F484261

General Info

Members Datasets Scaffolds Average Seq Length
873 289 871 184

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0736983|Ga0436363_0736983_1182_1799
Length 205
Sequence LVLFLKESEQTKEILNGSSNQWHSDSDLLEGCIKGDRKMQRELYNRFAPKMYAVCLRYAANAEEAEDILQEGFIKVFKKIASFRREGSFEGWVRRIFVNTAIEHYRKKTYLQPITEHEEATVEGNYLSVLDDLAERDIIRLVQQLSPGYRTVFNMYVVEGYSHKQIAEQLGISEGTSKSQLSRAKLILQDLVKTFIEERKQMPEQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
5 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
187 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
188 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
189 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
190 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
191 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
192 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
193 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
194 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
195 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
223 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
224 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
243 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
244 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
245 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
246 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
247 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
248 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
249 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
250 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
251 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
252 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
253 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
254 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
255 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
256 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
257 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
258 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
259 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
260 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
261 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
262 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
263 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
264 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
265 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
270 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
271 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
272 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
273 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
274 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
275 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
284 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
285 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
286 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
287 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
288 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.23
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 1.03
Rhizosphere 97.48
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1199054 2162886007 Bacteria 1948
2 SwRhRL2b_contig_28926 2162886007 Bacteria 897
3 MRS1b_contig_8355847 2162886011 Bacteria 1416
4 MBSR1b_contig_7905469 2162886012 Bacteria 848
5 JGI24736J21556_1047717 3300001904 Unclassified 659
6 Ga0058861_11891156 3300004800 Bacteria 1260
7 Ga0065704_10071448 3300005289 Bacteria 11108
8 Ga0065704_10138584 3300005289 Bacteria 1542
9 Ga0065704_10171434 3300005289 Bacteria 1289
10 Ga0065707_10172329 3300005295 Unclassified 1475
11 Ga0070658_10011892 3300005327 Bacteria 6988
12 Ga0070658_10020900 3300005327 Bacteria 5243
13 Ga0070658_10209540 3300005327 Bacteria 1646
14 Ga0070658_10641434 3300005327 Unclassified 921
15 Ga0070676_10087371 3300005328 Bacteria 1903
16 Ga0070676_10872245 3300005328 Unclassified 669
17 Ga0070683_100049339 3300005329 Bacteria 3893
18 Ga0070683_100469526 3300005329 Bacteria 1201
19 Ga0070683_100704514 3300005329 Unclassified 967
20 Ga0070683_101016471 3300005329 Bacteria 796
21 Ga0070690_100213700 3300005330 Unclassified 1348
22 Ga0070670_100037728 3300005331 Bacteria 4156
23 Ga0070670_100039617 3300005331 Unclassified 4052
24 Ga0070670_100049340 3300005331 Bacteria 3619
25 Ga0070670_100055870 3300005331 Bacteria 3388
26 Ga0070670_100057150 3300005331 Unclassified 3350
27 Ga0070670_100290243 3300005331 Bacteria 1429
28 Ga0070670_100334288 3300005331 Unclassified 1329
29 Ga0070670_100394603 3300005331 Bacteria 1221
30 Ga0070677_10026061 3300005333 Unclassified 2189
31 Ga0070677_10196608 3300005333 Unclassified 970
32 Ga0068869_100011219 3300005334 Bacteria 5870
33 Ga0068869_100013854 3300005334 Bacteria 5375
34 Ga0068869_100036944 3300005334 Bacteria 3471
35 Ga0068869_100118802 3300005334 Bacteria 2019
36 Ga0068869_100134215 3300005334 Unclassified 1905
37 Ga0068869_100256730 3300005334 Bacteria 1398
38 Ga0070666_10000051 3300005335 Bacteria 99740
39 Ga0070666_10003560 3300005335 Bacteria 9444
40 Ga0070666_10278258 3300005335 Unclassified 1189
41 Ga0070680_100018651 3300005336 Bacteria 5486
42 Ga0070682_100731126 3300005337 Bacteria 797
43 Ga0068868_100002074 3300005338 Bacteria 13781
44 Ga0068868_100004561 3300005338 Bacteria 9724
45 Ga0068868_100040512 3300005338 Bacteria 3626
46 Ga0068868_100097882 3300005338 Bacteria 2371
47 Ga0068868_100105750 3300005338 Bacteria 2282
48 Ga0068868_100127203 3300005338 Unclassified 2082
49 Ga0068868_101492704 3300005338 Bacteria 633
50 Ga0070660_100016234 3300005339 Bacteria 5400
51 Ga0070660_100068070 3300005339 Bacteria 2775
52 Ga0070660_100077930 3300005339 Bacteria 2598
53 Ga0070660_100082873 3300005339 Bacteria 2519
54 Ga0070660_100490433 3300005339 Bacteria 1022
55 Ga0070660_101808317 3300005339 Unclassified 521
56 Ga0070689_100229204 3300005340 Bacteria 1526
57 Ga0070689_100303077 3300005340 Bacteria 1330
58 Ga0070691_10078453 3300005341 Unclassified 1613
59 Ga0070687_100025475 3300005343 Bacteria 2839
60 Ga0070687_100255316 3300005343 Bacteria 1091
61 Ga0070661_100004667 3300005344 Bacteria 9442
62 Ga0070661_100041040 3300005344 Bacteria 3376
63 Ga0070661_100058504 3300005344 Unclassified 2825
64 Ga0070661_100495832 3300005344 Bacteria 977
65 Ga0070661_100602337 3300005344 Bacteria 888
66 Ga0070668_100017512 3300005347 Bacteria 5372
67 Ga0070668_100094903 3300005347 Unclassified 2355
68 Ga0070668_100171175 3300005347 Bacteria 1768
69 Ga0070668_100389631 3300005347 Bacteria 1187
70 Ga0070668_100806979 3300005347 Unclassified 834
71 Ga0070669_100003262 3300005353 Bacteria 11656
72 Ga0070669_100046045 3300005353 Bacteria 3180
73 Ga0070669_100193469 3300005353 Unclassified 1597
74 Ga0070669_100284817 3300005353 Bacteria 1325
75 Ga0070669_101240856 3300005353 Bacteria 645
76 Ga0070675_100012636 3300005354 Bacteria 6623
77 Ga0070675_100061480 3300005354 Unclassified 3101
78 Ga0070675_100063469 3300005354 Bacteria 3054
79 Ga0070675_100096905 3300005354 Bacteria 2479
80 Ga0070675_100235142 3300005354 Bacteria 1600
81 Ga0070675_100394866 3300005354 Bacteria 1233
82 Ga0070671_100013288 3300005355 Bacteria 6637
83 Ga0070671_100032458 3300005355 Bacteria 4316
84 Ga0070671_100032943 3300005355 Bacteria 4283
85 Ga0070671_100079978 3300005355 Unclassified 2732
86 Ga0070671_100094736 3300005355 Bacteria 2503
87 Ga0070671_100299445 3300005355 Unclassified 1369
88 Ga0070671_100318774 3300005355 Unclassified 1325
89 Ga0070671_100547691 3300005355 Bacteria 997
90 Ga0070671_101161375 3300005355 Unclassified 679
91 Ga0070674_100058570 3300005356 Unclassified 2678
92 Ga0070674_100203187 3300005356 Bacteria 1531
93 Ga0070674_100348092 3300005356 Bacteria 1196
94 Ga0070674_100542404 3300005356 Bacteria 975
95 Ga0070673_100106373 3300005364 Unclassified 2319
96 Ga0070673_100146744 3300005364 Unclassified 1995
97 Ga0070673_100180695 3300005364 Bacteria 1806
98 Ga0070673_100222059 3300005364 Bacteria 1636
99 Ga0070673_100393138 3300005364 Bacteria 1238
100 Ga0070673_100397109 3300005364 Unclassified 1232
101 Ga0070673_100564948 3300005364 Unclassified 1035
102 Ga0070673_100581162 3300005364 Bacteria 1020
103 Ga0070673_100583868 3300005364 Bacteria 1018
104 Ga0070673_101249987 3300005364 Bacteria 697
105 Ga0070688_100012191 3300005365 Unclassified 4809
106 Ga0070688_100118925 3300005365 Bacteria 1767
107 Ga0070688_100500625 3300005365 Bacteria 916
108 Ga0070688_100516301 3300005365 Bacteria 903
109 Ga0070659_100003883 3300005366 Bacteria 10646
110 Ga0070659_100056690 3300005366 Bacteria 3089
111 Ga0070659_100147805 3300005366 Bacteria 1915
112 Ga0070659_100430203 3300005366 Bacteria 1117
113 Ga0070659_101401478 3300005366 Bacteria 621
114 Ga0070667_100054486 3300005367 Bacteria 3377
115 Ga0070667_100114151 3300005367 Unclassified 2345
116 Ga0070667_100126539 3300005367 Bacteria 2227
117 Ga0070667_100160204 3300005367 Bacteria 1982
118 Ga0070667_100182203 3300005367 Bacteria 1858
119 Ga0070667_100526854 3300005367 Bacteria 1085
120 Ga0070701_10084495 3300005438 Unclassified 1726
121 Ga0070701_10916206 3300005438 Bacteria 606
122 Ga0070700_100235515 3300005441 Bacteria 1305
123 Ga0070663_100019473 3300005455 Bacteria 4474
124 Ga0070663_100185529 3300005455 Bacteria 1616
125 Ga0070663_100415687 3300005455 Bacteria 1102
126 Ga0070678_100013606 3300005456 Bacteria 5110
127 Ga0070678_100101316 3300005456 Bacteria 2232
128 Ga0070678_100143461 3300005456 Bacteria 1914
129 Ga0070678_100275646 3300005456 Bacteria 1420
130 Ga0070678_100322916 3300005456 Bacteria 1319
131 Ga0070678_100366314 3300005456 Bacteria 1243
132 Ga0070678_100992017 3300005456 Unclassified 772
133 Ga0070662_100020483 3300005457 Bacteria 4504
134 Ga0070662_100118047 3300005457 Unclassified 2030
135 Ga0070662_100125200 3300005457 Bacteria 1975
136 Ga0070662_100142343 3300005457 Bacteria 1860
137 Ga0070662_101163925 3300005457 Unclassified 662
138 Ga0070681_10044182 3300005458 Bacteria 4459
139 Ga0070681_10101100 3300005458 Bacteria 2828
140 Ga0070681_10503220 3300005458 Bacteria 1125
141 Ga0068867_100015945 3300005459 Bacteria 5334
142 Ga0068867_100033559 3300005459 Unclassified 3718
143 Ga0068867_100124423 3300005459 Bacteria 1997
144 Ga0068867_100143553 3300005459 Bacteria 1868
145 Ga0068867_100366603 3300005459 Bacteria 1206
146 Ga0068867_100455016 3300005459 Bacteria 1091
147 Ga0068867_100555118 3300005459 Bacteria 995
148 Ga0068867_100588509 3300005459 Bacteria 969
149 Ga0068867_100903095 3300005459 Bacteria 795
150 Ga0070685_10040628 3300005466 Unclassified 2647
151 Ga0070685_10046540 3300005466 Bacteria 2491
152 Ga0070685_10362288 3300005466 Unclassified 994
153 Ga0070679_100005880 3300005530 Bacteria 11395
154 Ga0070679_100117451 3300005530 Bacteria 2645
155 Ga0070679_100277671 3300005530 Bacteria 1628
156 Ga0070684_100000732 3300005535 Bacteria 22748
157 Ga0070684_100057871 3300005535 Unclassified 3386
158 Ga0070684_100063983 3300005535 Bacteria 3226
159 Ga0068853_100046316 3300005539 Bacteria 3729
160 Ga0068853_100122865 3300005539 Unclassified 2318
161 Ga0068853_100186815 3300005539 Bacteria 1881
162 Ga0068853_100387618 3300005539 Bacteria 1306
163 Ga0068853_100390725 3300005539 Bacteria 1301
164 Ga0068853_101198371 3300005539 Bacteria 733
165 Ga0068853_101497357 3300005539 Unclassified 653
166 Ga0070672_100036985 3300005543 Bacteria 3723
167 Ga0070672_100048558 3300005543 Unclassified 3299
168 Ga0070672_100073133 3300005543 Bacteria 2731
169 Ga0070672_100106244 3300005543 Bacteria 2284
170 Ga0070672_100186840 3300005543 Bacteria 1729
171 Ga0070672_100207449 3300005543 Bacteria 1640
172 Ga0070672_100375370 3300005543 Unclassified 1216
173 Ga0070686_100029033 3300005544 Bacteria 3360
174 Ga0070695_100968699 3300005545 Bacteria 690
175 Ga0070693_100012847 3300005547 Bacteria 4250
176 Ga0070693_100222468 3300005547 Bacteria 1237
177 Ga0070665_100071523 3300005548 Unclassified 3475
178 Ga0070665_100299126 3300005548 Bacteria 1612
179 Ga0070665_100488123 3300005548 Bacteria 1243
180 Ga0068855_100008437 3300005563 Bacteria 12460
181 Ga0068855_100011433 3300005563 Bacteria 10723
182 Ga0068855_100171998 3300005563 Bacteria 2453
183 Ga0068855_100203638 3300005563 Bacteria 2227
184 Ga0068855_100736791 3300005563 Bacteria 1052
185 Ga0068855_101214540 3300005563 Bacteria 783
186 Ga0070664_100004812 3300005564 Bacteria 10817
187 Ga0070664_100005353 3300005564 Bacteria 10299
188 Ga0070664_100089884 3300005564 Unclassified 2657
189 Ga0070664_100105796 3300005564 Unclassified 2451
190 Ga0070664_100147599 3300005564 Bacteria 2075
191 Ga0070664_100346932 3300005564 Bacteria 1349
192 Ga0070664_100427738 3300005564 Bacteria 1213
193 Ga0070664_100452177 3300005564 Bacteria 1179
194 Ga0068857_100015051 3300005577 Bacteria 6750
195 Ga0068857_100046477 3300005577 Bacteria 3852
196 Ga0068857_100089903 3300005577 Bacteria 2748
197 Ga0068857_100100738 3300005577 Bacteria 2591
198 Ga0068857_100183014 3300005577 Bacteria 1907
199 Ga0068857_100298459 3300005577 Bacteria 1485
200 Ga0068857_100323166 3300005577 Unclassified 1425
201 Ga0068857_100646114 3300005577 Bacteria 1002
202 Ga0068854_100275873 3300005578 Bacteria 1352
203 Ga0068854_100328888 3300005578 Bacteria 1245
204 Ga0068854_100495251 3300005578 Bacteria 1028
205 Ga0068854_100744697 3300005578 Bacteria 850
206 Ga0068856_100066740 3300005614 Unclassified 3555
207 Ga0068856_100292744 3300005614 Unclassified 1645
208 Ga0068856_100359274 3300005614 Bacteria 1475
209 Ga0070702_100017096 3300005615 Unclassified 3735
210 Ga0070702_100070832 3300005615 Unclassified 2059
211 Ga0068852_100030388 3300005616 Unclassified 4446
212 Ga0068852_100085281 3300005616 Unclassified 2813
213 Ga0068852_100087517 3300005616 Unclassified 2780
214 Ga0068852_100168494 3300005616 Bacteria 2051
215 Ga0068852_100270575 3300005616 Bacteria 1635
216 Ga0068852_100460814 3300005616 Bacteria 1260
217 Ga0068852_100945341 3300005616 Bacteria 880
218 Ga0068859_100000023 3300005617 Bacteria 221914
219 Ga0068859_100002585 3300005617 Bacteria 18417
220 Ga0068859_100031954 3300005617 Bacteria 5288
221 Ga0068859_100050459 3300005617 Unclassified 4179
222 Ga0068859_100126744 3300005617 Unclassified 2622
223 Ga0068859_100130686 3300005617 Unclassified 2582
224 Ga0068859_100396636 3300005617 Unclassified 1476
225 Ga0068864_100006376 3300005618 Bacteria 9670
226 Ga0068864_100011486 3300005618 Bacteria 7315
227 Ga0068864_100015347 3300005618 Bacteria 6368
228 Ga0068864_100336826 3300005618 Unclassified 1421
229 Ga0068866_10014659 3300005718 Bacteria 3467
230 Ga0068866_10036931 3300005718 Unclassified 2396
231 Ga0068866_10099942 3300005718 Unclassified 1598
232 Ga0068866_10184746 3300005718 Bacteria 1234
233 Ga0068866_10390936 3300005718 Bacteria 894
234 Ga0068866_10487158 3300005718 Bacteria 813
235 Ga0068866_10607443 3300005718 Bacteria 739
236 Ga0068861_100003939 3300005719 Bacteria 9929
237 Ga0068861_100066558 3300005719 Bacteria 2778
238 Ga0068861_100069663 3300005719 Bacteria 2722
239 Ga0068861_100194982 3300005719 Unclassified 1696
240 Ga0068861_100239966 3300005719 Bacteria 1541
241 Ga0068861_100426056 3300005719 Bacteria 1183
242 Ga0068861_101432993 3300005719 Unclassified 676
243 Ga0068851_10043901 3300005834 Bacteria 2254
244 Ga0068851_10047482 3300005834 Unclassified 2175
245 Ga0068851_10520687 3300005834 Unclassified 715
246 Ga0068870_10020219 3300005840 Unclassified 3238
247 Ga0068870_10025829 3300005840 Bacteria 2921
248 Ga0068870_10247206 3300005840 Bacteria 1104
249 Ga0068870_10372162 3300005840 Bacteria 922
250 Ga0068870_10539470 3300005840 Unclassified 784
251 Ga0068863_100009644 3300005841 Bacteria 9420
252 Ga0068863_100014587 3300005841 Bacteria 7565
253 Ga0068863_100035327 3300005841 Bacteria 4761
254 Ga0068863_100088765 3300005841 Bacteria 2931
255 Ga0068863_100110665 3300005841 Unclassified 2616
256 Ga0068858_100023286 3300005842 Bacteria 5771
257 Ga0068858_100192007 3300005842 Bacteria 1930
258 Ga0068858_100286764 3300005842 Bacteria 1568
259 Ga0068858_100377487 3300005842 Bacteria 1360
260 Ga0068860_100001475 3300005843 Bacteria 25414
261 Ga0068860_100011162 3300005843 Bacteria 8853
262 Ga0068860_100049889 3300005843 Bacteria 3986
263 Ga0068860_100113037 3300005843 Bacteria 2596
264 Ga0068860_100225752 3300005843 Bacteria 1819
265 Ga0068860_100305483 3300005843 Bacteria 1559
266 Ga0068860_100736682 3300005843 Bacteria 997
267 Ga0068860_101101616 3300005843 Bacteria 813
268 Ga0068862_100017333 3300005844 Bacteria 5996
269 Ga0068862_100145146 3300005844 Unclassified 2109
270 Ga0068862_100176206 3300005844 Unclassified 1917
271 Ga0068862_100606771 3300005844 Unclassified 1051
272 Ga0068862_100854413 3300005844 Bacteria 892
273 Ga0068862_101262635 3300005844 Bacteria 739
274 Ga0075366_10027426 3300006195 Unclassified 3341
275 Ga0097621_100000423 3300006237 Bacteria 29421
276 Ga0097621_100022999 3300006237 Bacteria 4846
277 Ga0097621_100657470 3300006237 Unclassified 962
278 Ga0068871_100000604 3300006358 Bacteria 24668
279 Ga0068871_100075398 3300006358 Unclassified 2784
280 Ga0068871_100093572 3300006358 Bacteria 2508
281 Ga0068871_100232950 3300006358 Bacteria 1599
282 Ga0068871_100240891 3300006358 Bacteria 1572
283 Ga0075428_101118287 3300006844 Bacteria 832
284 Ga0075429_100346297 3300006880 Bacteria 1301
285 Ga0068865_100017686 3300006881 Bacteria 4589
286 Ga0068865_100080247 3300006881 Bacteria 2339
287 Ga0068865_100682176 3300006881 Bacteria 876
288 Ga0097620_100000023 3300006931 Bacteria 221914
289 Ga0097620_100000575 3300006931 Bacteria 36670
290 Ga0097620_100002585 3300006931 Bacteria 18417
291 Ga0097620_100031954 3300006931 Bacteria 5288
292 Ga0097620_100050465 3300006931 Unclassified 4179
293 Ga0097620_100126756 3300006931 Unclassified 2622
294 Ga0097620_100130682 3300006931 Unclassified 2582
295 Ga0097620_100383935 3300006931 Bacteria 1500
296 Ga0097620_100396666 3300006931 Unclassified 1476
297 Ga0105240_10058540 3300009093 Bacteria 4810
298 Ga0111539_10021610 3300009094 Bacteria 7915
299 Ga0111539_10139259 3300009094 Bacteria 2841
300 Ga0105245_10523827 3300009098 Unclassified 1204
301 Ga0105247_10004502 3300009101 Bacteria 8890
302 Ga0105243_11300555 3300009148 Bacteria 744
303 Ga0105241_10085795 3300009174 Bacteria 2475
304 Ga0105241_10226034 3300009174 Bacteria 1576
305 Ga0105241_11275136 3300009174 Bacteria 699
306 Ga0105242_10035787 3300009176 Unclassified 3981
307 Ga0105242_10066827 3300009176 Bacteria 2970
308 Ga0105242_10220729 3300009176 Bacteria 1694
309 Ga0105242_10224991 3300009176 Bacteria 1679
310 Ga0105248_10035159 3300009177 Bacteria 5606
311 Ga0105248_10980683 3300009177 Bacteria 955
312 Ga0105237_10049418 3300009545 Bacteria 4228
313 Ga0105249_10000806 3300009553 Bacteria 28220
314 Ga0105249_10103410 3300009553 Bacteria 2682
315 Ga0105249_10381130 3300009553 Bacteria 1436
316 Ga0105239_10211325 3300010375 Bacteria 2175
317 Ga0157319_1002218 3300012497 Bacteria 1095
318 Ga0157373_10020816 3300013100 Bacteria 4762
319 Ga0157373_10028779 3300013100 Bacteria 4007
320 Ga0157373_10047594 3300013100 Bacteria 3058
321 Ga0157373_10083164 3300013100 Bacteria 2256
322 Ga0157373_10122072 3300013100 Bacteria 1831
323 Ga0157371_10000284 3300013102 Bacteria 68549
324 Ga0157371_10000924 3300013102 Bacteria 32978
325 Ga0157371_10003533 3300013102 Bacteria 14106
326 Ga0157371_10004001 3300013102 Bacteria 13061
327 Ga0157371_10022893 3300013102 Bacteria 4570
328 Ga0157371_10035665 3300013102 Unclassified 3564
329 Ga0157371_10042494 3300013102 Bacteria 3239
330 Ga0157371_10047902 3300013102 Unclassified 3038
331 Ga0157371_10047990 3300013102 Bacteria 3035
332 Ga0157371_10050384 3300013102 Bacteria 2959
333 Ga0157371_10140953 3300013102 Bacteria 1717
334 Ga0157371_10361980 3300013102 Bacteria 1057
335 Ga0157370_10003733 3300013104 Bacteria 17802
336 Ga0157370_10004338 3300013104 Bacteria 16292
337 Ga0157370_10009105 3300013104 Bacteria 10650
338 Ga0157370_10023600 3300013104 Bacteria 6105
339 Ga0157370_10063719 3300013104 Bacteria 3491
340 Ga0157370_10070410 3300013104 Bacteria 3301
341 Ga0157370_10140422 3300013104 Bacteria 2251
342 Ga0157370_10359894 3300013104 Bacteria 1341
343 Ga0157370_10387855 3300013104 Bacteria 1286
344 Ga0157370_10415630 3300013104 Bacteria 1238
345 Ga0157370_10572744 3300013104 Bacteria 1035
346 Ga0157370_10902020 3300013104 Bacteria 802
347 Ga0157370_10903421 3300013104 Bacteria 801
348 Ga0157369_10019696 3300013105 Bacteria 7552
349 Ga0157369_10037231 3300013105 Bacteria 5326
350 Ga0157369_10157991 3300013105 Bacteria 2394
351 Ga0157369_10241722 3300013105 Bacteria 1886
352 Ga0157369_10478167 3300013105 Bacteria 1289
353 Ga0157369_10777074 3300013105 Bacteria 985
354 Ga0157369_10920836 3300013105 Bacteria 896
355 Ga0157369_10947998 3300013105 Bacteria 882
356 Ga0157374_10001939 3300013296 Bacteria 17348
357 Ga0157374_10088226 3300013296 Unclassified 2954
358 Ga0157374_10365741 3300013296 Bacteria 1435
359 Ga0157374_10661838 3300013296 Bacteria 1056
360 Ga0157374_10934347 3300013296 Bacteria 885
361 Ga0157378_10002625 3300013297 Bacteria 16007
362 Ga0157378_10011662 3300013297 Bacteria 7692
363 Ga0157378_10067120 3300013297 Bacteria 3214
364 Ga0157378_10071982 3300013297 Unclassified 3105
365 Ga0157378_10135010 3300013297 Unclassified 2287
366 Ga0157378_10260607 3300013297 Bacteria 1663
367 Ga0157378_10372245 3300013297 Unclassified 1401
368 Ga0157378_10635436 3300013297 Bacteria 1082
369 Ga0157378_11005930 3300013297 Unclassified 868
370 Ga0163162_10000114 3300013306 Bacteria 71183
371 Ga0163162_10001189 3300013306 Bacteria 24282
372 Ga0163162_10001642 3300013306 Bacteria 20968
373 Ga0163162_10032258 3300013306 Bacteria 5201
374 Ga0163162_10098560 3300013306 Bacteria 3012
375 Ga0163162_10248162 3300013306 Unclassified 1912
376 Ga0163162_10521440 3300013306 Bacteria 1318
377 Ga0157372_10008876 3300013307 Bacteria 10676
378 Ga0157372_10023602 3300013307 Bacteria 6671
379 Ga0157372_10024383 3300013307 Bacteria 6570
380 Ga0157372_10048241 3300013307 Bacteria 4734
381 Ga0157372_10057098 3300013307 Bacteria 4363
382 Ga0157372_10066227 3300013307 Bacteria 4058
383 Ga0157372_10089423 3300013307 Bacteria 3499
384 Ga0157372_10222694 3300013307 Bacteria 2187
385 Ga0157372_10231472 3300013307 Bacteria 2142
386 Ga0157372_10266213 3300013307 Bacteria 1990
387 Ga0157372_10392178 3300013307 Bacteria 1618
388 Ga0157372_10410440 3300013307 Bacteria 1578
389 Ga0157372_10468944 3300013307 Bacteria 1467
390 Ga0157372_10618024 3300013307 Bacteria 1263
391 Ga0157372_10710485 3300013307 Bacteria 1169
392 Ga0157372_10833691 3300013307 Unclassified 1071
393 Ga0157375_10025511 3300013308 Bacteria 5494
394 Ga0157375_10063866 3300013308 Bacteria 3665
395 Ga0157375_10072650 3300013308 Unclassified 3458
396 Ga0157375_10089651 3300013308 Unclassified 3132
397 Ga0157375_10142569 3300013308 Bacteria 2524
398 Ga0157375_10177729 3300013308 Bacteria 2279
399 Ga0157375_10351754 3300013308 Unclassified 1639
400 Ga0157375_11423448 3300013308 Bacteria 817
401 Ga0163163_10001283 3300014325 Bacteria 21227
402 Ga0163163_10002242 3300014325 Bacteria 16284
403 Ga0163163_10071200 3300014325 Bacteria 3464
404 Ga0163163_10074115 3300014325 Bacteria 3395
405 Ga0163163_10305715 3300014325 Bacteria 1643
406 Ga0163163_10392545 3300014325 Bacteria 1446
407 Ga0163163_10447627 3300014325 Bacteria 1351
408 Ga0163163_10549615 3300014325 Bacteria 1217
409 Ga0163163_10643555 3300014325 Bacteria 1124
410 Ga0163163_11319007 3300014325 Unclassified 784
411 Ga0157380_10043776 3300014326 Bacteria 3506
412 Ga0157380_10387092 3300014326 Bacteria 1322
413 Ga0157380_10788288 3300014326 Bacteria 966
414 Ga0182008_10067865 3300014497 Bacteria 1755
415 Ga0157377_10010475 3300014745 Unclassified 4587
416 Ga0157377_10019607 3300014745 Bacteria 3534
417 Ga0157377_10110006 3300014745 Bacteria 1655
418 Ga0157379_10033404 3300014968 Bacteria 4588
419 Ga0157379_10183882 3300014968 Unclassified 1888
420 Ga0157379_10328993 3300014968 Bacteria 1396
421 Ga0157379_10384706 3300014968 Unclassified 1288
422 Ga0157379_10634104 3300014968 Unclassified 999
423 Ga0157376_10001023 3300014969 Bacteria 18258
424 Ga0157376_10048312 3300014969 Bacteria 3518
425 Ga0157376_10388211 3300014969 Bacteria 1347
426 Ga0157376_10499859 3300014969 Unclassified 1195
427 Ga0157376_11220972 3300014969 Unclassified 780
428 Ga0182006_1034846 3300015261 Bacteria 2011
429 Ga0163161_10001357 3300017792 Bacteria 18206
430 Ga0163161_10002438 3300017792 Bacteria 13288
431 Ga0163161_10011682 3300017792 Bacteria 6093
432 Ga0163161_10012045 3300017792 Bacteria 5998
433 Ga0163161_10042073 3300017792 Bacteria 3285
434 Ga0163161_11196101 3300017792 Bacteria 657
435 Ga0207697_10217459 3300025315 Bacteria 843
436 Ga0207697_10329511 3300025315 Bacteria 678
437 Ga0207656_10014573 3300025321 Unclassified 3032
438 Ga0207656_10030148 3300025321 Bacteria 2239
439 Ga0207642_10010313 3300025899 Unclassified 3289
440 Ga0207642_10317422 3300025899 Bacteria 909
441 Ga0207642_10376537 3300025899 Unclassified 844
442 Ga0207688_10008415 3300025901 Bacteria 5610
443 Ga0207680_10000856 3300025903 Bacteria 14358
444 Ga0207680_10085235 3300025903 Unclassified 1995
445 Ga0207680_10091324 3300025903 Unclassified 1937
446 Ga0207680_10135237 3300025903 Unclassified 1628
447 Ga0207647_10000110 3300025904 Bacteria 62980
448 Ga0207647_10022580 3300025904 Bacteria 4176
449 Ga0207647_10052196 3300025904 Bacteria 2524
450 Ga0207647_10475246 3300025904 Bacteria 699
451 Ga0207645_10010260 3300025907 Bacteria 6436
452 Ga0207645_10014403 3300025907 Bacteria 5290
453 Ga0207645_10069140 3300025907 Bacteria 2259
454 Ga0207645_10170420 3300025907 Bacteria 1427
455 Ga0207643_10043706 3300025908 Bacteria 2529
456 Ga0207643_10151961 3300025908 Unclassified 1388
457 Ga0207643_10318655 3300025908 Unclassified 971
458 Ga0207705_10018149 3300025909 Bacteria 5030
459 Ga0207705_10055977 3300025909 Bacteria 2843
460 Ga0207705_10066453 3300025909 Bacteria 2608
461 Ga0207705_10090663 3300025909 Bacteria 2238
462 Ga0207705_10159460 3300025909 Bacteria 1694
463 Ga0207705_10588882 3300025909 Bacteria 865
464 Ga0207654_10001756 3300025911 Bacteria 11258
465 Ga0207654_10260197 3300025911 Bacteria 1166
466 Ga0207707_10020922 3300025912 Bacteria 5715
467 Ga0207707_10192723 3300025912 Bacteria 1778
468 Ga0207707_10252815 3300025912 Bacteria 1530
469 Ga0207707_10318694 3300025912 Bacteria 1343
470 Ga0207695_10006992 3300025913 Bacteria 14485
471 Ga0207671_10001442 3300025914 Bacteria 27518
472 Ga0207671_10259093 3300025914 Bacteria 1368
473 Ga0207660_10021291 3300025917 Bacteria 4359
474 Ga0207660_10043002 3300025917 Bacteria 3173
475 Ga0207660_10582456 3300025917 Bacteria 911
476 Ga0207662_10112363 3300025918 Bacteria 1700
477 Ga0207662_10511580 3300025918 Bacteria 828
478 Ga0207662_10517268 3300025918 Bacteria 823
479 Ga0207657_10027646 3300025919 Bacteria 5191
480 Ga0207657_10059391 3300025919 Bacteria 3285
481 Ga0207657_10074029 3300025919 Bacteria 2877
482 Ga0207657_10074404 3300025919 Bacteria 2869
483 Ga0207657_10124769 3300025919 Unclassified 2115
484 Ga0207657_10196162 3300025919 Bacteria 1626
485 Ga0207649_10250216 3300025920 Unclassified 1276
486 Ga0207649_10389698 3300025920 Bacteria 1040
487 Ga0207649_10691628 3300025920 Unclassified 790
488 Ga0207652_10000166 3300025921 Bacteria 71226
489 Ga0207652_10001364 3300025921 Bacteria 21700
490 Ga0207652_10010361 3300025921 Bacteria 7506
491 Ga0207652_10061630 3300025921 Bacteria 3239
492 Ga0207681_10009947 3300025923 Bacteria 5822
493 Ga0207681_10019146 3300025923 Bacteria 4322
494 Ga0207681_10049173 3300025923 Bacteria 2849
495 Ga0207681_10281337 3300025923 Bacteria 1310
496 Ga0207681_10391847 3300025923 Bacteria 1120
497 Ga0207650_10004016 3300025925 Bacteria 10066
498 Ga0207650_10040561 3300025925 Bacteria 3407
499 Ga0207650_10365833 3300025925 Bacteria 1189
500 Ga0207650_10372325 3300025925 Bacteria 1178
501 Ga0207650_10391652 3300025925 Bacteria 1149
502 Ga0207650_10501190 3300025925 Bacteria 1015
503 Ga0207650_10846692 3300025925 Bacteria 776
504 Ga0207659_10003079 3300025926 Bacteria 9954
505 Ga0207659_10032494 3300025926 Bacteria 3583
506 Ga0207659_10049413 3300025926 Unclassified 2984
507 Ga0207659_10077068 3300025926 Bacteria 2453
508 Ga0207659_10194089 3300025926 Unclassified 1617
509 Ga0207659_10227153 3300025926 Bacteria 1504
510 Ga0207659_11092514 3300025926 Unclassified 686
511 Ga0207664_10777185 3300025929 Bacteria 861
512 Ga0207644_10015867 3300025931 Bacteria 5065
513 Ga0207644_10051317 3300025931 Unclassified 2960
514 Ga0207690_10015683 3300025932 Bacteria 4597
515 Ga0207690_10618407 3300025932 Bacteria 885
516 Ga0207706_10024969 3300025933 Bacteria 5358
517 Ga0207706_10120722 3300025933 Unclassified 2304
518 Ga0207686_10014735 3300025934 Bacteria 4361
519 Ga0207686_10030283 3300025934 Unclassified 3202
520 Ga0207686_10051345 3300025934 Bacteria 2568
521 Ga0207686_10192960 3300025934 Bacteria 1453
522 Ga0207686_10408973 3300025934 Bacteria 1035
523 Ga0207686_10554792 3300025934 Bacteria 899
524 Ga0207686_10889765 3300025934 Bacteria 718
525 Ga0207709_10284760 3300025935 Bacteria 1222
526 Ga0207670_10033313 3300025936 Bacteria 3319
527 Ga0207669_10011405 3300025937 Unclassified 4323
528 Ga0207669_10030753 3300025937 Bacteria 2988
529 Ga0207669_10152439 3300025937 Bacteria 1621
530 Ga0207669_10417488 3300025937 Unclassified 1055
531 Ga0207704_10019095 3300025938 Bacteria 3594
532 Ga0207704_11227896 3300025938 Bacteria 640
533 Ga0207691_10001792 3300025940 Bacteria 21130
534 Ga0207691_10058045 3300025940 Unclassified 3520
535 Ga0207691_10086186 3300025940 Bacteria 2818
536 Ga0207691_10158185 3300025940 Unclassified 1989
537 Ga0207691_10168614 3300025940 Bacteria 1918
538 Ga0207691_10343321 3300025940 Unclassified 1278
539 Ga0207691_10346426 3300025940 Bacteria 1271
540 Ga0207691_10457333 3300025940 Bacteria 1086
541 Ga0207691_11189802 3300025940 Bacteria 632
542 Ga0207689_10002648 3300025942 Bacteria 16557
543 Ga0207689_10002715 3300025942 Bacteria 16372
544 Ga0207689_10002890 3300025942 Bacteria 15844
545 Ga0207689_10006627 3300025942 Bacteria 10214
546 Ga0207689_10036976 3300025942 Unclassified 4052
547 Ga0207689_10194435 3300025942 Unclassified 1674
548 Ga0207689_10447171 3300025942 Bacteria 1080
549 Ga0207689_10563100 3300025942 Unclassified 958
550 Ga0207661_10009619 3300025944 Bacteria 6939
551 Ga0207661_10048003 3300025944 Bacteria 3391
552 Ga0207661_10176797 3300025944 Bacteria 1862
553 Ga0207661_10929646 3300025944 Bacteria 801
554 Ga0207679_10008767 3300025945 Bacteria 6452
555 Ga0207679_10020432 3300025945 Bacteria 4469
556 Ga0207679_10024202 3300025945 Bacteria 4162
557 Ga0207679_10038291 3300025945 Bacteria 3415
558 Ga0207679_10086137 3300025945 Bacteria 2415
559 Ga0207679_10246651 3300025945 Bacteria 1516
560 Ga0207679_10851736 3300025945 Bacteria 832
561 Ga0207667_10001454 3300025949 Bacteria 29736
562 Ga0207667_10016511 3300025949 Bacteria 8339
563 Ga0207667_10070704 3300025949 Bacteria 3632
564 Ga0207667_10178873 3300025949 Bacteria 2179
565 Ga0207651_10000351 3300025960 Bacteria 19522
566 Ga0207651_10034932 3300025960 Bacteria 3262
567 Ga0207651_10132577 3300025960 Unclassified 1910
568 Ga0207651_10338911 3300025960 Bacteria 1262
569 Ga0207712_10003480 3300025961 Bacteria 9939
570 Ga0207712_10007969 3300025961 Bacteria 6696
571 Ga0207712_10043635 3300025961 Unclassified 3094
572 Ga0207712_10223943 3300025961 Bacteria 1505
573 Ga0207712_10336280 3300025961 Bacteria 1251
574 Ga0207712_10349105 3300025961 Bacteria 1229
575 Ga0207712_11223553 3300025961 Bacteria 670
576 Ga0207668_10038727 3300025972 Unclassified 3203
577 Ga0207668_10126240 3300025972 Bacteria 1946
578 Ga0207668_10345595 3300025972 Unclassified 1242
579 Ga0207668_10351034 3300025972 Bacteria 1233
580 Ga0207668_10491120 3300025972 Unclassified 1054
581 Ga0207640_10247117 3300025981 Bacteria 1382
582 Ga0207640_10352041 3300025981 Bacteria 1184
583 Ga0207640_10442930 3300025981 Bacteria 1068
584 Ga0207640_10890056 3300025981 Bacteria 777
585 Ga0207640_11185071 3300025981 Bacteria 679
586 Ga0207658_10016630 3300025986 Bacteria 5063
587 Ga0207658_10073893 3300025986 Unclassified 2589
588 Ga0207658_10291639 3300025986 Bacteria 1402
589 Ga0207658_10423335 3300025986 Bacteria 1174
590 Ga0207658_10561782 3300025986 Bacteria 1022
591 Ga0207658_10943740 3300025986 Bacteria 786
592 Ga0207677_10026970 3300026023 Bacteria 3610
593 Ga0207677_10057954 3300026023 Unclassified 2663
594 Ga0207677_10223694 3300026023 Bacteria 1511
595 Ga0207677_10240672 3300026023 Bacteria 1464
596 Ga0207703_10018796 3300026035 Bacteria 5396
597 Ga0207703_10036946 3300026035 Bacteria 3890
598 Ga0207703_10049308 3300026035 Unclassified 3404
599 Ga0207703_10264218 3300026035 Bacteria 1556
600 Ga0207703_10309259 3300026035 Bacteria 1444
601 Ga0207703_10670431 3300026035 Bacteria 985
602 Ga0207639_10082245 3300026041 Bacteria 2552
603 Ga0207639_10086848 3300026041 Bacteria 2492
604 Ga0207639_10312432 3300026041 Unclassified 1393
605 Ga0207639_10400412 3300026041 Unclassified 1236
606 Ga0207639_10423906 3300026041 Bacteria 1203
607 Ga0207639_10830612 3300026041 Unclassified 862
608 Ga0207639_11380017 3300026041 Bacteria 661
609 Ga0207639_11414216 3300026041 Unclassified 653
610 Ga0207678_10007975 3300026067 Bacteria 9336
611 Ga0207678_10040991 3300026067 Bacteria 4014
612 Ga0207678_10274646 3300026067 Bacteria 1446
613 Ga0207678_10443545 3300026067 Bacteria 1127
614 Ga0207708_10063911 3300026075 Bacteria 2812
615 Ga0207708_10150719 3300026075 Bacteria 1830
616 Ga0207708_10210475 3300026075 Bacteria 1554
617 Ga0207702_10041800 3300026078 Bacteria 3844
618 Ga0207702_10263629 3300026078 Bacteria 1623
619 Ga0207702_10619623 3300026078 Bacteria 1063
620 Ga0207702_10687921 3300026078 Bacteria 1007
621 Ga0207641_10000202 3300026088 Bacteria 79668
622 Ga0207641_10021731 3300026088 Bacteria 5274
623 Ga0207641_10183973 3300026088 Bacteria 1916
624 Ga0207641_10204350 3300026088 Unclassified 1823
625 Ga0207641_10264392 3300026088 Bacteria 1612
626 Ga0207641_10380691 3300026088 Unclassified 1351
627 Ga0207648_10001834 3300026089 Bacteria 23247
628 Ga0207648_10036103 3300026089 Unclassified 4354
629 Ga0207648_10038845 3300026089 Bacteria 4188
630 Ga0207648_10045161 3300026089 Bacteria 3865
631 Ga0207648_10045942 3300026089 Bacteria 3829
632 Ga0207648_10066057 3300026089 Bacteria 3154
633 Ga0207648_10067278 3300026089 Bacteria 3124
634 Ga0207648_10207638 3300026089 Unclassified 1738
635 Ga0207648_10208913 3300026089 Bacteria 1732
636 Ga0207648_10823521 3300026089 Bacteria 865
637 Ga0207676_10042150 3300026095 Unclassified 3509
638 Ga0207676_10058964 3300026095 Unclassified 3030
639 Ga0207676_10094165 3300026095 Bacteria 2467
640 Ga0207676_10120008 3300026095 Bacteria 2215
641 Ga0207676_10773408 3300026095 Bacteria 935
642 Ga0207674_10010080 3300026116 Bacteria 10745
643 Ga0207674_10029331 3300026116 Bacteria 5792
644 Ga0207674_10040613 3300026116 Bacteria 4818
645 Ga0207674_10058037 3300026116 Bacteria 3923
646 Ga0207674_10065653 3300026116 Bacteria 3657
647 Ga0207674_10210214 3300026116 Bacteria 1895
648 Ga0207674_10434719 3300026116 Unclassified 1268
649 Ga0207674_10533882 3300026116 Bacteria 1133
650 Ga0207674_10738556 3300026116 Unclassified 950
651 Ga0207675_100001207 3300026118 Bacteria 25729
652 Ga0207675_100086651 3300026118 Bacteria 2941
653 Ga0207675_100192852 3300026118 Unclassified 1955
654 Ga0207675_100337527 3300026118 Bacteria 1475
655 Ga0207675_100444784 3300026118 Bacteria 1283
656 Ga0207675_101676701 3300026118 Bacteria 656
657 Ga0207683_10004024 3300026121 Bacteria 12713
658 Ga0207683_10074567 3300026121 Bacteria 3002
659 Ga0207683_10080331 3300026121 Bacteria 2893
660 Ga0207683_10132662 3300026121 Unclassified 2241
661 Ga0207683_10402780 3300026121 Bacteria 1259
662 Ga0207683_10992926 3300026121 Bacteria 779
663 Ga0207698_10026514 3300026142 Bacteria 4100
664 Ga0207698_10099782 3300026142 Bacteria 2403
665 Ga0207698_10197244 3300026142 Bacteria 1799
666 Ga0207698_10475079 3300026142 Bacteria 1212
667 Ga0207698_10496139 3300026142 Unclassified 1187
668 Ga0207698_10805720 3300026142 Bacteria 942
669 Ga0209968_1029266 3300027526 Bacteria 917
670 Ga0209999_1019113 3300027543 Bacteria 1255
671 Ga0210002_1001946 3300027617 Bacteria 2963
672 Ga0209974_10005287 3300027876 Bacteria 4555
673 Ga0207428_10281497 3300027907 Bacteria 1234
674 Ga0268266_10352900 3300028379 Bacteria 1382
675 Ga0268265_10101182 3300028380 Bacteria 2328
676 Ga0268265_10123415 3300028380 Unclassified 2138
677 Ga0268265_10394202 3300028380 Unclassified 1278
678 Ga0268265_11042494 3300028380 Bacteria 810
679 Ga0268264_10001369 3300028381 Bacteria 22810
680 Ga0268264_10004843 3300028381 Bacteria 11406
681 Ga0268264_10101627 3300028381 Bacteria 2500
682 Ga0268264_10128103 3300028381 Unclassified 2246
683 Ga0268264_10403632 3300028381 Bacteria 1314
684 Ga0268264_10433617 3300028381 Unclassified 1270
685 Ga0268264_10686834 3300028381 Unclassified 1016
686 Ga0268264_10938486 3300028381 Bacteria 870
687 Ga0268264_11069079 3300028381 Bacteria 815
688 Ga0268264_11282530 3300028381 Unclassified 742
689 Ga0307515_10000076 3300028794 Bacteria 228736
690 Ga0265338_10004606 3300028800 Bacteria 18534
691 Ga0307408_100034097 3300031548 Bacteria 3562
692 Ga0316576_10097357 3300031727 Bacteria 2197
693 Ga0316576_10106021 3300031727 Bacteria 2104
694 Ga0307405_10000001 3300031731 Bacteria 1731270
695 Ga0307410_10455804 3300031852 Bacteria 1044
696 Ga0307406_10001003 3300031901 Bacteria 15676
697 Ga0307406_10224234 3300031901 Bacteria 1399
698 Ga0307407_10007419 3300031903 Bacteria 4968
699 Ga0307416_100242685 3300032002 Bacteria 1747
700 Ga0307414_10017574 3300032004 Bacteria 4379
701 Ga0307411_10762139 3300032005 Unclassified 849
702 Ga0307415_100130429 3300032126 Bacteria 1902
703 Ga0307415_100803122 3300032126 Unclassified 859
704 Ga0316574_0022694 3300035398 Bacteria 3741
705 Ga0316574_0073861 3300035398 Bacteria 2157
706 Ga0395899_0032571 3300037312 Bacteria 3915
707 Ga0395899_0042390 3300037312 Bacteria 3397
708 Ga0395899_0744894 3300037312 Bacteria 610
709 Ga0395900_0018883 3300037418 Bacteria 7032
710 Ga0395900_0160319 3300037418 Bacteria 2295
711 Ga0395900_0206307 3300037418 Bacteria 1986
712 Ga0395900_0799130 3300037418 Bacteria 871
713 Ga0395898_0001959 3300037466 Bacteria 26028
714 Ga0395898_0011790 3300037466 Bacteria 9062
715 Ga0395898_0158338 3300037466 Bacteria 2166
716 Ga0395905_0066795 3300037471 Bacteria 3368
717 Ga0395905_0236620 3300037471 Bacteria 1707
718 Ga0395901_0009760 3300038443 Bacteria 9734
719 Ga0395901_0049162 3300038443 Bacteria 4381
720 Ga0436363_0736983 3300039450 Bacteria 1820
721 Ga0439436_0019194 3300041404 Unclassified 2042
722 Ga0439465_0087445 3300041413 Bacteria 1063
723 Ga0451787_815422 3300041441 Unclassified 586
724 Ga0451807_0071894 3300041486 Unclassified 1264
725 Ga0439431_0002653 3300041997 Bacteria 3942
726 Ga0439442_011201 3300042002 Unclassified 1824
727 Ga0439449_0001010 3300042007 Bacteria 11093
728 Ga0439449_0005071 3300042007 Bacteria 5065
729 Ga0439457_002322 3300042014 Bacteria 5470
730 Ga0439462_0097425 3300042015 Unclassified 809
731 Ga0450894_005182 3300042131 Bacteria 1686
732 Ga0450896_019098 3300042133 Bacteria 996
733 Ga0450898_000625 3300042134 Unclassified 4238
734 Ga0439434_0010938 3300042435 Unclassified 2681
735 Ga0439434_0202377 3300042435 Unclassified 670
736 Ga0451577_0010807 3300042876 Bacteria 8681
737 Ga0451577_0019894 3300042876 Bacteria 6167
738 Ga0451577_0192098 3300042876 Bacteria 1842
739 Ga0451577_0491833 3300042876 Unclassified 1114
740 Ga0451577_0974533 3300042876 Bacteria 762
741 Ga0466972_0211320 3300044658 Unclassified 908
742 Ga0453683_0147588 3300044673 Unclassified 1485
743 Ga0466961_0161196 3300044693 Bacteria 1398
744 Ga0453684_0001359 3300044712 Bacteria 71348
745 Ga0453684_0019484 3300044712 Bacteria 10327
746 Ga0453684_0046970 3300044712 Bacteria 5733
747 Ga0466957_0790066 3300044842 Bacteria 674
748 Ga0466959_0137635 3300045049 Bacteria 1728
749 Ga0495627_008282 3300046453 Bacteria 3912
750 Ga0495592_0187564 3300046454 Bacteria 1404
751 Ga0495607_0233747 3300046501 Bacteria 893
752 Ga0495606_0193206 3300046507 Bacteria 1165
753 Ga0495608_0236627 3300046511 Unclassified 1142
754 Ga0495643_0111939 3300046522 Unclassified 1387
755 Ga0495624_0188026 3300046690 Bacteria 1257
756 Ga0495686_0221790 3300047472 Bacteria 1075
757 Ga0496100_0013114 3300048903 Bacteria 4772
758 Ga0496101_0340236 3300048904 Bacteria 1178
759 Ga0496104_0791806 3300048907 Bacteria 854
760 Ga0496110_0895250 3300048913 Bacteria 793
761 Ga0496112_0943998 3300048915 Bacteria 784
762 Ga0496114_0065779 3300048917 Bacteria 3038
763 Ga0496115_0322018 3300048918 Bacteria 1264
764 Ga0496125_0000267 3300048928 Bacteria 107026
765 Ga0496126_0060982 3300048929 Bacteria 3390
766 Ga0501308_075990 3300049128 Unclassified 528
767 Ga0501292_015915 3300049515 Unclassified 1179
768 Ga0501297_012494 3300049520 Unclassified 987
769 Ga0501298_005588 3300049521 Unclassified 2023
770 Ga0501031_0020894 3300049568 Unclassified 4268
771 Ga0501032_0004176 3300049569 Bacteria 10944
772 Ga0501033_0070793 3300049570 Unclassified 2562
773 Ga0501034_0021997 3300049571 Bacteria 6496
774 Ga0501034_0119651 3300049571 Unclassified 2620
775 Ga0501034_0147346 3300049571 Bacteria 2331
776 Ga0501034_0150256 3300049571 Bacteria 2305
777 Ga0501034_0245511 3300049571 Bacteria 1735
778 Ga0501036_0015465 3300049572 Bacteria 6374
779 Ga0501036_0032888 3300049572 Bacteria 4385
780 Ga0501037_0057762 3300049573 Unclassified 2832
781 Ga0501037_0081171 3300049573 Unclassified 2352
782 Ga0501038_0006778 3300049574 Bacteria 10581
783 Ga0501038_0127876 3300049574 Bacteria 2089
784 Ga0501038_0181945 3300049574 Unclassified 1696
785 Ga0501039_0039337 3300049575 Unclassified 3652
786 Ga0501040_0304934 3300049576 Bacteria 1138
787 Ga0501043_0013160 3300049579 Bacteria 6470
788 Ga0501043_0033365 3300049579 Unclassified 4050
789 Ga0501043_0056190 3300049579 Bacteria 3092
790 Ga0501043_0082436 3300049579 Bacteria 2528
791 Ga0501046_0129122 3300049580 Bacteria 1918
792 Ga0501046_0145309 3300049580 Bacteria 1791
793 Ga0501047_0046818 3300049581 Bacteria 4179
794 Ga0501047_0117465 3300049581 Bacteria 2541
795 Ga0501047_0528321 3300049581 Bacteria 1005
796 Ga0501048_0125622 3300049582 Bacteria 1813
797 Ga0501067_0123330 3300049583 Bacteria 1442
798 Ga0501070_0013512 3300049586 Bacteria 6882
799 Ga0501070_0251869 3300049586 Bacteria 1444
800 Ga0501073_0013121 3300049589 Bacteria 6042
801 Ga0501073_0304853 3300049589 Bacteria 1099
802 Ga0501074_0002073 3300049590 Bacteria 13850
803 Ga0501201_002129 3300049651 Unclassified 1822
804 Ga0501202_004293 3300049652 Unclassified 2493
805 Ga0501206_002739 3300049653 Bacteria 2220
806 Ga0501207_009108 3300049654 Unclassified 1445
807 Ga0501216_091741 3300049660 Bacteria 657
808 Ga0501217_002935 3300049661 Bacteria 3410
809 Ga0501217_024744 3300049661 Unclassified 1439
810 Ga0501217_038486 3300049661 Bacteria 1208
811 Ga0501222_014259 3300049662 Bacteria 1048
812 Ga0501223_013445 3300049663 Unclassified 1630
813 Ga0501223_029282 3300049663 Unclassified 1071
814 Ga0501224_002914 3300049664 Unclassified 2364
815 Ga0501227_085736 3300049665 Unclassified 828
816 Ga0501233_032396 3300049668 Unclassified 1189
817 Ga0501235_015206 3300049669 Unclassified 1697
818 Ga0501235_061458 3300049669 Bacteria 880
819 Ga0501236_083459 3300049670 Unclassified 603
820 Ga0501240_008299 3300049673 Unclassified 1329
821 Ga0501240_052680 3300049673 Unclassified 701
822 Ga0501242_003822 3300049674 Unclassified 1646
823 Ga0501242_005630 3300049674 Unclassified 1415
824 Ga0501243_001940 3300049675 Bacteria 3007
825 Ga0501249_031153 3300049679 Bacteria 1189
826 Ga0501250_008966 3300049680 Unclassified 1116
827 Ga0501259_000666 3300049688 Bacteria 5507
828 Ga0501259_000668 3300049688 Bacteria 5495
829 Ga0501259_070561 3300049688 Unclassified 748
830 Ga0501261_001484 3300049690 Bacteria 2884
831 Ga0501221_028772 3300049704 Unclassified 1145
832 Ga0501221_053776 3300049704 Unclassified 914
833 Ga0501225_0001259 3300049705 Bacteria 7864
834 Ga0501225_0005639 3300049705 Bacteria 3671
835 Ga0501234_000881 3300049707 Bacteria 4729
836 Ga0501234_018826 3300049707 Bacteria 1093
837 Ga0501245_004279 3300049708 Unclassified 1958
838 Ga0501079_0152267 3300049741 Bacteria 1803
839 Ga0501080_0015122 3300049742 Bacteria 7111
840 Ga0501080_0204218 3300049742 Unclassified 1813
841 Ga0501083_0004676 3300049744 Bacteria 9672
842 Ga0501232_005930 3300049757 Unclassified 1234
843 Ga0501232_020988 3300049757 Bacteria 841
844 Ga0501263_027000 3300049760 Unclassified 796
845 Ga0501267_015282 3300049764 Unclassified 811
846 Ga0501268_026083 3300049765 Unclassified 1031
847 Ga0501268_044650 3300049765 Unclassified 843
848 Ga0501268_052589 3300049765 Unclassified 791
849 Ga0501274_006948 3300049771 Unclassified 987
850 Ga0501279_023980 3300049775 Unclassified 881
851 Ga0501281_06286 3300049777 Unclassified 832
852 Ga0501281_17784 3300049777 Unclassified 536
853 Ga0501035_0015829 3300049822 Bacteria 6960
854 Ga0501035_0053964 3300049822 Bacteria 3592
855 Ga0501035_0104635 3300049822 Bacteria 2482
856 Ga0501035_0117545 3300049822 Unclassified 2326
857 Ga0501035_0399172 3300049822 Bacteria 1144
858 Ga0501044_0055496 3300049823 Bacteria 4069
859 Ga0501045_0170055 3300049824 Bacteria 1623
860 Ga0501212_009308 3300049851 Unclassified 1381
861 nmdc:mga0k408_44395_c1 3300050493 Unclassified 2563
862 nmdc:mga09592_398074_c1 3300050508 Bacteria 1190
863 nmdc:mga08y16_267569_c1 3300050511 Bacteria 1765
864 Ga0500641_0003475 3300053096 Bacteria 5572
865 Ga0500641_0022722 3300053096 Bacteria 2405
866 Ga0500553_144538 3300053101 Bacteria 930
867 Ga0500568_0004547 3300053139 Bacteria 7399
868 Ga0500588_0000768 3300053146 Bacteria 5520
869 Ga0500616_0022392 3300053153 Bacteria 3528
870 Ga0500611_000026 3300053727 Bacteria 96342
871 Ga0501084_0809416 3300054114 Bacteria 789

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005616 Ga0068852_100460814 Ga0068852_1004608142 147
2 3300013104 Ga0157370_10063719 Ga0157370_100637194 147
3 3300026142 Ga0207698_10475079 Ga0207698_104750791 147
4 3300005331 Ga0070670_100037728 Ga0070670_1000377282 148
5 3300005354 Ga0070675_100096905 Ga0070675_1000969052 148
6 3300005543 Ga0070672_100207449 Ga0070672_1002074492 148
7 3300005844 Ga0068862_100854413 Ga0068862_1008544131 148
8 3300025923 Ga0207681_10391847 Ga0207681_103918472 148
9 3300025925 Ga0207650_10391652 Ga0207650_103916522 148
10 3300025926 Ga0207659_10032494 Ga0207659_100324942 148
11 3300005367 Ga0070667_100126539 Ga0070667_1001265392 150
12 3300013308 Ga0157375_11423448 Ga0157375_114234481 153
13 3300001904 JGI24736J21556_1047717 JGI24736J21556_10477171 154
14 3300005295 Ga0065707_10172329 Ga0065707_101723292 154
15 3300005329 Ga0070683_100704514 Ga0070683_1007045141 154
16 3300005329 Ga0070683_101016471 Ga0070683_1010164711 154
17 3300005331 Ga0070670_100290243 Ga0070670_1002902432 154
18 3300005331 Ga0070670_100394603 Ga0070670_1003946032 154
19 3300005334 Ga0068869_100256730 Ga0068869_1002567301 154
20 3300005339 Ga0070660_100077930 Ga0070660_1000779302 154
21 3300005339 Ga0070660_101808317 Ga0070660_1018083171 154
22 3300005341 Ga0070691_10078453 Ga0070691_100784533 154
23 3300005343 Ga0070687_100255316 Ga0070687_1002553161 154
24 3300005344 Ga0070661_100004667 Ga0070661_1000046676 154
25 3300005344 Ga0070661_100058504 Ga0070661_1000585044 154
26 3300005347 Ga0070668_100806979 Ga0070668_1008069792 154
27 3300005355 Ga0070671_101161375 Ga0070671_1011613751 154
28 3300005356 Ga0070674_100348092 Ga0070674_1003480922 154
29 3300005356 Ga0070674_100542404 Ga0070674_1005424042 154
30 3300005365 Ga0070688_100012191 Ga0070688_1000121916 154
31 3300005365 Ga0070688_100118925 Ga0070688_1001189252 154
32 3300005441 Ga0070700_100235515 Ga0070700_1002355151 154
33 3300005456 Ga0070678_100322916 Ga0070678_1003229162 154
34 3300005457 Ga0070662_100020483 Ga0070662_1000204832 154
35 3300005459 Ga0068867_100033559 Ga0068867_1000335594 154
36 3300005459 Ga0068867_100588509 Ga0068867_1005885092 154
37 3300005539 Ga0068853_100390725 Ga0068853_1003907251 154
38 3300005539 Ga0068853_101198371 Ga0068853_1011983711 154
39 3300005564 Ga0070664_100147599 Ga0070664_1001475993 154
40 3300005577 Ga0068857_100015051 Ga0068857_1000150513 154
41 3300005577 Ga0068857_100323166 Ga0068857_1003231662 154
42 3300005578 Ga0068854_100744697 Ga0068854_1007446972 154
43 3300005614 Ga0068856_100359274 Ga0068856_1003592742 154
44 3300005616 Ga0068852_100945341 Ga0068852_1009453412 154
45 3300005618 Ga0068864_100336826 Ga0068864_1003368262 154
46 3300005718 Ga0068866_10099942 Ga0068866_100999422 154
47 3300005719 Ga0068861_100194982 Ga0068861_1001949822 154
48 3300005719 Ga0068861_100239966 Ga0068861_1002399663 154
49 3300005840 Ga0068870_10247206 Ga0068870_102472062 154
50 3300006358 Ga0068871_100240891 Ga0068871_1002408912 154
51 3300006844 Ga0075428_101118287 Ga0075428_1011182871 154
52 3300006881 Ga0068865_100682176 Ga0068865_1006821762 154
53 3300009176 Ga0105242_10035787 Ga0105242_100357873 154
54 3300009545 Ga0105237_10049418 Ga0105237_100494183 154
55 3300013100 Ga0157373_10020816 Ga0157373_100208166 154
56 3300013102 Ga0157371_10000284 Ga0157371_1000028444 154
57 3300013102 Ga0157371_10004001 Ga0157371_100040019 154
58 3300013104 Ga0157370_10902020 Ga0157370_109020201 154
59 3300013105 Ga0157369_10478167 Ga0157369_104781672 154
60 3300013105 Ga0157369_10947998 Ga0157369_109479982 154
61 3300013296 Ga0157374_10661838 Ga0157374_106618382 154
62 3300013296 Ga0157374_10934347 Ga0157374_109343472 154
63 3300013297 Ga0157378_10071982 Ga0157378_100719824 154
64 3300013297 Ga0157378_10135010 Ga0157378_101350102 154
65 3300013306 Ga0163162_10001642 Ga0163162_1000164210 154
66 3300013307 Ga0157372_10008876 Ga0157372_100088769 154
67 3300013307 Ga0157372_10410440 Ga0157372_104104402 154
68 3300013308 Ga0157375_10025511 Ga0157375_100255116 154
69 3300014325 Ga0163163_10074115 Ga0163163_100741152 154
70 3300014968 Ga0157379_10033404 Ga0157379_100334044 154
71 3300014968 Ga0157379_10328993 Ga0157379_103289933 154
72 3300014968 Ga0157379_10384706 Ga0157379_103847062 154
73 3300014969 Ga0157376_10048312 Ga0157376_100483126 154
74 3300025909 Ga0207705_10588882 Ga0207705_105888822 154
75 3300025914 Ga0207671_10259093 Ga0207671_102590932 154
76 3300025920 Ga0207649_10691628 Ga0207649_106916282 154
77 3300025925 Ga0207650_10365833 Ga0207650_103658332 154
78 3300025925 Ga0207650_10846692 Ga0207650_108466922 154
79 3300025934 Ga0207686_10030283 Ga0207686_100302832 154
80 3300025944 Ga0207661_10929646 Ga0207661_109296462 154
81 3300025945 Ga0207679_10851736 Ga0207679_108517362 154
82 3300025960 Ga0207651_10000351 Ga0207651_100003512 154
83 3300026089 Ga0207648_10036103 Ga0207648_100361033 154
84 3300026116 Ga0207674_10434719 Ga0207674_104347192 154
85 3300027526 Ga0209968_1029266 Ga0209968_10292662 154
86 3300027543 Ga0209999_1019113 Ga0209999_10191132 154
87 3300028381 Ga0268264_10433617 Ga0268264_104336172 154
88 3300037418 Ga0395900_0799130 Ga0395900_0799130_352_849 154
89 3300037471 Ga0395905_0066795 Ga0395905_0066795_11_508 154
90 3300042007 Ga0439449_0005071 Ga0439449_0005071_65_562 154
91 3300042876 Ga0451577_0491833 Ga0451577_0491833_383_880 154
92 3300044658 Ga0466972_0211320 Ga0466972_0211320_401_898 154
93 3300044673 Ga0453683_0147588 Ga0453683_0147588_20_517 154
94 3300044693 Ga0466961_0161196 Ga0466961_0161196_570_1067 154
95 3300044712 Ga0453684_0019484 Ga0453684_0019484_2406_2903 154
96 3300045049 Ga0466959_0137635 Ga0466959_0137635_155_652 154
97 3300049579 Ga0501043_0082436 Ga0501043_0082436_1283_1780 154
98 3300049660 Ga0501216_091741 Ga0501216_091741_95_592 154
99 3300049661 Ga0501217_024744 Ga0501217_024744_520_1017 154
100 3300049673 Ga0501240_008299 Ga0501240_008299_112_609 154
101 3300049673 Ga0501240_052680 Ga0501240_052680_180_677 154
102 3300049674 Ga0501242_005630 Ga0501242_005630_335_832 154
103 3300049688 Ga0501259_000666 Ga0501259_000666_971_1468 154
104 3300049771 Ga0501274_006948 Ga0501274_006948_151_648 154
105 3300005330 Ga0070690_100213700 Ga0070690_1002137002 155
106 3300005334 Ga0068869_100036944 Ga0068869_1000369444 155
107 3300005343 Ga0070687_100025475 Ga0070687_1000254753 155
108 3300005457 Ga0070662_101163925 Ga0070662_1011639251 155
109 3300005564 Ga0070664_100452177 Ga0070664_1004521772 155
110 3300005617 Ga0068859_100396636 Ga0068859_1003966362 155
111 3300005841 Ga0068863_100110665 Ga0068863_1001106653 155
112 3300005843 Ga0068860_100225752 Ga0068860_1002257523 155
113 3300006931 Ga0097620_100396666 Ga0097620_1003966662 155
114 3300009094 Ga0111539_10139259 Ga0111539_101392593 155
115 3300009176 Ga0105242_10224991 Ga0105242_102249912 155
116 3300009177 Ga0105248_10980683 Ga0105248_109806832 155
117 3300013297 Ga0157378_10002625 Ga0157378_1000262512 155
118 3300013306 Ga0163162_10248162 Ga0163162_102481622 155
119 3300013308 Ga0157375_10072650 Ga0157375_100726504 155
120 3300014326 Ga0157380_10788288 Ga0157380_107882882 155
121 3300025899 Ga0207642_10376537 Ga0207642_103765372 155
122 3300025903 Ga0207680_10135237 Ga0207680_101352372 155
123 3300025918 Ga0207662_10112363 Ga0207662_101123633 155
124 3300025940 Ga0207691_10086186 Ga0207691_100861863 155
125 3300026088 Ga0207641_10183973 Ga0207641_101839732 155
126 3300026089 Ga0207648_10207638 Ga0207648_102076383 155
127 3300026121 Ga0207683_10132662 Ga0207683_101326623 155
128 3300028381 Ga0268264_10686834 Ga0268264_106868342 155
129 3300032005 Ga0307411_10762139 Ga0307411_107621392 155
130 3300044842 Ga0466957_0790066 Ga0466957_0790066_153_656 155
131 3300049128 Ga0501308_075990 Ga0501308_075990_13_516 155
132 3300049777 Ga0501281_17784 Ga0501281_17784_20_523 155
133 3300050508 nmdc:mga09592_398074_c1 nmdc:mga09592_398074_c1_400_903 155
134 3300005459 Ga0068867_100903095 Ga0068867_1009030952 156
135 3300009174 Ga0105241_10085795 Ga0105241_100857954 156
136 3300009176 Ga0105242_10220729 Ga0105242_102207293 156
137 3300010375 Ga0105239_10211325 Ga0105239_102113252 156
138 3300013100 Ga0157373_10047594 Ga0157373_100475943 156
139 3300013104 Ga0157370_10572744 Ga0157370_105727442 156
140 3300013308 Ga0157375_10351754 Ga0157375_103517542 156
141 3300014325 Ga0163163_10305715 Ga0163163_103057152 156
142 3300014325 Ga0163163_11319007 Ga0163163_113190072 156
143 3300014969 Ga0157376_11220972 Ga0157376_112209722 156
144 3300025912 Ga0207707_10318694 Ga0207707_103186942 156
145 3300025925 Ga0207650_10501190 Ga0207650_105011902 156
146 3300025929 Ga0207664_10777185 Ga0207664_107771852 156
147 3300025942 Ga0207689_10194435 Ga0207689_101944351 156
148 3300025961 Ga0207712_11223553 Ga0207712_112235531 156
149 3300025986 Ga0207658_10943740 Ga0207658_109437401 156
150 3300026041 Ga0207639_11380017 Ga0207639_113800171 156
151 3300026075 Ga0207708_10150719 Ga0207708_101507193 156
152 3300041413 Ga0439465_0087445 Ga0439465_0087445_458_964 156
153 3300042876 Ga0451577_0974533 Ga0451577_0974533_33_530 156
154 3300053101 Ga0500553_144538 Ga0500553_144538_216_722 156
155 3300053153 Ga0500616_0022392 Ga0500616_0022392_2594_3100 156
156 3300053727 Ga0500611_000026 Ga0500611_000026_68384_68890 156
157 3300054114 Ga0501084_0809416 Ga0501084_0809416_38_544 156
158 3300005328 Ga0070676_10872245 Ga0070676_108722451 157
159 3300005456 Ga0070678_100992017 Ga0070678_1009920171 157
160 3300005459 Ga0068867_100455016 Ga0068867_1004550162 157
161 3300005545 Ga0070695_100968699 Ga0070695_1009686991 157
162 3300013307 Ga0157372_10710485 Ga0157372_107104852 157
163 3300026118 Ga0207675_100337527 Ga0207675_1003375272 157
164 3300025945 Ga0207679_10246651 Ga0207679_102466511 158
165 3300004800 Ga0058861_11891156 Ga0058861_118911562 159
166 3300005719 Ga0068861_101432993 Ga0068861_1014329931 159
167 3300028381 Ga0268264_11282530 Ga0268264_112825302 160
168 3300005329 Ga0070683_100469526 Ga0070683_1004695262 161
169 3300005339 Ga0070660_100082873 Ga0070660_1000828734 161
170 3300005539 Ga0068853_100122865 Ga0068853_1001228652 161
171 3300005577 Ga0068857_100089903 Ga0068857_1000899032 161
172 3300009174 Ga0105241_11275136 Ga0105241_112751361 161
173 3300025904 Ga0207647_10475246 Ga0207647_104752461 161
174 3300025909 Ga0207705_10159460 Ga0207705_101594603 161
175 3300025917 Ga0207660_10043002 Ga0207660_100430022 161
176 3300025919 Ga0207657_10027646 Ga0207657_100276465 161
177 3300025932 Ga0207690_10618407 Ga0207690_106184071 161
178 3300026041 Ga0207639_10312432 Ga0207639_103124322 161
179 3300026116 Ga0207674_10058037 Ga0207674_100580374 161
180 3300028800 Ga0265338_10004606 Ga0265338_1000460610 161
181 3300041441 Ga0451787_815422 Ga0451787_815422_35_556 161
182 3300005327 Ga0070658_10641434 Ga0070658_106414342 162
183 3300005353 Ga0070669_100284817 Ga0070669_1002848172 162
184 3300005365 Ga0070688_100500625 Ga0070688_1005006252 162
185 3300005367 Ga0070667_100526854 Ga0070667_1005268542 162
186 3300005577 Ga0068857_100183014 Ga0068857_1001830142 162
187 3300005617 Ga0068859_100002585 Ga0068859_10000258512 162
188 3300005618 Ga0068864_100011486 Ga0068864_1000114862 162
189 3300005842 Ga0068858_100192007 Ga0068858_1001920073 162
190 3300005843 Ga0068860_100736682 Ga0068860_1007366822 162
191 3300005844 Ga0068862_100017333 Ga0068862_1000173336 162
192 3300006931 Ga0097620_100002585 Ga0097620_10000258512 162
193 3300009553 Ga0105249_10103410 Ga0105249_101034104 162
194 3300014325 Ga0163163_10071200 Ga0163163_100712002 162
195 3300025923 Ga0207681_10049173 Ga0207681_100491734 162
196 3300025961 Ga0207712_10336280 Ga0207712_103362802 162
197 3300026035 Ga0207703_10670431 Ga0207703_106704312 162
198 3300026095 Ga0207676_10120008 Ga0207676_101200083 162
199 3300026116 Ga0207674_10040613 Ga0207674_100406135 162
200 3300028380 Ga0268265_10101182 Ga0268265_101011822 162
201 3300028381 Ga0268264_10101627 Ga0268264_101016274 162
202 3300028381 Ga0268264_10938486 Ga0268264_109384862 162
203 3300037312 Ga0395899_0032571 Ga0395899_0032571_1989_2558 162
204 3300037418 Ga0395900_0018883 Ga0395900_0018883_6368_6937 162
205 3300037466 Ga0395898_0001959 Ga0395898_0001959_16966_17535 162
206 3300038443 Ga0395901_0009760 Ga0395901_0009760_3459_4028 162
207 3300042435 Ga0439434_0202377 Ga0439434_0202377_10_534 162
208 3300042876 Ga0451577_0010807 Ga0451577_0010807_2712_3260 162
209 3300047472 Ga0495686_0221790 Ga0495686_0221790_115_639 162
210 3300025942 Ga0207689_10563100 Ga0207689_105631002 167
211 3300005841 Ga0068863_100009644 Ga0068863_1000096442 168
212 3300026088 Ga0207641_10204350 Ga0207641_102043503 168
213 3300049515 Ga0501292_015915 Ga0501292_015915_249_770 168
214 2162886011 MRS1b_contig_8355847 MRS1b_0147.00001540 170
215 2162886012 MBSR1b_contig_7905469 MBSR1b_0637.00004270 170
216 3300005327 Ga0070658_10011892 Ga0070658_100118924 170
217 3300005329 Ga0070683_100049339 Ga0070683_1000493392 170
218 3300005331 Ga0070670_100049340 Ga0070670_1000493402 170
219 3300005331 Ga0070670_100055870 Ga0070670_1000558704 170
220 3300005331 Ga0070670_100057150 Ga0070670_1000571501 170
221 3300005334 Ga0068869_100011219 Ga0068869_1000112194 170
222 3300005334 Ga0068869_100013854 Ga0068869_1000138544 170
223 3300005335 Ga0070666_10003560 Ga0070666_100035604 170
224 3300005337 Ga0070682_100731126 Ga0070682_1007311261 170
225 3300005338 Ga0068868_100004561 Ga0068868_1000045613 170
226 3300005338 Ga0068868_100040512 Ga0068868_1000405124 170
227 3300005338 Ga0068868_101492704 Ga0068868_1014927041 170
228 3300005339 Ga0070660_100490433 Ga0070660_1004904332 170
229 3300005340 Ga0070689_100229204 Ga0070689_1002292042 170
230 3300005340 Ga0070689_100303077 Ga0070689_1003030772 170
231 3300005344 Ga0070661_100041040 Ga0070661_1000410402 170
232 3300005344 Ga0070661_100495832 Ga0070661_1004958321 170
233 3300005344 Ga0070661_100602337 Ga0070661_1006023371 170
234 3300005347 Ga0070668_100094903 Ga0070668_1000949032 170
235 3300005353 Ga0070669_100003262 Ga0070669_10000326211 170
236 3300005353 Ga0070669_101240856 Ga0070669_1012408561 170
237 3300005354 Ga0070675_100012636 Ga0070675_1000126366 170
238 3300005354 Ga0070675_100063469 Ga0070675_1000634692 170
239 3300005354 Ga0070675_100394866 Ga0070675_1003948661 170
240 3300005355 Ga0070671_100032943 Ga0070671_1000329435 170
241 3300005355 Ga0070671_100079978 Ga0070671_1000799784 170
242 3300005355 Ga0070671_100318774 Ga0070671_1003187742 170
243 3300005355 Ga0070671_100547691 Ga0070671_1005476912 170
244 3300005364 Ga0070673_100106373 Ga0070673_1001063732 170
245 3300005364 Ga0070673_100146744 Ga0070673_1001467443 170
246 3300005364 Ga0070673_100180695 Ga0070673_1001806951 170
247 3300005364 Ga0070673_100397109 Ga0070673_1003971092 170
248 3300005364 Ga0070673_100581162 Ga0070673_1005811621 170
249 3300005364 Ga0070673_101249987 Ga0070673_1012499871 170
250 3300005366 Ga0070659_100056690 Ga0070659_1000566904 170
251 3300005366 Ga0070659_100147805 Ga0070659_1001478052 170
252 3300005366 Ga0070659_101401478 Ga0070659_1014014781 170
253 3300005367 Ga0070667_100054486 Ga0070667_1000544862 170
254 3300005367 Ga0070667_100114151 Ga0070667_1001141512 170
255 3300005438 Ga0070701_10916206 Ga0070701_109162061 170
256 3300005455 Ga0070663_100415687 Ga0070663_1004156872 170
257 3300005456 Ga0070678_100366314 Ga0070678_1003663142 170
258 3300005457 Ga0070662_100118047 Ga0070662_1001180472 170
259 3300005457 Ga0070662_100125200 Ga0070662_1001252002 170
260 3300005457 Ga0070662_100142343 Ga0070662_1001423432 170
261 3300005458 Ga0070681_10044182 Ga0070681_100441823 170
262 3300005459 Ga0068867_100015945 Ga0068867_1000159456 170
263 3300005459 Ga0068867_100124423 Ga0068867_1001244232 170
264 3300005466 Ga0070685_10040628 Ga0070685_100406283 170
265 3300005466 Ga0070685_10046540 Ga0070685_100465403 170
266 3300005535 Ga0070684_100000732 Ga0070684_10000073215 170
267 3300005535 Ga0070684_100057871 Ga0070684_1000578714 170
268 3300005535 Ga0070684_100063983 Ga0070684_1000639835 170
269 3300005539 Ga0068853_100387618 Ga0068853_1003876182 170
270 3300005543 Ga0070672_100048558 Ga0070672_1000485583 170
271 3300005543 Ga0070672_100106244 Ga0070672_1001062444 170
272 3300005543 Ga0070672_100186840 Ga0070672_1001868401 170
273 3300005543 Ga0070672_100375370 Ga0070672_1003753702 170
274 3300005548 Ga0070665_100299126 Ga0070665_1002991262 170
275 3300005548 Ga0070665_100488123 Ga0070665_1004881232 170
276 3300005563 Ga0068855_100171998 Ga0068855_1001719983 170
277 3300005563 Ga0068855_100203638 Ga0068855_1002036384 170
278 3300005563 Ga0068855_100736791 Ga0068855_1007367912 170
279 3300005564 Ga0070664_100004812 Ga0070664_1000048125 170
280 3300005564 Ga0070664_100005353 Ga0070664_1000053532 170
281 3300005564 Ga0070664_100089884 Ga0070664_1000898842 170
282 3300005564 Ga0070664_100105796 Ga0070664_1001057964 170
283 3300005564 Ga0070664_100346932 Ga0070664_1003469321 170
284 3300005564 Ga0070664_100427738 Ga0070664_1004277382 170
285 3300005577 Ga0068857_100046477 Ga0068857_1000464773 170
286 3300005577 Ga0068857_100298459 Ga0068857_1002984593 170
287 3300005578 Ga0068854_100328888 Ga0068854_1003288882 170
288 3300005614 Ga0068856_100292744 Ga0068856_1002927443 170
289 3300005615 Ga0070702_100070832 Ga0070702_1000708322 170
290 3300005616 Ga0068852_100030388 Ga0068852_1000303884 170
291 3300005616 Ga0068852_100085281 Ga0068852_1000852814 170
292 3300005616 Ga0068852_100087517 Ga0068852_1000875174 170
293 3300005617 Ga0068859_100031954 Ga0068859_1000319544 170
294 3300005617 Ga0068859_100050459 Ga0068859_1000504592 170
295 3300005617 Ga0068859_100130686 Ga0068859_1001306864 170
296 3300005618 Ga0068864_100015347 Ga0068864_1000153473 170
297 3300005718 Ga0068866_10184746 Ga0068866_101847462 170
298 3300005718 Ga0068866_10607443 Ga0068866_106074432 170
299 3300005719 Ga0068861_100003939 Ga0068861_1000039393 170
300 3300005834 Ga0068851_10047482 Ga0068851_100474822 170
301 3300005840 Ga0068870_10020219 Ga0068870_100202192 170
302 3300005841 Ga0068863_100088765 Ga0068863_1000887653 170
303 3300005842 Ga0068858_100286764 Ga0068858_1002867642 170
304 3300005842 Ga0068858_100377487 Ga0068858_1003774872 170
305 3300005843 Ga0068860_100011162 Ga0068860_1000111622 170
306 3300005843 Ga0068860_100113037 Ga0068860_1001130374 170
307 3300005843 Ga0068860_100305483 Ga0068860_1003054833 170
308 3300005844 Ga0068862_100145146 Ga0068862_1001451462 170
309 3300006237 Ga0097621_100000423 Ga0097621_10000042316 170
310 3300006237 Ga0097621_100022999 Ga0097621_1000229993 170
311 3300006358 Ga0068871_100000604 Ga0068871_10000060418 170
312 3300006881 Ga0068865_100017686 Ga0068865_1000176864 170
313 3300006931 Ga0097620_100000575 Ga0097620_10000057528 170
314 3300006931 Ga0097620_100031954 Ga0097620_1000319544 170
315 3300006931 Ga0097620_100050465 Ga0097620_1000504655 170
316 3300006931 Ga0097620_100130682 Ga0097620_1001306824 170
317 3300006931 Ga0097620_100383935 Ga0097620_1003839352 170
318 3300009094 Ga0111539_10021610 Ga0111539_100216102 170
319 3300009148 Ga0105243_11300555 Ga0105243_113005551 170
320 3300009177 Ga0105248_10035159 Ga0105248_100351595 170
321 3300009553 Ga0105249_10000806 Ga0105249_1000080626 170
322 3300009553 Ga0105249_10381130 Ga0105249_103811302 170
323 3300012497 Ga0157319_1002218 Ga0157319_10022182 170
324 3300013100 Ga0157373_10122072 Ga0157373_101220722 170
325 3300013102 Ga0157371_10003533 Ga0157371_100035332 170
326 3300013102 Ga0157371_10035665 Ga0157371_100356653 170
327 3300013102 Ga0157371_10042494 Ga0157371_100424944 170
328 3300013102 Ga0157371_10047902 Ga0157371_100479024 170
329 3300013104 Ga0157370_10359894 Ga0157370_103598942 170
330 3300013105 Ga0157369_10241722 Ga0157369_102417222 170
331 3300013105 Ga0157369_10920836 Ga0157369_109208361 170
332 3300013296 Ga0157374_10001939 Ga0157374_1000193914 170
333 3300013297 Ga0157378_10011662 Ga0157378_100116626 170
334 3300013297 Ga0157378_10372245 Ga0157378_103722452 170
335 3300013297 Ga0157378_10635436 Ga0157378_106354361 170
336 3300013306 Ga0163162_10000114 Ga0163162_1000011457 170
337 3300013306 Ga0163162_10001189 Ga0163162_1000118930 170
338 3300013306 Ga0163162_10098560 Ga0163162_100985604 170
339 3300013306 Ga0163162_10521440 Ga0163162_105214402 170
340 3300013307 Ga0157372_10023602 Ga0157372_100236022 170
341 3300013307 Ga0157372_10024383 Ga0157372_100243834 170
342 3300013307 Ga0157372_10057098 Ga0157372_100570985 170
343 3300013307 Ga0157372_10066227 Ga0157372_100662275 170
344 3300013307 Ga0157372_10089423 Ga0157372_100894235 170
345 3300013307 Ga0157372_10468944 Ga0157372_104689442 170
346 3300013307 Ga0157372_10833691 Ga0157372_108336911 170
347 3300013308 Ga0157375_10142569 Ga0157375_101425692 170
348 3300013308 Ga0157375_10177729 Ga0157375_101777293 170
349 3300014325 Ga0163163_10001283 Ga0163163_1000128311 170
350 3300014325 Ga0163163_10002242 Ga0163163_1000224211 170
351 3300014325 Ga0163163_10447627 Ga0163163_104476272 170
352 3300014325 Ga0163163_10549615 Ga0163163_105496152 170
353 3300014326 Ga0157380_10043776 Ga0157380_100437764 170
354 3300014326 Ga0157380_10387092 Ga0157380_103870922 170
355 3300014745 Ga0157377_10010475 Ga0157377_100104754 170
356 3300014745 Ga0157377_10019607 Ga0157377_100196072 170
357 3300014968 Ga0157379_10183882 Ga0157379_101838822 170
358 3300014969 Ga0157376_10001023 Ga0157376_100010239 170
359 3300014969 Ga0157376_10388211 Ga0157376_103882112 170
360 3300017792 Ga0163161_10001357 Ga0163161_100013572 170
361 3300017792 Ga0163161_10012045 Ga0163161_100120457 170
362 3300025315 Ga0207697_10217459 Ga0207697_102174592 170
363 3300025321 Ga0207656_10014573 Ga0207656_100145732 170
364 3300025899 Ga0207642_10317422 Ga0207642_103174221 170
365 3300025903 Ga0207680_10085235 Ga0207680_100852353 170
366 3300025904 Ga0207647_10000110 Ga0207647_1000011034 170
367 3300025904 Ga0207647_10052196 Ga0207647_100521964 170
368 3300025907 Ga0207645_10170420 Ga0207645_101704202 170
369 3300025908 Ga0207643_10043706 Ga0207643_100437064 170
370 3300025908 Ga0207643_10151961 Ga0207643_101519612 170
371 3300025912 Ga0207707_10192723 Ga0207707_101927232 170
372 3300025918 Ga0207662_10511580 Ga0207662_105115801 170
373 3300025918 Ga0207662_10517268 Ga0207662_105172681 170
374 3300025919 Ga0207657_10074404 Ga0207657_100744042 170
375 3300025919 Ga0207657_10124769 Ga0207657_101247693 170
376 3300025920 Ga0207649_10389698 Ga0207649_103896982 170
377 3300025923 Ga0207681_10019146 Ga0207681_100191466 170
378 3300025923 Ga0207681_10281337 Ga0207681_102813372 170
379 3300025925 Ga0207650_10004016 Ga0207650_1000401610 170
380 3300025925 Ga0207650_10040561 Ga0207650_100405614 170
381 3300025925 Ga0207650_10372325 Ga0207650_103723252 170
382 3300025926 Ga0207659_10049413 Ga0207659_100494134 170
383 3300025926 Ga0207659_10077068 Ga0207659_100770682 170
384 3300025926 Ga0207659_10227153 Ga0207659_102271532 170
385 3300025933 Ga0207706_10024969 Ga0207706_100249692 170
386 3300025933 Ga0207706_10120722 Ga0207706_101207222 170
387 3300025934 Ga0207686_10014735 Ga0207686_100147357 170
388 3300025936 Ga0207670_10033313 Ga0207670_100333133 170
389 3300025937 Ga0207669_10152439 Ga0207669_101524392 170
390 3300025938 Ga0207704_10019095 Ga0207704_100190954 170
391 3300025938 Ga0207704_11227896 Ga0207704_112278961 170
392 3300025940 Ga0207691_10058045 Ga0207691_100580454 170
393 3300025940 Ga0207691_10158185 Ga0207691_101581852 170
394 3300025940 Ga0207691_10346426 Ga0207691_103464262 170
395 3300025940 Ga0207691_11189802 Ga0207691_111898021 170
396 3300025942 Ga0207689_10006627 Ga0207689_100066279 170
397 3300025944 Ga0207661_10009619 Ga0207661_100096193 170
398 3300025944 Ga0207661_10048003 Ga0207661_100480034 170
399 3300025945 Ga0207679_10008767 Ga0207679_100087674 170
400 3300025945 Ga0207679_10024202 Ga0207679_100242022 170
401 3300025945 Ga0207679_10038291 Ga0207679_100382912 170
402 3300025945 Ga0207679_10086137 Ga0207679_100861374 170
403 3300025949 Ga0207667_10178873 Ga0207667_101788733 170
404 3300025960 Ga0207651_10034932 Ga0207651_100349323 170
405 3300025961 Ga0207712_10003480 Ga0207712_1000348010 170
406 3300025961 Ga0207712_10043635 Ga0207712_100436354 170
407 3300025961 Ga0207712_10223943 Ga0207712_102239432 170
408 3300025961 Ga0207712_10349105 Ga0207712_103491051 170
409 3300025972 Ga0207668_10038727 Ga0207668_100387272 170
410 3300025986 Ga0207658_10016630 Ga0207658_100166307 170
411 3300025986 Ga0207658_10073893 Ga0207658_100738932 170
412 3300025986 Ga0207658_10291639 Ga0207658_102916392 170
413 3300026023 Ga0207677_10240672 Ga0207677_102406722 170
414 3300026035 Ga0207703_10018796 Ga0207703_100187966 170
415 3300026035 Ga0207703_10264218 Ga0207703_102642182 170
416 3300026035 Ga0207703_10309259 Ga0207703_103092592 170
417 3300026041 Ga0207639_10400412 Ga0207639_104004122 170
418 3300026041 Ga0207639_10423906 Ga0207639_104239062 170
419 3300026067 Ga0207678_10007975 Ga0207678_100079754 170
420 3300026067 Ga0207678_10443545 Ga0207678_104435452 170
421 3300026075 Ga0207708_10063911 Ga0207708_100639113 170
422 3300026075 Ga0207708_10210475 Ga0207708_102104752 170
423 3300026078 Ga0207702_10619623 Ga0207702_106196232 170
424 3300026078 Ga0207702_10687921 Ga0207702_106879212 170
425 3300026088 Ga0207641_10264392 Ga0207641_102643923 170
426 3300026088 Ga0207641_10380691 Ga0207641_103806912 170
427 3300026089 Ga0207648_10045161 Ga0207648_100451612 170
428 3300026089 Ga0207648_10066057 Ga0207648_100660574 170
429 3300026089 Ga0207648_10208913 Ga0207648_102089132 170
430 3300026095 Ga0207676_10058964 Ga0207676_100589644 170
431 3300026095 Ga0207676_10094165 Ga0207676_100941652 170
432 3300026116 Ga0207674_10010080 Ga0207674_100100802 170
433 3300026116 Ga0207674_10029331 Ga0207674_100293313 170
434 3300026116 Ga0207674_10065653 Ga0207674_100656535 170
435 3300026116 Ga0207674_10533882 Ga0207674_105338822 170
436 3300026118 Ga0207675_100001207 Ga0207675_10000120714 170
437 3300026118 Ga0207675_101676701 Ga0207675_1016767011 170
438 3300026121 Ga0207683_10080331 Ga0207683_100803312 170
439 3300026121 Ga0207683_10402780 Ga0207683_104027802 170
440 3300026142 Ga0207698_10026514 Ga0207698_100265143 170
441 3300026142 Ga0207698_10496139 Ga0207698_104961391 170
442 3300027907 Ga0207428_10281497 Ga0207428_102814972 170
443 3300028380 Ga0268265_10123415 Ga0268265_101234152 170
444 3300028381 Ga0268264_10004843 Ga0268264_100048436 170
445 3300028381 Ga0268264_10403632 Ga0268264_104036322 170
446 3300032126 Ga0307415_100130429 Ga0307415_1001304292 170
447 3300037466 Ga0395898_0158338 Ga0395898_0158338_38_607 170
448 3300041404 Ga0439436_0019194 Ga0439436_0019194_1207_1776 170
449 3300041997 Ga0439431_0002653 Ga0439431_0002653_1840_2409 170
450 3300042002 Ga0439442_011201 Ga0439442_011201_99_668 170
451 3300042007 Ga0439449_0001010 Ga0439449_0001010_8248_8796 170
452 3300042014 Ga0439457_002322 Ga0439457_002322_2837_3385 170
453 3300042015 Ga0439462_0097425 Ga0439462_0097425_88_636 170
454 3300042131 Ga0450894_005182 Ga0450894_005182_499_1068 170
455 3300042133 Ga0450896_019098 Ga0450896_019098_388_957 170
456 3300042134 Ga0450898_000625 Ga0450898_000625_1799_2368 170
457 3300042435 Ga0439434_0010938 Ga0439434_0010938_589_1158 170
458 3300046454 Ga0495592_0187564 Ga0495592_0187564_74_637 170
459 3300046511 Ga0495608_0236627 Ga0495608_0236627_172_735 170
460 3300046522 Ga0495643_0111939 Ga0495643_0111939_737_1306 170
461 3300046690 Ga0495624_0188026 Ga0495624_0188026_546_1109 170
462 3300048903 Ga0496100_0013114 Ga0496100_0013114_1157_1717 170
463 3300048904 Ga0496101_0340236 Ga0496101_0340236_10_570 170
464 3300048907 Ga0496104_0791806 Ga0496104_0791806_193_753 170
465 3300048913 Ga0496110_0895250 Ga0496110_0895250_110_670 170
466 3300048915 Ga0496112_0943998 Ga0496112_0943998_153_716 170
467 3300048917 Ga0496114_0065779 Ga0496114_0065779_267_827 170
468 3300049520 Ga0501297_012494 Ga0501297_012494_363_911 170
469 3300049521 Ga0501298_005588 Ga0501298_005588_908_1456 170
470 3300049570 Ga0501033_0070793 Ga0501033_0070793_1065_1625 170
471 3300049571 Ga0501034_0119651 Ga0501034_0119651_719_1279 170
472 3300049571 Ga0501034_0245511 Ga0501034_0245511_777_1313 170
473 3300049573 Ga0501037_0081171 Ga0501037_0081171_1264_1824 170
474 3300049574 Ga0501038_0181945 Ga0501038_0181945_291_851 170
475 3300049579 Ga0501043_0056190 Ga0501043_0056190_263_823 170
476 3300049581 Ga0501047_0046818 Ga0501047_0046818_3572_4132 170
477 3300049651 Ga0501201_002129 Ga0501201_002129_908_1456 170
478 3300049652 Ga0501202_004293 Ga0501202_004293_1165_1713 170
479 3300049653 Ga0501206_002739 Ga0501206_002739_516_1064 170
480 3300049654 Ga0501207_009108 Ga0501207_009108_16_564 170
481 3300049661 Ga0501217_002935 Ga0501217_002935_716_1264 170
482 3300049661 Ga0501217_038486 Ga0501217_038486_460_1008 170
483 3300049662 Ga0501222_014259 Ga0501222_014259_189_737 170
484 3300049663 Ga0501223_013445 Ga0501223_013445_472_1020 170
485 3300049663 Ga0501223_029282 Ga0501223_029282_311_859 170
486 3300049664 Ga0501224_002914 Ga0501224_002914_854_1402 170
487 3300049665 Ga0501227_085736 Ga0501227_085736_254_802 170
488 3300049668 Ga0501233_032396 Ga0501233_032396_605_1153 170
489 3300049669 Ga0501235_015206 Ga0501235_015206_741_1289 170
490 3300049669 Ga0501235_061458 Ga0501235_061458_31_579 170
491 3300049670 Ga0501236_083459 Ga0501236_083459_33_581 170
492 3300049674 Ga0501242_003822 Ga0501242_003822_268_816 170
493 3300049675 Ga0501243_001940 Ga0501243_001940_337_885 170
494 3300049679 Ga0501249_031153 Ga0501249_031153_180_728 170
495 3300049680 Ga0501250_008966 Ga0501250_008966_458_1006 170
496 3300049688 Ga0501259_000668 Ga0501259_000668_1779_2327 170
497 3300049688 Ga0501259_070561 Ga0501259_070561_33_581 170
498 3300049690 Ga0501261_001484 Ga0501261_001484_1652_2200 170
499 3300049704 Ga0501221_028772 Ga0501221_028772_43_591 170
500 3300049704 Ga0501221_053776 Ga0501221_053776_218_766 170
501 3300049705 Ga0501225_0001259 Ga0501225_0001259_2086_2634 170
502 3300049707 Ga0501234_000881 Ga0501234_000881_212_760 170
503 3300049708 Ga0501245_004279 Ga0501245_004279_274_822 170
504 3300049757 Ga0501232_005930 Ga0501232_005930_24_572 170
505 3300049757 Ga0501232_020988 Ga0501232_020988_112_660 170
506 3300049760 Ga0501263_027000 Ga0501263_027000_192_761 170
507 3300049764 Ga0501267_015282 Ga0501267_015282_96_644 170
508 3300049765 Ga0501268_026083 Ga0501268_026083_205_753 170
509 3300049765 Ga0501268_044650 Ga0501268_044650_146_694 170
510 3300049765 Ga0501268_052589 Ga0501268_052589_105_674 170
511 3300049775 Ga0501279_023980 Ga0501279_023980_161_709 170
512 3300049777 Ga0501281_06286 Ga0501281_06286_240_788 170
513 3300049822 Ga0501035_0053964 Ga0501035_0053964_1146_1706 170
514 3300049822 Ga0501035_0104635 Ga0501035_0104635_1568_2128 170
515 3300049851 Ga0501212_009308 Ga0501212_009308_43_591 170
516 3300050511 nmdc:mga08y16_267569_c1 nmdc:mga08y16_267569_c1_1061_1630 170
517 3300005328 Ga0070676_10087371 Ga0070676_100873712 171
518 3300005331 Ga0070670_100334288 Ga0070670_1003342882 171
519 3300005335 Ga0070666_10278258 Ga0070666_102782582 171
520 3300005338 Ga0068868_100105750 Ga0068868_1001057504 171
521 3300005353 Ga0070669_100193469 Ga0070669_1001934693 171
522 3300005354 Ga0070675_100235142 Ga0070675_1002351423 171
523 3300005355 Ga0070671_100032458 Ga0070671_1000324582 171
524 3300005355 Ga0070671_100299445 Ga0070671_1002994452 171
525 3300005356 Ga0070674_100203187 Ga0070674_1002031872 171
526 3300005364 Ga0070673_100222059 Ga0070673_1002220591 171
527 3300005364 Ga0070673_100393138 Ga0070673_1003931381 171
528 3300005366 Ga0070659_100430203 Ga0070659_1004302032 171
529 3300005438 Ga0070701_10084495 Ga0070701_100844952 171
530 3300005456 Ga0070678_100143461 Ga0070678_1001434613 171
531 3300005459 Ga0068867_100143553 Ga0068867_1001435533 171
532 3300005543 Ga0070672_100073133 Ga0070672_1000731333 171
533 3300005544 Ga0070686_100029033 Ga0070686_1000290334 171
534 3300005547 Ga0070693_100222468 Ga0070693_1002224681 171
535 3300005615 Ga0070702_100017096 Ga0070702_1000170963 171
536 3300005718 Ga0068866_10487158 Ga0068866_104871582 171
537 3300005719 Ga0068861_100426056 Ga0068861_1004260562 171
538 3300005834 Ga0068851_10520687 Ga0068851_105206872 171
539 3300005840 Ga0068870_10025829 Ga0068870_100258292 171
540 3300005840 Ga0068870_10372162 Ga0068870_103721622 171
541 3300005844 Ga0068862_101262635 Ga0068862_1012626352 171
542 3300006880 Ga0075429_100346297 Ga0075429_1003462972 171
543 3300013104 Ga0157370_10023600 Ga0157370_100236008 171
544 3300013297 Ga0157378_10260607 Ga0157378_102606072 171
545 3300014325 Ga0163163_10392545 Ga0163163_103925452 171
546 3300014745 Ga0157377_10110006 Ga0157377_101100063 171
547 3300025315 Ga0207697_10329511 Ga0207697_103295111 171
548 3300025907 Ga0207645_10010260 Ga0207645_100102603 171
549 3300025920 Ga0207649_10250216 Ga0207649_102502162 171
550 3300025926 Ga0207659_10003079 Ga0207659_100030799 171
551 3300025926 Ga0207659_11092514 Ga0207659_110925141 171
552 3300025931 Ga0207644_10051317 Ga0207644_100513174 171
553 3300025937 Ga0207669_10011405 Ga0207669_100114053 171
554 3300025937 Ga0207669_10417488 Ga0207669_104174882 171
555 3300025940 Ga0207691_10168614 Ga0207691_101686143 171
556 3300025942 Ga0207689_10036976 Ga0207689_100369763 171
557 3300025945 Ga0207679_10020432 Ga0207679_100204326 171
558 3300025960 Ga0207651_10338911 Ga0207651_103389112 171
559 3300025972 Ga0207668_10345595 Ga0207668_103455952 171
560 3300026023 Ga0207677_10057954 Ga0207677_100579544 171
561 3300026035 Ga0207703_10049308 Ga0207703_100493084 171
562 3300026089 Ga0207648_10038845 Ga0207648_100388456 171
563 3300026089 Ga0207648_10067278 Ga0207648_100672784 171
564 3300026118 Ga0207675_100192852 Ga0207675_1001928522 171
565 3300028380 Ga0268265_11042494 Ga0268265_110424941 171
566 3300031548 Ga0307408_100034097 Ga0307408_1000340971 171
567 3300031852 Ga0307410_10455804 Ga0307410_104558042 171
568 3300031901 Ga0307406_10224234 Ga0307406_102242342 171
569 3300031903 Ga0307407_10007419 Ga0307407_100074196 171
570 3300032002 Ga0307416_100242685 Ga0307416_1002426852 171
571 3300032126 Ga0307415_100803122 Ga0307415_1008031222 171
572 3300039450 Ga0436363_0736983 Ga0436363_0736983_1182_1799 171
573 3300042876 Ga0451577_0019894 Ga0451577_0019894_4540_5112 171
574 3300044712 Ga0453684_0001359 Ga0453684_0001359_56432_57004 171
575 3300049705 Ga0501225_0005639 Ga0501225_0005639_3009_3584 171
576 3300049707 Ga0501234_018826 Ga0501234_018826_339_914 171
577 3300005327 Ga0070658_10020900 Ga0070658_100209004 172
578 3300005327 Ga0070658_10209540 Ga0070658_102095402 172
579 3300005331 Ga0070670_100039617 Ga0070670_1000396174 172
580 3300005333 Ga0070677_10196608 Ga0070677_101966082 172
581 3300005334 Ga0068869_100118802 Ga0068869_1001188022 172
582 3300005335 Ga0070666_10000051 Ga0070666_10000051104 172
583 3300005336 Ga0070680_100018651 Ga0070680_1000186517 172
584 3300005338 Ga0068868_100127203 Ga0068868_1001272033 172
585 3300005339 Ga0070660_100016234 Ga0070660_1000162343 172
586 3300005339 Ga0070660_100068070 Ga0070660_1000680702 172
587 3300005347 Ga0070668_100171175 Ga0070668_1001711752 172
588 3300005347 Ga0070668_100389631 Ga0070668_1003896312 172
589 3300005355 Ga0070671_100013288 Ga0070671_1000132886 172
590 3300005364 Ga0070673_100583868 Ga0070673_1005838681 172
591 3300005366 Ga0070659_100003883 Ga0070659_1000038833 172
592 3300005367 Ga0070667_100182203 Ga0070667_1001822032 172
593 3300005455 Ga0070663_100019473 Ga0070663_1000194733 172
594 3300005456 Ga0070678_100013606 Ga0070678_1000136063 172
595 3300005456 Ga0070678_100275646 Ga0070678_1002756463 172
596 3300005458 Ga0070681_10503220 Ga0070681_105032202 172
597 3300005459 Ga0068867_100366603 Ga0068867_1003666032 172
598 3300005459 Ga0068867_100555118 Ga0068867_1005551182 172
599 3300005530 Ga0070679_100005880 Ga0070679_10000588013 172
600 3300005530 Ga0070679_100117451 Ga0070679_1001174511 172
601 3300005539 Ga0068853_100186815 Ga0068853_1001868153 172
602 3300005539 Ga0068853_101497357 Ga0068853_1014973571 172
603 3300005543 Ga0070672_100036985 Ga0070672_1000369851 172
604 3300005563 Ga0068855_100008437 Ga0068855_10000843711 172
605 3300005563 Ga0068855_101214540 Ga0068855_1012145402 172
606 3300005578 Ga0068854_100495251 Ga0068854_1004952512 172
607 3300005614 Ga0068856_100066740 Ga0068856_1000667403 172
608 3300005616 Ga0068852_100168494 Ga0068852_1001684942 172
609 3300005616 Ga0068852_100270575 Ga0068852_1002705752 172
610 3300005617 Ga0068859_100000023 Ga0068859_100000023142 172
611 3300005618 Ga0068864_100006376 Ga0068864_1000063767 172
612 3300005718 Ga0068866_10390936 Ga0068866_103909362 172
613 3300005719 Ga0068861_100069663 Ga0068861_1000696633 172
614 3300005834 Ga0068851_10043901 Ga0068851_100439013 172
615 3300005841 Ga0068863_100014587 Ga0068863_1000145872 172
616 3300005842 Ga0068858_100023286 Ga0068858_1000232866 172
617 3300005843 Ga0068860_100001475 Ga0068860_10000147517 172
618 3300005843 Ga0068860_101101616 Ga0068860_1011016162 172
619 3300006195 Ga0075366_10027426 Ga0075366_100274264 172
620 3300006237 Ga0097621_100657470 Ga0097621_1006574702 172
621 3300006358 Ga0068871_100075398 Ga0068871_1000753982 172
622 3300006931 Ga0097620_100000023 Ga0097620_100000023142 172
623 3300009093 Ga0105240_10058540 Ga0105240_100585402 172
624 3300009101 Ga0105247_10004502 Ga0105247_100045025 172
625 3300009174 Ga0105241_10226034 Ga0105241_102260342 172
626 3300013100 Ga0157373_10083164 Ga0157373_100831642 172
627 3300013102 Ga0157371_10000924 Ga0157371_1000092423 172
628 3300013102 Ga0157371_10022893 Ga0157371_100228935 172
629 3300013102 Ga0157371_10050384 Ga0157371_100503845 172
630 3300013102 Ga0157371_10140953 Ga0157371_101409533 172
631 3300013104 Ga0157370_10003733 Ga0157370_100037338 172
632 3300013104 Ga0157370_10070410 Ga0157370_100704105 172
633 3300013105 Ga0157369_10037231 Ga0157369_100372316 172
634 3300013105 Ga0157369_10157991 Ga0157369_101579912 172
635 3300013105 Ga0157369_10777074 Ga0157369_107770742 172
636 3300013307 Ga0157372_10048241 Ga0157372_100482414 172
637 3300013307 Ga0157372_10231472 Ga0157372_102314722 172
638 3300013307 Ga0157372_10618024 Ga0157372_106180242 172
639 3300017792 Ga0163161_10042073 Ga0163161_100420732 172
640 3300025321 Ga0207656_10030148 Ga0207656_100301482 172
641 3300025903 Ga0207680_10000856 Ga0207680_100008567 172
642 3300025904 Ga0207647_10022580 Ga0207647_100225804 172
643 3300025909 Ga0207705_10018149 Ga0207705_100181495 172
644 3300025909 Ga0207705_10055977 Ga0207705_100559773 172
645 3300025909 Ga0207705_10066453 Ga0207705_100664532 172
646 3300025909 Ga0207705_10090663 Ga0207705_100906633 172
647 3300025911 Ga0207654_10001756 Ga0207654_100017568 172
648 3300025911 Ga0207654_10260197 Ga0207654_102601972 172
649 3300025912 Ga0207707_10020922 Ga0207707_100209223 172
650 3300025913 Ga0207695_10006992 Ga0207695_100069926 172
651 3300025914 Ga0207671_10001442 Ga0207671_100014428 172
652 3300025917 Ga0207660_10021291 Ga0207660_100212916 172
653 3300025917 Ga0207660_10582456 Ga0207660_105824561 172
654 3300025919 Ga0207657_10074029 Ga0207657_100740294 172
655 3300025919 Ga0207657_10196162 Ga0207657_101961622 172
656 3300025921 Ga0207652_10000166 Ga0207652_1000016642 172
657 3300025921 Ga0207652_10001364 Ga0207652_1000136416 172
658 3300025931 Ga0207644_10015867 Ga0207644_100158675 172
659 3300025932 Ga0207690_10015683 Ga0207690_100156836 172
660 3300025934 Ga0207686_10192960 Ga0207686_101929603 172
661 3300025934 Ga0207686_10554792 Ga0207686_105547922 172
662 3300025935 Ga0207709_10284760 Ga0207709_102847602 172
663 3300025940 Ga0207691_10343321 Ga0207691_103433212 172
664 3300025942 Ga0207689_10002648 Ga0207689_1000264816 172
665 3300025942 Ga0207689_10002890 Ga0207689_100028909 172
666 3300025942 Ga0207689_10447171 Ga0207689_104471712 172
667 3300025944 Ga0207661_10176797 Ga0207661_101767973 172
668 3300025949 Ga0207667_10001454 Ga0207667_1000145416 172
669 3300025949 Ga0207667_10016511 Ga0207667_100165112 172
670 3300025961 Ga0207712_10007969 Ga0207712_100079693 172
671 3300025972 Ga0207668_10126240 Ga0207668_101262402 172
672 3300025972 Ga0207668_10351034 Ga0207668_103510342 172
673 3300025981 Ga0207640_10352041 Ga0207640_103520412 172
674 3300025981 Ga0207640_10442930 Ga0207640_104429302 172
675 3300025981 Ga0207640_11185071 Ga0207640_111850711 172
676 3300025986 Ga0207658_10423335 Ga0207658_104233352 172
677 3300026023 Ga0207677_10223694 Ga0207677_102236942 172
678 3300026035 Ga0207703_10036946 Ga0207703_100369464 172
679 3300026041 Ga0207639_10082245 Ga0207639_100822452 172
680 3300026041 Ga0207639_10830612 Ga0207639_108306122 172
681 3300026041 Ga0207639_11414216 Ga0207639_114142161 172
682 3300026067 Ga0207678_10040991 Ga0207678_100409914 172
683 3300026078 Ga0207702_10041800 Ga0207702_100418003 172
684 3300026078 Ga0207702_10263629 Ga0207702_102636293 172
685 3300026088 Ga0207641_10000202 Ga0207641_1000020255 172
686 3300026089 Ga0207648_10823521 Ga0207648_108235212 172
687 3300026095 Ga0207676_10042150 Ga0207676_100421502 172
688 3300026118 Ga0207675_100444784 Ga0207675_1004447842 172
689 3300026121 Ga0207683_10074567 Ga0207683_100745674 172
690 3300026142 Ga0207698_10099782 Ga0207698_100997822 172
691 3300026142 Ga0207698_10197244 Ga0207698_101972442 172
692 3300026142 Ga0207698_10805720 Ga0207698_108057202 172
693 3300028381 Ga0268264_10001369 Ga0268264_1000136912 172
694 3300028381 Ga0268264_11069079 Ga0268264_110690792 172
695 3300037312 Ga0395899_0042390 Ga0395899_0042390_1207_1776 172
696 3300037312 Ga0395899_0744894 Ga0395899_0744894_26_595 172
697 3300037418 Ga0395900_0160319 Ga0395900_0160319_1060_1629 172
698 3300037418 Ga0395900_0206307 Ga0395900_0206307_54_602 172
699 3300037466 Ga0395898_0011790 Ga0395898_0011790_8053_8622 172
700 3300037471 Ga0395905_0236620 Ga0395905_0236620_676_1245 172
701 3300038443 Ga0395901_0049162 Ga0395901_0049162_3027_3596 172
702 3300042876 Ga0451577_0192098 Ga0451577_0192098_1180_1791 172
703 3300044712 Ga0453684_0046970 Ga0453684_0046970_383_952 172
704 3300049569 Ga0501032_0004176 Ga0501032_0004176_4148_4726 172
705 3300049571 Ga0501034_0021997 Ga0501034_0021997_1921_2499 172
706 3300049571 Ga0501034_0150256 Ga0501034_0150256_722_1291 172
707 3300049572 Ga0501036_0032888 Ga0501036_0032888_965_1543 172
708 3300049574 Ga0501038_0006778 Ga0501038_0006778_1756_2334 172
709 3300049579 Ga0501043_0013160 Ga0501043_0013160_940_1518 172
710 3300049580 Ga0501046_0145309 Ga0501046_0145309_221_799 172
711 3300049581 Ga0501047_0117465 Ga0501047_0117465_1145_1723 172
712 3300049582 Ga0501048_0125622 Ga0501048_0125622_247_825 172
713 3300049583 Ga0501067_0123330 Ga0501067_0123330_348_926 172
714 3300049586 Ga0501070_0013512 Ga0501070_0013512_3762_4340 172
715 3300049586 Ga0501070_0251869 Ga0501070_0251869_508_1077 172
716 3300049589 Ga0501073_0013121 Ga0501073_0013121_2621_3199 172
717 3300049590 Ga0501074_0002073 Ga0501074_0002073_6540_7118 172
718 3300049741 Ga0501079_0152267 Ga0501079_0152267_649_1227 172
719 3300049742 Ga0501080_0015122 Ga0501080_0015122_2844_3422 172
720 3300049744 Ga0501083_0004676 Ga0501083_0004676_7465_8043 172
721 3300049822 Ga0501035_0015829 Ga0501035_0015829_2295_2873 172
722 3300049822 Ga0501035_0399172 Ga0501035_0399172_506_1075 172
723 3300049824 Ga0501045_0170055 Ga0501045_0170055_740_1318 172
724 3300050493 nmdc:mga0k408_44395_c1 nmdc:mga0k408_44395_c1_638_1216 172
725 3300053096 Ga0500641_0022722 Ga0500641_0022722_848_1426 172
726 3300053139 Ga0500568_0004547 Ga0500568_0004547_4782_5360 172
727 3300053146 Ga0500588_0000768 Ga0500588_0000768_3586_4164 172
728 3300005338 Ga0068868_100002074 Ga0068868_1000020749 173
729 3300005466 Ga0070685_10362288 Ga0070685_103622882 173
730 3300005577 Ga0068857_100646114 Ga0068857_1006461142 173
731 3300005718 Ga0068866_10014659 Ga0068866_100146594 173
732 3300005844 Ga0068862_100176206 Ga0068862_1001762062 173
733 3300006358 Ga0068871_100232950 Ga0068871_1002329502 173
734 3300013296 Ga0157374_10365741 Ga0157374_103657412 173
735 3300013297 Ga0157378_11005930 Ga0157378_110059301 173
736 3300013308 Ga0157375_10089651 Ga0157375_100896514 173
737 3300014969 Ga0157376_10499859 Ga0157376_104998592 173
738 3300025907 Ga0207645_10069140 Ga0207645_100691404 173
739 3300025934 Ga0207686_10408973 Ga0207686_104089732 173
740 3300025940 Ga0207691_10457333 Ga0207691_104573332 173
741 3300025981 Ga0207640_10890056 Ga0207640_108900562 173
742 3300025986 Ga0207658_10561782 Ga0207658_105617822 173
743 3300026023 Ga0207677_10026970 Ga0207677_100269704 173
744 3300026041 Ga0207639_10086848 Ga0207639_100868484 173
745 3300026089 Ga0207648_10045942 Ga0207648_100459423 173
746 3300026116 Ga0207674_10738556 Ga0207674_107385562 173
747 3300026121 Ga0207683_10992926 Ga0207683_109929262 173
748 3300049568 Ga0501031_0020894 Ga0501031_0020894_1932_2513 173
749 3300049571 Ga0501034_0147346 Ga0501034_0147346_1136_1717 173
750 3300049572 Ga0501036_0015465 Ga0501036_0015465_4815_5396 173
751 3300049573 Ga0501037_0057762 Ga0501037_0057762_1852_2433 173
752 3300049574 Ga0501038_0127876 Ga0501038_0127876_222_803 173
753 3300049575 Ga0501039_0039337 Ga0501039_0039337_1459_2040 173
754 3300049579 Ga0501043_0033365 Ga0501043_0033365_2803_3384 173
755 3300049580 Ga0501046_0129122 Ga0501046_0129122_979_1560 173
756 3300049581 Ga0501047_0528321 Ga0501047_0528321_95_676 173
757 3300049589 Ga0501073_0304853 Ga0501073_0304853_277_858 173
758 3300049742 Ga0501080_0204218 Ga0501080_0204218_770_1351 173
759 3300049822 Ga0501035_0117545 Ga0501035_0117545_956_1537 173
760 3300049823 Ga0501044_0055496 Ga0501044_0055496_2609_3190 173
761 3300005333 Ga0070677_10026061 Ga0070677_100260612 174
762 3300005334 Ga0068869_100134215 Ga0068869_1001342152 174
763 3300005338 Ga0068868_100097882 Ga0068868_1000978821 174
764 3300005347 Ga0070668_100017512 Ga0070668_1000175126 174
765 3300005353 Ga0070669_100046045 Ga0070669_1000460452 174
766 3300005354 Ga0070675_100061480 Ga0070675_1000614804 174
767 3300005355 Ga0070671_100094736 Ga0070671_1000947363 174
768 3300005356 Ga0070674_100058570 Ga0070674_1000585704 174
769 3300005364 Ga0070673_100564948 Ga0070673_1005649481 174
770 3300005365 Ga0070688_100516301 Ga0070688_1005163012 174
771 3300005367 Ga0070667_100160204 Ga0070667_1001602042 174
772 3300005455 Ga0070663_100185529 Ga0070663_1001855292 174
773 3300005456 Ga0070678_100101316 Ga0070678_1001013163 174
774 3300005539 Ga0068853_100046316 Ga0068853_1000463164 174
775 3300005548 Ga0070665_100071523 Ga0070665_1000715234 174
776 3300005577 Ga0068857_100100738 Ga0068857_1001007384 174
777 3300005578 Ga0068854_100275873 Ga0068854_1002758732 174
778 3300005617 Ga0068859_100126744 Ga0068859_1001267442 174
779 3300005718 Ga0068866_10036931 Ga0068866_100369314 174
780 3300005719 Ga0068861_100066558 Ga0068861_1000665582 174
781 3300005840 Ga0068870_10539470 Ga0068870_105394702 174
782 3300005841 Ga0068863_100035327 Ga0068863_1000353272 174
783 3300005843 Ga0068860_100049889 Ga0068860_1000498894 174
784 3300005844 Ga0068862_100606771 Ga0068862_1006067712 174
785 3300006358 Ga0068871_100093572 Ga0068871_1000935724 174
786 3300006881 Ga0068865_100080247 Ga0068865_1000802472 174
787 3300006931 Ga0097620_100126756 Ga0097620_1001267562 174
788 3300009098 Ga0105245_10523827 Ga0105245_105238272 174
789 3300009176 Ga0105242_10066827 Ga0105242_100668274 174
790 3300013102 Ga0157371_10361980 Ga0157371_103619801 174
791 3300013104 Ga0157370_10415630 Ga0157370_104156301 174
792 3300013296 Ga0157374_10088226 Ga0157374_100882262 174
793 3300013297 Ga0157378_10067120 Ga0157378_100671201 174
794 3300013307 Ga0157372_10222694 Ga0157372_102226942 174
795 3300013307 Ga0157372_10266213 Ga0157372_102662132 174
796 3300013308 Ga0157375_10063866 Ga0157375_100638664 174
797 3300014325 Ga0163163_10643555 Ga0163163_106435552 174
798 3300014968 Ga0157379_10634104 Ga0157379_106341042 174
799 3300025899 Ga0207642_10010313 Ga0207642_100103133 174
800 3300025901 Ga0207688_10008415 Ga0207688_100084156 174
801 3300025903 Ga0207680_10091324 Ga0207680_100913242 174
802 3300025907 Ga0207645_10014403 Ga0207645_100144032 174
803 3300025908 Ga0207643_10318655 Ga0207643_103186552 174
804 3300025923 Ga0207681_10009947 Ga0207681_100099477 174
805 3300025926 Ga0207659_10194089 Ga0207659_101940892 174
806 3300025934 Ga0207686_10051345 Ga0207686_100513454 174
807 3300025937 Ga0207669_10030753 Ga0207669_100307533 174
808 3300025940 Ga0207691_10001792 Ga0207691_100017927 174
809 3300025942 Ga0207689_10002715 Ga0207689_1000271513 174
810 3300025960 Ga0207651_10132577 Ga0207651_101325773 174
811 3300025972 Ga0207668_10491120 Ga0207668_104911202 174
812 3300025981 Ga0207640_10247117 Ga0207640_102471172 174
813 3300026067 Ga0207678_10274646 Ga0207678_102746462 174
814 3300026088 Ga0207641_10021731 Ga0207641_100217312 174
815 3300026089 Ga0207648_10001834 Ga0207648_1000183415 174
816 3300026095 Ga0207676_10773408 Ga0207676_107734081 174
817 3300026116 Ga0207674_10210214 Ga0207674_102102143 174
818 3300026118 Ga0207675_100086651 Ga0207675_1000866512 174
819 3300026121 Ga0207683_10004024 Ga0207683_100040247 174
820 3300028379 Ga0268266_10352900 Ga0268266_103529002 174
821 3300028380 Ga0268265_10394202 Ga0268265_103942022 174
822 3300028381 Ga0268264_10128103 Ga0268264_101281033 174
823 3300028794 Ga0307515_10000076 Ga0307515_10000076154 174
824 3300041486 Ga0451807_0071894 Ga0451807_0071894_488_1072 174
825 iso_pu_bacteria 2833640130 2833641592 174
826 3300013307 Ga0157372_10392178 Ga0157372_103921782 175
827 3300031727 Ga0316576_10097357 Ga0316576_100973572 175
828 3300031727 Ga0316576_10106021 Ga0316576_101060213 175
829 3300035398 Ga0316574_0022694 Ga0316574_0022694_818_1360 175
830 3300025934 Ga0207686_10889765 Ga0207686_108897651 176
831 iso_pu_bacteria 2958512119 2958514240 176
832 3300005458 Ga0070681_10101100 Ga0070681_101011004 177
833 3300005530 Ga0070679_100277671 Ga0070679_1002776711 177
834 3300005563 Ga0068855_100011433 Ga0068855_1000114339 177
835 3300013100 Ga0157373_10028779 Ga0157373_100287795 177
836 3300013102 Ga0157371_10047990 Ga0157371_100479905 177
837 3300013104 Ga0157370_10903421 Ga0157370_109034211 177
838 3300013105 Ga0157369_10019696 Ga0157369_100196966 177
839 3300025912 Ga0207707_10252815 Ga0207707_102528152 177
840 3300025919 Ga0207657_10059391 Ga0207657_100593912 177
841 3300025921 Ga0207652_10010361 Ga0207652_100103616 177
842 3300025921 Ga0207652_10061630 Ga0207652_100616305 177
843 3300025949 Ga0207667_10070704 Ga0207667_100707046 177
844 3300032004 Ga0307414_10017574 Ga0307414_100175745 178
845 3300035398 Ga0316574_0073861 Ga0316574_0073861_524_1066 178
846 2162886007 SwRhRL2b_contig_28926 SwRhRL2b_0733.00002920 180
847 3300005289 Ga0065704_10138584 Ga0065704_101385842 180
848 3300013104 Ga0157370_10009105 Ga0157370_100091056 180
849 3300013104 Ga0157370_10140422 Ga0157370_101404222 180
850 3300013306 Ga0163162_10032258 Ga0163162_100322588 180
851 3300014497 Ga0182008_10067865 Ga0182008_100678652 180
852 3300017792 Ga0163161_10002438 Ga0163161_100024383 180
853 3300017792 Ga0163161_10011682 Ga0163161_100116824 180
854 3300017792 Ga0163161_11196101 Ga0163161_111961011 180
855 3300027617 Ga0210002_1001946 Ga0210002_10019462 180
856 3300027876 Ga0209974_10005287 Ga0209974_100052872 180
857 3300046453 Ga0495627_008282 Ga0495627_008282_599_1141 180
858 3300046501 Ga0495607_0233747 Ga0495607_0233747_276_818 180
859 3300046507 Ga0495606_0193206 Ga0495606_0193206_71_613 180
860 3300048918 Ga0496115_0322018 Ga0496115_0322018_407_949 180
861 3300048928 Ga0496125_0000267 Ga0496125_0000267_29364_29906 180
862 3300048929 Ga0496126_0060982 Ga0496126_0060982_2817_3359 180
863 3300053096 Ga0500641_0003475 Ga0500641_0003475_636_1178 180
864 2162886007 SwRhRL2b_contig_1199054 SwRhRL2b_0900.00005840 181
865 3300005289 Ga0065704_10071448 Ga0065704_100714484 181
866 3300005289 Ga0065704_10171434 Ga0065704_101714342 181
867 3300005547 Ga0070693_100012847 Ga0070693_1000128473 181
868 3300013104 Ga0157370_10004338 Ga0157370_100043388 181
869 3300013104 Ga0157370_10387855 Ga0157370_103878553 181
870 3300015261 Ga0182006_1034846 Ga0182006_10348462 181
871 3300031731 Ga0307405_10000001 Ga0307405_1000000169 181
872 3300031901 Ga0307406_10001003 Ga0307406_100010038 181
873 3300049576 Ga0501040_0304934 Ga0501040_0304934_78_635 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

43

110

0.97

PF04545

Sigma70_r4

Sigma-70, region 4

127

189

0.95

PF08281

Sigma70_r4_2

Sigma-70, region 4

135

188

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bhy-assembly1.cif.gz_A dna-binding domain of deor in complex with the dna operator 0.9818 124 162
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9731 114 164
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9697 121 168
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9627 111 164
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9575 114 172
ID Description Score Start End Superfamily
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9731 114 164 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9645 111 164 1.10.10.10
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9627 111 164 1.10.10.10
3hugG00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9512 114 172 1.10.10.10
3vfzA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9495 115 169 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1I6PML3-F1-model_v4 RNA polymerase sigma-70 factor, ECF subfamily 0.9602 1 174 GO:0003677
GO:0006352
GO:0016987
AF-A0A316E4U8-F1-model_v4 RNA polymerase sigma-70 factor (ECF subfamily) 0.9568 1 174 GO:0003677
GO:0006352
GO:0016987
AF-A0A2K1E397-F1-model_v4 RNA polymerase subunit sigma-70 0.9525 1 174 GO:0003677
GO:0006352
GO:0016987
AF-A0A258ES14-F1-model_v4 RNA polymerase subunit sigma-70 0.9478 15 174 GO:0003677
GO:0006352
GO:0016987
AF-A0A7X3D158-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9351 1 174 GO:0003677
GO:0006352
GO:0016987

Feature Viewer

pLDDT pTM Quality
83.98 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map