_10001442 | Ga0207671_100014428 | 172 |
| 652 | 3300025917 | Ga0207660_10021291 | Ga0207660_100212916 | 172 |
| 653 | 3300025917 | Ga0207660_10582456 | Ga0207660_105824561 | 172 |
| 654 | 3300025919 | Ga0207657_10074029 | Ga0207657_100740294 | 172 |
| 655 | 3300025919 | Ga0207657_10196162 | Ga0207657_101961622 | 172 |
| 656 | 3300025921 | Ga0207652_10000166 | Ga0207652_1000016642 | 172 |
| 657 | 3300025921 | Ga0207652_10001364 | Ga0207652_1000136416 | 172 |
| 658 | 3300025931 | Ga0207644_10015867 | Ga0207644_100158675 | 172 |
| 659 | 3300025932 | Ga0207690_10015683 | Ga0207690_100156836 | 172 |
| 660 | 3300025934 | Ga0207686_10192960 | Ga0207686_101929603 | 172 |
| 661 | 3300025934 | Ga0207686_10554792 | Ga0207686_105547922 | 172 |
| 662 | 3300025935 | Ga0207709_10284760 | Ga0207709_102847602 | 172 |
| 663 | 3300025940 | Ga0207691_10343321 | Ga0207691_103433212 | 172 |
| 664 | 3300025942 | Ga0207689_10002648 | Ga0207689_1000264816 | 172 |
| 665 | 3300025942 | Ga0207689_10002890 | Ga0207689_100028909 | 172 |
| 666 | 3300025942 | Ga0207689_10447171 | Ga0207689_104471712 | 172 |
| 667 | 3300025944 | Ga0207661_10176797 | Ga0207661_101767973 | 172 |
| 668 | 3300025949 | Ga0207667_10001454 | Ga0207667_1000145416 | 172 |
| 669 | 3300025949 | Ga0207667_10016511 | Ga0207667_100165112 | 172 |
| 670 | 3300025961 | Ga0207712_10007969 | Ga0207712_100079693 | 172 |
| 671 | 3300025972 | Ga0207668_10126240 | Ga0207668_101262402 | 172 |
| 672 | 3300025972 | Ga0207668_10351034 | Ga0207668_103510342 | 172 |
| 673 | 3300025981 | Ga0207640_10352041 | Ga0207640_103520412 | 172 |
| 674 | 3300025981 | Ga0207640_10442930 | Ga0207640_104429302 | 172 |
| 675 | 3300025981 | Ga0207640_11185071 | Ga0207640_111850711 | 172 |
| 676 | 3300025986 | Ga0207658_10423335 | Ga0207658_104233352 | 172 |
| 677 | 3300026023 | Ga0207677_10223694 | Ga0207677_102236942 | 172 |
| 678 | 3300026035 | Ga0207703_10036946 | Ga0207703_100369464 | 172 |
| 679 | 3300026041 | Ga0207639_10082245 | Ga0207639_100822452 | 172 |
| 680 | 3300026041 | Ga0207639_10830612 | Ga0207639_108306122 | 172 |
| 681 | 3300026041 | Ga0207639_11414216 | Ga0207639_114142161 | 172 |
| 682 | 3300026067 | Ga0207678_10040991 | Ga0207678_100409914 | 172 |
| 683 | 3300026078 | Ga0207702_10041800 | Ga0207702_100418003 | 172 |
| 684 | 3300026078 | Ga0207702_10263629 | Ga0207702_102636293 | 172 |
| 685 | 3300026088 | Ga0207641_10000202 | Ga0207641_1000020255 | 172 |
| 686 | 3300026089 | Ga0207648_10823521 | Ga0207648_108235212 | 172 |
| 687 | 3300026095 | Ga0207676_10042150 | Ga0207676_100421502 | 172 |
| 688 | 3300026118 | Ga0207675_100444784 | Ga0207675_1004447842 | 172 |
| 689 | 3300026121 | Ga0207683_10074567 | Ga0207683_100745674 | 172 |
| 690 | 3300026142 | Ga0207698_10099782 | Ga0207698_100997822 | 172 |
| 691 | 3300026142 | Ga0207698_10197244 | Ga0207698_101972442 | 172 |
| 692 | 3300026142 | Ga0207698_10805720 | Ga0207698_108057202 | 172 |
| 693 | 3300028381 | Ga0268264_10001369 | Ga0268264_1000136912 | 172 |
| 694 | 3300028381 | Ga0268264_11069079 | Ga0268264_110690792 | 172 |
| 695 | 3300037312 | Ga0395899_0042390 | Ga0395899_0042390_1207_1776 | 172 |
| 696 | 3300037312 | Ga0395899_0744894 | Ga0395899_0744894_26_595 | 172 |
| 697 | 3300037418 | Ga0395900_0160319 | Ga0395900_0160319_1060_1629 | 172 |
| 698 | 3300037418 | Ga0395900_0206307 | Ga0395900_0206307_54_602 | 172 |
| 699 | 3300037466 | Ga0395898_0011790 | Ga0395898_0011790_8053_8622 | 172 |
| 700 | 3300037471 | Ga0395905_0236620 | Ga0395905_0236620_676_1245 | 172 |
| 701 | 3300038443 | Ga0395901_0049162 | Ga0395901_0049162_3027_3596 | 172 |
| 702 | 3300042876 | Ga0451577_0192098 | Ga0451577_0192098_1180_1791 | 172 |
| 703 | 3300044712 | Ga0453684_0046970 | Ga0453684_0046970_383_952 | 172 |
| 704 | 3300049569 | Ga0501032_0004176 | Ga0501032_0004176_4148_4726 | 172 |
| 705 | 3300049571 | Ga0501034_0021997 | Ga0501034_0021997_1921_2499 | 172 |
| 706 | 3300049571 | Ga0501034_0150256 | Ga0501034_0150256_722_1291 | 172 |
| 707 | 3300049572 | Ga0501036_0032888 | Ga0501036_0032888_965_1543 | 172 |
| 708 | 3300049574 | Ga0501038_0006778 | Ga0501038_0006778_1756_2334 | 172 |
| 709 | 3300049579 | Ga0501043_0013160 | Ga0501043_0013160_940_1518 | 172 |
| 710 | 3300049580 | Ga0501046_0145309 | Ga0501046_0145309_221_799 | 172 |
| 711 | 3300049581 | Ga0501047_0117465 | Ga0501047_0117465_1145_1723 | 172 |
| 712 | 3300049582 | Ga0501048_0125622 | Ga0501048_0125622_247_825 | 172 |
| 713 | 3300049583 | Ga0501067_0123330 | Ga0501067_0123330_348_926 | 172 |
| 714 | 3300049586 | Ga0501070_0013512 | Ga0501070_0013512_3762_4340 | 172 |
| 715 | 3300049586 | Ga0501070_0251869 | Ga0501070_0251869_508_1077 | 172 |
| 716 | 3300049589 | Ga0501073_0013121 | Ga0501073_0013121_2621_3199 | 172 |
| 717 | 3300049590 | Ga0501074_0002073 | Ga0501074_0002073_6540_7118 | 172 |
| 718 | 3300049741 | Ga0501079_0152267 | Ga0501079_0152267_649_1227 | 172 |
| 719 | 3300049742 | Ga0501080_0015122 | Ga0501080_0015122_2844_3422 | 172 |
| 720 | 3300049744 | Ga0501083_0004676 | Ga0501083_0004676_7465_8043 | 172 |
| 721 | 3300049822 | Ga0501035_0015829 | Ga0501035_0015829_2295_2873 | 172 |
| 722 | 3300049822 | Ga0501035_0399172 | Ga0501035_0399172_506_1075 | 172 |
| 723 | 3300049824 | Ga0501045_0170055 | Ga0501045_0170055_740_1318 | 172 |
| 724 | 3300050493 | nmdc:mga0k408_44395_c1 | nmdc:mga0k408_44395_c1_638_1216 | 172 |
| 725 | 3300053096 | Ga0500641_0022722 | Ga0500641_0022722_848_1426 | 172 |
| 726 | 3300053139 | Ga0500568_0004547 | Ga0500568_0004547_4782_5360 | 172 |
| 727 | 3300053146 | Ga0500588_0000768 | Ga0500588_0000768_3586_4164 | 172 |
| 728 | 3300005338 | Ga0068868_100002074 | Ga0068868_1000020749 | 173 |
| 729 | 3300005466 | Ga0070685_10362288 | Ga0070685_103622882 | 173 |
| 730 | 3300005577 | Ga0068857_100646114 | Ga0068857_1006461142 | 173 |
| 731 | 3300005718 | Ga0068866_10014659 | Ga0068866_100146594 | 173 |
| 732 | 3300005844 | Ga0068862_100176206 | Ga0068862_1001762062 | 173 |
| 733 | 3300006358 | Ga0068871_100232950 | Ga0068871_1002329502 | 173 |
| 734 | 3300013296 | Ga0157374_10365741 | Ga0157374_103657412 | 173 |
| 735 | 3300013297 | Ga0157378_11005930 | Ga0157378_110059301 | 173 |
| 736 | 3300013308 | Ga0157375_10089651 | Ga0157375_100896514 | 173 |
| 737 | 3300014969 | Ga0157376_10499859 | Ga0157376_104998592 | 173 |
| 738 | 3300025907 | Ga0207645_10069140 | Ga0207645_100691404 | 173 |
| 739 | 3300025934 | Ga0207686_10408973 | Ga0207686_104089732 | 173 |
| 740 | 3300025940 | Ga0207691_10457333 | Ga0207691_104573332 | 173 |
| 741 | 3300025981 | Ga0207640_10890056 | Ga0207640_108900562 | 173 |
| 742 | 3300025986 | Ga0207658_10561782 | Ga0207658_105617822 | 173 |
| 743 | 3300026023 | Ga0207677_10026970 | Ga0207677_100269704 | 173 |
| 744 | 3300026041 | Ga0207639_10086848 | Ga0207639_100868484 | 173 |
| 745 | 3300026089 | Ga0207648_10045942 | Ga0207648_100459423 | 173 |
| 746 | 3300026116 | Ga0207674_10738556 | Ga0207674_107385562 | 173 |
| 747 | 3300026121 | Ga0207683_10992926 | Ga0207683_109929262 | 173 |
| 748 | 3300049568 | Ga0501031_0020894 | Ga0501031_0020894_1932_2513 | 173 |
| 749 | 3300049571 | Ga0501034_0147346 | Ga0501034_0147346_1136_1717 | 173 |
| 750 | 3300049572 | Ga0501036_0015465 | Ga0501036_0015465_4815_5396 | 173 |
| 751 | 3300049573 | Ga0501037_0057762 | Ga0501037_0057762_1852_2433 | 173 |
| 752 | 3300049574 | Ga0501038_0127876 | Ga0501038_0127876_222_803 | 173 |
| 753 | 3300049575 | Ga0501039_0039337 | Ga0501039_0039337_1459_2040 | 173 |
| 754 | 3300049579 | Ga0501043_0033365 | Ga0501043_0033365_2803_3384 | 173 |
| 755 | 3300049580 | Ga0501046_0129122 | Ga0501046_0129122_979_1560 | 173 |
| 756 | 3300049581 | Ga0501047_0528321 | Ga0501047_0528321_95_676 | 173 |
| 757 | 3300049589 | Ga0501073_0304853 | Ga0501073_0304853_277_858 | 173 |
| 758 | 3300049742 | Ga0501080_0204218 | Ga0501080_0204218_770_1351 | 173 |
| 759 | 3300049822 | Ga0501035_0117545 | Ga0501035_0117545_956_1537 | 173 |
| 760 | 3300049823 | Ga0501044_0055496 | Ga0501044_0055496_2609_3190 | 173 |
| 761 | 3300005333 | Ga0070677_10026061 | Ga0070677_100260612 | 174 |
| 762 | 3300005334 | Ga0068869_100134215 | Ga0068869_1001342152 | 174 |
| 763 | 3300005338 | Ga0068868_100097882 | Ga0068868_1000978821 | 174 |
| 764 | 3300005347 | Ga0070668_100017512 | Ga0070668_1000175126 | 174 |
| 765 | 3300005353 | Ga0070669_100046045 | Ga0070669_1000460452 | 174 |
| 766 | 3300005354 | Ga0070675_100061480 | Ga0070675_1000614804 | 174 |
| 767 | 3300005355 | Ga0070671_100094736 | Ga0070671_1000947363 | 174 |
| 768 | 3300005356 | Ga0070674_100058570 | Ga0070674_1000585704 | 174 |
| 769 | 3300005364 | Ga0070673_100564948 | Ga0070673_1005649481 | 174 |
| 770 | 3300005365 | Ga0070688_100516301 | Ga0070688_1005163012 | 174 |
| 771 | 3300005367 | Ga0070667_100160204 | Ga0070667_1001602042 | 174 |
| 772 | 3300005455 | Ga0070663_100185529 | Ga0070663_1001855292 | 174 |
| 773 | 3300005456 | Ga0070678_100101316 | Ga0070678_1001013163 | 174 |
| 774 | 3300005539 | Ga0068853_100046316 | Ga0068853_1000463164 | 174 |
| 775 | 3300005548 | Ga0070665_100071523 | Ga0070665_1000715234 | 174 |
| 776 | 3300005577 | Ga0068857_100100738 | Ga0068857_1001007384 | 174 |
| 777 | 3300005578 | Ga0068854_100275873 | Ga0068854_1002758732 | 174 |
| 778 | 3300005617 | Ga0068859_100126744 | Ga0068859_1001267442 | 174 |
| 779 | 3300005718 | Ga0068866_10036931 | Ga0068866_100369314 | 174 |
| 780 | 3300005719 | Ga0068861_100066558 | Ga0068861_1000665582 | 174 |
| 781 | 3300005840 | Ga0068870_10539470 | Ga0068870_105394702 | 174 |
| 782 | 3300005841 | Ga0068863_100035327 | Ga0068863_1000353272 | 174 |
| 783 | 3300005843 | Ga0068860_100049889 | Ga0068860_1000498894 | 174 |
| 784 | 3300005844 | Ga0068862_100606771 | Ga0068862_1006067712 | 174 |
| 785 | 3300006358 | Ga0068871_100093572 | Ga0068871_1000935724 | 174 |
| 786 | 3300006881 | Ga0068865_100080247 | Ga0068865_1000802472 | 174 |
| 787 | 3300006931 | Ga0097620_100126756 | Ga0097620_1001267562 | 174 |
| 788 | 3300009098 | Ga0105245_10523827 | Ga0105245_105238272 | 174 |
| 789 | 3300009176 | Ga0105242_10066827 | Ga0105242_100668274 | 174 |
| 790 | 3300013102 | Ga0157371_10361980 | Ga0157371_103619801 | 174 |
| 791 | 3300013104 | Ga0157370_10415630 | Ga0157370_104156301 | 174 |
| 792 | 3300013296 | Ga0157374_10088226 | Ga0157374_100882262 | 174 |
| 793 | 3300013297 | Ga0157378_10067120 | Ga0157378_100671201 | 174 |
| 794 | 3300013307 | Ga0157372_10222694 | Ga0157372_102226942 | 174 |
| 795 | 3300013307 | Ga0157372_10266213 | Ga0157372_102662132 | 174 |
| 796 | 3300013308 | Ga0157375_10063866 | Ga0157375_100638664 | 174 |
| 797 | 3300014325 | Ga0163163_10643555 | Ga0163163_106435552 | 174 |
| 798 | 3300014968 | Ga0157379_10634104 | Ga0157379_106341042 | 174 |
| 799 | 3300025899 | Ga0207642_10010313 | Ga0207642_100103133 | 174 |
| 800 | 3300025901 | Ga0207688_10008415 | Ga0207688_100084156 | 174 |
| 801 | 3300025903 | Ga0207680_10091324 | Ga0207680_100913242 | 174 |
| 802 | 3300025907 | Ga0207645_10014403 | Ga0207645_100144032 | 174 |
| 803 | 3300025908 | Ga0207643_10318655 | Ga0207643_103186552 | 174 |
| 804 | 3300025923 | Ga0207681_10009947 | Ga0207681_100099477 | 174 |
| 805 | 3300025926 | Ga0207659_10194089 | Ga0207659_101940892 | 174 |
| 806 | 3300025934 | Ga0207686_10051345 | Ga0207686_100513454 | 174 |
| 807 | 3300025937 | Ga0207669_10030753 | Ga0207669_100307533 | 174 |
| 808 | 3300025940 | Ga0207691_10001792 | Ga0207691_100017927 | 174 |
| 809 | 3300025942 | Ga0207689_10002715 | Ga0207689_1000271513 | 174 |
| 810 | 3300025960 | Ga0207651_10132577 | Ga0207651_101325773 | 174 |
| 811 | 3300025972 | Ga0207668_10491120 | Ga0207668_104911202 | 174 |
| 812 | 3300025981 | Ga0207640_10247117 | Ga0207640_102471172 | 174 |
| 813 | 3300026067 | Ga0207678_10274646 | Ga0207678_102746462 | 174 |
| 814 | 3300026088 | Ga0207641_10021731 | Ga0207641_100217312 | 174 |
| 815 | 3300026089 | Ga0207648_10001834 | Ga0207648_1000183415 | 174 |
| 816 | 3300026095 | Ga0207676_10773408 | Ga0207676_107734081 | 174 |
| 817 | 3300026116 | Ga0207674_10210214 | Ga0207674_102102143 | 174 |
| 818 | 3300026118 | Ga0207675_100086651 | Ga0207675_1000866512 | 174 |
| 819 | 3300026121 | Ga0207683_10004024 | Ga0207683_100040247 | 174 |
| 820 | 3300028379 | Ga0268266_10352900 | Ga0268266_103529002 | 174 |
| 821 | 3300028380 | Ga0268265_10394202 | Ga0268265_103942022 | 174 |
| 822 | 3300028381 | Ga0268264_10128103 | Ga0268264_101281033 | 174 |
| 823 | 3300028794 | Ga0307515_10000076 | Ga0307515_10000076154 | 174 |
| 824 | 3300041486 | Ga0451807_0071894 | Ga0451807_0071894_488_1072 | 174 |
| 825 | iso_pu_bacteria | 2833640130 | 2833641592 | 174 |
| 826 | 3300013307 | Ga0157372_10392178 | Ga0157372_103921782 | 175 |
| 827 | 3300031727 | Ga0316576_10097357 | Ga0316576_100973572 | 175 |
| 828 | 3300031727 | Ga0316576_10106021 | Ga0316576_101060213 | 175 |
| 829 | 3300035398 | Ga0316574_0022694 | Ga0316574_0022694_818_1360 | 175 |
| 830 | 3300025934 | Ga0207686_10889765 | Ga0207686_108897651 | 176 |
| 831 | iso_pu_bacteria | 2958512119 | 2958514240 | 176 |
| 832 | 3300005458 | Ga0070681_10101100 | Ga0070681_101011004 | 177 |
| 833 | 3300005530 | Ga0070679_100277671 | Ga0070679_1002776711 | 177 |
| 834 | 3300005563 | Ga0068855_100011433 | Ga0068855_1000114339 | 177 |
| 835 | 3300013100 | Ga0157373_10028779 | Ga0157373_100287795 | 177 |
| 836 | 3300013102 | Ga0157371_10047990 | Ga0157371_100479905 | 177 |
| 837 | 3300013104 | Ga0157370_10903421 | Ga0157370_109034211 | 177 |
| 838 | 3300013105 | Ga0157369_10019696 | Ga0157369_100196966 | 177 |
| 839 | 3300025912 | Ga0207707_10252815 | Ga0207707_102528152 | 177 |
| 840 | 3300025919 | Ga0207657_10059391 | Ga0207657_100593912 | 177 |
| 841 | 3300025921 | Ga0207652_10010361 | Ga0207652_100103616 | 177 |
| 842 | 3300025921 | Ga0207652_10061630 | Ga0207652_100616305 | 177 |
| 843 | 3300025949 | Ga0207667_10070704 | Ga0207667_100707046 | 177 |
| 844 | 3300032004 | Ga0307414_10017574 | Ga0307414_100175745 | 178 |
| 845 | 3300035398 | Ga0316574_0073861 | Ga0316574_0073861_524_1066 | 178 |
| 846 | 2162886007 | SwRhRL2b_contig_28926 | SwRhRL2b_0733.00002920 | 180 |
| 847 | 3300005289 | Ga0065704_10138584 | Ga0065704_101385842 | 180 |
| 848 | 3300013104 | Ga0157370_10009105 | Ga0157370_100091056 | 180 |
| 849 | 3300013104 | Ga0157370_10140422 | Ga0157370_101404222 | 180 |
| 850 | 3300013306 | Ga0163162_10032258 | Ga0163162_100322588 | 180 |
| 851 | 3300014497 | Ga0182008_10067865 | Ga0182008_100678652 | 180 |
| 852 | 3300017792 | Ga0163161_10002438 | Ga0163161_100024383 | 180 |
| 853 | 3300017792 | Ga0163161_10011682 | Ga0163161_100116824 | 180 |
| 854 | 3300017792 | Ga0163161_11196101 | Ga0163161_111961011 | 180 |
| 855 | 3300027617 | Ga0210002_1001946 | Ga0210002_10019462 | 180 |
| 856 | 3300027876 | Ga0209974_10005287 | Ga0209974_100052872 | 180 |
| 857 | 3300046453 | Ga0495627_008282 | Ga0495627_008282_599_1141 | 180 |
| 858 | 3300046501 | Ga0495607_0233747 | Ga0495607_0233747_276_818 | 180 |
| 859 | 3300046507 | Ga0495606_0193206 | Ga0495606_0193206_71_613 | 180 |
| 860 | 3300048918 | Ga0496115_0322018 | Ga0496115_0322018_407_949 | 180 |
| 861 | 3300048928 | Ga0496125_0000267 | Ga0496125_0000267_29364_29906 | 180 |
| 862 | 3300048929 | Ga0496126_0060982 | Ga0496126_0060982_2817_3359 | 180 |
| 863 | 3300053096 | Ga0500641_0003475 | Ga0500641_0003475_636_1178 | 180 |
| 864 | 2162886007 | SwRhRL2b_contig_1199054 | SwRhRL2b_0900.00005840 | 181 |
| 865 | 3300005289 | Ga0065704_10071448 | Ga0065704_100714484 | 181 |
| 866 | 3300005289 | Ga0065704_10171434 | Ga0065704_101714342 | 181 |
| 867 | 3300005547 | Ga0070693_100012847 | Ga0070693_1000128473 | 181 |
| 868 | 3300013104 | Ga0157370_10004338 | Ga0157370_100043388 | 181 |
| 869 | 3300013104 | Ga0157370_10387855 | Ga0157370_103878553 | 181 |
| 870 | 3300015261 | Ga0182006_1034846 | Ga0182006_10348462 | 181 |
| 871 | 3300031731 | Ga0307405_10000001 | Ga0307405_1000000169 | 181 |
| 872 | 3300031901 | Ga0307406_10001003 | Ga0307406_100010038 | 181 |
| 873 | 3300049576 | Ga0501040_0304934 | Ga0501040_0304934_78_635 | 181 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bhy-assembly1.cif.gz_A | dna-binding domain of deor in complex with the dna operator | 0.9818 | 124 | 162 |
| 2o8x-assembly1.cif.gz_A | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.9731 | 114 | 164 |
| 6jhe-assembly1.cif.gz_A | crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna | 0.9697 | 121 | 168 |
| 2o8x-assembly1.cif.gz_B | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.9627 | 111 | 164 |
| 3hug-assembly2.cif.gz_E | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.9575 | 114 | 172 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2o8xA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9731 | 114 | 164 | 1.10.10.10 |
| 2o8xC00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9645 | 111 | 164 | 1.10.10.10 |
| 2o8xB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9627 | 111 | 164 | 1.10.10.10 |
| 3hugG00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9512 | 114 | 172 | 1.10.10.10 |
| 3vfzA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9495 | 115 | 169 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I6PML3-F1-model_v4 | RNA polymerase sigma-70 factor, ECF subfamily | 0.9602 | 1 | 174 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A316E4U8-F1-model_v4 | RNA polymerase sigma-70 factor (ECF subfamily) | 0.9568 | 1 | 174 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A2K1E397-F1-model_v4 | RNA polymerase subunit sigma-70 | 0.9525 | 1 | 174 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A258ES14-F1-model_v4 | RNA polymerase subunit sigma-70 | 0.9478 | 15 | 174 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A7X3D158-F1-model_v4 | Sigma-70 family RNA polymerase sigma factor | 0.9351 | 1 | 174 |
GO:0003677
GO:0006352 GO:0016987 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar