F484153
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 870 | 358 | 870 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300035398|Ga0316574_0801827|Ga0316574_0801827_192_515 |
| Length | 97 |
| Sequence | MGGEKSEKGAPARVLGFQFPCRYEIKAMGRHSMRFEALVHAIVSRHIGREDLLASKQRFSRNRRYLSVTCIIRASSRQQLDEIYADLRGCPEVLAAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300003397 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM | Metagenome | Rhizosphere |
| 5 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 189 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 190 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 191 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 192 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 193 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 194 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 210 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 217 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 218 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 222 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 227 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 228 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 229 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 230 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 231 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 232 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 233 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 234 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 235 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 236 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 237 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 238 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 239 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 240 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 241 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 242 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 243 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 244 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 245 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 246 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 247 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 248 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 249 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 308 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 309 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 310 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 311 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 312 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 335 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 336 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 337 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 338 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 341 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 356 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 358 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0.23 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.69 |
| Nodule | 0 |
| Rhizoplane | 0.57 |
| Rhizosphere | 98.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10035649 | 3300003203 | Bacteria | 1814 |
| 2 | rootL2_10010637 | 3300003322 | Bacteria | 7774 |
| 3 | rootH1_10178713 | 3300003323 | Bacteria | 1563 |
| 4 | JGI26133J50247_101018 | 3300003397 | Bacteria | 838 |
| 5 | Ga0055529_1000015 | 3300003763 | Bacteria | 366950 |
| 6 | Ga0058860_11658417 | 3300004801 | Bacteria | 1390 |
| 7 | Ga0058862_10871056 | 3300004803 | Bacteria | 635 |
| 8 | Ga0065712_10380110 | 3300005290 | Unclassified | 753 |
| 9 | Ga0065707_10028465 | 3300005295 | Bacteria | 1790 |
| 10 | Ga0070676_10759131 | 3300005328 | Bacteria | 713 |
| 11 | Ga0070683_100228472 | 3300005329 | Bacteria | 1769 |
| 12 | Ga0070683_101622413 | 3300005329 | Bacteria | 622 |
| 13 | Ga0070690_100000197 | 3300005330 | Bacteria | 31360 |
| 14 | Ga0070690_100664488 | 3300005330 | Bacteria | 797 |
| 15 | Ga0070690_101016336 | 3300005330 | Bacteria | 654 |
| 16 | Ga0070690_101091112 | 3300005330 | Bacteria | 633 |
| 17 | Ga0070670_100290586 | 3300005331 | Unclassified | 1428 |
| 18 | Ga0070670_100899990 | 3300005331 | Bacteria | 802 |
| 19 | Ga0070670_101506574 | 3300005331 | Unclassified | 618 |
| 20 | Ga0068869_100000214 | 3300005334 | Bacteria | 30165 |
| 21 | Ga0068869_100063874 | 3300005334 | Bacteria | 2707 |
| 22 | Ga0068869_100229020 | 3300005334 | Bacteria | 1476 |
| 23 | Ga0070666_10263580 | 3300005335 | Bacteria | 1222 |
| 24 | Ga0070680_100005842 | 3300005336 | Bacteria | 9338 |
| 25 | Ga0070680_100061318 | 3300005336 | Bacteria | 3078 |
| 26 | Ga0070680_100189194 | 3300005336 | Bacteria | 1734 |
| 27 | Ga0070682_100003738 | 3300005337 | Bacteria | 8463 |
| 28 | Ga0068868_100000375 | 3300005338 | Bacteria | 30466 |
| 29 | Ga0068868_101098168 | 3300005338 | Bacteria | 732 |
| 30 | Ga0068868_101890732 | 3300005338 | Bacteria | 565 |
| 31 | Ga0070689_100000107 | 3300005340 | Bacteria | 48084 |
| 32 | Ga0070689_100065511 | 3300005340 | Bacteria | 2829 |
| 33 | Ga0070689_100214699 | 3300005340 | Bacteria | 1576 |
| 34 | Ga0070689_100357767 | 3300005340 | Bacteria | 1226 |
| 35 | Ga0070689_100727136 | 3300005340 | Bacteria | 868 |
| 36 | Ga0070689_100840768 | 3300005340 | Bacteria | 809 |
| 37 | Ga0070689_101641949 | 3300005340 | Unclassified | 584 |
| 38 | Ga0070691_10000220 | 3300005341 | Bacteria | 19309 |
| 39 | Ga0070691_10219666 | 3300005341 | Bacteria | 1006 |
| 40 | Ga0070691_10860537 | 3300005341 | Bacteria | 556 |
| 41 | Ga0070687_100000669 | 3300005343 | Bacteria | 11428 |
| 42 | Ga0070687_100128970 | 3300005343 | Bacteria | 1457 |
| 43 | Ga0070687_100159616 | 3300005343 | Bacteria | 1332 |
| 44 | Ga0070687_100253395 | 3300005343 | Bacteria | 1095 |
| 45 | Ga0070687_100673294 | 3300005343 | Bacteria | 720 |
| 46 | Ga0070692_10005331 | 3300005345 | Bacteria | 5469 |
| 47 | Ga0070692_10779827 | 3300005345 | Bacteria | 651 |
| 48 | Ga0070669_101040733 | 3300005353 | Bacteria | 703 |
| 49 | Ga0070675_100345976 | 3300005354 | Bacteria | 1318 |
| 50 | Ga0070675_100705968 | 3300005354 | Bacteria | 919 |
| 51 | Ga0070675_101221138 | 3300005354 | Bacteria | 692 |
| 52 | Ga0070674_100664544 | 3300005356 | Bacteria | 887 |
| 53 | Ga0070673_100266246 | 3300005364 | Bacteria | 1499 |
| 54 | Ga0070673_100467413 | 3300005364 | Bacteria | 1137 |
| 55 | Ga0070673_100765611 | 3300005364 | Bacteria | 890 |
| 56 | Ga0070673_100892420 | 3300005364 | Bacteria | 824 |
| 57 | Ga0070688_100033844 | 3300005365 | Bacteria | 3091 |
| 58 | Ga0070688_101569673 | 3300005365 | Bacteria | 537 |
| 59 | Ga0070659_100519794 | 3300005366 | Bacteria | 1016 |
| 60 | Ga0070703_10004630 | 3300005406 | Bacteria | 3852 |
| 61 | Ga0070703_10142223 | 3300005406 | Bacteria | 893 |
| 62 | Ga0070709_10519574 | 3300005434 | Bacteria | 907 |
| 63 | Ga0070714_100011982 | 3300005435 | Bacteria | 6898 |
| 64 | Ga0070713_100399710 | 3300005436 | Bacteria | 1283 |
| 65 | Ga0070713_102422813 | 3300005436 | Bacteria | 507 |
| 66 | Ga0070710_10437408 | 3300005437 | Bacteria | 884 |
| 67 | Ga0070701_10000396 | 3300005438 | Bacteria | 14677 |
| 68 | Ga0070701_10130788 | 3300005438 | Bacteria | 1426 |
| 69 | Ga0070711_101262697 | 3300005439 | Unclassified | 640 |
| 70 | Ga0070705_100027892 | 3300005440 | Bacteria | 3087 |
| 71 | Ga0070705_100075566 | 3300005440 | Bacteria | 2051 |
| 72 | Ga0070705_100721539 | 3300005440 | Bacteria | 785 |
| 73 | Ga0070705_101319470 | 3300005440 | Bacteria | 599 |
| 74 | Ga0070700_100000633 | 3300005441 | Bacteria | 17458 |
| 75 | Ga0070700_100103026 | 3300005441 | Bacteria | 1884 |
| 76 | Ga0070700_100111705 | 3300005441 | Bacteria | 1818 |
| 77 | Ga0070700_100216498 | 3300005441 | Bacteria | 1354 |
| 78 | Ga0070700_100263736 | 3300005441 | Bacteria | 1241 |
| 79 | Ga0070700_100360890 | 3300005441 | Unclassified | 1080 |
| 80 | Ga0070700_100721722 | 3300005441 | Bacteria | 795 |
| 81 | Ga0070694_100000126 | 3300005444 | Bacteria | 37932 |
| 82 | Ga0070694_100017277 | 3300005444 | Bacteria | 4556 |
| 83 | Ga0070694_100057979 | 3300005444 | Bacteria | 2633 |
| 84 | Ga0070694_100077882 | 3300005444 | Bacteria | 2298 |
| 85 | Ga0070694_100266507 | 3300005444 | Bacteria | 1301 |
| 86 | Ga0070694_100391685 | 3300005444 | Bacteria | 1086 |
| 87 | Ga0070694_100563404 | 3300005444 | Bacteria | 914 |
| 88 | Ga0070694_101758613 | 3300005444 | Bacteria | 528 |
| 89 | Ga0070708_100319275 | 3300005445 | Bacteria | 1463 |
| 90 | Ga0070708_101109277 | 3300005445 | Bacteria | 741 |
| 91 | Ga0070708_101631857 | 3300005445 | Bacteria | 600 |
| 92 | Ga0070678_100030611 | 3300005456 | Bacteria | 3702 |
| 93 | Ga0070681_10000399 | 3300005458 | Bacteria | 35221 |
| 94 | Ga0070681_10338742 | 3300005458 | Bacteria | 1414 |
| 95 | Ga0070681_10414874 | 3300005458 | Bacteria | 1258 |
| 96 | Ga0070681_10912559 | 3300005458 | Bacteria | 797 |
| 97 | Ga0068867_100000032 | 3300005459 | Bacteria | 84727 |
| 98 | Ga0068867_100846461 | 3300005459 | Bacteria | 819 |
| 99 | Ga0070707_100726748 | 3300005468 | Bacteria | 956 |
| 100 | Ga0070707_100753833 | 3300005468 | Bacteria | 937 |
| 101 | Ga0070707_100798163 | 3300005468 | Bacteria | 908 |
| 102 | Ga0070707_101083333 | 3300005468 | Bacteria | 767 |
| 103 | Ga0070698_100162623 | 3300005471 | Bacteria | 2176 |
| 104 | Ga0070698_101948042 | 3300005471 | Bacteria | 541 |
| 105 | Ga0070699_100015187 | 3300005518 | Bacteria | 6617 |
| 106 | Ga0070699_100102761 | 3300005518 | Bacteria | 2506 |
| 107 | Ga0070699_100998981 | 3300005518 | Bacteria | 767 |
| 108 | Ga0070679_100108511 | 3300005530 | Bacteria | 2762 |
| 109 | Ga0070679_101063904 | 3300005530 | Bacteria | 753 |
| 110 | Ga0070684_100874045 | 3300005535 | Unclassified | 842 |
| 111 | Ga0070684_101303839 | 3300005535 | Unclassified | 683 |
| 112 | Ga0070697_100000648 | 3300005536 | Bacteria | 26304 |
| 113 | Ga0070697_100249725 | 3300005536 | Bacteria | 1517 |
| 114 | Ga0070697_100663479 | 3300005536 | Bacteria | 919 |
| 115 | Ga0070697_101303123 | 3300005536 | Bacteria | 648 |
| 116 | Ga0068853_100191540 | 3300005539 | Bacteria | 1858 |
| 117 | Ga0070672_100786395 | 3300005543 | Bacteria | 837 |
| 118 | Ga0070686_100000253 | 3300005544 | Bacteria | 36736 |
| 119 | Ga0070686_100227621 | 3300005544 | Bacteria | 1351 |
| 120 | Ga0070686_100533516 | 3300005544 | Bacteria | 915 |
| 121 | Ga0070686_100625088 | 3300005544 | Bacteria | 851 |
| 122 | Ga0070686_100886077 | 3300005544 | Bacteria | 725 |
| 123 | Ga0070686_100969123 | 3300005544 | Bacteria | 696 |
| 124 | Ga0070695_100000197 | 3300005545 | Bacteria | 29394 |
| 125 | Ga0070695_100000362 | 3300005545 | Bacteria | 23307 |
| 126 | Ga0070695_100045316 | 3300005545 | Bacteria | 2803 |
| 127 | Ga0070695_100164586 | 3300005545 | Bacteria | 1560 |
| 128 | Ga0070695_100246385 | 3300005545 | Bacteria | 1299 |
| 129 | Ga0070695_100293197 | 3300005545 | Bacteria | 1200 |
| 130 | Ga0070695_100831223 | 3300005545 | Bacteria | 742 |
| 131 | Ga0070695_101127588 | 3300005545 | Unclassified | 643 |
| 132 | Ga0070695_101443105 | 3300005545 | Unclassified | 571 |
| 133 | Ga0070695_101616568 | 3300005545 | Bacteria | 541 |
| 134 | Ga0070696_100000089 | 3300005546 | Bacteria | 44686 |
| 135 | Ga0070696_100000482 | 3300005546 | Bacteria | 25020 |
| 136 | Ga0070696_100002485 | 3300005546 | Bacteria | 12219 |
| 137 | Ga0070696_100166322 | 3300005546 | Bacteria | 1628 |
| 138 | Ga0070696_100471717 | 3300005546 | Bacteria | 994 |
| 139 | Ga0070696_100603027 | 3300005546 | Bacteria | 885 |
| 140 | Ga0070696_100717106 | 3300005546 | Bacteria | 816 |
| 141 | Ga0070693_100000400 | 3300005547 | Bacteria | 19703 |
| 142 | Ga0070693_100168146 | 3300005547 | Bacteria | 1402 |
| 143 | Ga0070704_100000017 | 3300005549 | Bacteria | 57626 |
| 144 | Ga0070704_100009024 | 3300005549 | Bacteria | 6011 |
| 145 | Ga0070704_100025353 | 3300005549 | Bacteria | 3903 |
| 146 | Ga0070704_100421993 | 3300005549 | Bacteria | 1142 |
| 147 | Ga0070704_100623839 | 3300005549 | Bacteria | 949 |
| 148 | Ga0070704_100791533 | 3300005549 | Bacteria | 847 |
| 149 | Ga0068855_100002377 | 3300005563 | Bacteria | 23195 |
| 150 | Ga0068855_101574544 | 3300005563 | Bacteria | 673 |
| 151 | Ga0068857_100997366 | 3300005577 | Bacteria | 806 |
| 152 | Ga0068857_102182359 | 3300005577 | Bacteria | 544 |
| 153 | Ga0068854_100022368 | 3300005578 | Bacteria | 4306 |
| 154 | Ga0068854_102014307 | 3300005578 | Bacteria | 532 |
| 155 | Ga0068856_100142277 | 3300005614 | Bacteria | 2406 |
| 156 | Ga0070702_100000001 | 3300005615 | Bacteria | 87224 |
| 157 | Ga0070702_100018216 | 3300005615 | Bacteria | 3639 |
| 158 | Ga0070702_100239864 | 3300005615 | Bacteria | 1223 |
| 159 | Ga0068859_100000149 | 3300005617 | Bacteria | 66296 |
| 160 | Ga0068859_100249647 | 3300005617 | Bacteria | 1865 |
| 161 | Ga0068859_101059047 | 3300005617 | Bacteria | 892 |
| 162 | Ga0068859_101070061 | 3300005617 | Bacteria | 887 |
| 163 | Ga0068864_100009007 | 3300005618 | Bacteria | 8230 |
| 164 | Ga0068864_100082993 | 3300005618 | Bacteria | 2813 |
| 165 | Ga0068864_102069581 | 3300005618 | Bacteria | 575 |
| 166 | Ga0068866_10000326 | 3300005718 | Bacteria | 22539 |
| 167 | Ga0068861_100000428 | 3300005719 | Bacteria | 24436 |
| 168 | Ga0068861_100128148 | 3300005719 | Bacteria | 2056 |
| 169 | Ga0068861_100326403 | 3300005719 | Bacteria | 1338 |
| 170 | Ga0068870_10492096 | 3300005840 | Bacteria | 816 |
| 171 | Ga0068863_100262007 | 3300005841 | Bacteria | 1672 |
| 172 | Ga0068863_100283339 | 3300005841 | Bacteria | 1606 |
| 173 | Ga0068863_100299836 | 3300005841 | Bacteria | 1559 |
| 174 | Ga0068863_102046408 | 3300005841 | Bacteria | 583 |
| 175 | Ga0068858_100002902 | 3300005842 | Bacteria | 17243 |
| 176 | Ga0068858_100615355 | 3300005842 | Bacteria | 1054 |
| 177 | Ga0068858_101160466 | 3300005842 | Bacteria | 759 |
| 178 | Ga0068860_100001090 | 3300005843 | Bacteria | 29921 |
| 179 | Ga0068860_100894234 | 3300005843 | Bacteria | 904 |
| 180 | Ga0068862_100000409 | 3300005844 | Bacteria | 46422 |
| 181 | Ga0081538_10152692 | 3300005981 | Bacteria | 1042 |
| 182 | Ga0081539_10000686 | 3300005985 | Bacteria | 67858 |
| 183 | Ga0070715_10229490 | 3300006163 | Bacteria | 959 |
| 184 | Ga0070716_100101869 | 3300006173 | Bacteria | 1762 |
| 185 | Ga0070716_100445383 | 3300006173 | Bacteria | 943 |
| 186 | Ga0075367_10815908 | 3300006178 | Bacteria | 594 |
| 187 | Ga0097621_100000928 | 3300006237 | Bacteria | 20529 |
| 188 | Ga0068871_100011561 | 3300006358 | Bacteria | 6476 |
| 189 | Ga0068871_101248038 | 3300006358 | Bacteria | 698 |
| 190 | Ga0068871_101409027 | 3300006358 | Bacteria | 657 |
| 191 | Ga0068871_101459461 | 3300006358 | Bacteria | 646 |
| 192 | Ga0075428_100000083 | 3300006844 | Bacteria | 78689 |
| 193 | Ga0075428_100040406 | 3300006844 | Bacteria | 5132 |
| 194 | Ga0075428_100214190 | 3300006844 | Bacteria | 2081 |
| 195 | Ga0075428_100456878 | 3300006844 | Bacteria | 1368 |
| 196 | Ga0075430_100000550 | 3300006846 | Bacteria | 28484 |
| 197 | Ga0075430_100007696 | 3300006846 | Bacteria | 9098 |
| 198 | Ga0075430_100189368 | 3300006846 | Bacteria | 1710 |
| 199 | Ga0075430_100341025 | 3300006846 | Unclassified | 1238 |
| 200 | Ga0075430_100438589 | 3300006846 | Bacteria | 1078 |
| 201 | Ga0075430_100483458 | 3300006846 | Bacteria | 1022 |
| 202 | Ga0075430_100537999 | 3300006846 | Bacteria | 963 |
| 203 | Ga0075430_100776711 | 3300006846 | Bacteria | 789 |
| 204 | Ga0075430_100852917 | 3300006846 | Bacteria | 751 |
| 205 | Ga0075431_100016437 | 3300006847 | Bacteria | 7510 |
| 206 | Ga0075431_100123948 | 3300006847 | Bacteria | 2666 |
| 207 | Ga0075431_100353925 | 3300006847 | Bacteria | 1476 |
| 208 | Ga0075431_100397211 | 3300006847 | Bacteria | 1380 |
| 209 | Ga0075431_100443596 | 3300006847 | Bacteria | 1294 |
| 210 | Ga0075431_100522127 | 3300006847 | Bacteria | 1177 |
| 211 | Ga0075431_100656026 | 3300006847 | Bacteria | 1029 |
| 212 | Ga0075433_10033239 | 3300006852 | Bacteria | 4420 |
| 213 | Ga0075433_10164444 | 3300006852 | Bacteria | 1975 |
| 214 | Ga0075433_11086754 | 3300006852 | Bacteria | 696 |
| 215 | Ga0075434_100000011 | 3300006871 | Bacteria | 86261 |
| 216 | Ga0075434_100005363 | 3300006871 | Bacteria | 11665 |
| 217 | Ga0075434_100007734 | 3300006871 | Bacteria | 9953 |
| 218 | Ga0075434_100266698 | 3300006871 | Bacteria | 1731 |
| 219 | Ga0075434_101385976 | 3300006871 | Bacteria | 713 |
| 220 | Ga0075429_100000480 | 3300006880 | Bacteria | 29845 |
| 221 | Ga0075429_100069548 | 3300006880 | Bacteria | 3065 |
| 222 | Ga0075429_100072951 | 3300006880 | Bacteria | 2989 |
| 223 | Ga0075429_100226541 | 3300006880 | Unclassified | 1637 |
| 224 | Ga0075429_100254048 | 3300006880 | Bacteria | 1539 |
| 225 | Ga0075429_101078498 | 3300006880 | Bacteria | 702 |
| 226 | Ga0075429_101344870 | 3300006880 | Bacteria | 623 |
| 227 | Ga0068865_100000059 | 3300006881 | Bacteria | 58856 |
| 228 | Ga0075436_100003220 | 3300006914 | Bacteria | 11194 |
| 229 | Ga0075436_100004494 | 3300006914 | Bacteria | 9572 |
| 230 | Ga0075436_100014323 | 3300006914 | Bacteria | 5429 |
| 231 | Ga0075436_100042934 | 3300006914 | Bacteria | 3117 |
| 232 | Ga0075436_100164546 | 3300006914 | Bacteria | 1565 |
| 233 | Ga0075436_100166596 | 3300006914 | Bacteria | 1555 |
| 234 | Ga0075436_100504715 | 3300006914 | Bacteria | 885 |
| 235 | Ga0075436_100606801 | 3300006914 | Bacteria | 806 |
| 236 | Ga0097620_100000149 | 3300006931 | Bacteria | 66296 |
| 237 | Ga0097620_100249643 | 3300006931 | Bacteria | 1865 |
| 238 | Ga0097620_101059077 | 3300006931 | Bacteria | 892 |
| 239 | Ga0097620_101070087 | 3300006931 | Bacteria | 887 |
| 240 | Ga0075435_100000388 | 3300007076 | Bacteria | 26867 |
| 241 | Ga0075435_100029181 | 3300007076 | Bacteria | 4328 |
| 242 | Ga0075435_100060020 | 3300007076 | Bacteria | 3083 |
| 243 | Ga0075435_100129605 | 3300007076 | Bacteria | 2110 |
| 244 | Ga0075435_100663288 | 3300007076 | Bacteria | 906 |
| 245 | Ga0075435_100723078 | 3300007076 | Bacteria | 866 |
| 246 | Ga0075435_100772429 | 3300007076 | Bacteria | 836 |
| 247 | Ga0099794_10015782 | 3300007265 | Bacteria | 3340 |
| 248 | Ga0099794_10022481 | 3300007265 | Bacteria | 2875 |
| 249 | Ga0099794_10415968 | 3300007265 | Bacteria | 703 |
| 250 | Ga0099794_10421351 | 3300007265 | Bacteria | 698 |
| 251 | Ga0105251_10643320 | 3300009011 | Bacteria | 506 |
| 252 | Ga0105244_10492227 | 3300009036 | Bacteria | 564 |
| 253 | Ga0105240_10540267 | 3300009093 | Bacteria | 1291 |
| 254 | Ga0111539_10016381 | 3300009094 | Bacteria | 9192 |
| 255 | Ga0111539_10026004 | 3300009094 | Bacteria | 7163 |
| 256 | Ga0111539_10038453 | 3300009094 | Bacteria | 5771 |
| 257 | Ga0111539_10039269 | 3300009094 | Bacteria | 5706 |
| 258 | Ga0111539_10070916 | 3300009094 | Bacteria | 4112 |
| 259 | Ga0111539_10150838 | 3300009094 | Bacteria | 2721 |
| 260 | Ga0111539_10693456 | 3300009094 | Bacteria | 1185 |
| 261 | Ga0111539_10958092 | 3300009094 | Unclassified | 995 |
| 262 | Ga0111539_11783976 | 3300009094 | Bacteria | 713 |
| 263 | Ga0111539_13494213 | 3300009094 | Bacteria | 504 |
| 264 | Ga0105245_10000075 | 3300009098 | Bacteria | 103550 |
| 265 | Ga0105245_11176772 | 3300009098 | Bacteria | 814 |
| 266 | Ga0114129_10000210 | 3300009147 | Bacteria | 65476 |
| 267 | Ga0114129_10634184 | 3300009147 | Unclassified | 1381 |
| 268 | Ga0114129_10961706 | 3300009147 | Bacteria | 1078 |
| 269 | Ga0114129_11130110 | 3300009147 | Bacteria | 979 |
| 270 | Ga0114129_11193197 | 3300009147 | Bacteria | 948 |
| 271 | Ga0114129_11433701 | 3300009147 | Bacteria | 851 |
| 272 | Ga0114129_11444908 | 3300009147 | Unclassified | 847 |
| 273 | Ga0114129_11946484 | 3300009147 | Bacteria | 712 |
| 274 | Ga0114129_12507585 | 3300009147 | Bacteria | 616 |
| 275 | Ga0114129_12724503 | 3300009147 | Bacteria | 589 |
| 276 | Ga0105243_10000622 | 3300009148 | Bacteria | 35310 |
| 277 | Ga0105243_10010536 | 3300009148 | Bacteria | 7020 |
| 278 | Ga0105243_12273446 | 3300009148 | Bacteria | 579 |
| 279 | Ga0105241_10084412 | 3300009174 | Bacteria | 2493 |
| 280 | Ga0105242_10000407 | 3300009176 | Bacteria | 34281 |
| 281 | Ga0105242_10372148 | 3300009176 | Bacteria | 1325 |
| 282 | Ga0105242_12061126 | 3300009176 | Bacteria | 614 |
| 283 | Ga0105248_10217743 | 3300009177 | Bacteria | 2150 |
| 284 | Ga0105248_10414506 | 3300009177 | Bacteria | 1517 |
| 285 | Ga0105248_10838385 | 3300009177 | Bacteria | 1038 |
| 286 | Ga0105249_10002440 | 3300009553 | Bacteria | 16141 |
| 287 | Ga0105249_10004477 | 3300009553 | Bacteria | 12079 |
| 288 | Ga0105249_12614768 | 3300009553 | Unclassified | 577 |
| 289 | Ga0105239_10111905 | 3300010375 | Bacteria | 3027 |
| 290 | Ga0105246_12265558 | 3300011119 | Bacteria | 530 |
| 291 | Ga0157335_1035026 | 3300012492 | Bacteria | 543 |
| 292 | Ga0157378_10000074 | 3300013297 | Bacteria | 90608 |
| 293 | Ga0157378_12532270 | 3300013297 | Bacteria | 565 |
| 294 | Ga0163162_10757695 | 3300013306 | Bacteria | 1090 |
| 295 | Ga0163162_13341312 | 3300013306 | Unclassified | 513 |
| 296 | Ga0157372_10357574 | 3300013307 | Bacteria | 1701 |
| 297 | Ga0157375_11045777 | 3300013308 | Bacteria | 954 |
| 298 | Ga0157375_11079065 | 3300013308 | Bacteria | 939 |
| 299 | Ga0157380_10001505 | 3300014326 | Bacteria | 15283 |
| 300 | Ga0157380_10103645 | 3300014326 | Bacteria | 2374 |
| 301 | Ga0157380_10907627 | 3300014326 | Bacteria | 907 |
| 302 | Ga0157377_10065103 | 3300014745 | Bacteria | 2093 |
| 303 | Ga0157377_11447566 | 3300014745 | Bacteria | 544 |
| 304 | Ga0157379_10879275 | 3300014968 | Bacteria | 849 |
| 305 | Ga0157376_10021663 | 3300014969 | Bacteria | 4994 |
| 306 | Ga0163161_10691716 | 3300017792 | Bacteria | 848 |
| 307 | Ga0209437_119409 | 3300025233 | Bacteria | 855 |
| 308 | Ga0209455_1000031 | 3300025272 | Bacteria | 519952 |
| 309 | Ga0207653_10004464 | 3300025885 | Bacteria | 4387 |
| 310 | Ga0207692_10248029 | 3300025898 | Bacteria | 1066 |
| 311 | Ga0207642_10004209 | 3300025899 | Bacteria | 4629 |
| 312 | Ga0207688_10030324 | 3300025901 | Bacteria | 2981 |
| 313 | Ga0207688_10059207 | 3300025901 | Bacteria | 2157 |
| 314 | Ga0207688_10740502 | 3300025901 | Bacteria | 622 |
| 315 | Ga0207680_10244047 | 3300025903 | Bacteria | 1239 |
| 316 | Ga0207647_10657704 | 3300025904 | Unclassified | 574 |
| 317 | Ga0207685_10496850 | 3300025905 | Bacteria | 641 |
| 318 | Ga0207645_10263795 | 3300025907 | Bacteria | 1141 |
| 319 | Ga0207645_10270574 | 3300025907 | Bacteria | 1126 |
| 320 | Ga0207643_10428606 | 3300025908 | Bacteria | 839 |
| 321 | Ga0207654_10022847 | 3300025911 | Bacteria | 3342 |
| 322 | Ga0207707_10003163 | 3300025912 | Bacteria | 14617 |
| 323 | Ga0207707_10210452 | 3300025912 | Bacteria | 1694 |
| 324 | Ga0207707_10440915 | 3300025912 | Bacteria | 1115 |
| 325 | Ga0207707_10651865 | 3300025912 | Bacteria | 887 |
| 326 | Ga0207695_11243277 | 3300025913 | Bacteria | 625 |
| 327 | Ga0207663_10251923 | 3300025916 | Bacteria | 1300 |
| 328 | Ga0207663_10448430 | 3300025916 | Bacteria | 995 |
| 329 | Ga0207663_10511958 | 3300025916 | Bacteria | 934 |
| 330 | Ga0207660_10078664 | 3300025917 | Bacteria | 2417 |
| 331 | Ga0207660_10626293 | 3300025917 | Bacteria | 877 |
| 332 | Ga0207660_10720685 | 3300025917 | Unclassified | 814 |
| 333 | Ga0207660_10863670 | 3300025917 | Bacteria | 738 |
| 334 | Ga0207662_10000315 | 3300025918 | Bacteria | 22055 |
| 335 | Ga0207662_10129249 | 3300025918 | Bacteria | 1591 |
| 336 | Ga0207662_10171434 | 3300025918 | Bacteria | 1392 |
| 337 | Ga0207662_10173077 | 3300025918 | Bacteria | 1385 |
| 338 | Ga0207662_10283799 | 3300025918 | Bacteria | 1096 |
| 339 | Ga0207662_10543112 | 3300025918 | Bacteria | 804 |
| 340 | Ga0207649_11439209 | 3300025920 | Unclassified | 545 |
| 341 | Ga0207646_10404443 | 3300025922 | Bacteria | 1233 |
| 342 | Ga0207646_10663526 | 3300025922 | Bacteria | 934 |
| 343 | Ga0207681_10248018 | 3300025923 | Bacteria | 1389 |
| 344 | Ga0207650_11534089 | 3300025925 | Unclassified | 566 |
| 345 | Ga0207659_10068577 | 3300025926 | Bacteria | 2580 |
| 346 | Ga0207659_11884448 | 3300025926 | Bacteria | 507 |
| 347 | Ga0207687_10001426 | 3300025927 | Bacteria | 16345 |
| 348 | Ga0207687_11552174 | 3300025927 | Bacteria | 568 |
| 349 | Ga0207700_10760973 | 3300025928 | Bacteria | 866 |
| 350 | Ga0207700_11624483 | 3300025928 | Bacteria | 571 |
| 351 | Ga0207664_10398785 | 3300025929 | Bacteria | 1223 |
| 352 | Ga0207644_10029941 | 3300025931 | Bacteria | 3780 |
| 353 | Ga0207686_10000243 | 3300025934 | Bacteria | 41698 |
| 354 | Ga0207686_10753542 | 3300025934 | Bacteria | 777 |
| 355 | Ga0207709_10001387 | 3300025935 | Bacteria | 16961 |
| 356 | Ga0207670_10001067 | 3300025936 | Bacteria | 14456 |
| 357 | Ga0207670_10108375 | 3300025936 | Bacteria | 1996 |
| 358 | Ga0207670_10127750 | 3300025936 | Bacteria | 1857 |
| 359 | Ga0207670_10334710 | 3300025936 | Bacteria | 1195 |
| 360 | Ga0207670_10352382 | 3300025936 | Bacteria | 1166 |
| 361 | Ga0207670_11394570 | 3300025936 | Unclassified | 595 |
| 362 | Ga0207669_10659205 | 3300025937 | Bacteria | 857 |
| 363 | Ga0207704_10018253 | 3300025938 | Bacteria | 3658 |
| 364 | Ga0207704_11779416 | 3300025938 | Bacteria | 530 |
| 365 | Ga0207665_10132548 | 3300025939 | Bacteria | 1771 |
| 366 | Ga0207665_10144714 | 3300025939 | Bacteria | 1698 |
| 367 | Ga0207665_10317248 | 3300025939 | Bacteria | 1169 |
| 368 | Ga0207711_10618201 | 3300025941 | Bacteria | 1011 |
| 369 | Ga0207711_11811618 | 3300025941 | Bacteria | 553 |
| 370 | Ga0207689_10000007 | 3300025942 | Bacteria | 132362 |
| 371 | Ga0207689_10097695 | 3300025942 | Bacteria | 2412 |
| 372 | Ga0207689_10259174 | 3300025942 | Bacteria | 1438 |
| 373 | Ga0207689_10562218 | 3300025942 | Bacteria | 958 |
| 374 | Ga0207661_10116956 | 3300025944 | Bacteria | 2264 |
| 375 | Ga0207661_11151068 | 3300025944 | Bacteria | 714 |
| 376 | Ga0207667_10077643 | 3300025949 | Bacteria | 3443 |
| 377 | Ga0207667_11302905 | 3300025949 | Bacteria | 703 |
| 378 | Ga0207651_10195881 | 3300025960 | Bacteria | 1615 |
| 379 | Ga0207651_10251540 | 3300025960 | Bacteria | 1446 |
| 380 | Ga0207651_11099234 | 3300025960 | Unclassified | 712 |
| 381 | Ga0207712_10002821 | 3300025961 | Bacteria | 11132 |
| 382 | Ga0207668_11245685 | 3300025972 | Bacteria | 669 |
| 383 | Ga0207640_10015170 | 3300025981 | Bacteria | 4454 |
| 384 | Ga0207677_10000823 | 3300026023 | Bacteria | 17732 |
| 385 | Ga0207677_10335847 | 3300026023 | Bacteria | 1261 |
| 386 | Ga0207677_10919033 | 3300026023 | Bacteria | 790 |
| 387 | Ga0207703_10102600 | 3300026035 | Bacteria | 2427 |
| 388 | Ga0207703_10345945 | 3300026035 | Bacteria | 1368 |
| 389 | Ga0207639_10520357 | 3300026041 | Bacteria | 1089 |
| 390 | Ga0207708_10000086 | 3300026075 | Bacteria | 73314 |
| 391 | Ga0207708_10113450 | 3300026075 | Bacteria | 2106 |
| 392 | Ga0207708_10202555 | 3300026075 | Bacteria | 1584 |
| 393 | Ga0207708_10251397 | 3300026075 | Bacteria | 1424 |
| 394 | Ga0207708_10354104 | 3300026075 | Bacteria | 1205 |
| 395 | Ga0207708_10561004 | 3300026075 | Bacteria | 964 |
| 396 | Ga0207708_11288530 | 3300026075 | Bacteria | 640 |
| 397 | Ga0207708_11522484 | 3300026075 | Unclassified | 588 |
| 398 | Ga0207708_11779641 | 3300026075 | Bacteria | 541 |
| 399 | Ga0207702_10145265 | 3300026078 | Bacteria | 2152 |
| 400 | Ga0207641_10161054 | 3300026088 | Bacteria | 2040 |
| 401 | Ga0207641_10225916 | 3300026088 | Bacteria | 1738 |
| 402 | Ga0207641_10312390 | 3300026088 | Bacteria | 1488 |
| 403 | Ga0207641_10423615 | 3300026088 | Bacteria | 1282 |
| 404 | Ga0207648_10000079 | 3300026089 | Bacteria | 92044 |
| 405 | Ga0207648_10377073 | 3300026089 | Bacteria | 1282 |
| 406 | Ga0207648_11126314 | 3300026089 | Bacteria | 736 |
| 407 | Ga0207648_12189534 | 3300026089 | Bacteria | 514 |
| 408 | Ga0207676_10037278 | 3300026095 | Bacteria | 3704 |
| 409 | Ga0207676_10321696 | 3300026095 | Bacteria | 1420 |
| 410 | Ga0207674_10159116 | 3300026116 | Bacteria | 2213 |
| 411 | Ga0207675_100000093 | 3300026118 | Bacteria | 70343 |
| 412 | Ga0207675_100144068 | 3300026118 | Bacteria | 2265 |
| 413 | Ga0207675_100654318 | 3300026118 | Bacteria | 1057 |
| 414 | Ga0207675_100829724 | 3300026118 | Bacteria | 939 |
| 415 | Ga0207683_10327647 | 3300026121 | Bacteria | 1403 |
| 416 | Ga0209969_1000430 | 3300027360 | Bacteria | 5605 |
| 417 | Ga0209969_1001086 | 3300027360 | Bacteria | 3731 |
| 418 | Ga0209969_1003617 | 3300027360 | Bacteria | 2142 |
| 419 | Ga0209969_1016600 | 3300027360 | Bacteria | 1081 |
| 420 | Ga0209967_1000417 | 3300027364 | Bacteria | 5603 |
| 421 | Ga0209967_1001327 | 3300027364 | Bacteria | 3170 |
| 422 | Ga0209967_1003025 | 3300027364 | Bacteria | 2207 |
| 423 | Ga0209981_1001444 | 3300027378 | Bacteria | 3001 |
| 424 | Ga0209981_1001566 | 3300027378 | Bacteria | 2895 |
| 425 | Ga0209981_1010103 | 3300027378 | Bacteria | 1293 |
| 426 | Ga0209981_1021781 | 3300027378 | Bacteria | 918 |
| 427 | Ga0209996_1026728 | 3300027395 | Bacteria | 828 |
| 428 | Ga0209996_1060653 | 3300027395 | Bacteria | 581 |
| 429 | Ga0210000_1000446 | 3300027462 | Bacteria | 5675 |
| 430 | Ga0210000_1001892 | 3300027462 | Bacteria | 2958 |
| 431 | Ga0210000_1002212 | 3300027462 | Bacteria | 2757 |
| 432 | Ga0210000_1042787 | 3300027462 | Unclassified | 720 |
| 433 | Ga0209995_1000255 | 3300027471 | Bacteria | 8527 |
| 434 | Ga0209995_1001597 | 3300027471 | Bacteria | 3511 |
| 435 | Ga0209995_1007282 | 3300027471 | Bacteria | 1784 |
| 436 | Ga0209995_1028014 | 3300027471 | Bacteria | 940 |
| 437 | Ga0209968_1002375 | 3300027526 | Bacteria | 2843 |
| 438 | Ga0209968_1003221 | 3300027526 | Bacteria | 2445 |
| 439 | Ga0209968_1018430 | 3300027526 | Bacteria | 1118 |
| 440 | Ga0209968_1065309 | 3300027526 | Unclassified | 644 |
| 441 | Ga0209999_1000334 | 3300027543 | Bacteria | 7086 |
| 442 | Ga0209999_1007955 | 3300027543 | Bacteria | 1906 |
| 443 | Ga0209999_1032187 | 3300027543 | Bacteria | 974 |
| 444 | Ga0209999_1042378 | 3300027543 | Bacteria | 854 |
| 445 | Ga0209983_1052129 | 3300027665 | Bacteria | 896 |
| 446 | Ga0209588_1045166 | 3300027671 | Bacteria | 1425 |
| 447 | Ga0209588_1259659 | 3300027671 | Bacteria | 529 |
| 448 | Ga0209971_1007609 | 3300027682 | Bacteria | 2572 |
| 449 | Ga0209971_1010313 | 3300027682 | Bacteria | 2212 |
| 450 | Ga0209966_1005660 | 3300027695 | Bacteria | 2148 |
| 451 | Ga0209966_1016285 | 3300027695 | Bacteria | 1405 |
| 452 | Ga0209998_10031398 | 3300027717 | Bacteria | 1177 |
| 453 | Ga0209974_10001421 | 3300027876 | Bacteria | 8660 |
| 454 | Ga0209974_10009715 | 3300027876 | Bacteria | 3264 |
| 455 | Ga0209974_10032169 | 3300027876 | Bacteria | 1738 |
| 456 | Ga0209974_10169376 | 3300027876 | Bacteria | 796 |
| 457 | Ga0207428_10000321 | 3300027907 | Bacteria | 62664 |
| 458 | Ga0207428_10024838 | 3300027907 | Bacteria | 5027 |
| 459 | Ga0207428_10062422 | 3300027907 | Bacteria | 2946 |
| 460 | Ga0207428_10142297 | 3300027907 | Bacteria | 1829 |
| 461 | Ga0207428_10214049 | 3300027907 | Bacteria | 1447 |
| 462 | Ga0207428_10534253 | 3300027907 | Bacteria | 849 |
| 463 | Ga0268265_10003346 | 3300028380 | Bacteria | 11597 |
| 464 | Ga0268265_10551255 | 3300028380 | Bacteria | 1094 |
| 465 | Ga0268264_10001077 | 3300028381 | Bacteria | 27026 |
| 466 | Ga0268264_10231781 | 3300028381 | Bacteria | 1706 |
| 467 | Ga0268264_11229884 | 3300028381 | Bacteria | 759 |
| 468 | Ga0307408_100164000 | 3300031548 | Unclassified | 1768 |
| 469 | Ga0307408_100481287 | 3300031548 | Bacteria | 1083 |
| 470 | Ga0307408_100759153 | 3300031548 | Bacteria | 877 |
| 471 | Ga0307408_101274824 | 3300031548 | Bacteria | 688 |
| 472 | Ga0307408_101627004 | 3300031548 | Bacteria | 614 |
| 473 | Ga0307408_101637079 | 3300031548 | Bacteria | 612 |
| 474 | Ga0307405_10174146 | 3300031731 | Unclassified | 1538 |
| 475 | Ga0307410_11808088 | 3300031852 | Bacteria | 543 |
| 476 | Ga0307406_10641146 | 3300031901 | Bacteria | 881 |
| 477 | Ga0307407_10873038 | 3300031903 | Bacteria | 689 |
| 478 | Ga0307412_10106667 | 3300031911 | Bacteria | 1992 |
| 479 | Ga0307412_10197098 | 3300031911 | Bacteria | 1527 |
| 480 | Ga0307412_10733636 | 3300031911 | Bacteria | 851 |
| 481 | Ga0307412_10972524 | 3300031911 | Bacteria | 748 |
| 482 | Ga0307409_102277653 | 3300031995 | Bacteria | 571 |
| 483 | Ga0307416_100183675 | 3300032002 | Bacteria | 1963 |
| 484 | Ga0307416_100343938 | 3300032002 | Unclassified | 1506 |
| 485 | Ga0307416_100474965 | 3300032002 | Bacteria | 1309 |
| 486 | Ga0307416_101611686 | 3300032002 | Bacteria | 754 |
| 487 | Ga0307416_101652519 | 3300032002 | Bacteria | 745 |
| 488 | Ga0307411_10349598 | 3300032005 | Bacteria | 1205 |
| 489 | Ga0307411_10466326 | 3300032005 | Bacteria | 1060 |
| 490 | Ga0307411_10887640 | 3300032005 | Bacteria | 791 |
| 491 | Ga0307411_11016350 | 3300032005 | Bacteria | 743 |
| 492 | Ga0307411_11147741 | 3300032005 | Unclassified | 702 |
| 493 | Ga0307411_11583439 | 3300032005 | Bacteria | 604 |
| 494 | Ga0307411_11747277 | 3300032005 | Bacteria | 576 |
| 495 | Ga0316583_10124335 | 3300032133 | Unclassified | 899 |
| 496 | Ga0373948_0043427 | 3300034817 | Bacteria | 947 |
| 497 | Ga0373938_0077990 | 3300034957 | Bacteria | 802 |
| 498 | Ga0373926_0037450 | 3300035083 | Bacteria | 1725 |
| 499 | Ga0373928_0001275 | 3300035084 | Bacteria | 4964 |
| 500 | Ga0373928_0033048 | 3300035084 | Bacteria | 1156 |
| 501 | Ga0373928_0176903 | 3300035084 | Bacteria | 604 |
| 502 | Ga0373929_0110196 | 3300035085 | Bacteria | 703 |
| 503 | Ga0373929_0154870 | 3300035085 | Bacteria | 617 |
| 504 | Ga0373929_0234115 | 3300035085 | Bacteria | 527 |
| 505 | Ga0373934_0018623 | 3300035086 | Bacteria | 2658 |
| 506 | Ga0373934_0327756 | 3300035086 | Bacteria | 636 |
| 507 | Ga0373940_0069540 | 3300035088 | Bacteria | 1022 |
| 508 | Ga0373940_0242819 | 3300035088 | Bacteria | 605 |
| 509 | Ga0373944_0007607 | 3300035089 | Bacteria | 2908 |
| 510 | Ga0373944_0032245 | 3300035089 | Bacteria | 1581 |
| 511 | Ga0373949_0135679 | 3300035090 | Bacteria | 701 |
| 512 | Ga0373949_0241556 | 3300035090 | Bacteria | 556 |
| 513 | Ga0373951_0082723 | 3300035091 | Bacteria | 833 |
| 514 | Ga0373951_0187381 | 3300035091 | Bacteria | 597 |
| 515 | Ga0373952_0001950 | 3300035092 | Bacteria | 3737 |
| 516 | Ga0373952_0163933 | 3300035092 | Bacteria | 631 |
| 517 | Ga0373952_0171573 | 3300035092 | Unclassified | 620 |
| 518 | Ga0373923_0079537 | 3300035111 | Bacteria | 1420 |
| 519 | Ga0373923_0303738 | 3300035111 | Bacteria | 755 |
| 520 | Ga0373932_0002438 | 3300035112 | Bacteria | 4717 |
| 521 | Ga0373932_0133532 | 3300035112 | Bacteria | 838 |
| 522 | Ga0373932_0231573 | 3300035112 | Bacteria | 668 |
| 523 | Ga0373936_0029588 | 3300035113 | Bacteria | 2156 |
| 524 | Ga0373936_0252223 | 3300035113 | Bacteria | 788 |
| 525 | Ga0373936_0348296 | 3300035113 | Bacteria | 674 |
| 526 | Ga0373939_0002522 | 3300035114 | Bacteria | 4308 |
| 527 | Ga0373939_0136570 | 3300035114 | Bacteria | 880 |
| 528 | Ga0373941_0031727 | 3300035115 | Bacteria | 1576 |
| 529 | Ga0373941_0113920 | 3300035115 | Bacteria | 956 |
| 530 | Ga0373941_0300139 | 3300035115 | Bacteria | 641 |
| 531 | Ga0373945_0001661 | 3300035116 | Bacteria | 6831 |
| 532 | Ga0373953_0002608 | 3300035117 | Bacteria | 5457 |
| 533 | Ga0373954_0000002 | 3300035118 | Bacteria | 147478 |
| 534 | Ga0373954_0204650 | 3300035118 | Bacteria | 970 |
| 535 | Ga0373956_0156368 | 3300035119 | Bacteria | 1073 |
| 536 | Ga0373956_0173831 | 3300035119 | Bacteria | 1017 |
| 537 | Ga0373957_0023276 | 3300035120 | Bacteria | 2214 |
| 538 | Ga0373960_0015187 | 3300035121 | Bacteria | 1961 |
| 539 | Ga0373960_0169062 | 3300035121 | Bacteria | 757 |
| 540 | Ga0373960_0221428 | 3300035121 | Bacteria | 677 |
| 541 | Ga0373943_0010824 | 3300035170 | Bacteria | 4094 |
| 542 | Ga0373943_0097712 | 3300035170 | Bacteria | 1530 |
| 543 | Ga0373943_0885911 | 3300035170 | Bacteria | 533 |
| 544 | Ga0373946_0005645 | 3300035171 | Bacteria | 4519 |
| 545 | Ga0373946_0041970 | 3300035171 | Bacteria | 1878 |
| 546 | Ga0373955_0038672 | 3300035172 | Bacteria | 2543 |
| 547 | Ga0373955_0083592 | 3300035172 | Bacteria | 1809 |
| 548 | Ga0373955_0299717 | 3300035172 | Bacteria | 969 |
| 549 | Ga0373955_0824571 | 3300035172 | Unclassified | 570 |
| 550 | Ga0373942_0006452 | 3300035207 | Bacteria | 2710 |
| 551 | Ga0373942_0098176 | 3300035207 | Bacteria | 891 |
| 552 | Ga0373961_0025476 | 3300035241 | Bacteria | 1608 |
| 553 | Ga0373961_0050216 | 3300035241 | Bacteria | 1235 |
| 554 | Ga0373962_0011183 | 3300035242 | Bacteria | 2246 |
| 555 | Ga0373962_0063589 | 3300035242 | Bacteria | 1089 |
| 556 | Ga0316574_0801827 | 3300035398 | Bacteria | 573 |
| 557 | Ga0373924_0069540 | 3300035410 | Bacteria | 1483 |
| 558 | Ga0373924_0084250 | 3300035410 | Bacteria | 1355 |
| 559 | Ga0373924_0203820 | 3300035410 | Bacteria | 873 |
| 560 | Ga0373924_0221463 | 3300035410 | Bacteria | 836 |
| 561 | Ga0373931_0000265 | 3300035691 | Bacteria | 22203 |
| 562 | Ga0373931_0008664 | 3300035691 | Bacteria | 4835 |
| 563 | Ga0373931_0034304 | 3300035691 | Bacteria | 2633 |
| 564 | Ga0373931_0120090 | 3300035691 | Bacteria | 1501 |
| 565 | Ga0373931_0441787 | 3300035691 | Bacteria | 831 |
| 566 | Ga0373935_0029727 | 3300035692 | Bacteria | 3382 |
| 567 | Ga0373935_0033469 | 3300035692 | Bacteria | 3198 |
| 568 | Ga0373935_0324545 | 3300035692 | Bacteria | 1093 |
| 569 | Ga0373927_0078223 | 3300035695 | Bacteria | 2142 |
| 570 | Ga0373927_0114908 | 3300035695 | Bacteria | 1754 |
| 571 | Ga0373933_0000657 | 3300035724 | Bacteria | 21450 |
| 572 | Ga0373933_0015090 | 3300035724 | Bacteria | 4305 |
| 573 | Ga0373933_0202219 | 3300035724 | Bacteria | 1271 |
| 574 | Ga0373947_0009354 | 3300035725 | Bacteria | 5630 |
| 575 | Ga0373947_0036354 | 3300035725 | Bacteria | 2920 |
| 576 | Ga0373947_1037173 | 3300035725 | Unclassified | 559 |
| 577 | Ga0373937_0000358 | 3300036401 | Bacteria | 42468 |
| 578 | Ga0373937_0006046 | 3300036401 | Bacteria | 10424 |
| 579 | Ga0373937_0193976 | 3300036401 | Bacteria | 1909 |
| 580 | Ga0373937_0218547 | 3300036401 | Bacteria | 1793 |
| 581 | Ga0373925_0002889 | 3300037068 | Bacteria | 13571 |
| 582 | Ga0373925_0040234 | 3300037068 | Bacteria | 3460 |
| 583 | Ga0373925_0110612 | 3300037068 | Bacteria | 2122 |
| 584 | Ga0373925_0777110 | 3300037068 | Bacteria | 790 |
| 585 | Ga0373925_1153276 | 3300037068 | Bacteria | 637 |
| 586 | Ga0373925_1193750 | 3300037068 | Bacteria | 625 |
| 587 | Ga0373925_1537367 | 3300037068 | Bacteria | 544 |
| 588 | Ga0439461_0002213 | 3300041410 | Bacteria | 3086 |
| 589 | Ga0451839_1400463 | 3300041496 | Bacteria | 1248 |
| 590 | Ga0451845_0711978 | 3300041501 | Bacteria | 647 |
| 591 | Ga0439441_002685 | 3300042001 | Bacteria | 2529 |
| 592 | Ga0439441_013676 | 3300042001 | Bacteria | 1412 |
| 593 | Ga0439443_012970 | 3300042003 | Bacteria | 1240 |
| 594 | Ga0439454_015792 | 3300042011 | Bacteria | 1061 |
| 595 | Ga0439456_014934 | 3300042013 | Bacteria | 1620 |
| 596 | Ga0439463_145298 | 3300042016 | Bacteria | 615 |
| 597 | Ga0450888_080082 | 3300042126 | Unclassified | 501 |
| 598 | Ga0450910_040851 | 3300042147 | Bacteria | 749 |
| 599 | Ga0439446_0000176 | 3300042156 | Bacteria | 11244 |
| 600 | Ga0439446_0181296 | 3300042156 | Unclassified | 704 |
| 601 | Ga0439434_0001633 | 3300042435 | Bacteria | 6483 |
| 602 | Ga0439434_0063431 | 3300042435 | Bacteria | 1158 |
| 603 | Ga0439435_0000026 | 3300042436 | Bacteria | 16073 |
| 604 | Ga0439444_0003007 | 3300042437 | Bacteria | 2352 |
| 605 | Ga0439464_0069306 | 3300042439 | Bacteria | 1042 |
| 606 | Ga0439460_0044333 | 3300042461 | Bacteria | 1316 |
| 607 | Ga0450918_100795 | 3300042531 | Bacteria | 565 |
| 608 | Ga0451577_0050315 | 3300042876 | Bacteria | 3720 |
| 609 | Ga0451577_0470068 | 3300042876 | Bacteria | 1142 |
| 610 | Ga0466965_0165682 | 3300044683 | Bacteria | 1160 |
| 611 | Ga0466963_0049527 | 3300044694 | Bacteria | 2779 |
| 612 | Ga0466964_0004501 | 3300044706 | Bacteria | 5145 |
| 613 | Ga0466964_0339405 | 3300044706 | Bacteria | 769 |
| 614 | Ga0453684_0319001 | 3300044712 | Bacteria | 1761 |
| 615 | Ga0453684_1389708 | 3300044712 | Bacteria | 729 |
| 616 | Ga0451576_0001306 | 3300045051 | Bacteria | 43171 |
| 617 | Ga0451576_0035821 | 3300045051 | Bacteria | 5262 |
| 618 | Ga0451576_0146167 | 3300045051 | Bacteria | 2465 |
| 619 | Ga0451576_0193274 | 3300045051 | Bacteria | 2125 |
| 620 | Ga0451576_0311617 | 3300045051 | Bacteria | 1646 |
| 621 | Ga0451576_0510906 | 3300045051 | Bacteria | 1262 |
| 622 | Ga0451576_0679899 | 3300045051 | Bacteria | 1081 |
| 623 | Ga0451576_0701437 | 3300045051 | Bacteria | 1063 |
| 624 | Ga0451576_2583611 | 3300045051 | Unclassified | 518 |
| 625 | Ga0466958_0145560 | 3300045836 | Bacteria | 1493 |
| 626 | Ga0466967_0020049 | 3300045976 | Bacteria | 5393 |
| 627 | Ga0495592_0003821 | 3300046454 | Bacteria | 10887 |
| 628 | Ga0495592_0551946 | 3300046454 | Bacteria | 708 |
| 629 | Ga0495603_0013943 | 3300046455 | Bacteria | 4860 |
| 630 | Ga0495603_0607940 | 3300046455 | Unclassified | 626 |
| 631 | Ga0495641_0235955 | 3300046461 | Bacteria | 821 |
| 632 | Ga0495651_0279044 | 3300046462 | Bacteria | 1130 |
| 633 | Ga0495651_0287408 | 3300046462 | Bacteria | 1108 |
| 634 | Ga0495651_0343714 | 3300046462 | Bacteria | 988 |
| 635 | Ga0495653_0132467 | 3300046463 | Bacteria | 1763 |
| 636 | Ga0495653_0586168 | 3300046463 | Unclassified | 687 |
| 637 | Ga0495580_0033208 | 3300046472 | Bacteria | 3719 |
| 638 | Ga0495582_0018968 | 3300046473 | Bacteria | 3764 |
| 639 | Ga0495639_0022242 | 3300046475 | Bacteria | 2781 |
| 640 | Ga0495639_0058813 | 3300046475 | Bacteria | 1759 |
| 641 | Ga0495662_0008976 | 3300046476 | Bacteria | 4910 |
| 642 | Ga0495664_0258423 | 3300046477 | Bacteria | 1053 |
| 643 | Ga0495584_0072974 | 3300046491 | Bacteria | 1725 |
| 644 | Ga0495594_0264567 | 3300046499 | Bacteria | 979 |
| 645 | Ga0495608_0002044 | 3300046511 | Bacteria | 14501 |
| 646 | Ga0495608_0418106 | 3300046511 | Bacteria | 818 |
| 647 | Ga0495618_0022560 | 3300046514 | Bacteria | 3888 |
| 648 | Ga0495628_0016487 | 3300046516 | Bacteria | 6161 |
| 649 | Ga0495628_0453205 | 3300046516 | Bacteria | 931 |
| 650 | Ga0495630_0001185 | 3300046517 | Bacteria | 17975 |
| 651 | Ga0495630_0039270 | 3300046517 | Bacteria | 3540 |
| 652 | Ga0495630_0622469 | 3300046517 | Bacteria | 827 |
| 653 | Ga0495666_0003317 | 3300046526 | Bacteria | 8133 |
| 654 | Ga0495642_0199025 | 3300046528 | Bacteria | 873 |
| 655 | Ga0495642_0257853 | 3300046528 | Bacteria | 762 |
| 656 | Ga0495652_0033401 | 3300046529 | Bacteria | 4491 |
| 657 | Ga0495652_0180923 | 3300046529 | Bacteria | 1618 |
| 658 | Ga0495665_0309752 | 3300046531 | Bacteria | 807 |
| 659 | Ga0495640_0000808 | 3300046533 | Bacteria | 23777 |
| 660 | Ga0495640_0004665 | 3300046533 | Bacteria | 10928 |
| 661 | Ga0495640_0582423 | 3300046533 | Unclassified | 677 |
| 662 | Ga0495586_0000440 | 3300046535 | Bacteria | 24985 |
| 663 | Ga0495586_0009939 | 3300046535 | Bacteria | 5068 |
| 664 | Ga0495586_0028778 | 3300046535 | Bacteria | 2973 |
| 665 | Ga0495598_0037970 | 3300046537 | Bacteria | 1392 |
| 666 | Ga0495598_0103180 | 3300046537 | Bacteria | 946 |
| 667 | Ga0495598_0163324 | 3300046537 | Bacteria | 785 |
| 668 | Ga0495598_0295255 | 3300046537 | Bacteria | 612 |
| 669 | Ga0495621_0029158 | 3300046539 | Bacteria | 1880 |
| 670 | Ga0495621_0058828 | 3300046539 | Bacteria | 1391 |
| 671 | Ga0495645_0274616 | 3300046543 | Bacteria | 1111 |
| 672 | Ga0495622_0300432 | 3300046557 | Bacteria | 700 |
| 673 | Ga0495633_0375027 | 3300046558 | Bacteria | 644 |
| 674 | Ga0495667_0001153 | 3300046559 | Bacteria | 17225 |
| 675 | Ga0495667_0192726 | 3300046559 | Bacteria | 1306 |
| 676 | Ga0495667_0230699 | 3300046559 | Bacteria | 1180 |
| 677 | Ga0495656_0225811 | 3300046615 | Bacteria | 938 |
| 678 | Ga0495634_0002587 | 3300046642 | Bacteria | 14917 |
| 679 | Ga0495634_0091842 | 3300046642 | Bacteria | 1970 |
| 680 | Ga0495635_0097799 | 3300046663 | Bacteria | 2006 |
| 681 | Ga0495635_0132240 | 3300046663 | Bacteria | 1701 |
| 682 | Ga0495659_0051963 | 3300046664 | Bacteria | 1494 |
| 683 | Ga0495588_0078511 | 3300046674 | Bacteria | 1722 |
| 684 | Ga0495657_0302645 | 3300046675 | Bacteria | 953 |
| 685 | Ga0495657_0825119 | 3300046675 | Bacteria | 529 |
| 686 | Ga0495599_0007763 | 3300046678 | Bacteria | 6512 |
| 687 | Ga0495647_0049604 | 3300046681 | Bacteria | 1626 |
| 688 | Ga0495647_0419253 | 3300046681 | Bacteria | 617 |
| 689 | Ga0495658_0004220 | 3300046683 | Bacteria | 7071 |
| 690 | Ga0495658_0172434 | 3300046683 | Bacteria | 1339 |
| 691 | Ga0495669_0004311 | 3300046684 | Bacteria | 5870 |
| 692 | Ga0495613_0025295 | 3300046689 | Bacteria | 4423 |
| 693 | Ga0495624_0034028 | 3300046690 | Bacteria | 3299 |
| 694 | Ga0495624_0199350 | 3300046690 | Bacteria | 1216 |
| 695 | Ga0495600_0008016 | 3300046809 | Bacteria | 6473 |
| 696 | Ga0495581_0175427 | 3300047315 | Bacteria | 1253 |
| 697 | Ga0495604_0002447 | 3300047317 | Bacteria | 14851 |
| 698 | Ga0495604_0100700 | 3300047317 | Bacteria | 2124 |
| 699 | Ga0495604_0134414 | 3300047317 | Bacteria | 1774 |
| 700 | Ga0495636_0133687 | 3300047318 | Bacteria | 1104 |
| 701 | Ga0495636_0312728 | 3300047318 | Bacteria | 736 |
| 702 | Ga0495636_0609051 | 3300047318 | Unclassified | 534 |
| 703 | Ga0495636_0699755 | 3300047318 | Bacteria | 500 |
| 704 | Ga0495674_0123030 | 3300047319 | Bacteria | 2191 |
| 705 | Ga0495674_0285677 | 3300047319 | Bacteria | 1351 |
| 706 | Ga0495676_0019304 | 3300047321 | Bacteria | 5998 |
| 707 | Ga0495680_0001572 | 3300047322 | Bacteria | 24459 |
| 708 | Ga0495680_0296405 | 3300047322 | Bacteria | 1136 |
| 709 | Ga0495675_0319881 | 3300047444 | Bacteria | 918 |
| 710 | Ga0495675_0528769 | 3300047444 | Bacteria | 674 |
| 711 | Ga0495677_0263386 | 3300047445 | Bacteria | 675 |
| 712 | Ga0495684_0018458 | 3300047471 | Bacteria | 5374 |
| 713 | Ga0495614_0339553 | 3300048089 | Bacteria | 699 |
| 714 | Ga0495614_0425781 | 3300048089 | Unclassified | 626 |
| 715 | Ga0496100_0285861 | 3300048903 | Unclassified | 1231 |
| 716 | Ga0496101_0367531 | 3300048904 | Unclassified | 1131 |
| 717 | Ga0496104_0797108 | 3300048907 | Bacteria | 851 |
| 718 | Ga0496106_0074134 | 3300048909 | Bacteria | 2605 |
| 719 | Ga0496114_0093146 | 3300048917 | Bacteria | 2561 |
| 720 | Ga0501291_091408 | 3300049514 | Bacteria | 622 |
| 721 | Ga0501292_036836 | 3300049515 | Bacteria | 836 |
| 722 | Ga0501296_013948 | 3300049519 | Bacteria | 982 |
| 723 | Ga0501296_045493 | 3300049519 | Bacteria | 630 |
| 724 | Ga0501298_014855 | 3300049521 | Bacteria | 1396 |
| 725 | Ga0501299_005994 | 3300049522 | Bacteria | 1892 |
| 726 | Ga0501299_021606 | 3300049522 | Bacteria | 1181 |
| 727 | Ga0501299_172976 | 3300049522 | Bacteria | 559 |
| 728 | Ga0501031_0283837 | 3300049568 | Bacteria | 1074 |
| 729 | Ga0501031_0837714 | 3300049568 | Bacteria | 589 |
| 730 | Ga0501032_0400987 | 3300049569 | Bacteria | 881 |
| 731 | Ga0501036_0518807 | 3300049572 | Bacteria | 991 |
| 732 | Ga0501036_1198192 | 3300049572 | Bacteria | 619 |
| 733 | Ga0501037_0481448 | 3300049573 | Bacteria | 844 |
| 734 | Ga0501038_0427688 | 3300049574 | Bacteria | 1021 |
| 735 | Ga0501038_0746776 | 3300049574 | Bacteria | 730 |
| 736 | Ga0501039_0085414 | 3300049575 | Bacteria | 2458 |
| 737 | Ga0501039_0174792 | 3300049575 | Bacteria | 1689 |
| 738 | Ga0501039_0344457 | 3300049575 | Bacteria | 1171 |
| 739 | Ga0501040_0016065 | 3300049576 | Bacteria | 4951 |
| 740 | Ga0501040_0263815 | 3300049576 | Bacteria | 1229 |
| 741 | Ga0501040_0541392 | 3300049576 | Bacteria | 840 |
| 742 | Ga0501040_1325192 | 3300049576 | Bacteria | 522 |
| 743 | Ga0501041_0441151 | 3300049577 | Bacteria | 826 |
| 744 | Ga0501041_0767380 | 3300049577 | Bacteria | 618 |
| 745 | Ga0501042_0341249 | 3300049578 | Bacteria | 1083 |
| 746 | Ga0501042_0444854 | 3300049578 | Bacteria | 940 |
| 747 | Ga0501042_1199542 | 3300049578 | Bacteria | 553 |
| 748 | Ga0501042_1367739 | 3300049578 | Bacteria | 516 |
| 749 | Ga0501043_0238284 | 3300049579 | Bacteria | 1404 |
| 750 | Ga0501046_0484505 | 3300049580 | Bacteria | 887 |
| 751 | Ga0501047_0875526 | 3300049581 | Bacteria | 712 |
| 752 | Ga0501048_0171493 | 3300049582 | Bacteria | 1537 |
| 753 | Ga0501048_0762931 | 3300049582 | Unclassified | 695 |
| 754 | Ga0501048_1266525 | 3300049582 | Unclassified | 530 |
| 755 | Ga0501048_1283986 | 3300049582 | Unclassified | 526 |
| 756 | Ga0501068_0258697 | 3300049584 | Bacteria | 1110 |
| 757 | Ga0501068_1186248 | 3300049584 | Bacteria | 506 |
| 758 | Ga0501069_0086665 | 3300049585 | Bacteria | 1768 |
| 759 | Ga0501069_0106646 | 3300049585 | Bacteria | 1593 |
| 760 | Ga0501069_0890123 | 3300049585 | Bacteria | 541 |
| 761 | Ga0501071_0264776 | 3300049587 | Bacteria | 1299 |
| 762 | Ga0501071_0574110 | 3300049587 | Bacteria | 866 |
| 763 | Ga0501071_0667808 | 3300049587 | Bacteria | 800 |
| 764 | Ga0501071_1107370 | 3300049587 | Bacteria | 612 |
| 765 | Ga0501071_1191915 | 3300049587 | Bacteria | 588 |
| 766 | Ga0501071_1448855 | 3300049587 | Bacteria | 530 |
| 767 | Ga0501072_0060734 | 3300049588 | Bacteria | 2980 |
| 768 | Ga0501072_0189057 | 3300049588 | Bacteria | 1642 |
| 769 | Ga0501072_0328206 | 3300049588 | Bacteria | 1216 |
| 770 | Ga0501072_0953160 | 3300049588 | Bacteria | 669 |
| 771 | Ga0501072_1019118 | 3300049588 | Bacteria | 645 |
| 772 | Ga0501073_1257108 | 3300049589 | Bacteria | 508 |
| 773 | Ga0501074_0981525 | 3300049590 | Bacteria | 594 |
| 774 | Ga0501074_0983563 | 3300049590 | Bacteria | 593 |
| 775 | Ga0501075_0161351 | 3300049591 | Bacteria | 1710 |
| 776 | Ga0501075_0172967 | 3300049591 | Bacteria | 1648 |
| 777 | Ga0501076_0224034 | 3300049592 | Unclassified | 1537 |
| 778 | Ga0501076_0980119 | 3300049592 | Bacteria | 696 |
| 779 | Ga0501077_0312874 | 3300049593 | Bacteria | 1001 |
| 780 | Ga0501216_057812 | 3300049660 | Bacteria | 776 |
| 781 | Ga0501217_212610 | 3300049661 | Bacteria | 608 |
| 782 | Ga0501233_018696 | 3300049668 | Bacteria | 1460 |
| 783 | Ga0501257_132602 | 3300049686 | Bacteria | 675 |
| 784 | Ga0501080_0465462 | 3300049742 | Bacteria | 1132 |
| 785 | Ga0501080_1221096 | 3300049742 | Unclassified | 646 |
| 786 | Ga0501081_0186035 | 3300049743 | Bacteria | 1503 |
| 787 | Ga0501081_1124917 | 3300049743 | Bacteria | 594 |
| 788 | Ga0501283_012493 | 3300049779 | Bacteria | 1277 |
| 789 | Ga0501035_0344705 | 3300049822 | Bacteria | 1248 |
| 790 | Ga0501045_0245273 | 3300049824 | Bacteria | 1333 |
| 791 | Ga0501045_0611365 | 3300049824 | Bacteria | 807 |
| 792 | Ga0501045_0765153 | 3300049824 | Bacteria | 711 |
| 793 | Ga0501045_1167805 | 3300049824 | Bacteria | 562 |
| 794 | Ga0501045_1238818 | 3300049824 | Bacteria | 544 |
| 795 | Ga0501045_1278336 | 3300049824 | Bacteria | 534 |
| 796 | nmdc:mga06z11_390846_c1 | 3300050494 | Bacteria | 836 |
| 797 | nmdc:mga05p37_1264825_c1 | 3300050507 | Unclassified | 756 |
| 798 | nmdc:mga05p37_1668226_c1 | 3300050507 | Bacteria | 623 |
| 799 | nmdc:mga05p37_1692350_c1 | 3300050507 | Bacteria | 617 |
| 800 | nmdc:mga05p37_1796511_c1 | 3300050507 | Bacteria | 592 |
| 801 | nmdc:mga05p37_1807699_c1 | 3300050507 | Bacteria | 589 |
| 802 | nmdc:mga05p37_320641_c1 | 3300050507 | Bacteria | 1834 |
| 803 | nmdc:mga05p37_3367_c1 | 3300050507 | Bacteria | 18658 |
| 804 | nmdc:mga09592_103435_c1 | 3300050508 | Bacteria | 2440 |
| 805 | nmdc:mga09592_106007_c1 | 3300050508 | Bacteria | 2410 |
| 806 | nmdc:mga09592_1741425_c1 | 3300050508 | Bacteria | 502 |
| 807 | nmdc:mga09592_235628_c1 | 3300050508 | Bacteria | 1586 |
| 808 | nmdc:mga09592_646_c1 | 3300050508 | Bacteria | 26554 |
| 809 | nmdc:mga09592_81062_c1 | 3300050508 | Bacteria | 2765 |
| 810 | nmdc:mga0qj67_207274_c1 | 3300050509 | Bacteria | 1592 |
| 811 | nmdc:mga0qj67_248854_c1 | 3300050509 | Bacteria | 1442 |
| 812 | nmdc:mga0qj67_271612_c1 | 3300050509 | Bacteria | 1375 |
| 813 | nmdc:mga0qj67_408212_c1 | 3300050509 | Unclassified | 1096 |
| 814 | nmdc:mga0qj67_512293_c1 | 3300050509 | Bacteria | 964 |
| 815 | nmdc:mga0qj67_52148_c1 | 3300050509 | Bacteria | 3237 |
| 816 | nmdc:mga0qj67_623_c1 | 3300050509 | Bacteria | 24285 |
| 817 | nmdc:mga06r32_133999_c1 | 3300050510 | Bacteria | 2452 |
| 818 | nmdc:mga06r32_1401902_c1 | 3300050510 | Bacteria | 641 |
| 819 | nmdc:mga06r32_1679372_c1 | 3300050510 | Bacteria | 572 |
| 820 | nmdc:mga06r32_301273_c1 | 3300050510 | Bacteria | 1589 |
| 821 | nmdc:mga06r32_513920_c1 | 3300050510 | Bacteria | 1174 |
| 822 | nmdc:mga06r32_58630_c1 | 3300050510 | Bacteria | 3700 |
| 823 | nmdc:mga06r32_7083_c1 | 3300050510 | Bacteria | 10092 |
| 824 | nmdc:mga08y16_115323_c1 | 3300050511 | Bacteria | 2797 |
| 825 | nmdc:mga08y16_117352_c1 | 3300050511 | Bacteria | 2770 |
| 826 | nmdc:mga08y16_1209_c1 | 3300050511 | Bacteria | 25503 |
| 827 | nmdc:mga08y16_124404_c1 | 3300050511 | Bacteria | 2683 |
| 828 | nmdc:mga08y16_1301843_c1 | 3300050511 | Bacteria | 693 |
| 829 | nmdc:mga08y16_1772955_c1 | 3300050511 | Unclassified | 571 |
| 830 | nmdc:mga08y16_26333_c1 | 3300050511 | Bacteria | 6132 |
| 831 | nmdc:mga08y16_27053_c1 | 3300050511 | Bacteria | 6045 |
| 832 | nmdc:mga08y16_36047_c1 | 3300050511 | Bacteria | 5194 |
| 833 | nmdc:mga08y16_419359_c1 | 3300050511 | Bacteria | 1368 |
| 834 | nmdc:mga0n895_1176724_c1 | 3300050512 | Bacteria | 741 |
| 835 | nmdc:mga0n895_1336_c1 | 3300050512 | Bacteria | 18273 |
| 836 | nmdc:mga0n895_1563_c1 | 3300050512 | Bacteria | 17209 |
| 837 | nmdc:mga0n895_1572399_c1 | 3300050512 | Bacteria | 622 |
| 838 | nmdc:mga0n895_4259_c1 | 3300050512 | Bacteria | 11704 |
| 839 | nmdc:mga0n895_6387_c1 | 3300050512 | Bacteria | 10005 |
| 840 | nmdc:mga0rr50_1001979_c1 | 3300050513 | Unclassified | 712 |
| 841 | nmdc:mga0rr50_11005_c1 | 3300050513 | Bacteria | 5769 |
| 842 | nmdc:mga0rr50_1230403_c1 | 3300050513 | Bacteria | 636 |
| 843 | nmdc:mga0rr50_1308241_c1 | 3300050513 | Bacteria | 615 |
| 844 | nmdc:mga0rr50_170783_c1 | 3300050513 | Bacteria | 1772 |
| 845 | nmdc:mga0rr50_258537_c1 | 3300050513 | Bacteria | 1448 |
| 846 | nmdc:mga0rr50_35369_c1 | 3300050513 | Bacteria | 3587 |
| 847 | nmdc:mga0rr50_569532_c1 | 3300050513 | Bacteria | 965 |
| 848 | nmdc:mga08x19_142786_c1 | 3300050514 | Bacteria | 1618 |
| 849 | nmdc:mga08x19_22439_c1 | 3300050514 | Bacteria | 3909 |
| 850 | nmdc:mga08x19_23150_c1 | 3300050514 | Bacteria | 3853 |
| 851 | nmdc:mga08x19_263437_c1 | 3300050514 | Bacteria | 1192 |
| 852 | nmdc:mga08x19_2829_c1 | 3300050514 | Bacteria | 10472 |
| 853 | nmdc:mga08x19_513020_c1 | 3300050514 | Bacteria | 847 |
| 854 | nmdc:mga08x19_55_c1 | 3300050514 | Bacteria | 120851 |
| 855 | nmdc:mga08x19_670353_c1 | 3300050514 | Bacteria | 736 |
| 856 | nmdc:mga0a205_283089_c1 | 3300050515 | Bacteria | 1533 |
| 857 | nmdc:mga0a205_38464_c1 | 3300050515 | Bacteria | 4603 |
| 858 | nmdc:mga0a205_589984_c1 | 3300050515 | Bacteria | 965 |
| 859 | nmdc:mga0a205_935_c1 | 3300050515 | Bacteria | 24102 |
| 860 | Ga0495601_0005497 | 3300053077 | Bacteria | 7389 |
| 861 | Ga0495601_0083732 | 3300053077 | Bacteria | 2049 |
| 862 | Ga0495601_0630251 | 3300053077 | Bacteria | 687 |
| 863 | Ga0495595_0520309 | 3300053084 | Unclassified | 607 |
| 864 | Ga0500566_0122685 | 3300053094 | Bacteria | 1399 |
| 865 | Ga0501084_0616219 | 3300054114 | Bacteria | 917 |
| 866 | Ga0501084_1292809 | 3300054114 | Bacteria | 611 |
| 867 | Ga0590077_050692 | 3300059426 | Bacteria | 931 |
| 868 | Ga0501082_0336784 | 3300060353 | Bacteria | 1315 |
| 869 | Ga0501082_0920350 | 3300060353 | Bacteria | 765 |
| 870 | Ga0501082_1618964 | 3300060353 | Bacteria | 565 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032133 | Ga0316583_10124335 | Ga0316583_101243352 | 84 |
| 2 | 3300035398 | Ga0316574_0801827 | Ga0316574_0801827_192_515 | 84 |
| 3 | 3300004801 | Ga0058860_11658417 | Ga0058860_116584172 | 86 |
| 4 | 3300004803 | Ga0058862_10871056 | Ga0058862_108710562 | 86 |
| 5 | 3300005295 | Ga0065707_10028465 | Ga0065707_100284652 | 86 |
| 6 | 3300005330 | Ga0070690_100000197 | Ga0070690_10000019726 | 86 |
| 7 | 3300005330 | Ga0070690_100664488 | Ga0070690_1006644882 | 86 |
| 8 | 3300005331 | Ga0070670_100899990 | Ga0070670_1008999902 | 86 |
| 9 | 3300005334 | Ga0068869_100000214 | Ga0068869_10000021426 | 86 |
| 10 | 3300005334 | Ga0068869_100063874 | Ga0068869_1000638743 | 86 |
| 11 | 3300005335 | Ga0070666_10263580 | Ga0070666_102635802 | 86 |
| 12 | 3300005336 | Ga0070680_100005842 | Ga0070680_1000058425 | 86 |
| 13 | 3300005337 | Ga0070682_100003738 | Ga0070682_1000037383 | 86 |
| 14 | 3300005338 | Ga0068868_100000375 | Ga0068868_10000037533 | 86 |
| 15 | 3300005340 | Ga0070689_100000107 | Ga0070689_10000010720 | 86 |
| 16 | 3300005340 | Ga0070689_100214699 | Ga0070689_1002146992 | 86 |
| 17 | 3300005340 | Ga0070689_100840768 | Ga0070689_1008407682 | 86 |
| 18 | 3300005341 | Ga0070691_10000220 | Ga0070691_1000022013 | 86 |
| 19 | 3300005341 | Ga0070691_10860537 | Ga0070691_108605372 | 86 |
| 20 | 3300005343 | Ga0070687_100000669 | Ga0070687_1000006696 | 86 |
| 21 | 3300005343 | Ga0070687_100253395 | Ga0070687_1002533952 | 86 |
| 22 | 3300005345 | Ga0070692_10005331 | Ga0070692_100053314 | 86 |
| 23 | 3300005364 | Ga0070673_100266246 | Ga0070673_1002662462 | 86 |
| 24 | 3300005364 | Ga0070673_100892420 | Ga0070673_1008924202 | 86 |
| 25 | 3300005366 | Ga0070659_100519794 | Ga0070659_1005197942 | 86 |
| 26 | 3300005406 | Ga0070703_10004630 | Ga0070703_100046304 | 86 |
| 27 | 3300005437 | Ga0070710_10437408 | Ga0070710_104374081 | 86 |
| 28 | 3300005438 | Ga0070701_10000396 | Ga0070701_1000039616 | 86 |
| 29 | 3300005441 | Ga0070700_100000633 | Ga0070700_10000063311 | 86 |
| 30 | 3300005441 | Ga0070700_100111705 | Ga0070700_1001117052 | 86 |
| 31 | 3300005441 | Ga0070700_100360890 | Ga0070700_1003608902 | 86 |
| 32 | 3300005444 | Ga0070694_100000126 | Ga0070694_10000012613 | 86 |
| 33 | 3300005445 | Ga0070708_100319275 | Ga0070708_1003192752 | 86 |
| 34 | 3300005456 | Ga0070678_100030611 | Ga0070678_1000306113 | 86 |
| 35 | 3300005458 | Ga0070681_10414874 | Ga0070681_104148742 | 86 |
| 36 | 3300005458 | Ga0070681_10912559 | Ga0070681_109125592 | 86 |
| 37 | 3300005459 | Ga0068867_100000032 | Ga0068867_10000003262 | 86 |
| 38 | 3300005518 | Ga0070699_100998981 | Ga0070699_1009989812 | 86 |
| 39 | 3300005530 | Ga0070679_100108511 | Ga0070679_1001085113 | 86 |
| 40 | 3300005536 | Ga0070697_100249725 | Ga0070697_1002497252 | 86 |
| 41 | 3300005539 | Ga0068853_100191540 | Ga0068853_1001915403 | 86 |
| 42 | 3300005544 | Ga0070686_100000253 | Ga0070686_10000025317 | 86 |
| 43 | 3300005544 | Ga0070686_100886077 | Ga0070686_1008860772 | 86 |
| 44 | 3300005545 | Ga0070695_100000197 | Ga0070695_1000001979 | 86 |
| 45 | 3300005545 | Ga0070695_100246385 | Ga0070695_1002463853 | 86 |
| 46 | 3300005545 | Ga0070695_100293197 | Ga0070695_1002931972 | 86 |
| 47 | 3300005546 | Ga0070696_100000089 | Ga0070696_10000008942 | 86 |
| 48 | 3300005546 | Ga0070696_100000482 | Ga0070696_1000004828 | 86 |
| 49 | 3300005547 | Ga0070693_100000400 | Ga0070693_10000040020 | 86 |
| 50 | 3300005549 | Ga0070704_100000017 | Ga0070704_10000001748 | 86 |
| 51 | 3300005563 | Ga0068855_100002377 | Ga0068855_10000237726 | 86 |
| 52 | 3300005563 | Ga0068855_101574544 | Ga0068855_1015745442 | 86 |
| 53 | 3300005577 | Ga0068857_100997366 | Ga0068857_1009973662 | 86 |
| 54 | 3300005578 | Ga0068854_100022368 | Ga0068854_1000223682 | 86 |
| 55 | 3300005614 | Ga0068856_100142277 | Ga0068856_1001422774 | 86 |
| 56 | 3300005615 | Ga0070702_100000001 | Ga0070702_10000000128 | 86 |
| 57 | 3300005617 | Ga0068859_100000149 | Ga0068859_10000014933 | 86 |
| 58 | 3300005617 | Ga0068859_100249647 | Ga0068859_1002496473 | 86 |
| 59 | 3300005618 | Ga0068864_100009007 | Ga0068864_1000090074 | 86 |
| 60 | 3300005718 | Ga0068866_10000326 | Ga0068866_1000032624 | 86 |
| 61 | 3300005719 | Ga0068861_100000428 | Ga0068861_1000004283 | 86 |
| 62 | 3300005841 | Ga0068863_100262007 | Ga0068863_1002620072 | 86 |
| 63 | 3300005841 | Ga0068863_100283339 | Ga0068863_1002833392 | 86 |
| 64 | 3300005841 | Ga0068863_100299836 | Ga0068863_1002998362 | 86 |
| 65 | 3300005842 | Ga0068858_100002902 | Ga0068858_10000290212 | 86 |
| 66 | 3300005842 | Ga0068858_100615355 | Ga0068858_1006153552 | 86 |
| 67 | 3300005843 | Ga0068860_100001090 | Ga0068860_1000010905 | 86 |
| 68 | 3300005843 | Ga0068860_100894234 | Ga0068860_1008942342 | 86 |
| 69 | 3300005844 | Ga0068862_100000409 | Ga0068862_10000040931 | 86 |
| 70 | 3300006163 | Ga0070715_10229490 | Ga0070715_102294901 | 86 |
| 71 | 3300006237 | Ga0097621_100000928 | Ga0097621_1000009283 | 86 |
| 72 | 3300006358 | Ga0068871_100011561 | Ga0068871_1000115615 | 86 |
| 73 | 3300006358 | Ga0068871_101248038 | Ga0068871_1012480382 | 86 |
| 74 | 3300006844 | Ga0075428_100000083 | Ga0075428_1000000837 | 86 |
| 75 | 3300006847 | Ga0075431_100123948 | Ga0075431_1001239483 | 86 |
| 76 | 3300006852 | Ga0075433_10033239 | Ga0075433_100332394 | 86 |
| 77 | 3300006871 | Ga0075434_100007734 | Ga0075434_10000773410 | 86 |
| 78 | 3300006871 | Ga0075434_101385976 | Ga0075434_1013859761 | 86 |
| 79 | 3300006880 | Ga0075429_100000480 | Ga0075429_1000004803 | 86 |
| 80 | 3300006881 | Ga0068865_100000059 | Ga0068865_10000005926 | 86 |
| 81 | 3300006914 | Ga0075436_100003220 | Ga0075436_10000322012 | 86 |
| 82 | 3300006931 | Ga0097620_100000149 | Ga0097620_10000014942 | 86 |
| 83 | 3300006931 | Ga0097620_100249643 | Ga0097620_1002496433 | 86 |
| 84 | 3300007076 | Ga0075435_100000388 | Ga0075435_10000038814 | 86 |
| 85 | 3300007076 | Ga0075435_100772429 | Ga0075435_1007724292 | 86 |
| 86 | 3300009011 | Ga0105251_10643320 | Ga0105251_106433201 | 86 |
| 87 | 3300009036 | Ga0105244_10492227 | Ga0105244_104922272 | 86 |
| 88 | 3300009093 | Ga0105240_10540267 | Ga0105240_105402672 | 86 |
| 89 | 3300009094 | Ga0111539_10038453 | Ga0111539_100384536 | 86 |
| 90 | 3300009098 | Ga0105245_10000075 | Ga0105245_1000007563 | 86 |
| 91 | 3300009147 | Ga0114129_10000210 | Ga0114129_1000021045 | 86 |
| 92 | 3300009147 | Ga0114129_11433701 | Ga0114129_114337012 | 86 |
| 93 | 3300009148 | Ga0105243_10000622 | Ga0105243_1000062234 | 86 |
| 94 | 3300009148 | Ga0105243_12273446 | Ga0105243_122734462 | 86 |
| 95 | 3300009174 | Ga0105241_10084412 | Ga0105241_100844122 | 86 |
| 96 | 3300009176 | Ga0105242_10000407 | Ga0105242_1000040734 | 86 |
| 97 | 3300009177 | Ga0105248_10217743 | Ga0105248_102177433 | 86 |
| 98 | 3300009177 | Ga0105248_10414506 | Ga0105248_104145063 | 86 |
| 99 | 3300009553 | Ga0105249_10002440 | Ga0105249_100024404 | 86 |
| 100 | 3300010375 | Ga0105239_10111905 | Ga0105239_101119052 | 86 |
| 101 | 3300011119 | Ga0105246_12265558 | Ga0105246_122655582 | 86 |
| 102 | 3300012492 | Ga0157335_1035026 | Ga0157335_10350261 | 86 |
| 103 | 3300013297 | Ga0157378_10000074 | Ga0157378_1000007432 | 86 |
| 104 | 3300013306 | Ga0163162_13341312 | Ga0163162_133413121 | 86 |
| 105 | 3300013308 | Ga0157375_11079065 | Ga0157375_110790652 | 86 |
| 106 | 3300014326 | Ga0157380_10103645 | Ga0157380_101036453 | 86 |
| 107 | 3300014745 | Ga0157377_11447566 | Ga0157377_114475662 | 86 |
| 108 | 3300014968 | Ga0157379_10879275 | Ga0157379_108792752 | 86 |
| 109 | 3300014969 | Ga0157376_10021663 | Ga0157376_100216633 | 86 |
| 110 | 3300017792 | Ga0163161_10691716 | Ga0163161_106917162 | 86 |
| 111 | 3300025898 | Ga0207692_10248029 | Ga0207692_102480292 | 86 |
| 112 | 3300025899 | Ga0207642_10004209 | Ga0207642_100042093 | 86 |
| 113 | 3300025901 | Ga0207688_10059207 | Ga0207688_100592074 | 86 |
| 114 | 3300025903 | Ga0207680_10244047 | Ga0207680_102440472 | 86 |
| 115 | 3300025904 | Ga0207647_10657704 | Ga0207647_106577042 | 86 |
| 116 | 3300025905 | Ga0207685_10496850 | Ga0207685_104968502 | 86 |
| 117 | 3300025911 | Ga0207654_10022847 | Ga0207654_100228472 | 86 |
| 118 | 3300025912 | Ga0207707_10210452 | Ga0207707_102104523 | 86 |
| 119 | 3300025913 | Ga0207695_11243277 | Ga0207695_112432772 | 86 |
| 120 | 3300025916 | Ga0207663_10251923 | Ga0207663_102519232 | 86 |
| 121 | 3300025916 | Ga0207663_10511958 | Ga0207663_105119582 | 86 |
| 122 | 3300025917 | Ga0207660_10078664 | Ga0207660_100786642 | 86 |
| 123 | 3300025918 | Ga0207662_10000315 | Ga0207662_100003156 | 86 |
| 124 | 3300025918 | Ga0207662_10283799 | Ga0207662_102837992 | 86 |
| 125 | 3300025923 | Ga0207681_10248018 | Ga0207681_102480182 | 86 |
| 126 | 3300025927 | Ga0207687_10001426 | Ga0207687_1000142618 | 86 |
| 127 | 3300025928 | Ga0207700_11624483 | Ga0207700_116244832 | 86 |
| 128 | 3300025931 | Ga0207644_10029941 | Ga0207644_100299412 | 86 |
| 129 | 3300025934 | Ga0207686_10000243 | Ga0207686_1000024316 | 86 |
| 130 | 3300025935 | Ga0207709_10001387 | Ga0207709_1000138713 | 86 |
| 131 | 3300025936 | Ga0207670_10001067 | Ga0207670_1000106715 | 86 |
| 132 | 3300025936 | Ga0207670_10108375 | Ga0207670_101083752 | 86 |
| 133 | 3300025938 | Ga0207704_10018253 | Ga0207704_100182532 | 86 |
| 134 | 3300025939 | Ga0207665_10144714 | Ga0207665_101447142 | 86 |
| 135 | 3300025941 | Ga0207711_10618201 | Ga0207711_106182012 | 86 |
| 136 | 3300025942 | Ga0207689_10000007 | Ga0207689_1000000777 | 86 |
| 137 | 3300025942 | Ga0207689_10097695 | Ga0207689_100976952 | 86 |
| 138 | 3300025949 | Ga0207667_10077643 | Ga0207667_100776434 | 86 |
| 139 | 3300025949 | Ga0207667_11302905 | Ga0207667_113029052 | 86 |
| 140 | 3300025960 | Ga0207651_10195881 | Ga0207651_101958813 | 86 |
| 141 | 3300025960 | Ga0207651_11099234 | Ga0207651_110992342 | 86 |
| 142 | 3300025961 | Ga0207712_10002821 | Ga0207712_100028219 | 86 |
| 143 | 3300025981 | Ga0207640_10015170 | Ga0207640_100151702 | 86 |
| 144 | 3300026023 | Ga0207677_10000823 | Ga0207677_1000082317 | 86 |
| 145 | 3300026035 | Ga0207703_10102600 | Ga0207703_101026003 | 86 |
| 146 | 3300026035 | Ga0207703_10345945 | Ga0207703_103459452 | 86 |
| 147 | 3300026041 | Ga0207639_10520357 | Ga0207639_105203572 | 86 |
| 148 | 3300026075 | Ga0207708_10000086 | Ga0207708_1000008611 | 86 |
| 149 | 3300026075 | Ga0207708_10251397 | Ga0207708_102513972 | 86 |
| 150 | 3300026075 | Ga0207708_10561004 | Ga0207708_105610042 | 86 |
| 151 | 3300026078 | Ga0207702_10145265 | Ga0207702_101452652 | 86 |
| 152 | 3300026088 | Ga0207641_10161054 | Ga0207641_101610543 | 86 |
| 153 | 3300026088 | Ga0207641_10225916 | Ga0207641_102259162 | 86 |
| 154 | 3300026088 | Ga0207641_10423615 | Ga0207641_104236152 | 86 |
| 155 | 3300026089 | Ga0207648_10000079 | Ga0207648_1000007962 | 86 |
| 156 | 3300026095 | Ga0207676_10037278 | Ga0207676_100372782 | 86 |
| 157 | 3300026118 | Ga0207675_100000093 | Ga0207675_10000009364 | 86 |
| 158 | 3300026118 | Ga0207675_100829724 | Ga0207675_1008297242 | 86 |
| 159 | 3300026121 | Ga0207683_10327647 | Ga0207683_103276472 | 86 |
| 160 | 3300027907 | Ga0207428_10000321 | Ga0207428_100003219 | 86 |
| 161 | 3300027907 | Ga0207428_10142297 | Ga0207428_101422972 | 86 |
| 162 | 3300028380 | Ga0268265_10003346 | Ga0268265_100033465 | 86 |
| 163 | 3300028381 | Ga0268264_10001077 | Ga0268264_1000107728 | 86 |
| 164 | 3300028381 | Ga0268264_11229884 | Ga0268264_112298841 | 86 |
| 165 | 3300034817 | Ga0373948_0043427 | Ga0373948_0043427_384_644 | 86 |
| 166 | 3300035083 | Ga0373926_0037450 | Ga0373926_0037450_498_758 | 86 |
| 167 | 3300035084 | Ga0373928_0001275 | Ga0373928_0001275_3594_3854 | 86 |
| 168 | 3300035085 | Ga0373929_0154870 | Ga0373929_0154870_204_464 | 86 |
| 169 | 3300035086 | Ga0373934_0327756 | Ga0373934_0327756_98_358 | 86 |
| 170 | 3300035088 | Ga0373940_0069540 | Ga0373940_0069540_111_371 | 86 |
| 171 | 3300035089 | Ga0373944_0007607 | Ga0373944_0007607_1320_1580 | 86 |
| 172 | 3300035089 | Ga0373944_0032245 | Ga0373944_0032245_1099_1359 | 86 |
| 173 | 3300035090 | Ga0373949_0135679 | Ga0373949_0135679_150_410 | 86 |
| 174 | 3300035090 | Ga0373949_0241556 | Ga0373949_0241556_58_318 | 86 |
| 175 | 3300035091 | Ga0373951_0082723 | Ga0373951_0082723_62_322 | 86 |
| 176 | 3300035092 | Ga0373952_0171573 | Ga0373952_0171573_117_377 | 86 |
| 177 | 3300035111 | Ga0373923_0303738 | Ga0373923_0303738_99_359 | 86 |
| 178 | 3300035112 | Ga0373932_0002438 | Ga0373932_0002438_2046_2306 | 86 |
| 179 | 3300035112 | Ga0373932_0133532 | Ga0373932_0133532_476_736 | 86 |
| 180 | 3300035113 | Ga0373936_0029588 | Ga0373936_0029588_874_1134 | 86 |
| 181 | 3300035113 | Ga0373936_0348296 | Ga0373936_0348296_225_485 | 86 |
| 182 | 3300035114 | Ga0373939_0002522 | Ga0373939_0002522_871_1131 | 86 |
| 183 | 3300035115 | Ga0373941_0031727 | Ga0373941_0031727_229_489 | 86 |
| 184 | 3300035115 | Ga0373941_0113920 | Ga0373941_0113920_357_617 | 86 |
| 185 | 3300035115 | Ga0373941_0300139 | Ga0373941_0300139_61_321 | 86 |
| 186 | 3300035116 | Ga0373945_0001661 | Ga0373945_0001661_3017_3277 | 86 |
| 187 | 3300035117 | Ga0373953_0002608 | Ga0373953_0002608_2546_2806 | 86 |
| 188 | 3300035118 | Ga0373954_0204650 | Ga0373954_0204650_669_929 | 86 |
| 189 | 3300035119 | Ga0373956_0156368 | Ga0373956_0156368_511_771 | 86 |
| 190 | 3300035120 | Ga0373957_0023276 | Ga0373957_0023276_911_1171 | 86 |
| 191 | 3300035121 | Ga0373960_0015187 | Ga0373960_0015187_16_276 | 86 |
| 192 | 3300035121 | Ga0373960_0169062 | Ga0373960_0169062_89_349 | 86 |
| 193 | 3300035170 | Ga0373943_0010824 | Ga0373943_0010824_1672_1932 | 86 |
| 194 | 3300035170 | Ga0373943_0097712 | Ga0373943_0097712_1031_1291 | 86 |
| 195 | 3300035171 | Ga0373946_0005645 | Ga0373946_0005645_848_1108 | 86 |
| 196 | 3300035171 | Ga0373946_0041970 | Ga0373946_0041970_234_494 | 86 |
| 197 | 3300035172 | Ga0373955_0038672 | Ga0373955_0038672_252_512 | 86 |
| 198 | 3300035207 | Ga0373942_0098176 | Ga0373942_0098176_320_580 | 86 |
| 199 | 3300035241 | Ga0373961_0025476 | Ga0373961_0025476_818_1078 | 86 |
| 200 | 3300035242 | Ga0373962_0011183 | Ga0373962_0011183_1215_1475 | 86 |
| 201 | 3300035410 | Ga0373924_0069540 | Ga0373924_0069540_76_336 | 86 |
| 202 | 3300035691 | Ga0373931_0000265 | Ga0373931_0000265_7612_7872 | 86 |
| 203 | 3300035691 | Ga0373931_0008664 | Ga0373931_0008664_2797_3057 | 86 |
| 204 | 3300035691 | Ga0373931_0034304 | Ga0373931_0034304_1735_1995 | 86 |
| 205 | 3300035692 | Ga0373935_0029727 | Ga0373935_0029727_3055_3315 | 86 |
| 206 | 3300035692 | Ga0373935_0033469 | Ga0373935_0033469_2162_2422 | 86 |
| 207 | 3300035692 | Ga0373935_0324545 | Ga0373935_0324545_227_487 | 86 |
| 208 | 3300035695 | Ga0373927_0078223 | Ga0373927_0078223_491_751 | 86 |
| 209 | 3300035695 | Ga0373927_0114908 | Ga0373927_0114908_1266_1526 | 86 |
| 210 | 3300035724 | Ga0373933_0015090 | Ga0373933_0015090_1613_1873 | 86 |
| 211 | 3300035725 | Ga0373947_0009354 | Ga0373947_0009354_1840_2100 | 86 |
| 212 | 3300035725 | Ga0373947_0036354 | Ga0373947_0036354_882_1142 | 86 |
| 213 | 3300036401 | Ga0373937_0218547 | Ga0373937_0218547_1023_1283 | 86 |
| 214 | 3300037068 | Ga0373925_0002889 | Ga0373925_0002889_1760_2020 | 86 |
| 215 | 3300037068 | Ga0373925_0040234 | Ga0373925_0040234_865_1125 | 86 |
| 216 | 3300037068 | Ga0373925_0110612 | Ga0373925_0110612_549_809 | 86 |
| 217 | 3300037068 | Ga0373925_0777110 | Ga0373925_0777110_22_282 | 86 |
| 218 | 3300042156 | Ga0439446_0181296 | Ga0439446_0181296_77_337 | 86 |
| 219 | 3300042876 | Ga0451577_0050315 | Ga0451577_0050315_2558_2818 | 86 |
| 220 | 3300044712 | Ga0453684_0319001 | Ga0453684_0319001_1055_1315 | 86 |
| 221 | 3300045051 | Ga0451576_0001306 | Ga0451576_0001306_2022_2282 | 86 |
| 222 | 3300045051 | Ga0451576_0035821 | Ga0451576_0035821_1761_2021 | 86 |
| 223 | 3300045051 | Ga0451576_0193274 | Ga0451576_0193274_782_1042 | 86 |
| 224 | 3300045051 | Ga0451576_0510906 | Ga0451576_0510906_966_1229 | 86 |
| 225 | 3300045051 | Ga0451576_0679899 | Ga0451576_0679899_644_904 | 86 |
| 226 | 3300045051 | Ga0451576_0701437 | Ga0451576_0701437_466_726 | 86 |
| 227 | 3300046455 | Ga0495603_0013943 | Ga0495603_0013943_3784_4044 | 86 |
| 228 | 3300046462 | Ga0495651_0343714 | Ga0495651_0343714_504_764 | 86 |
| 229 | 3300046463 | Ga0495653_0586168 | Ga0495653_0586168_339_599 | 86 |
| 230 | 3300046472 | Ga0495580_0033208 | Ga0495580_0033208_1254_1514 | 86 |
| 231 | 3300046473 | Ga0495582_0018968 | Ga0495582_0018968_2054_2314 | 86 |
| 232 | 3300046475 | Ga0495639_0022242 | Ga0495639_0022242_2198_2458 | 86 |
| 233 | 3300046477 | Ga0495664_0258423 | Ga0495664_0258423_235_495 | 86 |
| 234 | 3300046499 | Ga0495594_0264567 | Ga0495594_0264567_21_281 | 86 |
| 235 | 3300046517 | Ga0495630_0622469 | Ga0495630_0622469_546_806 | 86 |
| 236 | 3300046531 | Ga0495665_0309752 | Ga0495665_0309752_202_462 | 86 |
| 237 | 3300046533 | Ga0495640_0582423 | Ga0495640_0582423_97_357 | 86 |
| 238 | 3300046535 | Ga0495586_0009939 | Ga0495586_0009939_4140_4400 | 86 |
| 239 | 3300046537 | Ga0495598_0037970 | Ga0495598_0037970_534_794 | 86 |
| 240 | 3300046557 | Ga0495622_0300432 | Ga0495622_0300432_101_361 | 86 |
| 241 | 3300046615 | Ga0495656_0225811 | Ga0495656_0225811_534_794 | 86 |
| 242 | 3300046674 | Ga0495588_0078511 | Ga0495588_0078511_1351_1611 | 86 |
| 243 | 3300046681 | Ga0495647_0049604 | Ga0495647_0049604_625_885 | 86 |
| 244 | 3300046683 | Ga0495658_0004220 | Ga0495658_0004220_2333_2593 | 86 |
| 245 | 3300047317 | Ga0495604_0100700 | Ga0495604_0100700_1169_1429 | 86 |
| 246 | 3300047321 | Ga0495676_0019304 | Ga0495676_0019304_2392_2652 | 86 |
| 247 | 3300047445 | Ga0495677_0263386 | Ga0495677_0263386_92_352 | 86 |
| 248 | 3300048089 | Ga0495614_0339553 | Ga0495614_0339553_158_418 | 86 |
| 249 | 3300049572 | Ga0501036_0518807 | Ga0501036_0518807_206_466 | 86 |
| 250 | 3300049574 | Ga0501038_0746776 | Ga0501038_0746776_146_406 | 86 |
| 251 | 3300049576 | Ga0501040_0263815 | Ga0501040_0263815_872_1132 | 86 |
| 252 | 3300049577 | Ga0501041_0441151 | Ga0501041_0441151_187_447 | 86 |
| 253 | 3300049578 | Ga0501042_0444854 | Ga0501042_0444854_544_804 | 86 |
| 254 | 3300049580 | Ga0501046_0484505 | Ga0501046_0484505_512_772 | 86 |
| 255 | 3300049582 | Ga0501048_0171493 | Ga0501048_0171493_209_469 | 86 |
| 256 | 3300049582 | Ga0501048_1266525 | Ga0501048_1266525_122_382 | 86 |
| 257 | 3300049588 | Ga0501072_0189057 | Ga0501072_0189057_109_369 | 86 |
| 258 | 3300049588 | Ga0501072_0953160 | Ga0501072_0953160_388_648 | 86 |
| 259 | 3300049590 | Ga0501074_0981525 | Ga0501074_0981525_115_375 | 86 |
| 260 | 3300049591 | Ga0501075_0172967 | Ga0501075_0172967_563_823 | 86 |
| 261 | 3300049743 | Ga0501081_0186035 | Ga0501081_0186035_698_958 | 86 |
| 262 | 3300049824 | Ga0501045_0765153 | Ga0501045_0765153_346_606 | 86 |
| 263 | 3300049824 | Ga0501045_1278336 | Ga0501045_1278336_231_491 | 86 |
| 264 | 3300050507 | nmdc:mga05p37_3367_c1 | nmdc:mga05p37_3367_c1_18124_18384 | 86 |
| 265 | 3300050508 | nmdc:mga09592_646_c1 | nmdc:mga09592_646_c1_22229_22489 | 86 |
| 266 | 3300050510 | nmdc:mga06r32_301273_c1 | nmdc:mga06r32_301273_c1_1016_1276 | 86 |
| 267 | 3300050511 | nmdc:mga08y16_1209_c1 | nmdc:mga08y16_1209_c1_4248_4508 | 86 |
| 268 | 3300050511 | nmdc:mga08y16_27053_c1 | nmdc:mga08y16_27053_c1_1393_1653 | 86 |
| 269 | 3300050512 | nmdc:mga0n895_1572399_c1 | nmdc:mga0n895_1572399_c1_22_282 | 86 |
| 270 | 3300050512 | nmdc:mga0n895_4259_c1 | nmdc:mga0n895_4259_c1_2735_2995 | 86 |
| 271 | 3300050513 | nmdc:mga0rr50_11005_c1 | nmdc:mga0rr50_11005_c1_5007_5267 | 86 |
| 272 | 3300050513 | nmdc:mga0rr50_569532_c1 | nmdc:mga0rr50_569532_c1_503_763 | 86 |
| 273 | 3300050514 | nmdc:mga08x19_2829_c1 | nmdc:mga08x19_2829_c1_8101_8361 | 86 |
| 274 | 3300050515 | nmdc:mga0a205_589984_c1 | nmdc:mga0a205_589984_c1_153_413 | 86 |
| 275 | 3300050515 | nmdc:mga0a205_935_c1 | nmdc:mga0a205_935_c1_2441_2701 | 86 |
| 276 | 3300053084 | Ga0495595_0520309 | Ga0495595_0520309_107_367 | 86 |
| 277 | 3300060353 | Ga0501082_0920350 | Ga0501082_0920350_92_352 | 86 |
| 278 | 3300003397 | JGI26133J50247_101018 | JGI26133J50247_1010181 | 87 |
| 279 | 3300005330 | Ga0070690_101091112 | Ga0070690_1010911122 | 87 |
| 280 | 3300005334 | Ga0068869_100229020 | Ga0068869_1002290202 | 87 |
| 281 | 3300005340 | Ga0070689_100065511 | Ga0070689_1000655115 | 87 |
| 282 | 3300005341 | Ga0070691_10219666 | Ga0070691_102196661 | 87 |
| 283 | 3300005343 | Ga0070687_100159616 | Ga0070687_1001596162 | 87 |
| 284 | 3300005365 | Ga0070688_101569673 | Ga0070688_1015696731 | 87 |
| 285 | 3300005441 | Ga0070700_100103026 | Ga0070700_1001030262 | 87 |
| 286 | 3300005444 | Ga0070694_100563404 | Ga0070694_1005634041 | 87 |
| 287 | 3300005445 | Ga0070708_101109277 | Ga0070708_1011092772 | 87 |
| 288 | 3300005468 | Ga0070707_100726748 | Ga0070707_1007267482 | 87 |
| 289 | 3300005468 | Ga0070707_100798163 | Ga0070707_1007981632 | 87 |
| 290 | 3300005471 | Ga0070698_101948042 | Ga0070698_1019480421 | 87 |
| 291 | 3300005535 | Ga0070684_101303839 | Ga0070684_1013038392 | 87 |
| 292 | 3300005544 | Ga0070686_100533516 | Ga0070686_1005335162 | 87 |
| 293 | 3300005545 | Ga0070695_100045316 | Ga0070695_1000453165 | 87 |
| 294 | 3300005545 | Ga0070695_101443105 | Ga0070695_1014431051 | 87 |
| 295 | 3300005546 | Ga0070696_100166322 | Ga0070696_1001663222 | 87 |
| 296 | 3300005549 | Ga0070704_100421993 | Ga0070704_1004219932 | 87 |
| 297 | 3300005617 | Ga0068859_101059047 | Ga0068859_1010590472 | 87 |
| 298 | 3300005618 | Ga0068864_100082993 | Ga0068864_1000829933 | 87 |
| 299 | 3300005618 | Ga0068864_102069581 | Ga0068864_1020695812 | 87 |
| 300 | 3300005719 | Ga0068861_100326403 | Ga0068861_1003264033 | 87 |
| 301 | 3300005841 | Ga0068863_102046408 | Ga0068863_1020464082 | 87 |
| 302 | 3300006178 | Ga0075367_10815908 | Ga0075367_108159082 | 87 |
| 303 | 3300006358 | Ga0068871_101459461 | Ga0068871_1014594612 | 87 |
| 304 | 3300006844 | Ga0075428_100040406 | Ga0075428_1000404065 | 87 |
| 305 | 3300006846 | Ga0075430_100438589 | Ga0075430_1004385892 | 87 |
| 306 | 3300006871 | Ga0075434_100005363 | Ga0075434_1000053636 | 87 |
| 307 | 3300006880 | Ga0075429_100254048 | Ga0075429_1002540482 | 87 |
| 308 | 3300006880 | Ga0075429_101078498 | Ga0075429_1010784982 | 87 |
| 309 | 3300006931 | Ga0097620_101059077 | Ga0097620_1010590772 | 87 |
| 310 | 3300007076 | Ga0075435_100663288 | Ga0075435_1006632882 | 87 |
| 311 | 3300007265 | Ga0099794_10015782 | Ga0099794_100157822 | 87 |
| 312 | 3300009094 | Ga0111539_10026004 | Ga0111539_100260046 | 87 |
| 313 | 3300009094 | Ga0111539_10693456 | Ga0111539_106934562 | 87 |
| 314 | 3300009147 | Ga0114129_10634184 | Ga0114129_106341842 | 87 |
| 315 | 3300009147 | Ga0114129_11130110 | Ga0114129_111301102 | 87 |
| 316 | 3300009147 | Ga0114129_11946484 | Ga0114129_119464841 | 87 |
| 317 | 3300009176 | Ga0105242_12061126 | Ga0105242_120611262 | 87 |
| 318 | 3300009177 | Ga0105248_10838385 | Ga0105248_108383852 | 87 |
| 319 | 3300025885 | Ga0207653_10004464 | Ga0207653_100044642 | 87 |
| 320 | 3300025918 | Ga0207662_10171434 | Ga0207662_101714342 | 87 |
| 321 | 3300025918 | Ga0207662_10173077 | Ga0207662_101730772 | 87 |
| 322 | 3300025934 | Ga0207686_10753542 | Ga0207686_107535422 | 87 |
| 323 | 3300025936 | Ga0207670_10127750 | Ga0207670_101277503 | 87 |
| 324 | 3300025936 | Ga0207670_10334710 | Ga0207670_103347102 | 87 |
| 325 | 3300025941 | Ga0207711_11811618 | Ga0207711_118116182 | 87 |
| 326 | 3300025942 | Ga0207689_10259174 | Ga0207689_102591742 | 87 |
| 327 | 3300026075 | Ga0207708_10202555 | Ga0207708_102025552 | 87 |
| 328 | 3300026088 | Ga0207641_10312390 | Ga0207641_103123903 | 87 |
| 329 | 3300026089 | Ga0207648_10377073 | Ga0207648_103770733 | 87 |
| 330 | 3300026095 | Ga0207676_10321696 | Ga0207676_103216962 | 87 |
| 331 | 3300026118 | Ga0207675_100144068 | Ga0207675_1001440683 | 87 |
| 332 | 3300027360 | Ga0209969_1000430 | Ga0209969_10004309 | 87 |
| 333 | 3300027364 | Ga0209967_1000417 | Ga0209967_10004179 | 87 |
| 334 | 3300027378 | Ga0209981_1001566 | Ga0209981_10015662 | 87 |
| 335 | 3300027395 | Ga0209996_1026728 | Ga0209996_10267282 | 87 |
| 336 | 3300027462 | Ga0210000_1000446 | Ga0210000_10004463 | 87 |
| 337 | 3300027471 | Ga0209995_1000255 | Ga0209995_100025510 | 87 |
| 338 | 3300027543 | Ga0209999_1032187 | Ga0209999_10321872 | 87 |
| 339 | 3300027543 | Ga0209999_1042378 | Ga0209999_10423782 | 87 |
| 340 | 3300027671 | Ga0209588_1259659 | Ga0209588_12596592 | 87 |
| 341 | 3300027682 | Ga0209971_1010313 | Ga0209971_10103132 | 87 |
| 342 | 3300027695 | Ga0209966_1016285 | Ga0209966_10162853 | 87 |
| 343 | 3300027876 | Ga0209974_10001421 | Ga0209974_100014215 | 87 |
| 344 | 3300027907 | Ga0207428_10024838 | Ga0207428_100248383 | 87 |
| 345 | 3300031911 | Ga0307412_10197098 | Ga0307412_101970982 | 87 |
| 346 | 3300035092 | Ga0373952_0001950 | Ga0373952_0001950_599_865 | 87 |
| 347 | 3300035172 | Ga0373955_0299717 | Ga0373955_0299717_159_422 | 87 |
| 348 | 3300035172 | Ga0373955_0824571 | Ga0373955_0824571_29_292 | 87 |
| 349 | 3300035241 | Ga0373961_0050216 | Ga0373961_0050216_937_1203 | 87 |
| 350 | 3300035410 | Ga0373924_0221463 | Ga0373924_0221463_524_787 | 87 |
| 351 | 3300035725 | Ga0373947_1037173 | Ga0373947_1037173_238_501 | 87 |
| 352 | 3300036401 | Ga0373937_0006046 | Ga0373937_0006046_745_1008 | 87 |
| 353 | 3300037068 | Ga0373925_1153276 | Ga0373925_1153276_126_392 | 87 |
| 354 | 3300037068 | Ga0373925_1537367 | Ga0373925_1537367_157_420 | 87 |
| 355 | 3300042001 | Ga0439441_013676 | Ga0439441_013676_1137_1400 | 87 |
| 356 | 3300044712 | Ga0453684_1389708 | Ga0453684_1389708_21_287 | 87 |
| 357 | 3300045051 | Ga0451576_0311617 | Ga0451576_0311617_100_363 | 87 |
| 358 | 3300046454 | Ga0495592_0003821 | Ga0495592_0003821_6254_6517 | 87 |
| 359 | 3300046454 | Ga0495592_0551946 | Ga0495592_0551946_19_282 | 87 |
| 360 | 3300046455 | Ga0495603_0607940 | Ga0495603_0607940_172_435 | 87 |
| 361 | 3300046461 | Ga0495641_0235955 | Ga0495641_0235955_519_782 | 87 |
| 362 | 3300046463 | Ga0495653_0132467 | Ga0495653_0132467_400_663 | 87 |
| 363 | 3300046475 | Ga0495639_0058813 | Ga0495639_0058813_546_809 | 87 |
| 364 | 3300046476 | Ga0495662_0008976 | Ga0495662_0008976_1906_2169 | 87 |
| 365 | 3300046511 | Ga0495608_0002044 | Ga0495608_0002044_10894_11157 | 87 |
| 366 | 3300046514 | Ga0495618_0022560 | Ga0495618_0022560_1234_1497 | 87 |
| 367 | 3300046516 | Ga0495628_0016487 | Ga0495628_0016487_88_351 | 87 |
| 368 | 3300046516 | Ga0495628_0453205 | Ga0495628_0453205_202_465 | 87 |
| 369 | 3300046517 | Ga0495630_0001185 | Ga0495630_0001185_8895_9158 | 87 |
| 370 | 3300046517 | Ga0495630_0039270 | Ga0495630_0039270_2029_2292 | 87 |
| 371 | 3300046526 | Ga0495666_0003317 | Ga0495666_0003317_7171_7434 | 87 |
| 372 | 3300046529 | Ga0495652_0033401 | Ga0495652_0033401_2228_2491 | 87 |
| 373 | 3300046533 | Ga0495640_0000808 | Ga0495640_0000808_14187_14450 | 87 |
| 374 | 3300046533 | Ga0495640_0004665 | Ga0495640_0004665_8710_8973 | 87 |
| 375 | 3300046535 | Ga0495586_0000440 | Ga0495586_0000440_12954_13217 | 87 |
| 376 | 3300046535 | Ga0495586_0028778 | Ga0495586_0028778_646_909 | 87 |
| 377 | 3300046543 | Ga0495645_0274616 | Ga0495645_0274616_292_555 | 87 |
| 378 | 3300046559 | Ga0495667_0001153 | Ga0495667_0001153_2874_3137 | 87 |
| 379 | 3300046642 | Ga0495634_0002587 | Ga0495634_0002587_10700_10963 | 87 |
| 380 | 3300046642 | Ga0495634_0091842 | Ga0495634_0091842_878_1141 | 87 |
| 381 | 3300046663 | Ga0495635_0097799 | Ga0495635_0097799_88_351 | 87 |
| 382 | 3300046663 | Ga0495635_0132240 | Ga0495635_0132240_540_803 | 87 |
| 383 | 3300046678 | Ga0495599_0007763 | Ga0495599_0007763_5725_5988 | 87 |
| 384 | 3300046681 | Ga0495647_0419253 | Ga0495647_0419253_135_398 | 87 |
| 385 | 3300046683 | Ga0495658_0172434 | Ga0495658_0172434_216_479 | 87 |
| 386 | 3300046689 | Ga0495613_0025295 | Ga0495613_0025295_2138_2401 | 87 |
| 387 | 3300046690 | Ga0495624_0034028 | Ga0495624_0034028_1048_1311 | 87 |
| 388 | 3300046690 | Ga0495624_0199350 | Ga0495624_0199350_855_1118 | 87 |
| 389 | 3300046809 | Ga0495600_0008016 | Ga0495600_0008016_5716_5979 | 87 |
| 390 | 3300047315 | Ga0495581_0175427 | Ga0495581_0175427_772_1035 | 87 |
| 391 | 3300047317 | Ga0495604_0002447 | Ga0495604_0002447_793_1056 | 87 |
| 392 | 3300047318 | Ga0495636_0133687 | Ga0495636_0133687_52_315 | 87 |
| 393 | 3300047318 | Ga0495636_0312728 | Ga0495636_0312728_199_462 | 87 |
| 394 | 3300047318 | Ga0495636_0609051 | Ga0495636_0609051_66_329 | 87 |
| 395 | 3300047319 | Ga0495674_0123030 | Ga0495674_0123030_40_303 | 87 |
| 396 | 3300047319 | Ga0495674_0285677 | Ga0495674_0285677_216_479 | 87 |
| 397 | 3300047322 | Ga0495680_0001572 | Ga0495680_0001572_12509_12772 | 87 |
| 398 | 3300047322 | Ga0495680_0296405 | Ga0495680_0296405_627_890 | 87 |
| 399 | 3300047444 | Ga0495675_0528769 | Ga0495675_0528769_279_542 | 87 |
| 400 | 3300047471 | Ga0495684_0018458 | Ga0495684_0018458_4031_4294 | 87 |
| 401 | 3300048089 | Ga0495614_0425781 | Ga0495614_0425781_58_321 | 87 |
| 402 | 3300049568 | Ga0501031_0283837 | Ga0501031_0283837_651_914 | 87 |
| 403 | 3300049575 | Ga0501039_0174792 | Ga0501039_0174792_1173_1436 | 87 |
| 404 | 3300049576 | Ga0501040_0016065 | Ga0501040_0016065_4155_4418 | 87 |
| 405 | 3300049576 | Ga0501040_0541392 | Ga0501040_0541392_315_578 | 87 |
| 406 | 3300049587 | Ga0501071_1107370 | Ga0501071_1107370_17_280 | 87 |
| 407 | 3300049824 | Ga0501045_1238818 | Ga0501045_1238818_147_410 | 87 |
| 408 | 3300050494 | nmdc:mga06z11_390846_c1 | nmdc:mga06z11_390846_c1_19_282 | 87 |
| 409 | 3300050507 | nmdc:mga05p37_1692350_c1 | nmdc:mga05p37_1692350_c1_180_443 | 87 |
| 410 | 3300050507 | nmdc:mga05p37_320641_c1 | nmdc:mga05p37_320641_c1_576_842 | 87 |
| 411 | 3300050508 | nmdc:mga09592_106007_c1 | nmdc:mga09592_106007_c1_556_819 | 87 |
| 412 | 3300050508 | nmdc:mga09592_235628_c1 | nmdc:mga09592_235628_c1_1029_1295 | 87 |
| 413 | 3300050509 | nmdc:mga0qj67_248854_c1 | nmdc:mga0qj67_248854_c1_374_640 | 87 |
| 414 | 3300050511 | nmdc:mga08y16_115323_c1 | nmdc:mga08y16_115323_c1_230_496 | 87 |
| 415 | 3300050511 | nmdc:mga08y16_1301843_c1 | nmdc:mga08y16_1301843_c1_225_488 | 87 |
| 416 | 3300050512 | nmdc:mga0n895_1563_c1 | nmdc:mga0n895_1563_c1_2797_3060 | 87 |
| 417 | 3300050513 | nmdc:mga0rr50_258537_c1 | nmdc:mga0rr50_258537_c1_242_505 | 87 |
| 418 | 3300053077 | Ga0495601_0005497 | Ga0495601_0005497_4011_4274 | 87 |
| 419 | 3300053077 | Ga0495601_0083732 | Ga0495601_0083732_928_1191 | 87 |
| 420 | 3300053094 | Ga0500566_0122685 | Ga0500566_0122685_118_381 | 87 |
| 421 | 3300005329 | Ga0070683_100228472 | Ga0070683_1002284722 | 88 |
| 422 | 3300005439 | Ga0070711_101262697 | Ga0070711_1012626971 | 88 |
| 423 | 3300005458 | Ga0070681_10338742 | Ga0070681_103387422 | 88 |
| 424 | 3300006846 | Ga0075430_100537999 | Ga0075430_1005379992 | 88 |
| 425 | 3300007265 | Ga0099794_10421351 | Ga0099794_104213512 | 88 |
| 426 | 3300025912 | Ga0207707_10440915 | Ga0207707_104409152 | 88 |
| 427 | 3300025916 | Ga0207663_10448430 | Ga0207663_104484302 | 88 |
| 428 | 3300025917 | Ga0207660_10626293 | Ga0207660_106262932 | 88 |
| 429 | 3300025944 | Ga0207661_10116956 | Ga0207661_101169562 | 88 |
| 430 | 3300026075 | Ga0207708_11522484 | Ga0207708_115224842 | 88 |
| 431 | 3300031548 | Ga0307408_101637079 | Ga0307408_1016370792 | 88 |
| 432 | 3300035207 | Ga0373942_0006452 | Ga0373942_0006452_319_585 | 88 |
| 433 | 3300035410 | Ga0373924_0203820 | Ga0373924_0203820_86_352 | 88 |
| 434 | 3300035724 | Ga0373933_0202219 | Ga0373933_0202219_742_1008 | 88 |
| 435 | 3300036401 | Ga0373937_0193976 | Ga0373937_0193976_1508_1774 | 88 |
| 436 | 3300046462 | Ga0495651_0287408 | Ga0495651_0287408_200_466 | 88 |
| 437 | 3300046529 | Ga0495652_0180923 | Ga0495652_0180923_1078_1344 | 88 |
| 438 | 3300046559 | Ga0495667_0192726 | Ga0495667_0192726_899_1165 | 88 |
| 439 | 3300046675 | Ga0495657_0825119 | Ga0495657_0825119_66_332 | 88 |
| 440 | 3300047317 | Ga0495604_0134414 | Ga0495604_0134414_772_1038 | 88 |
| 441 | 3300049581 | Ga0501047_0875526 | Ga0501047_0875526_391_660 | 88 |
| 442 | 3300049585 | Ga0501069_0890123 | Ga0501069_0890123_122_388 | 88 |
| 443 | 3300049593 | Ga0501077_0312874 | Ga0501077_0312874_403_669 | 88 |
| 444 | 3300049742 | Ga0501080_1221096 | Ga0501080_1221096_187_456 | 88 |
| 445 | 3300050509 | nmdc:mga0qj67_512293_c1 | nmdc:mga0qj67_512293_c1_587_853 | 88 |
| 446 | 3300053077 | Ga0495601_0630251 | Ga0495601_0630251_387_653 | 88 |
| 447 | 3300059426 | Ga0590077_050692 | Ga0590077_050692_535_801 | 88 |
| 448 | 3300005290 | Ga0065712_10380110 | Ga0065712_103801103 | 89 |
| 449 | 3300005331 | Ga0070670_100290586 | Ga0070670_1002905862 | 89 |
| 450 | 3300005331 | Ga0070670_101506574 | Ga0070670_1015065741 | 89 |
| 451 | 3300005336 | Ga0070680_100189194 | Ga0070680_1001891944 | 89 |
| 452 | 3300005340 | Ga0070689_100357767 | Ga0070689_1003577672 | 89 |
| 453 | 3300005340 | Ga0070689_101641949 | Ga0070689_1016419492 | 89 |
| 454 | 3300005468 | Ga0070707_100753833 | Ga0070707_1007538331 | 89 |
| 455 | 3300005544 | Ga0070686_100969123 | Ga0070686_1009691232 | 89 |
| 456 | 3300005546 | Ga0070696_100717106 | Ga0070696_1007171061 | 89 |
| 457 | 3300006846 | Ga0075430_100341025 | Ga0075430_1003410254 | 89 |
| 458 | 3300006847 | Ga0075431_100016437 | Ga0075431_10001643710 | 89 |
| 459 | 3300006852 | Ga0075433_11086754 | Ga0075433_110867542 | 89 |
| 460 | 3300006871 | Ga0075434_100000011 | Ga0075434_10000001142 | 89 |
| 461 | 3300006880 | Ga0075429_100226541 | Ga0075429_1002265412 | 89 |
| 462 | 3300006914 | Ga0075436_100504715 | Ga0075436_1005047152 | 89 |
| 463 | 3300007076 | Ga0075435_100029181 | Ga0075435_1000291815 | 89 |
| 464 | 3300009094 | Ga0111539_10150838 | Ga0111539_101508383 | 89 |
| 465 | 3300009094 | Ga0111539_10958092 | Ga0111539_109580923 | 89 |
| 466 | 3300009147 | Ga0114129_11444908 | Ga0114129_114449083 | 89 |
| 467 | 3300013308 | Ga0157375_11045777 | Ga0157375_110457771 | 89 |
| 468 | 3300014326 | Ga0157380_10907627 | Ga0157380_109076271 | 89 |
| 469 | 3300025901 | Ga0207688_10740502 | Ga0207688_107405021 | 89 |
| 470 | 3300025920 | Ga0207649_11439209 | Ga0207649_114392091 | 89 |
| 471 | 3300025922 | Ga0207646_10663526 | Ga0207646_106635261 | 89 |
| 472 | 3300025925 | Ga0207650_11534089 | Ga0207650_115340891 | 89 |
| 473 | 3300025936 | Ga0207670_11394570 | Ga0207670_113945702 | 89 |
| 474 | 3300025938 | Ga0207704_11779416 | Ga0207704_117794161 | 89 |
| 475 | 3300027360 | Ga0209969_1003617 | Ga0209969_10036174 | 89 |
| 476 | 3300027378 | Ga0209981_1021781 | Ga0209981_10217812 | 89 |
| 477 | 3300027462 | Ga0210000_1042787 | Ga0210000_10427872 | 89 |
| 478 | 3300027526 | Ga0209968_1065309 | Ga0209968_10653092 | 89 |
| 479 | 3300027876 | Ga0209974_10032169 | Ga0209974_100321693 | 89 |
| 480 | 3300031548 | Ga0307408_100164000 | Ga0307408_1001640002 | 89 |
| 481 | 3300031548 | Ga0307408_100759153 | Ga0307408_1007591532 | 89 |
| 482 | 3300031731 | Ga0307405_10174146 | Ga0307405_101741462 | 89 |
| 483 | 3300032002 | Ga0307416_100343938 | Ga0307416_1003439382 | 89 |
| 484 | 3300032005 | Ga0307411_11147741 | Ga0307411_111477412 | 89 |
| 485 | 3300035084 | Ga0373928_0176903 | Ga0373928_0176903_227_496 | 89 |
| 486 | 3300041410 | Ga0439461_0002213 | Ga0439461_0002213_1850_2119 | 89 |
| 487 | 3300042156 | Ga0439446_0000176 | Ga0439446_0000176_6382_6651 | 89 |
| 488 | 3300042435 | Ga0439434_0001633 | Ga0439434_0001633_4638_4907 | 89 |
| 489 | 3300042436 | Ga0439435_0000026 | Ga0439435_0000026_212_481 | 89 |
| 490 | 3300046537 | Ga0495598_0295255 | Ga0495598_0295255_97_375 | 89 |
| 491 | 3300048903 | Ga0496100_0285861 | Ga0496100_0285861_327_596 | 89 |
| 492 | 3300048904 | Ga0496101_0367531 | Ga0496101_0367531_760_1029 | 89 |
| 493 | 3300048907 | Ga0496104_0797108 | Ga0496104_0797108_211_480 | 89 |
| 494 | 3300048909 | Ga0496106_0074134 | Ga0496106_0074134_1887_2156 | 89 |
| 495 | 3300048917 | Ga0496114_0093146 | Ga0496114_0093146_1651_1920 | 89 |
| 496 | 3300049572 | Ga0501036_1198192 | Ga0501036_1198192_200_469 | 89 |
| 497 | 3300049582 | Ga0501048_1283986 | Ga0501048_1283986_51_320 | 89 |
| 498 | 3300049592 | Ga0501076_0224034 | Ga0501076_0224034_409_678 | 89 |
| 499 | 3300050508 | nmdc:mga09592_103435_c1 | nmdc:mga09592_103435_c1_289_558 | 89 |
| 500 | 3300050509 | nmdc:mga0qj67_408212_c1 | nmdc:mga0qj67_408212_c1_674_943 | 89 |
| 501 | 3300050510 | nmdc:mga06r32_1679372_c1 | nmdc:mga06r32_1679372_c1_25_303 | 89 |
| 502 | 3300050510 | nmdc:mga06r32_7083_c1 | nmdc:mga06r32_7083_c1_2945_3214 | 89 |
| 503 | 3300050511 | nmdc:mga08y16_117352_c1 | nmdc:mga08y16_117352_c1_1828_2097 | 89 |
| 504 | 3300050511 | nmdc:mga08y16_1772955_c1 | nmdc:mga08y16_1772955_c1_10_279 | 89 |
| 505 | 3300050512 | nmdc:mga0n895_1336_c1 | nmdc:mga0n895_1336_c1_14844_15113 | 89 |
| 506 | 3300050513 | nmdc:mga0rr50_35369_c1 | nmdc:mga0rr50_35369_c1_1996_2265 | 89 |
| 507 | 3300050514 | nmdc:mga08x19_670353_c1 | nmdc:mga08x19_670353_c1_86_355 | 89 |
| 508 | 3300060353 | Ga0501082_0336784 | Ga0501082_0336784_936_1205 | 89 |
| 509 | 3300003203 | JGI25406J46586_10035649 | JGI25406J46586_100356491 | 90 |
| 510 | 3300003322 | rootL2_10010637 | rootL2_100106376 | 90 |
| 511 | 3300003323 | rootH1_10178713 | rootH1_101787132 | 90 |
| 512 | 3300003763 | Ga0055529_1000015 | Ga0055529_1000015171 | 90 |
| 513 | 3300005328 | Ga0070676_10759131 | Ga0070676_107591311 | 90 |
| 514 | 3300005329 | Ga0070683_101622413 | Ga0070683_1016224132 | 90 |
| 515 | 3300005330 | Ga0070690_101016336 | Ga0070690_1010163362 | 90 |
| 516 | 3300005336 | Ga0070680_100061318 | Ga0070680_1000613182 | 90 |
| 517 | 3300005338 | Ga0068868_101098168 | Ga0068868_1010981682 | 90 |
| 518 | 3300005338 | Ga0068868_101890732 | Ga0068868_1018907322 | 90 |
| 519 | 3300005340 | Ga0070689_100727136 | Ga0070689_1007271361 | 90 |
| 520 | 3300005343 | Ga0070687_100128970 | Ga0070687_1001289702 | 90 |
| 521 | 3300005343 | Ga0070687_100673294 | Ga0070687_1006732942 | 90 |
| 522 | 3300005345 | Ga0070692_10779827 | Ga0070692_107798272 | 90 |
| 523 | 3300005353 | Ga0070669_101040733 | Ga0070669_1010407332 | 90 |
| 524 | 3300005354 | Ga0070675_100345976 | Ga0070675_1003459762 | 90 |
| 525 | 3300005354 | Ga0070675_100705968 | Ga0070675_1007059682 | 90 |
| 526 | 3300005354 | Ga0070675_101221138 | Ga0070675_1012211382 | 90 |
| 527 | 3300005356 | Ga0070674_100664544 | Ga0070674_1006645442 | 90 |
| 528 | 3300005364 | Ga0070673_100467413 | Ga0070673_1004674132 | 90 |
| 529 | 3300005364 | Ga0070673_100765611 | Ga0070673_1007656112 | 90 |
| 530 | 3300005365 | Ga0070688_100033844 | Ga0070688_1000338445 | 90 |
| 531 | 3300005406 | Ga0070703_10142223 | Ga0070703_101422232 | 90 |
| 532 | 3300005434 | Ga0070709_10519574 | Ga0070709_105195742 | 90 |
| 533 | 3300005435 | Ga0070714_100011982 | Ga0070714_1000119826 | 90 |
| 534 | 3300005436 | Ga0070713_100399710 | Ga0070713_1003997102 | 90 |
| 535 | 3300005436 | Ga0070713_102422813 | Ga0070713_1024228132 | 90 |
| 536 | 3300005438 | Ga0070701_10130788 | Ga0070701_101307882 | 90 |
| 537 | 3300005440 | Ga0070705_100027892 | Ga0070705_1000278925 | 90 |
| 538 | 3300005440 | Ga0070705_100075566 | Ga0070705_1000755662 | 90 |
| 539 | 3300005440 | Ga0070705_100721539 | Ga0070705_1007215392 | 90 |
| 540 | 3300005440 | Ga0070705_101319470 | Ga0070705_1013194701 | 90 |
| 541 | 3300005441 | Ga0070700_100216498 | Ga0070700_1002164982 | 90 |
| 542 | 3300005441 | Ga0070700_100263736 | Ga0070700_1002637361 | 90 |
| 543 | 3300005441 | Ga0070700_100721722 | Ga0070700_1007217222 | 90 |
| 544 | 3300005444 | Ga0070694_100017277 | Ga0070694_1000172773 | 90 |
| 545 | 3300005444 | Ga0070694_100057979 | Ga0070694_1000579793 | 90 |
| 546 | 3300005444 | Ga0070694_100077882 | Ga0070694_1000778823 | 90 |
| 547 | 3300005444 | Ga0070694_100266507 | Ga0070694_1002665072 | 90 |
| 548 | 3300005444 | Ga0070694_100391685 | Ga0070694_1003916853 | 90 |
| 549 | 3300005444 | Ga0070694_101758613 | Ga0070694_1017586132 | 90 |
| 550 | 3300005445 | Ga0070708_101631857 | Ga0070708_1016318571 | 90 |
| 551 | 3300005458 | Ga0070681_10000399 | Ga0070681_100003996 | 90 |
| 552 | 3300005459 | Ga0068867_100846461 | Ga0068867_1008464612 | 90 |
| 553 | 3300005468 | Ga0070707_101083333 | Ga0070707_1010833332 | 90 |
| 554 | 3300005471 | Ga0070698_100162623 | Ga0070698_1001626232 | 90 |
| 555 | 3300005518 | Ga0070699_100015187 | Ga0070699_1000151872 | 90 |
| 556 | 3300005518 | Ga0070699_100102761 | Ga0070699_1001027614 | 90 |
| 557 | 3300005530 | Ga0070679_101063904 | Ga0070679_1010639042 | 90 |
| 558 | 3300005535 | Ga0070684_100874045 | Ga0070684_1008740452 | 90 |
| 559 | 3300005536 | Ga0070697_100000648 | Ga0070697_1000006484 | 90 |
| 560 | 3300005536 | Ga0070697_100663479 | Ga0070697_1006634791 | 90 |
| 561 | 3300005536 | Ga0070697_101303123 | Ga0070697_1013031232 | 90 |
| 562 | 3300005543 | Ga0070672_100786395 | Ga0070672_1007863952 | 90 |
| 563 | 3300005544 | Ga0070686_100227621 | Ga0070686_1002276212 | 90 |
| 564 | 3300005544 | Ga0070686_100625088 | Ga0070686_1006250882 | 90 |
| 565 | 3300005545 | Ga0070695_100000362 | Ga0070695_10000036222 | 90 |
| 566 | 3300005545 | Ga0070695_100164586 | Ga0070695_1001645862 | 90 |
| 567 | 3300005545 | Ga0070695_100831223 | Ga0070695_1008312232 | 90 |
| 568 | 3300005545 | Ga0070695_101127588 | Ga0070695_1011275882 | 90 |
| 569 | 3300005545 | Ga0070695_101616568 | Ga0070695_1016165681 | 90 |
| 570 | 3300005546 | Ga0070696_100002485 | Ga0070696_10000248512 | 90 |
| 571 | 3300005546 | Ga0070696_100471717 | Ga0070696_1004717172 | 90 |
| 572 | 3300005546 | Ga0070696_100603027 | Ga0070696_1006030271 | 90 |
| 573 | 3300005547 | Ga0070693_100168146 | Ga0070693_1001681462 | 90 |
| 574 | 3300005549 | Ga0070704_100009024 | Ga0070704_1000090243 | 90 |
| 575 | 3300005549 | Ga0070704_100025353 | Ga0070704_1000253533 | 90 |
| 576 | 3300005549 | Ga0070704_100623839 | Ga0070704_1006238392 | 90 |
| 577 | 3300005549 | Ga0070704_100791533 | Ga0070704_1007915331 | 90 |
| 578 | 3300005577 | Ga0068857_102182359 | Ga0068857_1021823592 | 90 |
| 579 | 3300005578 | Ga0068854_102014307 | Ga0068854_1020143072 | 90 |
| 580 | 3300005615 | Ga0070702_100018216 | Ga0070702_1000182162 | 90 |
| 581 | 3300005615 | Ga0070702_100239864 | Ga0070702_1002398642 | 90 |
| 582 | 3300005617 | Ga0068859_101070061 | Ga0068859_1010700612 | 90 |
| 583 | 3300005719 | Ga0068861_100128148 | Ga0068861_1001281482 | 90 |
| 584 | 3300005840 | Ga0068870_10492096 | Ga0068870_104920962 | 90 |
| 585 | 3300005842 | Ga0068858_101160466 | Ga0068858_1011604662 | 90 |
| 586 | 3300005981 | Ga0081538_10152692 | Ga0081538_101526922 | 90 |
| 587 | 3300005985 | Ga0081539_10000686 | Ga0081539_1000068657 | 90 |
| 588 | 3300006173 | Ga0070716_100101869 | Ga0070716_1001018692 | 90 |
| 589 | 3300006173 | Ga0070716_100445383 | Ga0070716_1004453831 | 90 |
| 590 | 3300006358 | Ga0068871_101409027 | Ga0068871_1014090272 | 90 |
| 591 | 3300006844 | Ga0075428_100214190 | Ga0075428_1002141903 | 90 |
| 592 | 3300006844 | Ga0075428_100456878 | Ga0075428_1004568782 | 90 |
| 593 | 3300006846 | Ga0075430_100000550 | Ga0075430_1000005508 | 90 |
| 594 | 3300006846 | Ga0075430_100007696 | Ga0075430_1000076965 | 90 |
| 595 | 3300006846 | Ga0075430_100189368 | Ga0075430_1001893683 | 90 |
| 596 | 3300006846 | Ga0075430_100483458 | Ga0075430_1004834582 | 90 |
| 597 | 3300006846 | Ga0075430_100776711 | Ga0075430_1007767112 | 90 |
| 598 | 3300006846 | Ga0075430_100852917 | Ga0075430_1008529172 | 90 |
| 599 | 3300006847 | Ga0075431_100353925 | Ga0075431_1003539253 | 90 |
| 600 | 3300006847 | Ga0075431_100397211 | Ga0075431_1003972112 | 90 |
| 601 | 3300006847 | Ga0075431_100443596 | Ga0075431_1004435962 | 90 |
| 602 | 3300006847 | Ga0075431_100522127 | Ga0075431_1005221272 | 90 |
| 603 | 3300006847 | Ga0075431_100656026 | Ga0075431_1006560262 | 90 |
| 604 | 3300006852 | Ga0075433_10164444 | Ga0075433_101644443 | 90 |
| 605 | 3300006871 | Ga0075434_100266698 | Ga0075434_1002666983 | 90 |
| 606 | 3300006880 | Ga0075429_100069548 | Ga0075429_1000695482 | 90 |
| 607 | 3300006880 | Ga0075429_100072951 | Ga0075429_1000729513 | 90 |
| 608 | 3300006880 | Ga0075429_101344870 | Ga0075429_1013448702 | 90 |
| 609 | 3300006914 | Ga0075436_100004494 | Ga0075436_1000044948 | 90 |
| 610 | 3300006914 | Ga0075436_100014323 | Ga0075436_1000143236 | 90 |
| 611 | 3300006914 | Ga0075436_100042934 | Ga0075436_1000429343 | 90 |
| 612 | 3300006914 | Ga0075436_100164546 | Ga0075436_1001645463 | 90 |
| 613 | 3300006914 | Ga0075436_100166596 | Ga0075436_1001665962 | 90 |
| 614 | 3300006914 | Ga0075436_100606801 | Ga0075436_1006068012 | 90 |
| 615 | 3300006931 | Ga0097620_101070087 | Ga0097620_1010700872 | 90 |
| 616 | 3300007076 | Ga0075435_100060020 | Ga0075435_1000600204 | 90 |
| 617 | 3300007076 | Ga0075435_100129605 | Ga0075435_1001296052 | 90 |
| 618 | 3300007076 | Ga0075435_100723078 | Ga0075435_1007230782 | 90 |
| 619 | 3300007265 | Ga0099794_10022481 | Ga0099794_100224814 | 90 |
| 620 | 3300007265 | Ga0099794_10415968 | Ga0099794_104159681 | 90 |
| 621 | 3300009094 | Ga0111539_10016381 | Ga0111539_100163815 | 90 |
| 622 | 3300009094 | Ga0111539_10039269 | Ga0111539_100392695 | 90 |
| 623 | 3300009094 | Ga0111539_10070916 | Ga0111539_100709165 | 90 |
| 624 | 3300009094 | Ga0111539_11783976 | Ga0111539_117839762 | 90 |
| 625 | 3300009094 | Ga0111539_13494213 | Ga0111539_134942132 | 90 |
| 626 | 3300009098 | Ga0105245_11176772 | Ga0105245_111767722 | 90 |
| 627 | 3300009147 | Ga0114129_10961706 | Ga0114129_109617062 | 90 |
| 628 | 3300009147 | Ga0114129_11193197 | Ga0114129_111931972 | 90 |
| 629 | 3300009147 | Ga0114129_12507585 | Ga0114129_125075852 | 90 |
| 630 | 3300009147 | Ga0114129_12724503 | Ga0114129_127245031 | 90 |
| 631 | 3300009148 | Ga0105243_10010536 | Ga0105243_100105363 | 90 |
| 632 | 3300009176 | Ga0105242_10372148 | Ga0105242_103721482 | 90 |
| 633 | 3300009553 | Ga0105249_10004477 | Ga0105249_1000447710 | 90 |
| 634 | 3300009553 | Ga0105249_12614768 | Ga0105249_126147682 | 90 |
| 635 | 3300013297 | Ga0157378_12532270 | Ga0157378_125322702 | 90 |
| 636 | 3300013306 | Ga0163162_10757695 | Ga0163162_107576952 | 90 |
| 637 | 3300013307 | Ga0157372_10357574 | Ga0157372_103575742 | 90 |
| 638 | 3300014326 | Ga0157380_10001505 | Ga0157380_1000150510 | 90 |
| 639 | 3300014745 | Ga0157377_10065103 | Ga0157377_100651033 | 90 |
| 640 | 3300025233 | Ga0209437_119409 | Ga0209437_1194092 | 90 |
| 641 | 3300025272 | Ga0209455_1000031 | Ga0209455_1000031172 | 90 |
| 642 | 3300025901 | Ga0207688_10030324 | Ga0207688_100303242 | 90 |
| 643 | 3300025907 | Ga0207645_10263795 | Ga0207645_102637952 | 90 |
| 644 | 3300025907 | Ga0207645_10270574 | Ga0207645_102705742 | 90 |
| 645 | 3300025908 | Ga0207643_10428606 | Ga0207643_104286062 | 90 |
| 646 | 3300025912 | Ga0207707_10003163 | Ga0207707_1000316316 | 90 |
| 647 | 3300025912 | Ga0207707_10651865 | Ga0207707_106518652 | 90 |
| 648 | 3300025917 | Ga0207660_10720685 | Ga0207660_107206852 | 90 |
| 649 | 3300025917 | Ga0207660_10863670 | Ga0207660_108636702 | 90 |
| 650 | 3300025918 | Ga0207662_10129249 | Ga0207662_101292493 | 90 |
| 651 | 3300025918 | Ga0207662_10543112 | Ga0207662_105431122 | 90 |
| 652 | 3300025922 | Ga0207646_10404443 | Ga0207646_104044432 | 90 |
| 653 | 3300025926 | Ga0207659_10068577 | Ga0207659_100685772 | 90 |
| 654 | 3300025926 | Ga0207659_11884448 | Ga0207659_118844482 | 90 |
| 655 | 3300025927 | Ga0207687_11552174 | Ga0207687_115521741 | 90 |
| 656 | 3300025928 | Ga0207700_10760973 | Ga0207700_107609732 | 90 |
| 657 | 3300025929 | Ga0207664_10398785 | Ga0207664_103987852 | 90 |
| 658 | 3300025936 | Ga0207670_10352382 | Ga0207670_103523822 | 90 |
| 659 | 3300025937 | Ga0207669_10659205 | Ga0207669_106592052 | 90 |
| 660 | 3300025939 | Ga0207665_10132548 | Ga0207665_101325481 | 90 |
| 661 | 3300025939 | Ga0207665_10317248 | Ga0207665_103172482 | 90 |
| 662 | 3300025942 | Ga0207689_10562218 | Ga0207689_105622182 | 90 |
| 663 | 3300025944 | Ga0207661_11151068 | Ga0207661_111510682 | 90 |
| 664 | 3300025960 | Ga0207651_10251540 | Ga0207651_102515402 | 90 |
| 665 | 3300025972 | Ga0207668_11245685 | Ga0207668_112456851 | 90 |
| 666 | 3300026023 | Ga0207677_10335847 | Ga0207677_103358473 | 90 |
| 667 | 3300026023 | Ga0207677_10919033 | Ga0207677_109190332 | 90 |
| 668 | 3300026075 | Ga0207708_10113450 | Ga0207708_101134503 | 90 |
| 669 | 3300026075 | Ga0207708_10354104 | Ga0207708_103541042 | 90 |
| 670 | 3300026075 | Ga0207708_11288530 | Ga0207708_112885302 | 90 |
| 671 | 3300026075 | Ga0207708_11779641 | Ga0207708_117796411 | 90 |
| 672 | 3300026089 | Ga0207648_11126314 | Ga0207648_111263141 | 90 |
| 673 | 3300026089 | Ga0207648_12189534 | Ga0207648_121895342 | 90 |
| 674 | 3300026116 | Ga0207674_10159116 | Ga0207674_101591161 | 90 |
| 675 | 3300026118 | Ga0207675_100654318 | Ga0207675_1006543182 | 90 |
| 676 | 3300027360 | Ga0209969_1001086 | Ga0209969_10010863 | 90 |
| 677 | 3300027360 | Ga0209969_1016600 | Ga0209969_10166002 | 90 |
| 678 | 3300027364 | Ga0209967_1001327 | Ga0209967_10013272 | 90 |
| 679 | 3300027364 | Ga0209967_1003025 | Ga0209967_10030253 | 90 |
| 680 | 3300027378 | Ga0209981_1001444 | Ga0209981_10014445 | 90 |
| 681 | 3300027378 | Ga0209981_1010103 | Ga0209981_10101031 | 90 |
| 682 | 3300027395 | Ga0209996_1060653 | Ga0209996_10606532 | 90 |
| 683 | 3300027462 | Ga0210000_1001892 | Ga0210000_10018923 | 90 |
| 684 | 3300027462 | Ga0210000_1002212 | Ga0210000_10022122 | 90 |
| 685 | 3300027471 | Ga0209995_1001597 | Ga0209995_10015974 | 90 |
| 686 | 3300027471 | Ga0209995_1007282 | Ga0209995_10072823 | 90 |
| 687 | 3300027471 | Ga0209995_1028014 | Ga0209995_10280142 | 90 |
| 688 | 3300027526 | Ga0209968_1002375 | Ga0209968_10023753 | 90 |
| 689 | 3300027526 | Ga0209968_1003221 | Ga0209968_10032211 | 90 |
| 690 | 3300027526 | Ga0209968_1018430 | Ga0209968_10184302 | 90 |
| 691 | 3300027543 | Ga0209999_1000334 | Ga0209999_10003342 | 90 |
| 692 | 3300027543 | Ga0209999_1007955 | Ga0209999_10079552 | 90 |
| 693 | 3300027665 | Ga0209983_1052129 | Ga0209983_10521292 | 90 |
| 694 | 3300027671 | Ga0209588_1045166 | Ga0209588_10451662 | 90 |
| 695 | 3300027682 | Ga0209971_1007609 | Ga0209971_10076093 | 90 |
| 696 | 3300027695 | Ga0209966_1005660 | Ga0209966_10056603 | 90 |
| 697 | 3300027717 | Ga0209998_10031398 | Ga0209998_100313981 | 90 |
| 698 | 3300027876 | Ga0209974_10009715 | Ga0209974_100097153 | 90 |
| 699 | 3300027876 | Ga0209974_10169376 | Ga0209974_101693762 | 90 |
| 700 | 3300027907 | Ga0207428_10062422 | Ga0207428_100624223 | 90 |
| 701 | 3300027907 | Ga0207428_10214049 | Ga0207428_102140493 | 90 |
| 702 | 3300027907 | Ga0207428_10534253 | Ga0207428_105342532 | 90 |
| 703 | 3300028380 | Ga0268265_10551255 | Ga0268265_105512553 | 90 |
| 704 | 3300028381 | Ga0268264_10231781 | Ga0268264_102317813 | 90 |
| 705 | 3300031548 | Ga0307408_100481287 | Ga0307408_1004812872 | 90 |
| 706 | 3300031548 | Ga0307408_101274824 | Ga0307408_1012748241 | 90 |
| 707 | 3300031548 | Ga0307408_101627004 | Ga0307408_1016270042 | 90 |
| 708 | 3300031852 | Ga0307410_11808088 | Ga0307410_118080882 | 90 |
| 709 | 3300031901 | Ga0307406_10641146 | Ga0307406_106411462 | 90 |
| 710 | 3300031903 | Ga0307407_10873038 | Ga0307407_108730382 | 90 |
| 711 | 3300031911 | Ga0307412_10106667 | Ga0307412_101066673 | 90 |
| 712 | 3300031911 | Ga0307412_10733636 | Ga0307412_107336362 | 90 |
| 713 | 3300031911 | Ga0307412_10972524 | Ga0307412_109725242 | 90 |
| 714 | 3300031995 | Ga0307409_102277653 | Ga0307409_1022776532 | 90 |
| 715 | 3300032002 | Ga0307416_100183675 | Ga0307416_1001836753 | 90 |
| 716 | 3300032002 | Ga0307416_100474965 | Ga0307416_1004749651 | 90 |
| 717 | 3300032002 | Ga0307416_101611686 | Ga0307416_1016116862 | 90 |
| 718 | 3300032002 | Ga0307416_101652519 | Ga0307416_1016525192 | 90 |
| 719 | 3300032005 | Ga0307411_10349598 | Ga0307411_103495983 | 90 |
| 720 | 3300032005 | Ga0307411_10466326 | Ga0307411_104663262 | 90 |
| 721 | 3300032005 | Ga0307411_10887640 | Ga0307411_108876402 | 90 |
| 722 | 3300032005 | Ga0307411_11016350 | Ga0307411_110163502 | 90 |
| 723 | 3300032005 | Ga0307411_11583439 | Ga0307411_115834391 | 90 |
| 724 | 3300032005 | Ga0307411_11747277 | Ga0307411_117472772 | 90 |
| 725 | 3300034957 | Ga0373938_0077990 | Ga0373938_0077990_243_515 | 90 |
| 726 | 3300035084 | Ga0373928_0033048 | Ga0373928_0033048_396_668 | 90 |
| 727 | 3300035085 | Ga0373929_0110196 | Ga0373929_0110196_340_612 | 90 |
| 728 | 3300035085 | Ga0373929_0234115 | Ga0373929_0234115_63_335 | 90 |
| 729 | 3300035086 | Ga0373934_0018623 | Ga0373934_0018623_111_383 | 90 |
| 730 | 3300035088 | Ga0373940_0242819 | Ga0373940_0242819_181_453 | 90 |
| 731 | 3300035091 | Ga0373951_0187381 | Ga0373951_0187381_29_301 | 90 |
| 732 | 3300035092 | Ga0373952_0163933 | Ga0373952_0163933_19_291 | 90 |
| 733 | 3300035111 | Ga0373923_0079537 | Ga0373923_0079537_371_643 | 90 |
| 734 | 3300035112 | Ga0373932_0231573 | Ga0373932_0231573_134_406 | 90 |
| 735 | 3300035113 | Ga0373936_0252223 | Ga0373936_0252223_225_497 | 90 |
| 736 | 3300035114 | Ga0373939_0136570 | Ga0373939_0136570_68_340 | 90 |
| 737 | 3300035118 | Ga0373954_0000002 | Ga0373954_0000002_63290_63562 | 90 |
| 738 | 3300035119 | Ga0373956_0173831 | Ga0373956_0173831_283_555 | 90 |
| 739 | 3300035121 | Ga0373960_0221428 | Ga0373960_0221428_58_330 | 90 |
| 740 | 3300035170 | Ga0373943_0885911 | Ga0373943_0885911_68_340 | 90 |
| 741 | 3300035172 | Ga0373955_0083592 | Ga0373955_0083592_848_1120 | 90 |
| 742 | 3300035242 | Ga0373962_0063589 | Ga0373962_0063589_504_776 | 90 |
| 743 | 3300035410 | Ga0373924_0084250 | Ga0373924_0084250_702_974 | 90 |
| 744 | 3300035691 | Ga0373931_0120090 | Ga0373931_0120090_882_1154 | 90 |
| 745 | 3300035691 | Ga0373931_0441787 | Ga0373931_0441787_340_612 | 90 |
| 746 | 3300035724 | Ga0373933_0000657 | Ga0373933_0000657_18341_18613 | 90 |
| 747 | 3300036401 | Ga0373937_0000358 | Ga0373937_0000358_25844_26116 | 90 |
| 748 | 3300037068 | Ga0373925_1193750 | Ga0373925_1193750_93_365 | 90 |
| 749 | 3300041496 | Ga0451839_1400463 | Ga0451839_1400463_649_921 | 90 |
| 750 | 3300041501 | Ga0451845_0711978 | Ga0451845_0711978_105_419 | 90 |
| 751 | 3300042001 | Ga0439441_002685 | Ga0439441_002685_2202_2474 | 90 |
| 752 | 3300042003 | Ga0439443_012970 | Ga0439443_012970_835_1107 | 90 |
| 753 | 3300042011 | Ga0439454_015792 | Ga0439454_015792_96_368 | 90 |
| 754 | 3300042013 | Ga0439456_014934 | Ga0439456_014934_1100_1372 | 90 |
| 755 | 3300042016 | Ga0439463_145298 | Ga0439463_145298_37_309 | 90 |
| 756 | 3300042126 | Ga0450888_080082 | Ga0450888_080082_168_440 | 90 |
| 757 | 3300042147 | Ga0450910_040851 | Ga0450910_040851_173_445 | 90 |
| 758 | 3300042435 | Ga0439434_0063431 | Ga0439434_0063431_588_860 | 90 |
| 759 | 3300042437 | Ga0439444_0003007 | Ga0439444_0003007_504_776 | 90 |
| 760 | 3300042439 | Ga0439464_0069306 | Ga0439464_0069306_345_617 | 90 |
| 761 | 3300042461 | Ga0439460_0044333 | Ga0439460_0044333_371_643 | 90 |
| 762 | 3300042531 | Ga0450918_100795 | Ga0450918_100795_246_518 | 90 |
| 763 | 3300042876 | Ga0451577_0470068 | Ga0451577_0470068_411_683 | 90 |
| 764 | 3300044683 | Ga0466965_0165682 | Ga0466965_0165682_26_298 | 90 |
| 765 | 3300044694 | Ga0466963_0049527 | Ga0466963_0049527_1065_1340 | 90 |
| 766 | 3300044706 | Ga0466964_0004501 | Ga0466964_0004501_163_438 | 90 |
| 767 | 3300044706 | Ga0466964_0339405 | Ga0466964_0339405_41_313 | 90 |
| 768 | 3300045051 | Ga0451576_0146167 | Ga0451576_0146167_2146_2418 | 90 |
| 769 | 3300045051 | Ga0451576_2583611 | Ga0451576_2583611_80_352 | 90 |
| 770 | 3300045836 | Ga0466958_0145560 | Ga0466958_0145560_678_953 | 90 |
| 771 | 3300045976 | Ga0466967_0020049 | Ga0466967_0020049_1824_2099 | 90 |
| 772 | 3300046462 | Ga0495651_0279044 | Ga0495651_0279044_241_513 | 90 |
| 773 | 3300046491 | Ga0495584_0072974 | Ga0495584_0072974_948_1220 | 90 |
| 774 | 3300046511 | Ga0495608_0418106 | Ga0495608_0418106_158_430 | 90 |
| 775 | 3300046528 | Ga0495642_0199025 | Ga0495642_0199025_559_831 | 90 |
| 776 | 3300046528 | Ga0495642_0257853 | Ga0495642_0257853_26_298 | 90 |
| 777 | 3300046537 | Ga0495598_0103180 | Ga0495598_0103180_261_533 | 90 |
| 778 | 3300046537 | Ga0495598_0163324 | Ga0495598_0163324_497_769 | 90 |
| 779 | 3300046539 | Ga0495621_0029158 | Ga0495621_0029158_408_680 | 90 |
| 780 | 3300046539 | Ga0495621_0058828 | Ga0495621_0058828_463_735 | 90 |
| 781 | 3300046558 | Ga0495633_0375027 | Ga0495633_0375027_129_434 | 90 |
| 782 | 3300046559 | Ga0495667_0230699 | Ga0495667_0230699_897_1169 | 90 |
| 783 | 3300046664 | Ga0495659_0051963 | Ga0495659_0051963_558_830 | 90 |
| 784 | 3300046675 | Ga0495657_0302645 | Ga0495657_0302645_265_537 | 90 |
| 785 | 3300046684 | Ga0495669_0004311 | Ga0495669_0004311_1282_1554 | 90 |
| 786 | 3300047318 | Ga0495636_0699755 | Ga0495636_0699755_45_317 | 90 |
| 787 | 3300047444 | Ga0495675_0319881 | Ga0495675_0319881_84_356 | 90 |
| 788 | 3300049514 | Ga0501291_091408 | Ga0501291_091408_218_490 | 90 |
| 789 | 3300049515 | Ga0501292_036836 | Ga0501292_036836_35_307 | 90 |
| 790 | 3300049519 | Ga0501296_013948 | Ga0501296_013948_564_836 | 90 |
| 791 | 3300049519 | Ga0501296_045493 | Ga0501296_045493_20_292 | 90 |
| 792 | 3300049521 | Ga0501298_014855 | Ga0501298_014855_314_586 | 90 |
| 793 | 3300049522 | Ga0501299_005994 | Ga0501299_005994_1472_1744 | 90 |
| 794 | 3300049522 | Ga0501299_021606 | Ga0501299_021606_712_984 | 90 |
| 795 | 3300049522 | Ga0501299_172976 | Ga0501299_172976_162_434 | 90 |
| 796 | 3300049568 | Ga0501031_0837714 | Ga0501031_0837714_186_458 | 90 |
| 797 | 3300049569 | Ga0501032_0400987 | Ga0501032_0400987_83_355 | 90 |
| 798 | 3300049573 | Ga0501037_0481448 | Ga0501037_0481448_138_410 | 90 |
| 799 | 3300049574 | Ga0501038_0427688 | Ga0501038_0427688_605_877 | 90 |
| 800 | 3300049575 | Ga0501039_0085414 | Ga0501039_0085414_2099_2371 | 90 |
| 801 | 3300049575 | Ga0501039_0344457 | Ga0501039_0344457_24_296 | 90 |
| 802 | 3300049576 | Ga0501040_1325192 | Ga0501040_1325192_65_337 | 90 |
| 803 | 3300049577 | Ga0501041_0767380 | Ga0501041_0767380_116_391 | 90 |
| 804 | 3300049578 | Ga0501042_0341249 | Ga0501042_0341249_40_312 | 90 |
| 805 | 3300049578 | Ga0501042_1199542 | Ga0501042_1199542_40_312 | 90 |
| 806 | 3300049578 | Ga0501042_1367739 | Ga0501042_1367739_36_308 | 90 |
| 807 | 3300049579 | Ga0501043_0238284 | Ga0501043_0238284_811_1083 | 90 |
| 808 | 3300049582 | Ga0501048_0762931 | Ga0501048_0762931_50_322 | 90 |
| 809 | 3300049584 | Ga0501068_0258697 | Ga0501068_0258697_16_288 | 90 |
| 810 | 3300049584 | Ga0501068_1186248 | Ga0501068_1186248_179_451 | 90 |
| 811 | 3300049585 | Ga0501069_0086665 | Ga0501069_0086665_946_1218 | 90 |
| 812 | 3300049585 | Ga0501069_0106646 | Ga0501069_0106646_1246_1518 | 90 |
| 813 | 3300049587 | Ga0501071_0264776 | Ga0501071_0264776_586_864 | 90 |
| 814 | 3300049587 | Ga0501071_0574110 | Ga0501071_0574110_547_822 | 90 |
| 815 | 3300049587 | Ga0501071_0667808 | Ga0501071_0667808_505_777 | 90 |
| 816 | 3300049587 | Ga0501071_1191915 | Ga0501071_1191915_181_453 | 90 |
| 817 | 3300049587 | Ga0501071_1448855 | Ga0501071_1448855_94_366 | 90 |
| 818 | 3300049588 | Ga0501072_0060734 | Ga0501072_0060734_1631_1903 | 90 |
| 819 | 3300049588 | Ga0501072_0328206 | Ga0501072_0328206_467_742 | 90 |
| 820 | 3300049588 | Ga0501072_1019118 | Ga0501072_1019118_336_608 | 90 |
| 821 | 3300049589 | Ga0501073_1257108 | Ga0501073_1257108_197_469 | 90 |
| 822 | 3300049590 | Ga0501074_0983563 | Ga0501074_0983563_297_575 | 90 |
| 823 | 3300049591 | Ga0501075_0161351 | Ga0501075_0161351_1335_1607 | 90 |
| 824 | 3300049592 | Ga0501076_0980119 | Ga0501076_0980119_326_598 | 90 |
| 825 | 3300049660 | Ga0501216_057812 | Ga0501216_057812_457_729 | 90 |
| 826 | 3300049661 | Ga0501217_212610 | Ga0501217_212610_306_578 | 90 |
| 827 | 3300049668 | Ga0501233_018696 | Ga0501233_018696_230_502 | 90 |
| 828 | 3300049686 | Ga0501257_132602 | Ga0501257_132602_306_578 | 90 |
| 829 | 3300049742 | Ga0501080_0465462 | Ga0501080_0465462_270_542 | 90 |
| 830 | 3300049743 | Ga0501081_1124917 | Ga0501081_1124917_10_282 | 90 |
| 831 | 3300049779 | Ga0501283_012493 | Ga0501283_012493_458_730 | 90 |
| 832 | 3300049822 | Ga0501035_0344705 | Ga0501035_0344705_911_1183 | 90 |
| 833 | 3300049824 | Ga0501045_0245273 | Ga0501045_0245273_635_907 | 90 |
| 834 | 3300049824 | Ga0501045_0611365 | Ga0501045_0611365_216_494 | 90 |
| 835 | 3300049824 | Ga0501045_1167805 | Ga0501045_1167805_106_378 | 90 |
| 836 | 3300050507 | nmdc:mga05p37_1264825_c1 | nmdc:mga05p37_1264825_c1_146_418 | 90 |
| 837 | 3300050507 | nmdc:mga05p37_1668226_c1 | nmdc:mga05p37_1668226_c1_29_301 | 90 |
| 838 | 3300050507 | nmdc:mga05p37_1796511_c1 | nmdc:mga05p37_1796511_c1_83_355 | 90 |
| 839 | 3300050507 | nmdc:mga05p37_1807699_c1 | nmdc:mga05p37_1807699_c1_274_546 | 90 |
| 840 | 3300050508 | nmdc:mga09592_1741425_c1 | nmdc:mga09592_1741425_c1_139_411 | 90 |
| 841 | 3300050508 | nmdc:mga09592_81062_c1 | nmdc:mga09592_81062_c1_2285_2557 | 90 |
| 842 | 3300050509 | nmdc:mga0qj67_207274_c1 | nmdc:mga0qj67_207274_c1_883_1155 | 90 |
| 843 | 3300050509 | nmdc:mga0qj67_271612_c1 | nmdc:mga0qj67_271612_c1_185_457 | 90 |
| 844 | 3300050509 | nmdc:mga0qj67_52148_c1 | nmdc:mga0qj67_52148_c1_2603_2875 | 90 |
| 845 | 3300050509 | nmdc:mga0qj67_623_c1 | nmdc:mga0qj67_623_c1_11719_11991 | 90 |
| 846 | 3300050510 | nmdc:mga06r32_133999_c1 | nmdc:mga06r32_133999_c1_887_1159 | 90 |
| 847 | 3300050510 | nmdc:mga06r32_1401902_c1 | nmdc:mga06r32_1401902_c1_207_479 | 90 |
| 848 | 3300050510 | nmdc:mga06r32_513920_c1 | nmdc:mga06r32_513920_c1_564_836 | 90 |
| 849 | 3300050510 | nmdc:mga06r32_58630_c1 | nmdc:mga06r32_58630_c1_3389_3661 | 90 |
| 850 | 3300050511 | nmdc:mga08y16_124404_c1 | nmdc:mga08y16_124404_c1_1153_1425 | 90 |
| 851 | 3300050511 | nmdc:mga08y16_26333_c1 | nmdc:mga08y16_26333_c1_3984_4256 | 90 |
| 852 | 3300050511 | nmdc:mga08y16_36047_c1 | nmdc:mga08y16_36047_c1_716_988 | 90 |
| 853 | 3300050511 | nmdc:mga08y16_419359_c1 | nmdc:mga08y16_419359_c1_717_989 | 90 |
| 854 | 3300050512 | nmdc:mga0n895_1176724_c1 | nmdc:mga0n895_1176724_c1_162_434 | 90 |
| 855 | 3300050512 | nmdc:mga0n895_6387_c1 | nmdc:mga0n895_6387_c1_8000_8272 | 90 |
| 856 | 3300050513 | nmdc:mga0rr50_1001979_c1 | nmdc:mga0rr50_1001979_c1_19_291 | 90 |
| 857 | 3300050513 | nmdc:mga0rr50_1230403_c1 | nmdc:mga0rr50_1230403_c1_112_384 | 90 |
| 858 | 3300050513 | nmdc:mga0rr50_1308241_c1 | nmdc:mga0rr50_1308241_c1_136_408 | 90 |
| 859 | 3300050513 | nmdc:mga0rr50_170783_c1 | nmdc:mga0rr50_170783_c1_1153_1425 | 90 |
| 860 | 3300050514 | nmdc:mga08x19_142786_c1 | nmdc:mga08x19_142786_c1_958_1230 | 90 |
| 861 | 3300050514 | nmdc:mga08x19_22439_c1 | nmdc:mga08x19_22439_c1_2299_2571 | 90 |
| 862 | 3300050514 | nmdc:mga08x19_23150_c1 | nmdc:mga08x19_23150_c1_1960_2232 | 90 |
| 863 | 3300050514 | nmdc:mga08x19_263437_c1 | nmdc:mga08x19_263437_c1_748_1020 | 90 |
| 864 | 3300050514 | nmdc:mga08x19_513020_c1 | nmdc:mga08x19_513020_c1_236_508 | 90 |
| 865 | 3300050514 | nmdc:mga08x19_55_c1 | nmdc:mga08x19_55_c1_83796_84068 | 90 |
| 866 | 3300050515 | nmdc:mga0a205_283089_c1 | nmdc:mga0a205_283089_c1_942_1214 | 90 |
| 867 | 3300050515 | nmdc:mga0a205_38464_c1 | nmdc:mga0a205_38464_c1_527_799 | 90 |
| 868 | 3300054114 | Ga0501084_0616219 | Ga0501084_0616219_377_649 | 90 |
| 869 | 3300054114 | Ga0501084_1292809 | Ga0501084_1292809_171_449 | 90 |
| 870 | 3300060353 | Ga0501082_1618964 | Ga0501082_1618964_36_308 | 90 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6wo1-assembly1.cif.gz_B | hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit | 0.8812 | 14 | 90 |
| 6lxg-assembly1.cif.gz_B | nmr solution structure of regulatory act domain of the mycobacterium tuberculosis rel protein | 0.8741 | 14 | 90 |
| 5iqr-assembly1.cif.gz_8 | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8718 | 15 | 90 |
| 2pc6-assembly1.cif.gz_A | crystal structure of putative acetolactate synthase- small subunit from nitrosomonas europaea | 0.869 | 14 | 90 |
| 6u9h-assembly1.cif.gz_G | arabidopsis thaliana acetohydroxyacid synthase complex | 0.8664 | 15 | 90 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AG20_664_743_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9014 | 14 | 90 | 3.30.70.260 |
| af_C6TJY5_99_186_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.8993 | 12 | 90 | 3.30.70.260 |
| af_Q2FXU1_650_729_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.8985 | 14 | 90 | 3.30.70.260 |
| af_Q2FWK5_1_78_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.8947 | 14 | 90 | 3.30.70.260 |
| af_P0AG24_623_702_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.8929 | 14 | 90 | 3.30.70.260 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521Z5A2-F1-model_v4 | DUF493 domain-containing protein | 1.001 | 22 | 90 |
GO:0005829
|
| AF-A0A3N5WDV4-F1-model_v4 | UPF0250 protein EHM16_10515 | 0.9919 | 10 | 90 |
GO:0005829
|
| AF-I3CC02-F1-model_v4 | UPF0250 protein BegalDRAFT_0223 | 0.9908 | 12 | 90 |
GO:0005829
|
| AF-A0A7Y3JXD7-F1-model_v4 | UPF0250 protein HKM01_02850 | 0.9903 | 12 | 90 |
GO:0005829
|
| AF-A0A351MCM8-F1-model_v4 | DUF493 domain-containing protein | 0.9896 | 12 | 90 |
GO:0005829
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar