F484153

General Info

Members Datasets Scaffolds Average Seq Length
870 358 870 88

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0801827|Ga0316574_0801827_192_515
Length 97
Sequence MGGEKSEKGAPARVLGFQFPCRYEIKAMGRHSMRFEALVHAIVSRHIGREDLLASKQRFSRNRRYLSVTCIIRASSRQQLDEIYADLRGCPEVLAAL

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003397 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM Metagenome Rhizosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
189 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
190 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
193 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
198 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
199 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
200 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
205 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
215 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
216 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
217 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
218 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
227 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
228 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
229 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
230 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
231 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
232 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
233 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
234 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
235 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
236 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
239 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
242 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
264 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
265 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
268 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
269 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
274 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
277 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
278 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
279 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
280 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
289 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
290 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
294 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
308 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
309 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
310 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
311 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
312 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
326 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
332 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
333 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
334 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
335 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
336 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
337 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
340 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
351 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
352 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
353 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
354 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
355 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
356 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
357 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 0.57
Rhizosphere 98.16
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10035649 3300003203 Bacteria 1814
2 rootL2_10010637 3300003322 Bacteria 7774
3 rootH1_10178713 3300003323 Bacteria 1563
4 JGI26133J50247_101018 3300003397 Bacteria 838
5 Ga0055529_1000015 3300003763 Bacteria 366950
6 Ga0058860_11658417 3300004801 Bacteria 1390
7 Ga0058862_10871056 3300004803 Bacteria 635
8 Ga0065712_10380110 3300005290 Unclassified 753
9 Ga0065707_10028465 3300005295 Bacteria 1790
10 Ga0070676_10759131 3300005328 Bacteria 713
11 Ga0070683_100228472 3300005329 Bacteria 1769
12 Ga0070683_101622413 3300005329 Bacteria 622
13 Ga0070690_100000197 3300005330 Bacteria 31360
14 Ga0070690_100664488 3300005330 Bacteria 797
15 Ga0070690_101016336 3300005330 Bacteria 654
16 Ga0070690_101091112 3300005330 Bacteria 633
17 Ga0070670_100290586 3300005331 Unclassified 1428
18 Ga0070670_100899990 3300005331 Bacteria 802
19 Ga0070670_101506574 3300005331 Unclassified 618
20 Ga0068869_100000214 3300005334 Bacteria 30165
21 Ga0068869_100063874 3300005334 Bacteria 2707
22 Ga0068869_100229020 3300005334 Bacteria 1476
23 Ga0070666_10263580 3300005335 Bacteria 1222
24 Ga0070680_100005842 3300005336 Bacteria 9338
25 Ga0070680_100061318 3300005336 Bacteria 3078
26 Ga0070680_100189194 3300005336 Bacteria 1734
27 Ga0070682_100003738 3300005337 Bacteria 8463
28 Ga0068868_100000375 3300005338 Bacteria 30466
29 Ga0068868_101098168 3300005338 Bacteria 732
30 Ga0068868_101890732 3300005338 Bacteria 565
31 Ga0070689_100000107 3300005340 Bacteria 48084
32 Ga0070689_100065511 3300005340 Bacteria 2829
33 Ga0070689_100214699 3300005340 Bacteria 1576
34 Ga0070689_100357767 3300005340 Bacteria 1226
35 Ga0070689_100727136 3300005340 Bacteria 868
36 Ga0070689_100840768 3300005340 Bacteria 809
37 Ga0070689_101641949 3300005340 Unclassified 584
38 Ga0070691_10000220 3300005341 Bacteria 19309
39 Ga0070691_10219666 3300005341 Bacteria 1006
40 Ga0070691_10860537 3300005341 Bacteria 556
41 Ga0070687_100000669 3300005343 Bacteria 11428
42 Ga0070687_100128970 3300005343 Bacteria 1457
43 Ga0070687_100159616 3300005343 Bacteria 1332
44 Ga0070687_100253395 3300005343 Bacteria 1095
45 Ga0070687_100673294 3300005343 Bacteria 720
46 Ga0070692_10005331 3300005345 Bacteria 5469
47 Ga0070692_10779827 3300005345 Bacteria 651
48 Ga0070669_101040733 3300005353 Bacteria 703
49 Ga0070675_100345976 3300005354 Bacteria 1318
50 Ga0070675_100705968 3300005354 Bacteria 919
51 Ga0070675_101221138 3300005354 Bacteria 692
52 Ga0070674_100664544 3300005356 Bacteria 887
53 Ga0070673_100266246 3300005364 Bacteria 1499
54 Ga0070673_100467413 3300005364 Bacteria 1137
55 Ga0070673_100765611 3300005364 Bacteria 890
56 Ga0070673_100892420 3300005364 Bacteria 824
57 Ga0070688_100033844 3300005365 Bacteria 3091
58 Ga0070688_101569673 3300005365 Bacteria 537
59 Ga0070659_100519794 3300005366 Bacteria 1016
60 Ga0070703_10004630 3300005406 Bacteria 3852
61 Ga0070703_10142223 3300005406 Bacteria 893
62 Ga0070709_10519574 3300005434 Bacteria 907
63 Ga0070714_100011982 3300005435 Bacteria 6898
64 Ga0070713_100399710 3300005436 Bacteria 1283
65 Ga0070713_102422813 3300005436 Bacteria 507
66 Ga0070710_10437408 3300005437 Bacteria 884
67 Ga0070701_10000396 3300005438 Bacteria 14677
68 Ga0070701_10130788 3300005438 Bacteria 1426
69 Ga0070711_101262697 3300005439 Unclassified 640
70 Ga0070705_100027892 3300005440 Bacteria 3087
71 Ga0070705_100075566 3300005440 Bacteria 2051
72 Ga0070705_100721539 3300005440 Bacteria 785
73 Ga0070705_101319470 3300005440 Bacteria 599
74 Ga0070700_100000633 3300005441 Bacteria 17458
75 Ga0070700_100103026 3300005441 Bacteria 1884
76 Ga0070700_100111705 3300005441 Bacteria 1818
77 Ga0070700_100216498 3300005441 Bacteria 1354
78 Ga0070700_100263736 3300005441 Bacteria 1241
79 Ga0070700_100360890 3300005441 Unclassified 1080
80 Ga0070700_100721722 3300005441 Bacteria 795
81 Ga0070694_100000126 3300005444 Bacteria 37932
82 Ga0070694_100017277 3300005444 Bacteria 4556
83 Ga0070694_100057979 3300005444 Bacteria 2633
84 Ga0070694_100077882 3300005444 Bacteria 2298
85 Ga0070694_100266507 3300005444 Bacteria 1301
86 Ga0070694_100391685 3300005444 Bacteria 1086
87 Ga0070694_100563404 3300005444 Bacteria 914
88 Ga0070694_101758613 3300005444 Bacteria 528
89 Ga0070708_100319275 3300005445 Bacteria 1463
90 Ga0070708_101109277 3300005445 Bacteria 741
91 Ga0070708_101631857 3300005445 Bacteria 600
92 Ga0070678_100030611 3300005456 Bacteria 3702
93 Ga0070681_10000399 3300005458 Bacteria 35221
94 Ga0070681_10338742 3300005458 Bacteria 1414
95 Ga0070681_10414874 3300005458 Bacteria 1258
96 Ga0070681_10912559 3300005458 Bacteria 797
97 Ga0068867_100000032 3300005459 Bacteria 84727
98 Ga0068867_100846461 3300005459 Bacteria 819
99 Ga0070707_100726748 3300005468 Bacteria 956
100 Ga0070707_100753833 3300005468 Bacteria 937
101 Ga0070707_100798163 3300005468 Bacteria 908
102 Ga0070707_101083333 3300005468 Bacteria 767
103 Ga0070698_100162623 3300005471 Bacteria 2176
104 Ga0070698_101948042 3300005471 Bacteria 541
105 Ga0070699_100015187 3300005518 Bacteria 6617
106 Ga0070699_100102761 3300005518 Bacteria 2506
107 Ga0070699_100998981 3300005518 Bacteria 767
108 Ga0070679_100108511 3300005530 Bacteria 2762
109 Ga0070679_101063904 3300005530 Bacteria 753
110 Ga0070684_100874045 3300005535 Unclassified 842
111 Ga0070684_101303839 3300005535 Unclassified 683
112 Ga0070697_100000648 3300005536 Bacteria 26304
113 Ga0070697_100249725 3300005536 Bacteria 1517
114 Ga0070697_100663479 3300005536 Bacteria 919
115 Ga0070697_101303123 3300005536 Bacteria 648
116 Ga0068853_100191540 3300005539 Bacteria 1858
117 Ga0070672_100786395 3300005543 Bacteria 837
118 Ga0070686_100000253 3300005544 Bacteria 36736
119 Ga0070686_100227621 3300005544 Bacteria 1351
120 Ga0070686_100533516 3300005544 Bacteria 915
121 Ga0070686_100625088 3300005544 Bacteria 851
122 Ga0070686_100886077 3300005544 Bacteria 725
123 Ga0070686_100969123 3300005544 Bacteria 696
124 Ga0070695_100000197 3300005545 Bacteria 29394
125 Ga0070695_100000362 3300005545 Bacteria 23307
126 Ga0070695_100045316 3300005545 Bacteria 2803
127 Ga0070695_100164586 3300005545 Bacteria 1560
128 Ga0070695_100246385 3300005545 Bacteria 1299
129 Ga0070695_100293197 3300005545 Bacteria 1200
130 Ga0070695_100831223 3300005545 Bacteria 742
131 Ga0070695_101127588 3300005545 Unclassified 643
132 Ga0070695_101443105 3300005545 Unclassified 571
133 Ga0070695_101616568 3300005545 Bacteria 541
134 Ga0070696_100000089 3300005546 Bacteria 44686
135 Ga0070696_100000482 3300005546 Bacteria 25020
136 Ga0070696_100002485 3300005546 Bacteria 12219
137 Ga0070696_100166322 3300005546 Bacteria 1628
138 Ga0070696_100471717 3300005546 Bacteria 994
139 Ga0070696_100603027 3300005546 Bacteria 885
140 Ga0070696_100717106 3300005546 Bacteria 816
141 Ga0070693_100000400 3300005547 Bacteria 19703
142 Ga0070693_100168146 3300005547 Bacteria 1402
143 Ga0070704_100000017 3300005549 Bacteria 57626
144 Ga0070704_100009024 3300005549 Bacteria 6011
145 Ga0070704_100025353 3300005549 Bacteria 3903
146 Ga0070704_100421993 3300005549 Bacteria 1142
147 Ga0070704_100623839 3300005549 Bacteria 949
148 Ga0070704_100791533 3300005549 Bacteria 847
149 Ga0068855_100002377 3300005563 Bacteria 23195
150 Ga0068855_101574544 3300005563 Bacteria 673
151 Ga0068857_100997366 3300005577 Bacteria 806
152 Ga0068857_102182359 3300005577 Bacteria 544
153 Ga0068854_100022368 3300005578 Bacteria 4306
154 Ga0068854_102014307 3300005578 Bacteria 532
155 Ga0068856_100142277 3300005614 Bacteria 2406
156 Ga0070702_100000001 3300005615 Bacteria 87224
157 Ga0070702_100018216 3300005615 Bacteria 3639
158 Ga0070702_100239864 3300005615 Bacteria 1223
159 Ga0068859_100000149 3300005617 Bacteria 66296
160 Ga0068859_100249647 3300005617 Bacteria 1865
161 Ga0068859_101059047 3300005617 Bacteria 892
162 Ga0068859_101070061 3300005617 Bacteria 887
163 Ga0068864_100009007 3300005618 Bacteria 8230
164 Ga0068864_100082993 3300005618 Bacteria 2813
165 Ga0068864_102069581 3300005618 Bacteria 575
166 Ga0068866_10000326 3300005718 Bacteria 22539
167 Ga0068861_100000428 3300005719 Bacteria 24436
168 Ga0068861_100128148 3300005719 Bacteria 2056
169 Ga0068861_100326403 3300005719 Bacteria 1338
170 Ga0068870_10492096 3300005840 Bacteria 816
171 Ga0068863_100262007 3300005841 Bacteria 1672
172 Ga0068863_100283339 3300005841 Bacteria 1606
173 Ga0068863_100299836 3300005841 Bacteria 1559
174 Ga0068863_102046408 3300005841 Bacteria 583
175 Ga0068858_100002902 3300005842 Bacteria 17243
176 Ga0068858_100615355 3300005842 Bacteria 1054
177 Ga0068858_101160466 3300005842 Bacteria 759
178 Ga0068860_100001090 3300005843 Bacteria 29921
179 Ga0068860_100894234 3300005843 Bacteria 904
180 Ga0068862_100000409 3300005844 Bacteria 46422
181 Ga0081538_10152692 3300005981 Bacteria 1042
182 Ga0081539_10000686 3300005985 Bacteria 67858
183 Ga0070715_10229490 3300006163 Bacteria 959
184 Ga0070716_100101869 3300006173 Bacteria 1762
185 Ga0070716_100445383 3300006173 Bacteria 943
186 Ga0075367_10815908 3300006178 Bacteria 594
187 Ga0097621_100000928 3300006237 Bacteria 20529
188 Ga0068871_100011561 3300006358 Bacteria 6476
189 Ga0068871_101248038 3300006358 Bacteria 698
190 Ga0068871_101409027 3300006358 Bacteria 657
191 Ga0068871_101459461 3300006358 Bacteria 646
192 Ga0075428_100000083 3300006844 Bacteria 78689
193 Ga0075428_100040406 3300006844 Bacteria 5132
194 Ga0075428_100214190 3300006844 Bacteria 2081
195 Ga0075428_100456878 3300006844 Bacteria 1368
196 Ga0075430_100000550 3300006846 Bacteria 28484
197 Ga0075430_100007696 3300006846 Bacteria 9098
198 Ga0075430_100189368 3300006846 Bacteria 1710
199 Ga0075430_100341025 3300006846 Unclassified 1238
200 Ga0075430_100438589 3300006846 Bacteria 1078
201 Ga0075430_100483458 3300006846 Bacteria 1022
202 Ga0075430_100537999 3300006846 Bacteria 963
203 Ga0075430_100776711 3300006846 Bacteria 789
204 Ga0075430_100852917 3300006846 Bacteria 751
205 Ga0075431_100016437 3300006847 Bacteria 7510
206 Ga0075431_100123948 3300006847 Bacteria 2666
207 Ga0075431_100353925 3300006847 Bacteria 1476
208 Ga0075431_100397211 3300006847 Bacteria 1380
209 Ga0075431_100443596 3300006847 Bacteria 1294
210 Ga0075431_100522127 3300006847 Bacteria 1177
211 Ga0075431_100656026 3300006847 Bacteria 1029
212 Ga0075433_10033239 3300006852 Bacteria 4420
213 Ga0075433_10164444 3300006852 Bacteria 1975
214 Ga0075433_11086754 3300006852 Bacteria 696
215 Ga0075434_100000011 3300006871 Bacteria 86261
216 Ga0075434_100005363 3300006871 Bacteria 11665
217 Ga0075434_100007734 3300006871 Bacteria 9953
218 Ga0075434_100266698 3300006871 Bacteria 1731
219 Ga0075434_101385976 3300006871 Bacteria 713
220 Ga0075429_100000480 3300006880 Bacteria 29845
221 Ga0075429_100069548 3300006880 Bacteria 3065
222 Ga0075429_100072951 3300006880 Bacteria 2989
223 Ga0075429_100226541 3300006880 Unclassified 1637
224 Ga0075429_100254048 3300006880 Bacteria 1539
225 Ga0075429_101078498 3300006880 Bacteria 702
226 Ga0075429_101344870 3300006880 Bacteria 623
227 Ga0068865_100000059 3300006881 Bacteria 58856
228 Ga0075436_100003220 3300006914 Bacteria 11194
229 Ga0075436_100004494 3300006914 Bacteria 9572
230 Ga0075436_100014323 3300006914 Bacteria 5429
231 Ga0075436_100042934 3300006914 Bacteria 3117
232 Ga0075436_100164546 3300006914 Bacteria 1565
233 Ga0075436_100166596 3300006914 Bacteria 1555
234 Ga0075436_100504715 3300006914 Bacteria 885
235 Ga0075436_100606801 3300006914 Bacteria 806
236 Ga0097620_100000149 3300006931 Bacteria 66296
237 Ga0097620_100249643 3300006931 Bacteria 1865
238 Ga0097620_101059077 3300006931 Bacteria 892
239 Ga0097620_101070087 3300006931 Bacteria 887
240 Ga0075435_100000388 3300007076 Bacteria 26867
241 Ga0075435_100029181 3300007076 Bacteria 4328
242 Ga0075435_100060020 3300007076 Bacteria 3083
243 Ga0075435_100129605 3300007076 Bacteria 2110
244 Ga0075435_100663288 3300007076 Bacteria 906
245 Ga0075435_100723078 3300007076 Bacteria 866
246 Ga0075435_100772429 3300007076 Bacteria 836
247 Ga0099794_10015782 3300007265 Bacteria 3340
248 Ga0099794_10022481 3300007265 Bacteria 2875
249 Ga0099794_10415968 3300007265 Bacteria 703
250 Ga0099794_10421351 3300007265 Bacteria 698
251 Ga0105251_10643320 3300009011 Bacteria 506
252 Ga0105244_10492227 3300009036 Bacteria 564
253 Ga0105240_10540267 3300009093 Bacteria 1291
254 Ga0111539_10016381 3300009094 Bacteria 9192
255 Ga0111539_10026004 3300009094 Bacteria 7163
256 Ga0111539_10038453 3300009094 Bacteria 5771
257 Ga0111539_10039269 3300009094 Bacteria 5706
258 Ga0111539_10070916 3300009094 Bacteria 4112
259 Ga0111539_10150838 3300009094 Bacteria 2721
260 Ga0111539_10693456 3300009094 Bacteria 1185
261 Ga0111539_10958092 3300009094 Unclassified 995
262 Ga0111539_11783976 3300009094 Bacteria 713
263 Ga0111539_13494213 3300009094 Bacteria 504
264 Ga0105245_10000075 3300009098 Bacteria 103550
265 Ga0105245_11176772 3300009098 Bacteria 814
266 Ga0114129_10000210 3300009147 Bacteria 65476
267 Ga0114129_10634184 3300009147 Unclassified 1381
268 Ga0114129_10961706 3300009147 Bacteria 1078
269 Ga0114129_11130110 3300009147 Bacteria 979
270 Ga0114129_11193197 3300009147 Bacteria 948
271 Ga0114129_11433701 3300009147 Bacteria 851
272 Ga0114129_11444908 3300009147 Unclassified 847
273 Ga0114129_11946484 3300009147 Bacteria 712
274 Ga0114129_12507585 3300009147 Bacteria 616
275 Ga0114129_12724503 3300009147 Bacteria 589
276 Ga0105243_10000622 3300009148 Bacteria 35310
277 Ga0105243_10010536 3300009148 Bacteria 7020
278 Ga0105243_12273446 3300009148 Bacteria 579
279 Ga0105241_10084412 3300009174 Bacteria 2493
280 Ga0105242_10000407 3300009176 Bacteria 34281
281 Ga0105242_10372148 3300009176 Bacteria 1325
282 Ga0105242_12061126 3300009176 Bacteria 614
283 Ga0105248_10217743 3300009177 Bacteria 2150
284 Ga0105248_10414506 3300009177 Bacteria 1517
285 Ga0105248_10838385 3300009177 Bacteria 1038
286 Ga0105249_10002440 3300009553 Bacteria 16141
287 Ga0105249_10004477 3300009553 Bacteria 12079
288 Ga0105249_12614768 3300009553 Unclassified 577
289 Ga0105239_10111905 3300010375 Bacteria 3027
290 Ga0105246_12265558 3300011119 Bacteria 530
291 Ga0157335_1035026 3300012492 Bacteria 543
292 Ga0157378_10000074 3300013297 Bacteria 90608
293 Ga0157378_12532270 3300013297 Bacteria 565
294 Ga0163162_10757695 3300013306 Bacteria 1090
295 Ga0163162_13341312 3300013306 Unclassified 513
296 Ga0157372_10357574 3300013307 Bacteria 1701
297 Ga0157375_11045777 3300013308 Bacteria 954
298 Ga0157375_11079065 3300013308 Bacteria 939
299 Ga0157380_10001505 3300014326 Bacteria 15283
300 Ga0157380_10103645 3300014326 Bacteria 2374
301 Ga0157380_10907627 3300014326 Bacteria 907
302 Ga0157377_10065103 3300014745 Bacteria 2093
303 Ga0157377_11447566 3300014745 Bacteria 544
304 Ga0157379_10879275 3300014968 Bacteria 849
305 Ga0157376_10021663 3300014969 Bacteria 4994
306 Ga0163161_10691716 3300017792 Bacteria 848
307 Ga0209437_119409 3300025233 Bacteria 855
308 Ga0209455_1000031 3300025272 Bacteria 519952
309 Ga0207653_10004464 3300025885 Bacteria 4387
310 Ga0207692_10248029 3300025898 Bacteria 1066
311 Ga0207642_10004209 3300025899 Bacteria 4629
312 Ga0207688_10030324 3300025901 Bacteria 2981
313 Ga0207688_10059207 3300025901 Bacteria 2157
314 Ga0207688_10740502 3300025901 Bacteria 622
315 Ga0207680_10244047 3300025903 Bacteria 1239
316 Ga0207647_10657704 3300025904 Unclassified 574
317 Ga0207685_10496850 3300025905 Bacteria 641
318 Ga0207645_10263795 3300025907 Bacteria 1141
319 Ga0207645_10270574 3300025907 Bacteria 1126
320 Ga0207643_10428606 3300025908 Bacteria 839
321 Ga0207654_10022847 3300025911 Bacteria 3342
322 Ga0207707_10003163 3300025912 Bacteria 14617
323 Ga0207707_10210452 3300025912 Bacteria 1694
324 Ga0207707_10440915 3300025912 Bacteria 1115
325 Ga0207707_10651865 3300025912 Bacteria 887
326 Ga0207695_11243277 3300025913 Bacteria 625
327 Ga0207663_10251923 3300025916 Bacteria 1300
328 Ga0207663_10448430 3300025916 Bacteria 995
329 Ga0207663_10511958 3300025916 Bacteria 934
330 Ga0207660_10078664 3300025917 Bacteria 2417
331 Ga0207660_10626293 3300025917 Bacteria 877
332 Ga0207660_10720685 3300025917 Unclassified 814
333 Ga0207660_10863670 3300025917 Bacteria 738
334 Ga0207662_10000315 3300025918 Bacteria 22055
335 Ga0207662_10129249 3300025918 Bacteria 1591
336 Ga0207662_10171434 3300025918 Bacteria 1392
337 Ga0207662_10173077 3300025918 Bacteria 1385
338 Ga0207662_10283799 3300025918 Bacteria 1096
339 Ga0207662_10543112 3300025918 Bacteria 804
340 Ga0207649_11439209 3300025920 Unclassified 545
341 Ga0207646_10404443 3300025922 Bacteria 1233
342 Ga0207646_10663526 3300025922 Bacteria 934
343 Ga0207681_10248018 3300025923 Bacteria 1389
344 Ga0207650_11534089 3300025925 Unclassified 566
345 Ga0207659_10068577 3300025926 Bacteria 2580
346 Ga0207659_11884448 3300025926 Bacteria 507
347 Ga0207687_10001426 3300025927 Bacteria 16345
348 Ga0207687_11552174 3300025927 Bacteria 568
349 Ga0207700_10760973 3300025928 Bacteria 866
350 Ga0207700_11624483 3300025928 Bacteria 571
351 Ga0207664_10398785 3300025929 Bacteria 1223
352 Ga0207644_10029941 3300025931 Bacteria 3780
353 Ga0207686_10000243 3300025934 Bacteria 41698
354 Ga0207686_10753542 3300025934 Bacteria 777
355 Ga0207709_10001387 3300025935 Bacteria 16961
356 Ga0207670_10001067 3300025936 Bacteria 14456
357 Ga0207670_10108375 3300025936 Bacteria 1996
358 Ga0207670_10127750 3300025936 Bacteria 1857
359 Ga0207670_10334710 3300025936 Bacteria 1195
360 Ga0207670_10352382 3300025936 Bacteria 1166
361 Ga0207670_11394570 3300025936 Unclassified 595
362 Ga0207669_10659205 3300025937 Bacteria 857
363 Ga0207704_10018253 3300025938 Bacteria 3658
364 Ga0207704_11779416 3300025938 Bacteria 530
365 Ga0207665_10132548 3300025939 Bacteria 1771
366 Ga0207665_10144714 3300025939 Bacteria 1698
367 Ga0207665_10317248 3300025939 Bacteria 1169
368 Ga0207711_10618201 3300025941 Bacteria 1011
369 Ga0207711_11811618 3300025941 Bacteria 553
370 Ga0207689_10000007 3300025942 Bacteria 132362
371 Ga0207689_10097695 3300025942 Bacteria 2412
372 Ga0207689_10259174 3300025942 Bacteria 1438
373 Ga0207689_10562218 3300025942 Bacteria 958
374 Ga0207661_10116956 3300025944 Bacteria 2264
375 Ga0207661_11151068 3300025944 Bacteria 714
376 Ga0207667_10077643 3300025949 Bacteria 3443
377 Ga0207667_11302905 3300025949 Bacteria 703
378 Ga0207651_10195881 3300025960 Bacteria 1615
379 Ga0207651_10251540 3300025960 Bacteria 1446
380 Ga0207651_11099234 3300025960 Unclassified 712
381 Ga0207712_10002821 3300025961 Bacteria 11132
382 Ga0207668_11245685 3300025972 Bacteria 669
383 Ga0207640_10015170 3300025981 Bacteria 4454
384 Ga0207677_10000823 3300026023 Bacteria 17732
385 Ga0207677_10335847 3300026023 Bacteria 1261
386 Ga0207677_10919033 3300026023 Bacteria 790
387 Ga0207703_10102600 3300026035 Bacteria 2427
388 Ga0207703_10345945 3300026035 Bacteria 1368
389 Ga0207639_10520357 3300026041 Bacteria 1089
390 Ga0207708_10000086 3300026075 Bacteria 73314
391 Ga0207708_10113450 3300026075 Bacteria 2106
392 Ga0207708_10202555 3300026075 Bacteria 1584
393 Ga0207708_10251397 3300026075 Bacteria 1424
394 Ga0207708_10354104 3300026075 Bacteria 1205
395 Ga0207708_10561004 3300026075 Bacteria 964
396 Ga0207708_11288530 3300026075 Bacteria 640
397 Ga0207708_11522484 3300026075 Unclassified 588
398 Ga0207708_11779641 3300026075 Bacteria 541
399 Ga0207702_10145265 3300026078 Bacteria 2152
400 Ga0207641_10161054 3300026088 Bacteria 2040
401 Ga0207641_10225916 3300026088 Bacteria 1738
402 Ga0207641_10312390 3300026088 Bacteria 1488
403 Ga0207641_10423615 3300026088 Bacteria 1282
404 Ga0207648_10000079 3300026089 Bacteria 92044
405 Ga0207648_10377073 3300026089 Bacteria 1282
406 Ga0207648_11126314 3300026089 Bacteria 736
407 Ga0207648_12189534 3300026089 Bacteria 514
408 Ga0207676_10037278 3300026095 Bacteria 3704
409 Ga0207676_10321696 3300026095 Bacteria 1420
410 Ga0207674_10159116 3300026116 Bacteria 2213
411 Ga0207675_100000093 3300026118 Bacteria 70343
412 Ga0207675_100144068 3300026118 Bacteria 2265
413 Ga0207675_100654318 3300026118 Bacteria 1057
414 Ga0207675_100829724 3300026118 Bacteria 939
415 Ga0207683_10327647 3300026121 Bacteria 1403
416 Ga0209969_1000430 3300027360 Bacteria 5605
417 Ga0209969_1001086 3300027360 Bacteria 3731
418 Ga0209969_1003617 3300027360 Bacteria 2142
419 Ga0209969_1016600 3300027360 Bacteria 1081
420 Ga0209967_1000417 3300027364 Bacteria 5603
421 Ga0209967_1001327 3300027364 Bacteria 3170
422 Ga0209967_1003025 3300027364 Bacteria 2207
423 Ga0209981_1001444 3300027378 Bacteria 3001
424 Ga0209981_1001566 3300027378 Bacteria 2895
425 Ga0209981_1010103 3300027378 Bacteria 1293
426 Ga0209981_1021781 3300027378 Bacteria 918
427 Ga0209996_1026728 3300027395 Bacteria 828
428 Ga0209996_1060653 3300027395 Bacteria 581
429 Ga0210000_1000446 3300027462 Bacteria 5675
430 Ga0210000_1001892 3300027462 Bacteria 2958
431 Ga0210000_1002212 3300027462 Bacteria 2757
432 Ga0210000_1042787 3300027462 Unclassified 720
433 Ga0209995_1000255 3300027471 Bacteria 8527
434 Ga0209995_1001597 3300027471 Bacteria 3511
435 Ga0209995_1007282 3300027471 Bacteria 1784
436 Ga0209995_1028014 3300027471 Bacteria 940
437 Ga0209968_1002375 3300027526 Bacteria 2843
438 Ga0209968_1003221 3300027526 Bacteria 2445
439 Ga0209968_1018430 3300027526 Bacteria 1118
440 Ga0209968_1065309 3300027526 Unclassified 644
441 Ga0209999_1000334 3300027543 Bacteria 7086
442 Ga0209999_1007955 3300027543 Bacteria 1906
443 Ga0209999_1032187 3300027543 Bacteria 974
444 Ga0209999_1042378 3300027543 Bacteria 854
445 Ga0209983_1052129 3300027665 Bacteria 896
446 Ga0209588_1045166 3300027671 Bacteria 1425
447 Ga0209588_1259659 3300027671 Bacteria 529
448 Ga0209971_1007609 3300027682 Bacteria 2572
449 Ga0209971_1010313 3300027682 Bacteria 2212
450 Ga0209966_1005660 3300027695 Bacteria 2148
451 Ga0209966_1016285 3300027695 Bacteria 1405
452 Ga0209998_10031398 3300027717 Bacteria 1177
453 Ga0209974_10001421 3300027876 Bacteria 8660
454 Ga0209974_10009715 3300027876 Bacteria 3264
455 Ga0209974_10032169 3300027876 Bacteria 1738
456 Ga0209974_10169376 3300027876 Bacteria 796
457 Ga0207428_10000321 3300027907 Bacteria 62664
458 Ga0207428_10024838 3300027907 Bacteria 5027
459 Ga0207428_10062422 3300027907 Bacteria 2946
460 Ga0207428_10142297 3300027907 Bacteria 1829
461 Ga0207428_10214049 3300027907 Bacteria 1447
462 Ga0207428_10534253 3300027907 Bacteria 849
463 Ga0268265_10003346 3300028380 Bacteria 11597
464 Ga0268265_10551255 3300028380 Bacteria 1094
465 Ga0268264_10001077 3300028381 Bacteria 27026
466 Ga0268264_10231781 3300028381 Bacteria 1706
467 Ga0268264_11229884 3300028381 Bacteria 759
468 Ga0307408_100164000 3300031548 Unclassified 1768
469 Ga0307408_100481287 3300031548 Bacteria 1083
470 Ga0307408_100759153 3300031548 Bacteria 877
471 Ga0307408_101274824 3300031548 Bacteria 688
472 Ga0307408_101627004 3300031548 Bacteria 614
473 Ga0307408_101637079 3300031548 Bacteria 612
474 Ga0307405_10174146 3300031731 Unclassified 1538
475 Ga0307410_11808088 3300031852 Bacteria 543
476 Ga0307406_10641146 3300031901 Bacteria 881
477 Ga0307407_10873038 3300031903 Bacteria 689
478 Ga0307412_10106667 3300031911 Bacteria 1992
479 Ga0307412_10197098 3300031911 Bacteria 1527
480 Ga0307412_10733636 3300031911 Bacteria 851
481 Ga0307412_10972524 3300031911 Bacteria 748
482 Ga0307409_102277653 3300031995 Bacteria 571
483 Ga0307416_100183675 3300032002 Bacteria 1963
484 Ga0307416_100343938 3300032002 Unclassified 1506
485 Ga0307416_100474965 3300032002 Bacteria 1309
486 Ga0307416_101611686 3300032002 Bacteria 754
487 Ga0307416_101652519 3300032002 Bacteria 745
488 Ga0307411_10349598 3300032005 Bacteria 1205
489 Ga0307411_10466326 3300032005 Bacteria 1060
490 Ga0307411_10887640 3300032005 Bacteria 791
491 Ga0307411_11016350 3300032005 Bacteria 743
492 Ga0307411_11147741 3300032005 Unclassified 702
493 Ga0307411_11583439 3300032005 Bacteria 604
494 Ga0307411_11747277 3300032005 Bacteria 576
495 Ga0316583_10124335 3300032133 Unclassified 899
496 Ga0373948_0043427 3300034817 Bacteria 947
497 Ga0373938_0077990 3300034957 Bacteria 802
498 Ga0373926_0037450 3300035083 Bacteria 1725
499 Ga0373928_0001275 3300035084 Bacteria 4964
500 Ga0373928_0033048 3300035084 Bacteria 1156
501 Ga0373928_0176903 3300035084 Bacteria 604
502 Ga0373929_0110196 3300035085 Bacteria 703
503 Ga0373929_0154870 3300035085 Bacteria 617
504 Ga0373929_0234115 3300035085 Bacteria 527
505 Ga0373934_0018623 3300035086 Bacteria 2658
506 Ga0373934_0327756 3300035086 Bacteria 636
507 Ga0373940_0069540 3300035088 Bacteria 1022
508 Ga0373940_0242819 3300035088 Bacteria 605
509 Ga0373944_0007607 3300035089 Bacteria 2908
510 Ga0373944_0032245 3300035089 Bacteria 1581
511 Ga0373949_0135679 3300035090 Bacteria 701
512 Ga0373949_0241556 3300035090 Bacteria 556
513 Ga0373951_0082723 3300035091 Bacteria 833
514 Ga0373951_0187381 3300035091 Bacteria 597
515 Ga0373952_0001950 3300035092 Bacteria 3737
516 Ga0373952_0163933 3300035092 Bacteria 631
517 Ga0373952_0171573 3300035092 Unclassified 620
518 Ga0373923_0079537 3300035111 Bacteria 1420
519 Ga0373923_0303738 3300035111 Bacteria 755
520 Ga0373932_0002438 3300035112 Bacteria 4717
521 Ga0373932_0133532 3300035112 Bacteria 838
522 Ga0373932_0231573 3300035112 Bacteria 668
523 Ga0373936_0029588 3300035113 Bacteria 2156
524 Ga0373936_0252223 3300035113 Bacteria 788
525 Ga0373936_0348296 3300035113 Bacteria 674
526 Ga0373939_0002522 3300035114 Bacteria 4308
527 Ga0373939_0136570 3300035114 Bacteria 880
528 Ga0373941_0031727 3300035115 Bacteria 1576
529 Ga0373941_0113920 3300035115 Bacteria 956
530 Ga0373941_0300139 3300035115 Bacteria 641
531 Ga0373945_0001661 3300035116 Bacteria 6831
532 Ga0373953_0002608 3300035117 Bacteria 5457
533 Ga0373954_0000002 3300035118 Bacteria 147478
534 Ga0373954_0204650 3300035118 Bacteria 970
535 Ga0373956_0156368 3300035119 Bacteria 1073
536 Ga0373956_0173831 3300035119 Bacteria 1017
537 Ga0373957_0023276 3300035120 Bacteria 2214
538 Ga0373960_0015187 3300035121 Bacteria 1961
539 Ga0373960_0169062 3300035121 Bacteria 757
540 Ga0373960_0221428 3300035121 Bacteria 677
541 Ga0373943_0010824 3300035170 Bacteria 4094
542 Ga0373943_0097712 3300035170 Bacteria 1530
543 Ga0373943_0885911 3300035170 Bacteria 533
544 Ga0373946_0005645 3300035171 Bacteria 4519
545 Ga0373946_0041970 3300035171 Bacteria 1878
546 Ga0373955_0038672 3300035172 Bacteria 2543
547 Ga0373955_0083592 3300035172 Bacteria 1809
548 Ga0373955_0299717 3300035172 Bacteria 969
549 Ga0373955_0824571 3300035172 Unclassified 570
550 Ga0373942_0006452 3300035207 Bacteria 2710
551 Ga0373942_0098176 3300035207 Bacteria 891
552 Ga0373961_0025476 3300035241 Bacteria 1608
553 Ga0373961_0050216 3300035241 Bacteria 1235
554 Ga0373962_0011183 3300035242 Bacteria 2246
555 Ga0373962_0063589 3300035242 Bacteria 1089
556 Ga0316574_0801827 3300035398 Bacteria 573
557 Ga0373924_0069540 3300035410 Bacteria 1483
558 Ga0373924_0084250 3300035410 Bacteria 1355
559 Ga0373924_0203820 3300035410 Bacteria 873
560 Ga0373924_0221463 3300035410 Bacteria 836
561 Ga0373931_0000265 3300035691 Bacteria 22203
562 Ga0373931_0008664 3300035691 Bacteria 4835
563 Ga0373931_0034304 3300035691 Bacteria 2633
564 Ga0373931_0120090 3300035691 Bacteria 1501
565 Ga0373931_0441787 3300035691 Bacteria 831
566 Ga0373935_0029727 3300035692 Bacteria 3382
567 Ga0373935_0033469 3300035692 Bacteria 3198
568 Ga0373935_0324545 3300035692 Bacteria 1093
569 Ga0373927_0078223 3300035695 Bacteria 2142
570 Ga0373927_0114908 3300035695 Bacteria 1754
571 Ga0373933_0000657 3300035724 Bacteria 21450
572 Ga0373933_0015090 3300035724 Bacteria 4305
573 Ga0373933_0202219 3300035724 Bacteria 1271
574 Ga0373947_0009354 3300035725 Bacteria 5630
575 Ga0373947_0036354 3300035725 Bacteria 2920
576 Ga0373947_1037173 3300035725 Unclassified 559
577 Ga0373937_0000358 3300036401 Bacteria 42468
578 Ga0373937_0006046 3300036401 Bacteria 10424
579 Ga0373937_0193976 3300036401 Bacteria 1909
580 Ga0373937_0218547 3300036401 Bacteria 1793
581 Ga0373925_0002889 3300037068 Bacteria 13571
582 Ga0373925_0040234 3300037068 Bacteria 3460
583 Ga0373925_0110612 3300037068 Bacteria 2122
584 Ga0373925_0777110 3300037068 Bacteria 790
585 Ga0373925_1153276 3300037068 Bacteria 637
586 Ga0373925_1193750 3300037068 Bacteria 625
587 Ga0373925_1537367 3300037068 Bacteria 544
588 Ga0439461_0002213 3300041410 Bacteria 3086
589 Ga0451839_1400463 3300041496 Bacteria 1248
590 Ga0451845_0711978 3300041501 Bacteria 647
591 Ga0439441_002685 3300042001 Bacteria 2529
592 Ga0439441_013676 3300042001 Bacteria 1412
593 Ga0439443_012970 3300042003 Bacteria 1240
594 Ga0439454_015792 3300042011 Bacteria 1061
595 Ga0439456_014934 3300042013 Bacteria 1620
596 Ga0439463_145298 3300042016 Bacteria 615
597 Ga0450888_080082 3300042126 Unclassified 501
598 Ga0450910_040851 3300042147 Bacteria 749
599 Ga0439446_0000176 3300042156 Bacteria 11244
600 Ga0439446_0181296 3300042156 Unclassified 704
601 Ga0439434_0001633 3300042435 Bacteria 6483
602 Ga0439434_0063431 3300042435 Bacteria 1158
603 Ga0439435_0000026 3300042436 Bacteria 16073
604 Ga0439444_0003007 3300042437 Bacteria 2352
605 Ga0439464_0069306 3300042439 Bacteria 1042
606 Ga0439460_0044333 3300042461 Bacteria 1316
607 Ga0450918_100795 3300042531 Bacteria 565
608 Ga0451577_0050315 3300042876 Bacteria 3720
609 Ga0451577_0470068 3300042876 Bacteria 1142
610 Ga0466965_0165682 3300044683 Bacteria 1160
611 Ga0466963_0049527 3300044694 Bacteria 2779
612 Ga0466964_0004501 3300044706 Bacteria 5145
613 Ga0466964_0339405 3300044706 Bacteria 769
614 Ga0453684_0319001 3300044712 Bacteria 1761
615 Ga0453684_1389708 3300044712 Bacteria 729
616 Ga0451576_0001306 3300045051 Bacteria 43171
617 Ga0451576_0035821 3300045051 Bacteria 5262
618 Ga0451576_0146167 3300045051 Bacteria 2465
619 Ga0451576_0193274 3300045051 Bacteria 2125
620 Ga0451576_0311617 3300045051 Bacteria 1646
621 Ga0451576_0510906 3300045051 Bacteria 1262
622 Ga0451576_0679899 3300045051 Bacteria 1081
623 Ga0451576_0701437 3300045051 Bacteria 1063
624 Ga0451576_2583611 3300045051 Unclassified 518
625 Ga0466958_0145560 3300045836 Bacteria 1493
626 Ga0466967_0020049 3300045976 Bacteria 5393
627 Ga0495592_0003821 3300046454 Bacteria 10887
628 Ga0495592_0551946 3300046454 Bacteria 708
629 Ga0495603_0013943 3300046455 Bacteria 4860
630 Ga0495603_0607940 3300046455 Unclassified 626
631 Ga0495641_0235955 3300046461 Bacteria 821
632 Ga0495651_0279044 3300046462 Bacteria 1130
633 Ga0495651_0287408 3300046462 Bacteria 1108
634 Ga0495651_0343714 3300046462 Bacteria 988
635 Ga0495653_0132467 3300046463 Bacteria 1763
636 Ga0495653_0586168 3300046463 Unclassified 687
637 Ga0495580_0033208 3300046472 Bacteria 3719
638 Ga0495582_0018968 3300046473 Bacteria 3764
639 Ga0495639_0022242 3300046475 Bacteria 2781
640 Ga0495639_0058813 3300046475 Bacteria 1759
641 Ga0495662_0008976 3300046476 Bacteria 4910
642 Ga0495664_0258423 3300046477 Bacteria 1053
643 Ga0495584_0072974 3300046491 Bacteria 1725
644 Ga0495594_0264567 3300046499 Bacteria 979
645 Ga0495608_0002044 3300046511 Bacteria 14501
646 Ga0495608_0418106 3300046511 Bacteria 818
647 Ga0495618_0022560 3300046514 Bacteria 3888
648 Ga0495628_0016487 3300046516 Bacteria 6161
649 Ga0495628_0453205 3300046516 Bacteria 931
650 Ga0495630_0001185 3300046517 Bacteria 17975
651 Ga0495630_0039270 3300046517 Bacteria 3540
652 Ga0495630_0622469 3300046517 Bacteria 827
653 Ga0495666_0003317 3300046526 Bacteria 8133
654 Ga0495642_0199025 3300046528 Bacteria 873
655 Ga0495642_0257853 3300046528 Bacteria 762
656 Ga0495652_0033401 3300046529 Bacteria 4491
657 Ga0495652_0180923 3300046529 Bacteria 1618
658 Ga0495665_0309752 3300046531 Bacteria 807
659 Ga0495640_0000808 3300046533 Bacteria 23777
660 Ga0495640_0004665 3300046533 Bacteria 10928
661 Ga0495640_0582423 3300046533 Unclassified 677
662 Ga0495586_0000440 3300046535 Bacteria 24985
663 Ga0495586_0009939 3300046535 Bacteria 5068
664 Ga0495586_0028778 3300046535 Bacteria 2973
665 Ga0495598_0037970 3300046537 Bacteria 1392
666 Ga0495598_0103180 3300046537 Bacteria 946
667 Ga0495598_0163324 3300046537 Bacteria 785
668 Ga0495598_0295255 3300046537 Bacteria 612
669 Ga0495621_0029158 3300046539 Bacteria 1880
670 Ga0495621_0058828 3300046539 Bacteria 1391
671 Ga0495645_0274616 3300046543 Bacteria 1111
672 Ga0495622_0300432 3300046557 Bacteria 700
673 Ga0495633_0375027 3300046558 Bacteria 644
674 Ga0495667_0001153 3300046559 Bacteria 17225
675 Ga0495667_0192726 3300046559 Bacteria 1306
676 Ga0495667_0230699 3300046559 Bacteria 1180
677 Ga0495656_0225811 3300046615 Bacteria 938
678 Ga0495634_0002587 3300046642 Bacteria 14917
679 Ga0495634_0091842 3300046642 Bacteria 1970
680 Ga0495635_0097799 3300046663 Bacteria 2006
681 Ga0495635_0132240 3300046663 Bacteria 1701
682 Ga0495659_0051963 3300046664 Bacteria 1494
683 Ga0495588_0078511 3300046674 Bacteria 1722
684 Ga0495657_0302645 3300046675 Bacteria 953
685 Ga0495657_0825119 3300046675 Bacteria 529
686 Ga0495599_0007763 3300046678 Bacteria 6512
687 Ga0495647_0049604 3300046681 Bacteria 1626
688 Ga0495647_0419253 3300046681 Bacteria 617
689 Ga0495658_0004220 3300046683 Bacteria 7071
690 Ga0495658_0172434 3300046683 Bacteria 1339
691 Ga0495669_0004311 3300046684 Bacteria 5870
692 Ga0495613_0025295 3300046689 Bacteria 4423
693 Ga0495624_0034028 3300046690 Bacteria 3299
694 Ga0495624_0199350 3300046690 Bacteria 1216
695 Ga0495600_0008016 3300046809 Bacteria 6473
696 Ga0495581_0175427 3300047315 Bacteria 1253
697 Ga0495604_0002447 3300047317 Bacteria 14851
698 Ga0495604_0100700 3300047317 Bacteria 2124
699 Ga0495604_0134414 3300047317 Bacteria 1774
700 Ga0495636_0133687 3300047318 Bacteria 1104
701 Ga0495636_0312728 3300047318 Bacteria 736
702 Ga0495636_0609051 3300047318 Unclassified 534
703 Ga0495636_0699755 3300047318 Bacteria 500
704 Ga0495674_0123030 3300047319 Bacteria 2191
705 Ga0495674_0285677 3300047319 Bacteria 1351
706 Ga0495676_0019304 3300047321 Bacteria 5998
707 Ga0495680_0001572 3300047322 Bacteria 24459
708 Ga0495680_0296405 3300047322 Bacteria 1136
709 Ga0495675_0319881 3300047444 Bacteria 918
710 Ga0495675_0528769 3300047444 Bacteria 674
711 Ga0495677_0263386 3300047445 Bacteria 675
712 Ga0495684_0018458 3300047471 Bacteria 5374
713 Ga0495614_0339553 3300048089 Bacteria 699
714 Ga0495614_0425781 3300048089 Unclassified 626
715 Ga0496100_0285861 3300048903 Unclassified 1231
716 Ga0496101_0367531 3300048904 Unclassified 1131
717 Ga0496104_0797108 3300048907 Bacteria 851
718 Ga0496106_0074134 3300048909 Bacteria 2605
719 Ga0496114_0093146 3300048917 Bacteria 2561
720 Ga0501291_091408 3300049514 Bacteria 622
721 Ga0501292_036836 3300049515 Bacteria 836
722 Ga0501296_013948 3300049519 Bacteria 982
723 Ga0501296_045493 3300049519 Bacteria 630
724 Ga0501298_014855 3300049521 Bacteria 1396
725 Ga0501299_005994 3300049522 Bacteria 1892
726 Ga0501299_021606 3300049522 Bacteria 1181
727 Ga0501299_172976 3300049522 Bacteria 559
728 Ga0501031_0283837 3300049568 Bacteria 1074
729 Ga0501031_0837714 3300049568 Bacteria 589
730 Ga0501032_0400987 3300049569 Bacteria 881
731 Ga0501036_0518807 3300049572 Bacteria 991
732 Ga0501036_1198192 3300049572 Bacteria 619
733 Ga0501037_0481448 3300049573 Bacteria 844
734 Ga0501038_0427688 3300049574 Bacteria 1021
735 Ga0501038_0746776 3300049574 Bacteria 730
736 Ga0501039_0085414 3300049575 Bacteria 2458
737 Ga0501039_0174792 3300049575 Bacteria 1689
738 Ga0501039_0344457 3300049575 Bacteria 1171
739 Ga0501040_0016065 3300049576 Bacteria 4951
740 Ga0501040_0263815 3300049576 Bacteria 1229
741 Ga0501040_0541392 3300049576 Bacteria 840
742 Ga0501040_1325192 3300049576 Bacteria 522
743 Ga0501041_0441151 3300049577 Bacteria 826
744 Ga0501041_0767380 3300049577 Bacteria 618
745 Ga0501042_0341249 3300049578 Bacteria 1083
746 Ga0501042_0444854 3300049578 Bacteria 940
747 Ga0501042_1199542 3300049578 Bacteria 553
748 Ga0501042_1367739 3300049578 Bacteria 516
749 Ga0501043_0238284 3300049579 Bacteria 1404
750 Ga0501046_0484505 3300049580 Bacteria 887
751 Ga0501047_0875526 3300049581 Bacteria 712
752 Ga0501048_0171493 3300049582 Bacteria 1537
753 Ga0501048_0762931 3300049582 Unclassified 695
754 Ga0501048_1266525 3300049582 Unclassified 530
755 Ga0501048_1283986 3300049582 Unclassified 526
756 Ga0501068_0258697 3300049584 Bacteria 1110
757 Ga0501068_1186248 3300049584 Bacteria 506
758 Ga0501069_0086665 3300049585 Bacteria 1768
759 Ga0501069_0106646 3300049585 Bacteria 1593
760 Ga0501069_0890123 3300049585 Bacteria 541
761 Ga0501071_0264776 3300049587 Bacteria 1299
762 Ga0501071_0574110 3300049587 Bacteria 866
763 Ga0501071_0667808 3300049587 Bacteria 800
764 Ga0501071_1107370 3300049587 Bacteria 612
765 Ga0501071_1191915 3300049587 Bacteria 588
766 Ga0501071_1448855 3300049587 Bacteria 530
767 Ga0501072_0060734 3300049588 Bacteria 2980
768 Ga0501072_0189057 3300049588 Bacteria 1642
769 Ga0501072_0328206 3300049588 Bacteria 1216
770 Ga0501072_0953160 3300049588 Bacteria 669
771 Ga0501072_1019118 3300049588 Bacteria 645
772 Ga0501073_1257108 3300049589 Bacteria 508
773 Ga0501074_0981525 3300049590 Bacteria 594
774 Ga0501074_0983563 3300049590 Bacteria 593
775 Ga0501075_0161351 3300049591 Bacteria 1710
776 Ga0501075_0172967 3300049591 Bacteria 1648
777 Ga0501076_0224034 3300049592 Unclassified 1537
778 Ga0501076_0980119 3300049592 Bacteria 696
779 Ga0501077_0312874 3300049593 Bacteria 1001
780 Ga0501216_057812 3300049660 Bacteria 776
781 Ga0501217_212610 3300049661 Bacteria 608
782 Ga0501233_018696 3300049668 Bacteria 1460
783 Ga0501257_132602 3300049686 Bacteria 675
784 Ga0501080_0465462 3300049742 Bacteria 1132
785 Ga0501080_1221096 3300049742 Unclassified 646
786 Ga0501081_0186035 3300049743 Bacteria 1503
787 Ga0501081_1124917 3300049743 Bacteria 594
788 Ga0501283_012493 3300049779 Bacteria 1277
789 Ga0501035_0344705 3300049822 Bacteria 1248
790 Ga0501045_0245273 3300049824 Bacteria 1333
791 Ga0501045_0611365 3300049824 Bacteria 807
792 Ga0501045_0765153 3300049824 Bacteria 711
793 Ga0501045_1167805 3300049824 Bacteria 562
794 Ga0501045_1238818 3300049824 Bacteria 544
795 Ga0501045_1278336 3300049824 Bacteria 534
796 nmdc:mga06z11_390846_c1 3300050494 Bacteria 836
797 nmdc:mga05p37_1264825_c1 3300050507 Unclassified 756
798 nmdc:mga05p37_1668226_c1 3300050507 Bacteria 623
799 nmdc:mga05p37_1692350_c1 3300050507 Bacteria 617
800 nmdc:mga05p37_1796511_c1 3300050507 Bacteria 592
801 nmdc:mga05p37_1807699_c1 3300050507 Bacteria 589
802 nmdc:mga05p37_320641_c1 3300050507 Bacteria 1834
803 nmdc:mga05p37_3367_c1 3300050507 Bacteria 18658
804 nmdc:mga09592_103435_c1 3300050508 Bacteria 2440
805 nmdc:mga09592_106007_c1 3300050508 Bacteria 2410
806 nmdc:mga09592_1741425_c1 3300050508 Bacteria 502
807 nmdc:mga09592_235628_c1 3300050508 Bacteria 1586
808 nmdc:mga09592_646_c1 3300050508 Bacteria 26554
809 nmdc:mga09592_81062_c1 3300050508 Bacteria 2765
810 nmdc:mga0qj67_207274_c1 3300050509 Bacteria 1592
811 nmdc:mga0qj67_248854_c1 3300050509 Bacteria 1442
812 nmdc:mga0qj67_271612_c1 3300050509 Bacteria 1375
813 nmdc:mga0qj67_408212_c1 3300050509 Unclassified 1096
814 nmdc:mga0qj67_512293_c1 3300050509 Bacteria 964
815 nmdc:mga0qj67_52148_c1 3300050509 Bacteria 3237
816 nmdc:mga0qj67_623_c1 3300050509 Bacteria 24285
817 nmdc:mga06r32_133999_c1 3300050510 Bacteria 2452
818 nmdc:mga06r32_1401902_c1 3300050510 Bacteria 641
819 nmdc:mga06r32_1679372_c1 3300050510 Bacteria 572
820 nmdc:mga06r32_301273_c1 3300050510 Bacteria 1589
821 nmdc:mga06r32_513920_c1 3300050510 Bacteria 1174
822 nmdc:mga06r32_58630_c1 3300050510 Bacteria 3700
823 nmdc:mga06r32_7083_c1 3300050510 Bacteria 10092
824 nmdc:mga08y16_115323_c1 3300050511 Bacteria 2797
825 nmdc:mga08y16_117352_c1 3300050511 Bacteria 2770
826 nmdc:mga08y16_1209_c1 3300050511 Bacteria 25503
827 nmdc:mga08y16_124404_c1 3300050511 Bacteria 2683
828 nmdc:mga08y16_1301843_c1 3300050511 Bacteria 693
829 nmdc:mga08y16_1772955_c1 3300050511 Unclassified 571
830 nmdc:mga08y16_26333_c1 3300050511 Bacteria 6132
831 nmdc:mga08y16_27053_c1 3300050511 Bacteria 6045
832 nmdc:mga08y16_36047_c1 3300050511 Bacteria 5194
833 nmdc:mga08y16_419359_c1 3300050511 Bacteria 1368
834 nmdc:mga0n895_1176724_c1 3300050512 Bacteria 741
835 nmdc:mga0n895_1336_c1 3300050512 Bacteria 18273
836 nmdc:mga0n895_1563_c1 3300050512 Bacteria 17209
837 nmdc:mga0n895_1572399_c1 3300050512 Bacteria 622
838 nmdc:mga0n895_4259_c1 3300050512 Bacteria 11704
839 nmdc:mga0n895_6387_c1 3300050512 Bacteria 10005
840 nmdc:mga0rr50_1001979_c1 3300050513 Unclassified 712
841 nmdc:mga0rr50_11005_c1 3300050513 Bacteria 5769
842 nmdc:mga0rr50_1230403_c1 3300050513 Bacteria 636
843 nmdc:mga0rr50_1308241_c1 3300050513 Bacteria 615
844 nmdc:mga0rr50_170783_c1 3300050513 Bacteria 1772
845 nmdc:mga0rr50_258537_c1 3300050513 Bacteria 1448
846 nmdc:mga0rr50_35369_c1 3300050513 Bacteria 3587
847 nmdc:mga0rr50_569532_c1 3300050513 Bacteria 965
848 nmdc:mga08x19_142786_c1 3300050514 Bacteria 1618
849 nmdc:mga08x19_22439_c1 3300050514 Bacteria 3909
850 nmdc:mga08x19_23150_c1 3300050514 Bacteria 3853
851 nmdc:mga08x19_263437_c1 3300050514 Bacteria 1192
852 nmdc:mga08x19_2829_c1 3300050514 Bacteria 10472
853 nmdc:mga08x19_513020_c1 3300050514 Bacteria 847
854 nmdc:mga08x19_55_c1 3300050514 Bacteria 120851
855 nmdc:mga08x19_670353_c1 3300050514 Bacteria 736
856 nmdc:mga0a205_283089_c1 3300050515 Bacteria 1533
857 nmdc:mga0a205_38464_c1 3300050515 Bacteria 4603
858 nmdc:mga0a205_589984_c1 3300050515 Bacteria 965
859 nmdc:mga0a205_935_c1 3300050515 Bacteria 24102
860 Ga0495601_0005497 3300053077 Bacteria 7389
861 Ga0495601_0083732 3300053077 Bacteria 2049
862 Ga0495601_0630251 3300053077 Bacteria 687
863 Ga0495595_0520309 3300053084 Unclassified 607
864 Ga0500566_0122685 3300053094 Bacteria 1399
865 Ga0501084_0616219 3300054114 Bacteria 917
866 Ga0501084_1292809 3300054114 Bacteria 611
867 Ga0590077_050692 3300059426 Bacteria 931
868 Ga0501082_0336784 3300060353 Bacteria 1315
869 Ga0501082_0920350 3300060353 Bacteria 765
870 Ga0501082_1618964 3300060353 Bacteria 565

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032133 Ga0316583_10124335 Ga0316583_101243352 84
2 3300035398 Ga0316574_0801827 Ga0316574_0801827_192_515 84
3 3300004801 Ga0058860_11658417 Ga0058860_116584172 86
4 3300004803 Ga0058862_10871056 Ga0058862_108710562 86
5 3300005295 Ga0065707_10028465 Ga0065707_100284652 86
6 3300005330 Ga0070690_100000197 Ga0070690_10000019726 86
7 3300005330 Ga0070690_100664488 Ga0070690_1006644882 86
8 3300005331 Ga0070670_100899990 Ga0070670_1008999902 86
9 3300005334 Ga0068869_100000214 Ga0068869_10000021426 86
10 3300005334 Ga0068869_100063874 Ga0068869_1000638743 86
11 3300005335 Ga0070666_10263580 Ga0070666_102635802 86
12 3300005336 Ga0070680_100005842 Ga0070680_1000058425 86
13 3300005337 Ga0070682_100003738 Ga0070682_1000037383 86
14 3300005338 Ga0068868_100000375 Ga0068868_10000037533 86
15 3300005340 Ga0070689_100000107 Ga0070689_10000010720 86
16 3300005340 Ga0070689_100214699 Ga0070689_1002146992 86
17 3300005340 Ga0070689_100840768 Ga0070689_1008407682 86
18 3300005341 Ga0070691_10000220 Ga0070691_1000022013 86
19 3300005341 Ga0070691_10860537 Ga0070691_108605372 86
20 3300005343 Ga0070687_100000669 Ga0070687_1000006696 86
21 3300005343 Ga0070687_100253395 Ga0070687_1002533952 86
22 3300005345 Ga0070692_10005331 Ga0070692_100053314 86
23 3300005364 Ga0070673_100266246 Ga0070673_1002662462 86
24 3300005364 Ga0070673_100892420 Ga0070673_1008924202 86
25 3300005366 Ga0070659_100519794 Ga0070659_1005197942 86
26 3300005406 Ga0070703_10004630 Ga0070703_100046304 86
27 3300005437 Ga0070710_10437408 Ga0070710_104374081 86
28 3300005438 Ga0070701_10000396 Ga0070701_1000039616 86
29 3300005441 Ga0070700_100000633 Ga0070700_10000063311 86
30 3300005441 Ga0070700_100111705 Ga0070700_1001117052 86
31 3300005441 Ga0070700_100360890 Ga0070700_1003608902 86
32 3300005444 Ga0070694_100000126 Ga0070694_10000012613 86
33 3300005445 Ga0070708_100319275 Ga0070708_1003192752 86
34 3300005456 Ga0070678_100030611 Ga0070678_1000306113 86
35 3300005458 Ga0070681_10414874 Ga0070681_104148742 86
36 3300005458 Ga0070681_10912559 Ga0070681_109125592 86
37 3300005459 Ga0068867_100000032 Ga0068867_10000003262 86
38 3300005518 Ga0070699_100998981 Ga0070699_1009989812 86
39 3300005530 Ga0070679_100108511 Ga0070679_1001085113 86
40 3300005536 Ga0070697_100249725 Ga0070697_1002497252 86
41 3300005539 Ga0068853_100191540 Ga0068853_1001915403 86
42 3300005544 Ga0070686_100000253 Ga0070686_10000025317 86
43 3300005544 Ga0070686_100886077 Ga0070686_1008860772 86
44 3300005545 Ga0070695_100000197 Ga0070695_1000001979 86
45 3300005545 Ga0070695_100246385 Ga0070695_1002463853 86
46 3300005545 Ga0070695_100293197 Ga0070695_1002931972 86
47 3300005546 Ga0070696_100000089 Ga0070696_10000008942 86
48 3300005546 Ga0070696_100000482 Ga0070696_1000004828 86
49 3300005547 Ga0070693_100000400 Ga0070693_10000040020 86
50 3300005549 Ga0070704_100000017 Ga0070704_10000001748 86
51 3300005563 Ga0068855_100002377 Ga0068855_10000237726 86
52 3300005563 Ga0068855_101574544 Ga0068855_1015745442 86
53 3300005577 Ga0068857_100997366 Ga0068857_1009973662 86
54 3300005578 Ga0068854_100022368 Ga0068854_1000223682 86
55 3300005614 Ga0068856_100142277 Ga0068856_1001422774 86
56 3300005615 Ga0070702_100000001 Ga0070702_10000000128 86
57 3300005617 Ga0068859_100000149 Ga0068859_10000014933 86
58 3300005617 Ga0068859_100249647 Ga0068859_1002496473 86
59 3300005618 Ga0068864_100009007 Ga0068864_1000090074 86
60 3300005718 Ga0068866_10000326 Ga0068866_1000032624 86
61 3300005719 Ga0068861_100000428 Ga0068861_1000004283 86
62 3300005841 Ga0068863_100262007 Ga0068863_1002620072 86
63 3300005841 Ga0068863_100283339 Ga0068863_1002833392 86
64 3300005841 Ga0068863_100299836 Ga0068863_1002998362 86
65 3300005842 Ga0068858_100002902 Ga0068858_10000290212 86
66 3300005842 Ga0068858_100615355 Ga0068858_1006153552 86
67 3300005843 Ga0068860_100001090 Ga0068860_1000010905 86
68 3300005843 Ga0068860_100894234 Ga0068860_1008942342 86
69 3300005844 Ga0068862_100000409 Ga0068862_10000040931 86
70 3300006163 Ga0070715_10229490 Ga0070715_102294901 86
71 3300006237 Ga0097621_100000928 Ga0097621_1000009283 86
72 3300006358 Ga0068871_100011561 Ga0068871_1000115615 86
73 3300006358 Ga0068871_101248038 Ga0068871_1012480382 86
74 3300006844 Ga0075428_100000083 Ga0075428_1000000837 86
75 3300006847 Ga0075431_100123948 Ga0075431_1001239483 86
76 3300006852 Ga0075433_10033239 Ga0075433_100332394 86
77 3300006871 Ga0075434_100007734 Ga0075434_10000773410 86
78 3300006871 Ga0075434_101385976 Ga0075434_1013859761 86
79 3300006880 Ga0075429_100000480 Ga0075429_1000004803 86
80 3300006881 Ga0068865_100000059 Ga0068865_10000005926 86
81 3300006914 Ga0075436_100003220 Ga0075436_10000322012 86
82 3300006931 Ga0097620_100000149 Ga0097620_10000014942 86
83 3300006931 Ga0097620_100249643 Ga0097620_1002496433 86
84 3300007076 Ga0075435_100000388 Ga0075435_10000038814 86
85 3300007076 Ga0075435_100772429 Ga0075435_1007724292 86
86 3300009011 Ga0105251_10643320 Ga0105251_106433201 86
87 3300009036 Ga0105244_10492227 Ga0105244_104922272 86
88 3300009093 Ga0105240_10540267 Ga0105240_105402672 86
89 3300009094 Ga0111539_10038453 Ga0111539_100384536 86
90 3300009098 Ga0105245_10000075 Ga0105245_1000007563 86
91 3300009147 Ga0114129_10000210 Ga0114129_1000021045 86
92 3300009147 Ga0114129_11433701 Ga0114129_114337012 86
93 3300009148 Ga0105243_10000622 Ga0105243_1000062234 86
94 3300009148 Ga0105243_12273446 Ga0105243_122734462 86
95 3300009174 Ga0105241_10084412 Ga0105241_100844122 86
96 3300009176 Ga0105242_10000407 Ga0105242_1000040734 86
97 3300009177 Ga0105248_10217743 Ga0105248_102177433 86
98 3300009177 Ga0105248_10414506 Ga0105248_104145063 86
99 3300009553 Ga0105249_10002440 Ga0105249_100024404 86
100 3300010375 Ga0105239_10111905 Ga0105239_101119052 86
101 3300011119 Ga0105246_12265558 Ga0105246_122655582 86
102 3300012492 Ga0157335_1035026 Ga0157335_10350261 86
103 3300013297 Ga0157378_10000074 Ga0157378_1000007432 86
104 3300013306 Ga0163162_13341312 Ga0163162_133413121 86
105 3300013308 Ga0157375_11079065 Ga0157375_110790652 86
106 3300014326 Ga0157380_10103645 Ga0157380_101036453 86
107 3300014745 Ga0157377_11447566 Ga0157377_114475662 86
108 3300014968 Ga0157379_10879275 Ga0157379_108792752 86
109 3300014969 Ga0157376_10021663 Ga0157376_100216633 86
110 3300017792 Ga0163161_10691716 Ga0163161_106917162 86
111 3300025898 Ga0207692_10248029 Ga0207692_102480292 86
112 3300025899 Ga0207642_10004209 Ga0207642_100042093 86
113 3300025901 Ga0207688_10059207 Ga0207688_100592074 86
114 3300025903 Ga0207680_10244047 Ga0207680_102440472 86
115 3300025904 Ga0207647_10657704 Ga0207647_106577042 86
116 3300025905 Ga0207685_10496850 Ga0207685_104968502 86
117 3300025911 Ga0207654_10022847 Ga0207654_100228472 86
118 3300025912 Ga0207707_10210452 Ga0207707_102104523 86
119 3300025913 Ga0207695_11243277 Ga0207695_112432772 86
120 3300025916 Ga0207663_10251923 Ga0207663_102519232 86
121 3300025916 Ga0207663_10511958 Ga0207663_105119582 86
122 3300025917 Ga0207660_10078664 Ga0207660_100786642 86
123 3300025918 Ga0207662_10000315 Ga0207662_100003156 86
124 3300025918 Ga0207662_10283799 Ga0207662_102837992 86
125 3300025923 Ga0207681_10248018 Ga0207681_102480182 86
126 3300025927 Ga0207687_10001426 Ga0207687_1000142618 86
127 3300025928 Ga0207700_11624483 Ga0207700_116244832 86
128 3300025931 Ga0207644_10029941 Ga0207644_100299412 86
129 3300025934 Ga0207686_10000243 Ga0207686_1000024316 86
130 3300025935 Ga0207709_10001387 Ga0207709_1000138713 86
131 3300025936 Ga0207670_10001067 Ga0207670_1000106715 86
132 3300025936 Ga0207670_10108375 Ga0207670_101083752 86
133 3300025938 Ga0207704_10018253 Ga0207704_100182532 86
134 3300025939 Ga0207665_10144714 Ga0207665_101447142 86
135 3300025941 Ga0207711_10618201 Ga0207711_106182012 86
136 3300025942 Ga0207689_10000007 Ga0207689_1000000777 86
137 3300025942 Ga0207689_10097695 Ga0207689_100976952 86
138 3300025949 Ga0207667_10077643 Ga0207667_100776434 86
139 3300025949 Ga0207667_11302905 Ga0207667_113029052 86
140 3300025960 Ga0207651_10195881 Ga0207651_101958813 86
141 3300025960 Ga0207651_11099234 Ga0207651_110992342 86
142 3300025961 Ga0207712_10002821 Ga0207712_100028219 86
143 3300025981 Ga0207640_10015170 Ga0207640_100151702 86
144 3300026023 Ga0207677_10000823 Ga0207677_1000082317 86
145 3300026035 Ga0207703_10102600 Ga0207703_101026003 86
146 3300026035 Ga0207703_10345945 Ga0207703_103459452 86
147 3300026041 Ga0207639_10520357 Ga0207639_105203572 86
148 3300026075 Ga0207708_10000086 Ga0207708_1000008611 86
149 3300026075 Ga0207708_10251397 Ga0207708_102513972 86
150 3300026075 Ga0207708_10561004 Ga0207708_105610042 86
151 3300026078 Ga0207702_10145265 Ga0207702_101452652 86
152 3300026088 Ga0207641_10161054 Ga0207641_101610543 86
153 3300026088 Ga0207641_10225916 Ga0207641_102259162 86
154 3300026088 Ga0207641_10423615 Ga0207641_104236152 86
155 3300026089 Ga0207648_10000079 Ga0207648_1000007962 86
156 3300026095 Ga0207676_10037278 Ga0207676_100372782 86
157 3300026118 Ga0207675_100000093 Ga0207675_10000009364 86
158 3300026118 Ga0207675_100829724 Ga0207675_1008297242 86
159 3300026121 Ga0207683_10327647 Ga0207683_103276472 86
160 3300027907 Ga0207428_10000321 Ga0207428_100003219 86
161 3300027907 Ga0207428_10142297 Ga0207428_101422972 86
162 3300028380 Ga0268265_10003346 Ga0268265_100033465 86
163 3300028381 Ga0268264_10001077 Ga0268264_1000107728 86
164 3300028381 Ga0268264_11229884 Ga0268264_112298841 86
165 3300034817 Ga0373948_0043427 Ga0373948_0043427_384_644 86
166 3300035083 Ga0373926_0037450 Ga0373926_0037450_498_758 86
167 3300035084 Ga0373928_0001275 Ga0373928_0001275_3594_3854 86
168 3300035085 Ga0373929_0154870 Ga0373929_0154870_204_464 86
169 3300035086 Ga0373934_0327756 Ga0373934_0327756_98_358 86
170 3300035088 Ga0373940_0069540 Ga0373940_0069540_111_371 86
171 3300035089 Ga0373944_0007607 Ga0373944_0007607_1320_1580 86
172 3300035089 Ga0373944_0032245 Ga0373944_0032245_1099_1359 86
173 3300035090 Ga0373949_0135679 Ga0373949_0135679_150_410 86
174 3300035090 Ga0373949_0241556 Ga0373949_0241556_58_318 86
175 3300035091 Ga0373951_0082723 Ga0373951_0082723_62_322 86
176 3300035092 Ga0373952_0171573 Ga0373952_0171573_117_377 86
177 3300035111 Ga0373923_0303738 Ga0373923_0303738_99_359 86
178 3300035112 Ga0373932_0002438 Ga0373932_0002438_2046_2306 86
179 3300035112 Ga0373932_0133532 Ga0373932_0133532_476_736 86
180 3300035113 Ga0373936_0029588 Ga0373936_0029588_874_1134 86
181 3300035113 Ga0373936_0348296 Ga0373936_0348296_225_485 86
182 3300035114 Ga0373939_0002522 Ga0373939_0002522_871_1131 86
183 3300035115 Ga0373941_0031727 Ga0373941_0031727_229_489 86
184 3300035115 Ga0373941_0113920 Ga0373941_0113920_357_617 86
185 3300035115 Ga0373941_0300139 Ga0373941_0300139_61_321 86
186 3300035116 Ga0373945_0001661 Ga0373945_0001661_3017_3277 86
187 3300035117 Ga0373953_0002608 Ga0373953_0002608_2546_2806 86
188 3300035118 Ga0373954_0204650 Ga0373954_0204650_669_929 86
189 3300035119 Ga0373956_0156368 Ga0373956_0156368_511_771 86
190 3300035120 Ga0373957_0023276 Ga0373957_0023276_911_1171 86
191 3300035121 Ga0373960_0015187 Ga0373960_0015187_16_276 86
192 3300035121 Ga0373960_0169062 Ga0373960_0169062_89_349 86
193 3300035170 Ga0373943_0010824 Ga0373943_0010824_1672_1932 86
194 3300035170 Ga0373943_0097712 Ga0373943_0097712_1031_1291 86
195 3300035171 Ga0373946_0005645 Ga0373946_0005645_848_1108 86
196 3300035171 Ga0373946_0041970 Ga0373946_0041970_234_494 86
197 3300035172 Ga0373955_0038672 Ga0373955_0038672_252_512 86
198 3300035207 Ga0373942_0098176 Ga0373942_0098176_320_580 86
199 3300035241 Ga0373961_0025476 Ga0373961_0025476_818_1078 86
200 3300035242 Ga0373962_0011183 Ga0373962_0011183_1215_1475 86
201 3300035410 Ga0373924_0069540 Ga0373924_0069540_76_336 86
202 3300035691 Ga0373931_0000265 Ga0373931_0000265_7612_7872 86
203 3300035691 Ga0373931_0008664 Ga0373931_0008664_2797_3057 86
204 3300035691 Ga0373931_0034304 Ga0373931_0034304_1735_1995 86
205 3300035692 Ga0373935_0029727 Ga0373935_0029727_3055_3315 86
206 3300035692 Ga0373935_0033469 Ga0373935_0033469_2162_2422 86
207 3300035692 Ga0373935_0324545 Ga0373935_0324545_227_487 86
208 3300035695 Ga0373927_0078223 Ga0373927_0078223_491_751 86
209 3300035695 Ga0373927_0114908 Ga0373927_0114908_1266_1526 86
210 3300035724 Ga0373933_0015090 Ga0373933_0015090_1613_1873 86
211 3300035725 Ga0373947_0009354 Ga0373947_0009354_1840_2100 86
212 3300035725 Ga0373947_0036354 Ga0373947_0036354_882_1142 86
213 3300036401 Ga0373937_0218547 Ga0373937_0218547_1023_1283 86
214 3300037068 Ga0373925_0002889 Ga0373925_0002889_1760_2020 86
215 3300037068 Ga0373925_0040234 Ga0373925_0040234_865_1125 86
216 3300037068 Ga0373925_0110612 Ga0373925_0110612_549_809 86
217 3300037068 Ga0373925_0777110 Ga0373925_0777110_22_282 86
218 3300042156 Ga0439446_0181296 Ga0439446_0181296_77_337 86
219 3300042876 Ga0451577_0050315 Ga0451577_0050315_2558_2818 86
220 3300044712 Ga0453684_0319001 Ga0453684_0319001_1055_1315 86
221 3300045051 Ga0451576_0001306 Ga0451576_0001306_2022_2282 86
222 3300045051 Ga0451576_0035821 Ga0451576_0035821_1761_2021 86
223 3300045051 Ga0451576_0193274 Ga0451576_0193274_782_1042 86
224 3300045051 Ga0451576_0510906 Ga0451576_0510906_966_1229 86
225 3300045051 Ga0451576_0679899 Ga0451576_0679899_644_904 86
226 3300045051 Ga0451576_0701437 Ga0451576_0701437_466_726 86
227 3300046455 Ga0495603_0013943 Ga0495603_0013943_3784_4044 86
228 3300046462 Ga0495651_0343714 Ga0495651_0343714_504_764 86
229 3300046463 Ga0495653_0586168 Ga0495653_0586168_339_599 86
230 3300046472 Ga0495580_0033208 Ga0495580_0033208_1254_1514 86
231 3300046473 Ga0495582_0018968 Ga0495582_0018968_2054_2314 86
232 3300046475 Ga0495639_0022242 Ga0495639_0022242_2198_2458 86
233 3300046477 Ga0495664_0258423 Ga0495664_0258423_235_495 86
234 3300046499 Ga0495594_0264567 Ga0495594_0264567_21_281 86
235 3300046517 Ga0495630_0622469 Ga0495630_0622469_546_806 86
236 3300046531 Ga0495665_0309752 Ga0495665_0309752_202_462 86
237 3300046533 Ga0495640_0582423 Ga0495640_0582423_97_357 86
238 3300046535 Ga0495586_0009939 Ga0495586_0009939_4140_4400 86
239 3300046537 Ga0495598_0037970 Ga0495598_0037970_534_794 86
240 3300046557 Ga0495622_0300432 Ga0495622_0300432_101_361 86
241 3300046615 Ga0495656_0225811 Ga0495656_0225811_534_794 86
242 3300046674 Ga0495588_0078511 Ga0495588_0078511_1351_1611 86
243 3300046681 Ga0495647_0049604 Ga0495647_0049604_625_885 86
244 3300046683 Ga0495658_0004220 Ga0495658_0004220_2333_2593 86
245 3300047317 Ga0495604_0100700 Ga0495604_0100700_1169_1429 86
246 3300047321 Ga0495676_0019304 Ga0495676_0019304_2392_2652 86
247 3300047445 Ga0495677_0263386 Ga0495677_0263386_92_352 86
248 3300048089 Ga0495614_0339553 Ga0495614_0339553_158_418 86
249 3300049572 Ga0501036_0518807 Ga0501036_0518807_206_466 86
250 3300049574 Ga0501038_0746776 Ga0501038_0746776_146_406 86
251 3300049576 Ga0501040_0263815 Ga0501040_0263815_872_1132 86
252 3300049577 Ga0501041_0441151 Ga0501041_0441151_187_447 86
253 3300049578 Ga0501042_0444854 Ga0501042_0444854_544_804 86
254 3300049580 Ga0501046_0484505 Ga0501046_0484505_512_772 86
255 3300049582 Ga0501048_0171493 Ga0501048_0171493_209_469 86
256 3300049582 Ga0501048_1266525 Ga0501048_1266525_122_382 86
257 3300049588 Ga0501072_0189057 Ga0501072_0189057_109_369 86
258 3300049588 Ga0501072_0953160 Ga0501072_0953160_388_648 86
259 3300049590 Ga0501074_0981525 Ga0501074_0981525_115_375 86
260 3300049591 Ga0501075_0172967 Ga0501075_0172967_563_823 86
261 3300049743 Ga0501081_0186035 Ga0501081_0186035_698_958 86
262 3300049824 Ga0501045_0765153 Ga0501045_0765153_346_606 86
263 3300049824 Ga0501045_1278336 Ga0501045_1278336_231_491 86
264 3300050507 nmdc:mga05p37_3367_c1 nmdc:mga05p37_3367_c1_18124_18384 86
265 3300050508 nmdc:mga09592_646_c1 nmdc:mga09592_646_c1_22229_22489 86
266 3300050510 nmdc:mga06r32_301273_c1 nmdc:mga06r32_301273_c1_1016_1276 86
267 3300050511 nmdc:mga08y16_1209_c1 nmdc:mga08y16_1209_c1_4248_4508 86
268 3300050511 nmdc:mga08y16_27053_c1 nmdc:mga08y16_27053_c1_1393_1653 86
269 3300050512 nmdc:mga0n895_1572399_c1 nmdc:mga0n895_1572399_c1_22_282 86
270 3300050512 nmdc:mga0n895_4259_c1 nmdc:mga0n895_4259_c1_2735_2995 86
271 3300050513 nmdc:mga0rr50_11005_c1 nmdc:mga0rr50_11005_c1_5007_5267 86
272 3300050513 nmdc:mga0rr50_569532_c1 nmdc:mga0rr50_569532_c1_503_763 86
273 3300050514 nmdc:mga08x19_2829_c1 nmdc:mga08x19_2829_c1_8101_8361 86
274 3300050515 nmdc:mga0a205_589984_c1 nmdc:mga0a205_589984_c1_153_413 86
275 3300050515 nmdc:mga0a205_935_c1 nmdc:mga0a205_935_c1_2441_2701 86
276 3300053084 Ga0495595_0520309 Ga0495595_0520309_107_367 86
277 3300060353 Ga0501082_0920350 Ga0501082_0920350_92_352 86
278 3300003397 JGI26133J50247_101018 JGI26133J50247_1010181 87
279 3300005330 Ga0070690_101091112 Ga0070690_1010911122 87
280 3300005334 Ga0068869_100229020 Ga0068869_1002290202 87
281 3300005340 Ga0070689_100065511 Ga0070689_1000655115 87
282 3300005341 Ga0070691_10219666 Ga0070691_102196661 87
283 3300005343 Ga0070687_100159616 Ga0070687_1001596162 87
284 3300005365 Ga0070688_101569673 Ga0070688_1015696731 87
285 3300005441 Ga0070700_100103026 Ga0070700_1001030262 87
286 3300005444 Ga0070694_100563404 Ga0070694_1005634041 87
287 3300005445 Ga0070708_101109277 Ga0070708_1011092772 87
288 3300005468 Ga0070707_100726748 Ga0070707_1007267482 87
289 3300005468 Ga0070707_100798163 Ga0070707_1007981632 87
290 3300005471 Ga0070698_101948042 Ga0070698_1019480421 87
291 3300005535 Ga0070684_101303839 Ga0070684_1013038392 87
292 3300005544 Ga0070686_100533516 Ga0070686_1005335162 87
293 3300005545 Ga0070695_100045316 Ga0070695_1000453165 87
294 3300005545 Ga0070695_101443105 Ga0070695_1014431051 87
295 3300005546 Ga0070696_100166322 Ga0070696_1001663222 87
296 3300005549 Ga0070704_100421993 Ga0070704_1004219932 87
297 3300005617 Ga0068859_101059047 Ga0068859_1010590472 87
298 3300005618 Ga0068864_100082993 Ga0068864_1000829933 87
299 3300005618 Ga0068864_102069581 Ga0068864_1020695812 87
300 3300005719 Ga0068861_100326403 Ga0068861_1003264033 87
301 3300005841 Ga0068863_102046408 Ga0068863_1020464082 87
302 3300006178 Ga0075367_10815908 Ga0075367_108159082 87
303 3300006358 Ga0068871_101459461 Ga0068871_1014594612 87
304 3300006844 Ga0075428_100040406 Ga0075428_1000404065 87
305 3300006846 Ga0075430_100438589 Ga0075430_1004385892 87
306 3300006871 Ga0075434_100005363 Ga0075434_1000053636 87
307 3300006880 Ga0075429_100254048 Ga0075429_1002540482 87
308 3300006880 Ga0075429_101078498 Ga0075429_1010784982 87
309 3300006931 Ga0097620_101059077 Ga0097620_1010590772 87
310 3300007076 Ga0075435_100663288 Ga0075435_1006632882 87
311 3300007265 Ga0099794_10015782 Ga0099794_100157822 87
312 3300009094 Ga0111539_10026004 Ga0111539_100260046 87
313 3300009094 Ga0111539_10693456 Ga0111539_106934562 87
314 3300009147 Ga0114129_10634184 Ga0114129_106341842 87
315 3300009147 Ga0114129_11130110 Ga0114129_111301102 87
316 3300009147 Ga0114129_11946484 Ga0114129_119464841 87
317 3300009176 Ga0105242_12061126 Ga0105242_120611262 87
318 3300009177 Ga0105248_10838385 Ga0105248_108383852 87
319 3300025885 Ga0207653_10004464 Ga0207653_100044642 87
320 3300025918 Ga0207662_10171434 Ga0207662_101714342 87
321 3300025918 Ga0207662_10173077 Ga0207662_101730772 87
322 3300025934 Ga0207686_10753542 Ga0207686_107535422 87
323 3300025936 Ga0207670_10127750 Ga0207670_101277503 87
324 3300025936 Ga0207670_10334710 Ga0207670_103347102 87
325 3300025941 Ga0207711_11811618 Ga0207711_118116182 87
326 3300025942 Ga0207689_10259174 Ga0207689_102591742 87
327 3300026075 Ga0207708_10202555 Ga0207708_102025552 87
328 3300026088 Ga0207641_10312390 Ga0207641_103123903 87
329 3300026089 Ga0207648_10377073 Ga0207648_103770733 87
330 3300026095 Ga0207676_10321696 Ga0207676_103216962 87
331 3300026118 Ga0207675_100144068 Ga0207675_1001440683 87
332 3300027360 Ga0209969_1000430 Ga0209969_10004309 87
333 3300027364 Ga0209967_1000417 Ga0209967_10004179 87
334 3300027378 Ga0209981_1001566 Ga0209981_10015662 87
335 3300027395 Ga0209996_1026728 Ga0209996_10267282 87
336 3300027462 Ga0210000_1000446 Ga0210000_10004463 87
337 3300027471 Ga0209995_1000255 Ga0209995_100025510 87
338 3300027543 Ga0209999_1032187 Ga0209999_10321872 87
339 3300027543 Ga0209999_1042378 Ga0209999_10423782 87
340 3300027671 Ga0209588_1259659 Ga0209588_12596592 87
341 3300027682 Ga0209971_1010313 Ga0209971_10103132 87
342 3300027695 Ga0209966_1016285 Ga0209966_10162853 87
343 3300027876 Ga0209974_10001421 Ga0209974_100014215 87
344 3300027907 Ga0207428_10024838 Ga0207428_100248383 87
345 3300031911 Ga0307412_10197098 Ga0307412_101970982 87
346 3300035092 Ga0373952_0001950 Ga0373952_0001950_599_865 87
347 3300035172 Ga0373955_0299717 Ga0373955_0299717_159_422 87
348 3300035172 Ga0373955_0824571 Ga0373955_0824571_29_292 87
349 3300035241 Ga0373961_0050216 Ga0373961_0050216_937_1203 87
350 3300035410 Ga0373924_0221463 Ga0373924_0221463_524_787 87
351 3300035725 Ga0373947_1037173 Ga0373947_1037173_238_501 87
352 3300036401 Ga0373937_0006046 Ga0373937_0006046_745_1008 87
353 3300037068 Ga0373925_1153276 Ga0373925_1153276_126_392 87
354 3300037068 Ga0373925_1537367 Ga0373925_1537367_157_420 87
355 3300042001 Ga0439441_013676 Ga0439441_013676_1137_1400 87
356 3300044712 Ga0453684_1389708 Ga0453684_1389708_21_287 87
357 3300045051 Ga0451576_0311617 Ga0451576_0311617_100_363 87
358 3300046454 Ga0495592_0003821 Ga0495592_0003821_6254_6517 87
359 3300046454 Ga0495592_0551946 Ga0495592_0551946_19_282 87
360 3300046455 Ga0495603_0607940 Ga0495603_0607940_172_435 87
361 3300046461 Ga0495641_0235955 Ga0495641_0235955_519_782 87
362 3300046463 Ga0495653_0132467 Ga0495653_0132467_400_663 87
363 3300046475 Ga0495639_0058813 Ga0495639_0058813_546_809 87
364 3300046476 Ga0495662_0008976 Ga0495662_0008976_1906_2169 87
365 3300046511 Ga0495608_0002044 Ga0495608_0002044_10894_11157 87
366 3300046514 Ga0495618_0022560 Ga0495618_0022560_1234_1497 87
367 3300046516 Ga0495628_0016487 Ga0495628_0016487_88_351 87
368 3300046516 Ga0495628_0453205 Ga0495628_0453205_202_465 87
369 3300046517 Ga0495630_0001185 Ga0495630_0001185_8895_9158 87
370 3300046517 Ga0495630_0039270 Ga0495630_0039270_2029_2292 87
371 3300046526 Ga0495666_0003317 Ga0495666_0003317_7171_7434 87
372 3300046529 Ga0495652_0033401 Ga0495652_0033401_2228_2491 87
373 3300046533 Ga0495640_0000808 Ga0495640_0000808_14187_14450 87
374 3300046533 Ga0495640_0004665 Ga0495640_0004665_8710_8973 87
375 3300046535 Ga0495586_0000440 Ga0495586_0000440_12954_13217 87
376 3300046535 Ga0495586_0028778 Ga0495586_0028778_646_909 87
377 3300046543 Ga0495645_0274616 Ga0495645_0274616_292_555 87
378 3300046559 Ga0495667_0001153 Ga0495667_0001153_2874_3137 87
379 3300046642 Ga0495634_0002587 Ga0495634_0002587_10700_10963 87
380 3300046642 Ga0495634_0091842 Ga0495634_0091842_878_1141 87
381 3300046663 Ga0495635_0097799 Ga0495635_0097799_88_351 87
382 3300046663 Ga0495635_0132240 Ga0495635_0132240_540_803 87
383 3300046678 Ga0495599_0007763 Ga0495599_0007763_5725_5988 87
384 3300046681 Ga0495647_0419253 Ga0495647_0419253_135_398 87
385 3300046683 Ga0495658_0172434 Ga0495658_0172434_216_479 87
386 3300046689 Ga0495613_0025295 Ga0495613_0025295_2138_2401 87
387 3300046690 Ga0495624_0034028 Ga0495624_0034028_1048_1311 87
388 3300046690 Ga0495624_0199350 Ga0495624_0199350_855_1118 87
389 3300046809 Ga0495600_0008016 Ga0495600_0008016_5716_5979 87
390 3300047315 Ga0495581_0175427 Ga0495581_0175427_772_1035 87
391 3300047317 Ga0495604_0002447 Ga0495604_0002447_793_1056 87
392 3300047318 Ga0495636_0133687 Ga0495636_0133687_52_315 87
393 3300047318 Ga0495636_0312728 Ga0495636_0312728_199_462 87
394 3300047318 Ga0495636_0609051 Ga0495636_0609051_66_329 87
395 3300047319 Ga0495674_0123030 Ga0495674_0123030_40_303 87
396 3300047319 Ga0495674_0285677 Ga0495674_0285677_216_479 87
397 3300047322 Ga0495680_0001572 Ga0495680_0001572_12509_12772 87
398 3300047322 Ga0495680_0296405 Ga0495680_0296405_627_890 87
399 3300047444 Ga0495675_0528769 Ga0495675_0528769_279_542 87
400 3300047471 Ga0495684_0018458 Ga0495684_0018458_4031_4294 87
401 3300048089 Ga0495614_0425781 Ga0495614_0425781_58_321 87
402 3300049568 Ga0501031_0283837 Ga0501031_0283837_651_914 87
403 3300049575 Ga0501039_0174792 Ga0501039_0174792_1173_1436 87
404 3300049576 Ga0501040_0016065 Ga0501040_0016065_4155_4418 87
405 3300049576 Ga0501040_0541392 Ga0501040_0541392_315_578 87
406 3300049587 Ga0501071_1107370 Ga0501071_1107370_17_280 87
407 3300049824 Ga0501045_1238818 Ga0501045_1238818_147_410 87
408 3300050494 nmdc:mga06z11_390846_c1 nmdc:mga06z11_390846_c1_19_282 87
409 3300050507 nmdc:mga05p37_1692350_c1 nmdc:mga05p37_1692350_c1_180_443 87
410 3300050507 nmdc:mga05p37_320641_c1 nmdc:mga05p37_320641_c1_576_842 87
411 3300050508 nmdc:mga09592_106007_c1 nmdc:mga09592_106007_c1_556_819 87
412 3300050508 nmdc:mga09592_235628_c1 nmdc:mga09592_235628_c1_1029_1295 87
413 3300050509 nmdc:mga0qj67_248854_c1 nmdc:mga0qj67_248854_c1_374_640 87
414 3300050511 nmdc:mga08y16_115323_c1 nmdc:mga08y16_115323_c1_230_496 87
415 3300050511 nmdc:mga08y16_1301843_c1 nmdc:mga08y16_1301843_c1_225_488 87
416 3300050512 nmdc:mga0n895_1563_c1 nmdc:mga0n895_1563_c1_2797_3060 87
417 3300050513 nmdc:mga0rr50_258537_c1 nmdc:mga0rr50_258537_c1_242_505 87
418 3300053077 Ga0495601_0005497 Ga0495601_0005497_4011_4274 87
419 3300053077 Ga0495601_0083732 Ga0495601_0083732_928_1191 87
420 3300053094 Ga0500566_0122685 Ga0500566_0122685_118_381 87
421 3300005329 Ga0070683_100228472 Ga0070683_1002284722 88
422 3300005439 Ga0070711_101262697 Ga0070711_1012626971 88
423 3300005458 Ga0070681_10338742 Ga0070681_103387422 88
424 3300006846 Ga0075430_100537999 Ga0075430_1005379992 88
425 3300007265 Ga0099794_10421351 Ga0099794_104213512 88
426 3300025912 Ga0207707_10440915 Ga0207707_104409152 88
427 3300025916 Ga0207663_10448430 Ga0207663_104484302 88
428 3300025917 Ga0207660_10626293 Ga0207660_106262932 88
429 3300025944 Ga0207661_10116956 Ga0207661_101169562 88
430 3300026075 Ga0207708_11522484 Ga0207708_115224842 88
431 3300031548 Ga0307408_101637079 Ga0307408_1016370792 88
432 3300035207 Ga0373942_0006452 Ga0373942_0006452_319_585 88
433 3300035410 Ga0373924_0203820 Ga0373924_0203820_86_352 88
434 3300035724 Ga0373933_0202219 Ga0373933_0202219_742_1008 88
435 3300036401 Ga0373937_0193976 Ga0373937_0193976_1508_1774 88
436 3300046462 Ga0495651_0287408 Ga0495651_0287408_200_466 88
437 3300046529 Ga0495652_0180923 Ga0495652_0180923_1078_1344 88
438 3300046559 Ga0495667_0192726 Ga0495667_0192726_899_1165 88
439 3300046675 Ga0495657_0825119 Ga0495657_0825119_66_332 88
440 3300047317 Ga0495604_0134414 Ga0495604_0134414_772_1038 88
441 3300049581 Ga0501047_0875526 Ga0501047_0875526_391_660 88
442 3300049585 Ga0501069_0890123 Ga0501069_0890123_122_388 88
443 3300049593 Ga0501077_0312874 Ga0501077_0312874_403_669 88
444 3300049742 Ga0501080_1221096 Ga0501080_1221096_187_456 88
445 3300050509 nmdc:mga0qj67_512293_c1 nmdc:mga0qj67_512293_c1_587_853 88
446 3300053077 Ga0495601_0630251 Ga0495601_0630251_387_653 88
447 3300059426 Ga0590077_050692 Ga0590077_050692_535_801 88
448 3300005290 Ga0065712_10380110 Ga0065712_103801103 89
449 3300005331 Ga0070670_100290586 Ga0070670_1002905862 89
450 3300005331 Ga0070670_101506574 Ga0070670_1015065741 89
451 3300005336 Ga0070680_100189194 Ga0070680_1001891944 89
452 3300005340 Ga0070689_100357767 Ga0070689_1003577672 89
453 3300005340 Ga0070689_101641949 Ga0070689_1016419492 89
454 3300005468 Ga0070707_100753833 Ga0070707_1007538331 89
455 3300005544 Ga0070686_100969123 Ga0070686_1009691232 89
456 3300005546 Ga0070696_100717106 Ga0070696_1007171061 89
457 3300006846 Ga0075430_100341025 Ga0075430_1003410254 89
458 3300006847 Ga0075431_100016437 Ga0075431_10001643710 89
459 3300006852 Ga0075433_11086754 Ga0075433_110867542 89
460 3300006871 Ga0075434_100000011 Ga0075434_10000001142 89
461 3300006880 Ga0075429_100226541 Ga0075429_1002265412 89
462 3300006914 Ga0075436_100504715 Ga0075436_1005047152 89
463 3300007076 Ga0075435_100029181 Ga0075435_1000291815 89
464 3300009094 Ga0111539_10150838 Ga0111539_101508383 89
465 3300009094 Ga0111539_10958092 Ga0111539_109580923 89
466 3300009147 Ga0114129_11444908 Ga0114129_114449083 89
467 3300013308 Ga0157375_11045777 Ga0157375_110457771 89
468 3300014326 Ga0157380_10907627 Ga0157380_109076271 89
469 3300025901 Ga0207688_10740502 Ga0207688_107405021 89
470 3300025920 Ga0207649_11439209 Ga0207649_114392091 89
471 3300025922 Ga0207646_10663526 Ga0207646_106635261 89
472 3300025925 Ga0207650_11534089 Ga0207650_115340891 89
473 3300025936 Ga0207670_11394570 Ga0207670_113945702 89
474 3300025938 Ga0207704_11779416 Ga0207704_117794161 89
475 3300027360 Ga0209969_1003617 Ga0209969_10036174 89
476 3300027378 Ga0209981_1021781 Ga0209981_10217812 89
477 3300027462 Ga0210000_1042787 Ga0210000_10427872 89
478 3300027526 Ga0209968_1065309 Ga0209968_10653092 89
479 3300027876 Ga0209974_10032169 Ga0209974_100321693 89
480 3300031548 Ga0307408_100164000 Ga0307408_1001640002 89
481 3300031548 Ga0307408_100759153 Ga0307408_1007591532 89
482 3300031731 Ga0307405_10174146 Ga0307405_101741462 89
483 3300032002 Ga0307416_100343938 Ga0307416_1003439382 89
484 3300032005 Ga0307411_11147741 Ga0307411_111477412 89
485 3300035084 Ga0373928_0176903 Ga0373928_0176903_227_496 89
486 3300041410 Ga0439461_0002213 Ga0439461_0002213_1850_2119 89
487 3300042156 Ga0439446_0000176 Ga0439446_0000176_6382_6651 89
488 3300042435 Ga0439434_0001633 Ga0439434_0001633_4638_4907 89
489 3300042436 Ga0439435_0000026 Ga0439435_0000026_212_481 89
490 3300046537 Ga0495598_0295255 Ga0495598_0295255_97_375 89
491 3300048903 Ga0496100_0285861 Ga0496100_0285861_327_596 89
492 3300048904 Ga0496101_0367531 Ga0496101_0367531_760_1029 89
493 3300048907 Ga0496104_0797108 Ga0496104_0797108_211_480 89
494 3300048909 Ga0496106_0074134 Ga0496106_0074134_1887_2156 89
495 3300048917 Ga0496114_0093146 Ga0496114_0093146_1651_1920 89
496 3300049572 Ga0501036_1198192 Ga0501036_1198192_200_469 89
497 3300049582 Ga0501048_1283986 Ga0501048_1283986_51_320 89
498 3300049592 Ga0501076_0224034 Ga0501076_0224034_409_678 89
499 3300050508 nmdc:mga09592_103435_c1 nmdc:mga09592_103435_c1_289_558 89
500 3300050509 nmdc:mga0qj67_408212_c1 nmdc:mga0qj67_408212_c1_674_943 89
501 3300050510 nmdc:mga06r32_1679372_c1 nmdc:mga06r32_1679372_c1_25_303 89
502 3300050510 nmdc:mga06r32_7083_c1 nmdc:mga06r32_7083_c1_2945_3214 89
503 3300050511 nmdc:mga08y16_117352_c1 nmdc:mga08y16_117352_c1_1828_2097 89
504 3300050511 nmdc:mga08y16_1772955_c1 nmdc:mga08y16_1772955_c1_10_279 89
505 3300050512 nmdc:mga0n895_1336_c1 nmdc:mga0n895_1336_c1_14844_15113 89
506 3300050513 nmdc:mga0rr50_35369_c1 nmdc:mga0rr50_35369_c1_1996_2265 89
507 3300050514 nmdc:mga08x19_670353_c1 nmdc:mga08x19_670353_c1_86_355 89
508 3300060353 Ga0501082_0336784 Ga0501082_0336784_936_1205 89
509 3300003203 JGI25406J46586_10035649 JGI25406J46586_100356491 90
510 3300003322 rootL2_10010637 rootL2_100106376 90
511 3300003323 rootH1_10178713 rootH1_101787132 90
512 3300003763 Ga0055529_1000015 Ga0055529_1000015171 90
513 3300005328 Ga0070676_10759131 Ga0070676_107591311 90
514 3300005329 Ga0070683_101622413 Ga0070683_1016224132 90
515 3300005330 Ga0070690_101016336 Ga0070690_1010163362 90
516 3300005336 Ga0070680_100061318 Ga0070680_1000613182 90
517 3300005338 Ga0068868_101098168 Ga0068868_1010981682 90
518 3300005338 Ga0068868_101890732 Ga0068868_1018907322 90
519 3300005340 Ga0070689_100727136 Ga0070689_1007271361 90
520 3300005343 Ga0070687_100128970 Ga0070687_1001289702 90
521 3300005343 Ga0070687_100673294 Ga0070687_1006732942 90
522 3300005345 Ga0070692_10779827 Ga0070692_107798272 90
523 3300005353 Ga0070669_101040733 Ga0070669_1010407332 90
524 3300005354 Ga0070675_100345976 Ga0070675_1003459762 90
525 3300005354 Ga0070675_100705968 Ga0070675_1007059682 90
526 3300005354 Ga0070675_101221138 Ga0070675_1012211382 90
527 3300005356 Ga0070674_100664544 Ga0070674_1006645442 90
528 3300005364 Ga0070673_100467413 Ga0070673_1004674132 90
529 3300005364 Ga0070673_100765611 Ga0070673_1007656112 90
530 3300005365 Ga0070688_100033844 Ga0070688_1000338445 90
531 3300005406 Ga0070703_10142223 Ga0070703_101422232 90
532 3300005434 Ga0070709_10519574 Ga0070709_105195742 90
533 3300005435 Ga0070714_100011982 Ga0070714_1000119826 90
534 3300005436 Ga0070713_100399710 Ga0070713_1003997102 90
535 3300005436 Ga0070713_102422813 Ga0070713_1024228132 90
536 3300005438 Ga0070701_10130788 Ga0070701_101307882 90
537 3300005440 Ga0070705_100027892 Ga0070705_1000278925 90
538 3300005440 Ga0070705_100075566 Ga0070705_1000755662 90
539 3300005440 Ga0070705_100721539 Ga0070705_1007215392 90
540 3300005440 Ga0070705_101319470 Ga0070705_1013194701 90
541 3300005441 Ga0070700_100216498 Ga0070700_1002164982 90
542 3300005441 Ga0070700_100263736 Ga0070700_1002637361 90
543 3300005441 Ga0070700_100721722 Ga0070700_1007217222 90
544 3300005444 Ga0070694_100017277 Ga0070694_1000172773 90
545 3300005444 Ga0070694_100057979 Ga0070694_1000579793 90
546 3300005444 Ga0070694_100077882 Ga0070694_1000778823 90
547 3300005444 Ga0070694_100266507 Ga0070694_1002665072 90
548 3300005444 Ga0070694_100391685 Ga0070694_1003916853 90
549 3300005444 Ga0070694_101758613 Ga0070694_1017586132 90
550 3300005445 Ga0070708_101631857 Ga0070708_1016318571 90
551 3300005458 Ga0070681_10000399 Ga0070681_100003996 90
552 3300005459 Ga0068867_100846461 Ga0068867_1008464612 90
553 3300005468 Ga0070707_101083333 Ga0070707_1010833332 90
554 3300005471 Ga0070698_100162623 Ga0070698_1001626232 90
555 3300005518 Ga0070699_100015187 Ga0070699_1000151872 90
556 3300005518 Ga0070699_100102761 Ga0070699_1001027614 90
557 3300005530 Ga0070679_101063904 Ga0070679_1010639042 90
558 3300005535 Ga0070684_100874045 Ga0070684_1008740452 90
559 3300005536 Ga0070697_100000648 Ga0070697_1000006484 90
560 3300005536 Ga0070697_100663479 Ga0070697_1006634791 90
561 3300005536 Ga0070697_101303123 Ga0070697_1013031232 90
562 3300005543 Ga0070672_100786395 Ga0070672_1007863952 90
563 3300005544 Ga0070686_100227621 Ga0070686_1002276212 90
564 3300005544 Ga0070686_100625088 Ga0070686_1006250882 90
565 3300005545 Ga0070695_100000362 Ga0070695_10000036222 90
566 3300005545 Ga0070695_100164586 Ga0070695_1001645862 90
567 3300005545 Ga0070695_100831223 Ga0070695_1008312232 90
568 3300005545 Ga0070695_101127588 Ga0070695_1011275882 90
569 3300005545 Ga0070695_101616568 Ga0070695_1016165681 90
570 3300005546 Ga0070696_100002485 Ga0070696_10000248512 90
571 3300005546 Ga0070696_100471717 Ga0070696_1004717172 90
572 3300005546 Ga0070696_100603027 Ga0070696_1006030271 90
573 3300005547 Ga0070693_100168146 Ga0070693_1001681462 90
574 3300005549 Ga0070704_100009024 Ga0070704_1000090243 90
575 3300005549 Ga0070704_100025353 Ga0070704_1000253533 90
576 3300005549 Ga0070704_100623839 Ga0070704_1006238392 90
577 3300005549 Ga0070704_100791533 Ga0070704_1007915331 90
578 3300005577 Ga0068857_102182359 Ga0068857_1021823592 90
579 3300005578 Ga0068854_102014307 Ga0068854_1020143072 90
580 3300005615 Ga0070702_100018216 Ga0070702_1000182162 90
581 3300005615 Ga0070702_100239864 Ga0070702_1002398642 90
582 3300005617 Ga0068859_101070061 Ga0068859_1010700612 90
583 3300005719 Ga0068861_100128148 Ga0068861_1001281482 90
584 3300005840 Ga0068870_10492096 Ga0068870_104920962 90
585 3300005842 Ga0068858_101160466 Ga0068858_1011604662 90
586 3300005981 Ga0081538_10152692 Ga0081538_101526922 90
587 3300005985 Ga0081539_10000686 Ga0081539_1000068657 90
588 3300006173 Ga0070716_100101869 Ga0070716_1001018692 90
589 3300006173 Ga0070716_100445383 Ga0070716_1004453831 90
590 3300006358 Ga0068871_101409027 Ga0068871_1014090272 90
591 3300006844 Ga0075428_100214190 Ga0075428_1002141903 90
592 3300006844 Ga0075428_100456878 Ga0075428_1004568782 90
593 3300006846 Ga0075430_100000550 Ga0075430_1000005508 90
594 3300006846 Ga0075430_100007696 Ga0075430_1000076965 90
595 3300006846 Ga0075430_100189368 Ga0075430_1001893683 90
596 3300006846 Ga0075430_100483458 Ga0075430_1004834582 90
597 3300006846 Ga0075430_100776711 Ga0075430_1007767112 90
598 3300006846 Ga0075430_100852917 Ga0075430_1008529172 90
599 3300006847 Ga0075431_100353925 Ga0075431_1003539253 90
600 3300006847 Ga0075431_100397211 Ga0075431_1003972112 90
601 3300006847 Ga0075431_100443596 Ga0075431_1004435962 90
602 3300006847 Ga0075431_100522127 Ga0075431_1005221272 90
603 3300006847 Ga0075431_100656026 Ga0075431_1006560262 90
604 3300006852 Ga0075433_10164444 Ga0075433_101644443 90
605 3300006871 Ga0075434_100266698 Ga0075434_1002666983 90
606 3300006880 Ga0075429_100069548 Ga0075429_1000695482 90
607 3300006880 Ga0075429_100072951 Ga0075429_1000729513 90
608 3300006880 Ga0075429_101344870 Ga0075429_1013448702 90
609 3300006914 Ga0075436_100004494 Ga0075436_1000044948 90
610 3300006914 Ga0075436_100014323 Ga0075436_1000143236 90
611 3300006914 Ga0075436_100042934 Ga0075436_1000429343 90
612 3300006914 Ga0075436_100164546 Ga0075436_1001645463 90
613 3300006914 Ga0075436_100166596 Ga0075436_1001665962 90
614 3300006914 Ga0075436_100606801 Ga0075436_1006068012 90
615 3300006931 Ga0097620_101070087 Ga0097620_1010700872 90
616 3300007076 Ga0075435_100060020 Ga0075435_1000600204 90
617 3300007076 Ga0075435_100129605 Ga0075435_1001296052 90
618 3300007076 Ga0075435_100723078 Ga0075435_1007230782 90
619 3300007265 Ga0099794_10022481 Ga0099794_100224814 90
620 3300007265 Ga0099794_10415968 Ga0099794_104159681 90
621 3300009094 Ga0111539_10016381 Ga0111539_100163815 90
622 3300009094 Ga0111539_10039269 Ga0111539_100392695 90
623 3300009094 Ga0111539_10070916 Ga0111539_100709165 90
624 3300009094 Ga0111539_11783976 Ga0111539_117839762 90
625 3300009094 Ga0111539_13494213 Ga0111539_134942132 90
626 3300009098 Ga0105245_11176772 Ga0105245_111767722 90
627 3300009147 Ga0114129_10961706 Ga0114129_109617062 90
628 3300009147 Ga0114129_11193197 Ga0114129_111931972 90
629 3300009147 Ga0114129_12507585 Ga0114129_125075852 90
630 3300009147 Ga0114129_12724503 Ga0114129_127245031 90
631 3300009148 Ga0105243_10010536 Ga0105243_100105363 90
632 3300009176 Ga0105242_10372148 Ga0105242_103721482 90
633 3300009553 Ga0105249_10004477 Ga0105249_1000447710 90
634 3300009553 Ga0105249_12614768 Ga0105249_126147682 90
635 3300013297 Ga0157378_12532270 Ga0157378_125322702 90
636 3300013306 Ga0163162_10757695 Ga0163162_107576952 90
637 3300013307 Ga0157372_10357574 Ga0157372_103575742 90
638 3300014326 Ga0157380_10001505 Ga0157380_1000150510 90
639 3300014745 Ga0157377_10065103 Ga0157377_100651033 90
640 3300025233 Ga0209437_119409 Ga0209437_1194092 90
641 3300025272 Ga0209455_1000031 Ga0209455_1000031172 90
642 3300025901 Ga0207688_10030324 Ga0207688_100303242 90
643 3300025907 Ga0207645_10263795 Ga0207645_102637952 90
644 3300025907 Ga0207645_10270574 Ga0207645_102705742 90
645 3300025908 Ga0207643_10428606 Ga0207643_104286062 90
646 3300025912 Ga0207707_10003163 Ga0207707_1000316316 90
647 3300025912 Ga0207707_10651865 Ga0207707_106518652 90
648 3300025917 Ga0207660_10720685 Ga0207660_107206852 90
649 3300025917 Ga0207660_10863670 Ga0207660_108636702 90
650 3300025918 Ga0207662_10129249 Ga0207662_101292493 90
651 3300025918 Ga0207662_10543112 Ga0207662_105431122 90
652 3300025922 Ga0207646_10404443 Ga0207646_104044432 90
653 3300025926 Ga0207659_10068577 Ga0207659_100685772 90
654 3300025926 Ga0207659_11884448 Ga0207659_118844482 90
655 3300025927 Ga0207687_11552174 Ga0207687_115521741 90
656 3300025928 Ga0207700_10760973 Ga0207700_107609732 90
657 3300025929 Ga0207664_10398785 Ga0207664_103987852 90
658 3300025936 Ga0207670_10352382 Ga0207670_103523822 90
659 3300025937 Ga0207669_10659205 Ga0207669_106592052 90
660 3300025939 Ga0207665_10132548 Ga0207665_101325481 90
661 3300025939 Ga0207665_10317248 Ga0207665_103172482 90
662 3300025942 Ga0207689_10562218 Ga0207689_105622182 90
663 3300025944 Ga0207661_11151068 Ga0207661_111510682 90
664 3300025960 Ga0207651_10251540 Ga0207651_102515402 90
665 3300025972 Ga0207668_11245685 Ga0207668_112456851 90
666 3300026023 Ga0207677_10335847 Ga0207677_103358473 90
667 3300026023 Ga0207677_10919033 Ga0207677_109190332 90
668 3300026075 Ga0207708_10113450 Ga0207708_101134503 90
669 3300026075 Ga0207708_10354104 Ga0207708_103541042 90
670 3300026075 Ga0207708_11288530 Ga0207708_112885302 90
671 3300026075 Ga0207708_11779641 Ga0207708_117796411 90
672 3300026089 Ga0207648_11126314 Ga0207648_111263141 90
673 3300026089 Ga0207648_12189534 Ga0207648_121895342 90
674 3300026116 Ga0207674_10159116 Ga0207674_101591161 90
675 3300026118 Ga0207675_100654318 Ga0207675_1006543182 90
676 3300027360 Ga0209969_1001086 Ga0209969_10010863 90
677 3300027360 Ga0209969_1016600 Ga0209969_10166002 90
678 3300027364 Ga0209967_1001327 Ga0209967_10013272 90
679 3300027364 Ga0209967_1003025 Ga0209967_10030253 90
680 3300027378 Ga0209981_1001444 Ga0209981_10014445 90
681 3300027378 Ga0209981_1010103 Ga0209981_10101031 90
682 3300027395 Ga0209996_1060653 Ga0209996_10606532 90
683 3300027462 Ga0210000_1001892 Ga0210000_10018923 90
684 3300027462 Ga0210000_1002212 Ga0210000_10022122 90
685 3300027471 Ga0209995_1001597 Ga0209995_10015974 90
686 3300027471 Ga0209995_1007282 Ga0209995_10072823 90
687 3300027471 Ga0209995_1028014 Ga0209995_10280142 90
688 3300027526 Ga0209968_1002375 Ga0209968_10023753 90
689 3300027526 Ga0209968_1003221 Ga0209968_10032211 90
690 3300027526 Ga0209968_1018430 Ga0209968_10184302 90
691 3300027543 Ga0209999_1000334 Ga0209999_10003342 90
692 3300027543 Ga0209999_1007955 Ga0209999_10079552 90
693 3300027665 Ga0209983_1052129 Ga0209983_10521292 90
694 3300027671 Ga0209588_1045166 Ga0209588_10451662 90
695 3300027682 Ga0209971_1007609 Ga0209971_10076093 90
696 3300027695 Ga0209966_1005660 Ga0209966_10056603 90
697 3300027717 Ga0209998_10031398 Ga0209998_100313981 90
698 3300027876 Ga0209974_10009715 Ga0209974_100097153 90
699 3300027876 Ga0209974_10169376 Ga0209974_101693762 90
700 3300027907 Ga0207428_10062422 Ga0207428_100624223 90
701 3300027907 Ga0207428_10214049 Ga0207428_102140493 90
702 3300027907 Ga0207428_10534253 Ga0207428_105342532 90
703 3300028380 Ga0268265_10551255 Ga0268265_105512553 90
704 3300028381 Ga0268264_10231781 Ga0268264_102317813 90
705 3300031548 Ga0307408_100481287 Ga0307408_1004812872 90
706 3300031548 Ga0307408_101274824 Ga0307408_1012748241 90
707 3300031548 Ga0307408_101627004 Ga0307408_1016270042 90
708 3300031852 Ga0307410_11808088 Ga0307410_118080882 90
709 3300031901 Ga0307406_10641146 Ga0307406_106411462 90
710 3300031903 Ga0307407_10873038 Ga0307407_108730382 90
711 3300031911 Ga0307412_10106667 Ga0307412_101066673 90
712 3300031911 Ga0307412_10733636 Ga0307412_107336362 90
713 3300031911 Ga0307412_10972524 Ga0307412_109725242 90
714 3300031995 Ga0307409_102277653 Ga0307409_1022776532 90
715 3300032002 Ga0307416_100183675 Ga0307416_1001836753 90
716 3300032002 Ga0307416_100474965 Ga0307416_1004749651 90
717 3300032002 Ga0307416_101611686 Ga0307416_1016116862 90
718 3300032002 Ga0307416_101652519 Ga0307416_1016525192 90
719 3300032005 Ga0307411_10349598 Ga0307411_103495983 90
720 3300032005 Ga0307411_10466326 Ga0307411_104663262 90
721 3300032005 Ga0307411_10887640 Ga0307411_108876402 90
722 3300032005 Ga0307411_11016350 Ga0307411_110163502 90
723 3300032005 Ga0307411_11583439 Ga0307411_115834391 90
724 3300032005 Ga0307411_11747277 Ga0307411_117472772 90
725 3300034957 Ga0373938_0077990 Ga0373938_0077990_243_515 90
726 3300035084 Ga0373928_0033048 Ga0373928_0033048_396_668 90
727 3300035085 Ga0373929_0110196 Ga0373929_0110196_340_612 90
728 3300035085 Ga0373929_0234115 Ga0373929_0234115_63_335 90
729 3300035086 Ga0373934_0018623 Ga0373934_0018623_111_383 90
730 3300035088 Ga0373940_0242819 Ga0373940_0242819_181_453 90
731 3300035091 Ga0373951_0187381 Ga0373951_0187381_29_301 90
732 3300035092 Ga0373952_0163933 Ga0373952_0163933_19_291 90
733 3300035111 Ga0373923_0079537 Ga0373923_0079537_371_643 90
734 3300035112 Ga0373932_0231573 Ga0373932_0231573_134_406 90
735 3300035113 Ga0373936_0252223 Ga0373936_0252223_225_497 90
736 3300035114 Ga0373939_0136570 Ga0373939_0136570_68_340 90
737 3300035118 Ga0373954_0000002 Ga0373954_0000002_63290_63562 90
738 3300035119 Ga0373956_0173831 Ga0373956_0173831_283_555 90
739 3300035121 Ga0373960_0221428 Ga0373960_0221428_58_330 90
740 3300035170 Ga0373943_0885911 Ga0373943_0885911_68_340 90
741 3300035172 Ga0373955_0083592 Ga0373955_0083592_848_1120 90
742 3300035242 Ga0373962_0063589 Ga0373962_0063589_504_776 90
743 3300035410 Ga0373924_0084250 Ga0373924_0084250_702_974 90
744 3300035691 Ga0373931_0120090 Ga0373931_0120090_882_1154 90
745 3300035691 Ga0373931_0441787 Ga0373931_0441787_340_612 90
746 3300035724 Ga0373933_0000657 Ga0373933_0000657_18341_18613 90
747 3300036401 Ga0373937_0000358 Ga0373937_0000358_25844_26116 90
748 3300037068 Ga0373925_1193750 Ga0373925_1193750_93_365 90
749 3300041496 Ga0451839_1400463 Ga0451839_1400463_649_921 90
750 3300041501 Ga0451845_0711978 Ga0451845_0711978_105_419 90
751 3300042001 Ga0439441_002685 Ga0439441_002685_2202_2474 90
752 3300042003 Ga0439443_012970 Ga0439443_012970_835_1107 90
753 3300042011 Ga0439454_015792 Ga0439454_015792_96_368 90
754 3300042013 Ga0439456_014934 Ga0439456_014934_1100_1372 90
755 3300042016 Ga0439463_145298 Ga0439463_145298_37_309 90
756 3300042126 Ga0450888_080082 Ga0450888_080082_168_440 90
757 3300042147 Ga0450910_040851 Ga0450910_040851_173_445 90
758 3300042435 Ga0439434_0063431 Ga0439434_0063431_588_860 90
759 3300042437 Ga0439444_0003007 Ga0439444_0003007_504_776 90
760 3300042439 Ga0439464_0069306 Ga0439464_0069306_345_617 90
761 3300042461 Ga0439460_0044333 Ga0439460_0044333_371_643 90
762 3300042531 Ga0450918_100795 Ga0450918_100795_246_518 90
763 3300042876 Ga0451577_0470068 Ga0451577_0470068_411_683 90
764 3300044683 Ga0466965_0165682 Ga0466965_0165682_26_298 90
765 3300044694 Ga0466963_0049527 Ga0466963_0049527_1065_1340 90
766 3300044706 Ga0466964_0004501 Ga0466964_0004501_163_438 90
767 3300044706 Ga0466964_0339405 Ga0466964_0339405_41_313 90
768 3300045051 Ga0451576_0146167 Ga0451576_0146167_2146_2418 90
769 3300045051 Ga0451576_2583611 Ga0451576_2583611_80_352 90
770 3300045836 Ga0466958_0145560 Ga0466958_0145560_678_953 90
771 3300045976 Ga0466967_0020049 Ga0466967_0020049_1824_2099 90
772 3300046462 Ga0495651_0279044 Ga0495651_0279044_241_513 90
773 3300046491 Ga0495584_0072974 Ga0495584_0072974_948_1220 90
774 3300046511 Ga0495608_0418106 Ga0495608_0418106_158_430 90
775 3300046528 Ga0495642_0199025 Ga0495642_0199025_559_831 90
776 3300046528 Ga0495642_0257853 Ga0495642_0257853_26_298 90
777 3300046537 Ga0495598_0103180 Ga0495598_0103180_261_533 90
778 3300046537 Ga0495598_0163324 Ga0495598_0163324_497_769 90
779 3300046539 Ga0495621_0029158 Ga0495621_0029158_408_680 90
780 3300046539 Ga0495621_0058828 Ga0495621_0058828_463_735 90
781 3300046558 Ga0495633_0375027 Ga0495633_0375027_129_434 90
782 3300046559 Ga0495667_0230699 Ga0495667_0230699_897_1169 90
783 3300046664 Ga0495659_0051963 Ga0495659_0051963_558_830 90
784 3300046675 Ga0495657_0302645 Ga0495657_0302645_265_537 90
785 3300046684 Ga0495669_0004311 Ga0495669_0004311_1282_1554 90
786 3300047318 Ga0495636_0699755 Ga0495636_0699755_45_317 90
787 3300047444 Ga0495675_0319881 Ga0495675_0319881_84_356 90
788 3300049514 Ga0501291_091408 Ga0501291_091408_218_490 90
789 3300049515 Ga0501292_036836 Ga0501292_036836_35_307 90
790 3300049519 Ga0501296_013948 Ga0501296_013948_564_836 90
791 3300049519 Ga0501296_045493 Ga0501296_045493_20_292 90
792 3300049521 Ga0501298_014855 Ga0501298_014855_314_586 90
793 3300049522 Ga0501299_005994 Ga0501299_005994_1472_1744 90
794 3300049522 Ga0501299_021606 Ga0501299_021606_712_984 90
795 3300049522 Ga0501299_172976 Ga0501299_172976_162_434 90
796 3300049568 Ga0501031_0837714 Ga0501031_0837714_186_458 90
797 3300049569 Ga0501032_0400987 Ga0501032_0400987_83_355 90
798 3300049573 Ga0501037_0481448 Ga0501037_0481448_138_410 90
799 3300049574 Ga0501038_0427688 Ga0501038_0427688_605_877 90
800 3300049575 Ga0501039_0085414 Ga0501039_0085414_2099_2371 90
801 3300049575 Ga0501039_0344457 Ga0501039_0344457_24_296 90
802 3300049576 Ga0501040_1325192 Ga0501040_1325192_65_337 90
803 3300049577 Ga0501041_0767380 Ga0501041_0767380_116_391 90
804 3300049578 Ga0501042_0341249 Ga0501042_0341249_40_312 90
805 3300049578 Ga0501042_1199542 Ga0501042_1199542_40_312 90
806 3300049578 Ga0501042_1367739 Ga0501042_1367739_36_308 90
807 3300049579 Ga0501043_0238284 Ga0501043_0238284_811_1083 90
808 3300049582 Ga0501048_0762931 Ga0501048_0762931_50_322 90
809 3300049584 Ga0501068_0258697 Ga0501068_0258697_16_288 90
810 3300049584 Ga0501068_1186248 Ga0501068_1186248_179_451 90
811 3300049585 Ga0501069_0086665 Ga0501069_0086665_946_1218 90
812 3300049585 Ga0501069_0106646 Ga0501069_0106646_1246_1518 90
813 3300049587 Ga0501071_0264776 Ga0501071_0264776_586_864 90
814 3300049587 Ga0501071_0574110 Ga0501071_0574110_547_822 90
815 3300049587 Ga0501071_0667808 Ga0501071_0667808_505_777 90
816 3300049587 Ga0501071_1191915 Ga0501071_1191915_181_453 90
817 3300049587 Ga0501071_1448855 Ga0501071_1448855_94_366 90
818 3300049588 Ga0501072_0060734 Ga0501072_0060734_1631_1903 90
819 3300049588 Ga0501072_0328206 Ga0501072_0328206_467_742 90
820 3300049588 Ga0501072_1019118 Ga0501072_1019118_336_608 90
821 3300049589 Ga0501073_1257108 Ga0501073_1257108_197_469 90
822 3300049590 Ga0501074_0983563 Ga0501074_0983563_297_575 90
823 3300049591 Ga0501075_0161351 Ga0501075_0161351_1335_1607 90
824 3300049592 Ga0501076_0980119 Ga0501076_0980119_326_598 90
825 3300049660 Ga0501216_057812 Ga0501216_057812_457_729 90
826 3300049661 Ga0501217_212610 Ga0501217_212610_306_578 90
827 3300049668 Ga0501233_018696 Ga0501233_018696_230_502 90
828 3300049686 Ga0501257_132602 Ga0501257_132602_306_578 90
829 3300049742 Ga0501080_0465462 Ga0501080_0465462_270_542 90
830 3300049743 Ga0501081_1124917 Ga0501081_1124917_10_282 90
831 3300049779 Ga0501283_012493 Ga0501283_012493_458_730 90
832 3300049822 Ga0501035_0344705 Ga0501035_0344705_911_1183 90
833 3300049824 Ga0501045_0245273 Ga0501045_0245273_635_907 90
834 3300049824 Ga0501045_0611365 Ga0501045_0611365_216_494 90
835 3300049824 Ga0501045_1167805 Ga0501045_1167805_106_378 90
836 3300050507 nmdc:mga05p37_1264825_c1 nmdc:mga05p37_1264825_c1_146_418 90
837 3300050507 nmdc:mga05p37_1668226_c1 nmdc:mga05p37_1668226_c1_29_301 90
838 3300050507 nmdc:mga05p37_1796511_c1 nmdc:mga05p37_1796511_c1_83_355 90
839 3300050507 nmdc:mga05p37_1807699_c1 nmdc:mga05p37_1807699_c1_274_546 90
840 3300050508 nmdc:mga09592_1741425_c1 nmdc:mga09592_1741425_c1_139_411 90
841 3300050508 nmdc:mga09592_81062_c1 nmdc:mga09592_81062_c1_2285_2557 90
842 3300050509 nmdc:mga0qj67_207274_c1 nmdc:mga0qj67_207274_c1_883_1155 90
843 3300050509 nmdc:mga0qj67_271612_c1 nmdc:mga0qj67_271612_c1_185_457 90
844 3300050509 nmdc:mga0qj67_52148_c1 nmdc:mga0qj67_52148_c1_2603_2875 90
845 3300050509 nmdc:mga0qj67_623_c1 nmdc:mga0qj67_623_c1_11719_11991 90
846 3300050510 nmdc:mga06r32_133999_c1 nmdc:mga06r32_133999_c1_887_1159 90
847 3300050510 nmdc:mga06r32_1401902_c1 nmdc:mga06r32_1401902_c1_207_479 90
848 3300050510 nmdc:mga06r32_513920_c1 nmdc:mga06r32_513920_c1_564_836 90
849 3300050510 nmdc:mga06r32_58630_c1 nmdc:mga06r32_58630_c1_3389_3661 90
850 3300050511 nmdc:mga08y16_124404_c1 nmdc:mga08y16_124404_c1_1153_1425 90
851 3300050511 nmdc:mga08y16_26333_c1 nmdc:mga08y16_26333_c1_3984_4256 90
852 3300050511 nmdc:mga08y16_36047_c1 nmdc:mga08y16_36047_c1_716_988 90
853 3300050511 nmdc:mga08y16_419359_c1 nmdc:mga08y16_419359_c1_717_989 90
854 3300050512 nmdc:mga0n895_1176724_c1 nmdc:mga0n895_1176724_c1_162_434 90
855 3300050512 nmdc:mga0n895_6387_c1 nmdc:mga0n895_6387_c1_8000_8272 90
856 3300050513 nmdc:mga0rr50_1001979_c1 nmdc:mga0rr50_1001979_c1_19_291 90
857 3300050513 nmdc:mga0rr50_1230403_c1 nmdc:mga0rr50_1230403_c1_112_384 90
858 3300050513 nmdc:mga0rr50_1308241_c1 nmdc:mga0rr50_1308241_c1_136_408 90
859 3300050513 nmdc:mga0rr50_170783_c1 nmdc:mga0rr50_170783_c1_1153_1425 90
860 3300050514 nmdc:mga08x19_142786_c1 nmdc:mga08x19_142786_c1_958_1230 90
861 3300050514 nmdc:mga08x19_22439_c1 nmdc:mga08x19_22439_c1_2299_2571 90
862 3300050514 nmdc:mga08x19_23150_c1 nmdc:mga08x19_23150_c1_1960_2232 90
863 3300050514 nmdc:mga08x19_263437_c1 nmdc:mga08x19_263437_c1_748_1020 90
864 3300050514 nmdc:mga08x19_513020_c1 nmdc:mga08x19_513020_c1_236_508 90
865 3300050514 nmdc:mga08x19_55_c1 nmdc:mga08x19_55_c1_83796_84068 90
866 3300050515 nmdc:mga0a205_283089_c1 nmdc:mga0a205_283089_c1_942_1214 90
867 3300050515 nmdc:mga0a205_38464_c1 nmdc:mga0a205_38464_c1_527_799 90
868 3300054114 Ga0501084_0616219 Ga0501084_0616219_377_649 90
869 3300054114 Ga0501084_1292809 Ga0501084_1292809_171_449 90
870 3300060353 Ga0501082_1618964 Ga0501082_1618964_36_308 90

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04359

DUF493

Protein of unknown function (DUF493)

16

97

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wo1-assembly1.cif.gz_B hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit 0.8812 14 90
6lxg-assembly1.cif.gz_B nmr solution structure of regulatory act domain of the mycobacterium tuberculosis rel protein 0.8741 14 90
5iqr-assembly1.cif.gz_8 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8718 15 90
2pc6-assembly1.cif.gz_A crystal structure of putative acetolactate synthase- small subunit from nitrosomonas europaea 0.869 14 90
6u9h-assembly1.cif.gz_G arabidopsis thaliana acetohydroxyacid synthase complex 0.8664 15 90
ID Description Score Start End Superfamily
af_P0AG20_664_743_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9014 14 90 3.30.70.260
af_C6TJY5_99_186_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8993 12 90 3.30.70.260
af_Q2FXU1_650_729_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8985 14 90 3.30.70.260
af_Q2FWK5_1_78_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8947 14 90 3.30.70.260
af_P0AG24_623_702_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8929 14 90 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A521Z5A2-F1-model_v4 DUF493 domain-containing protein 1.001 22 90 GO:0005829
AF-A0A3N5WDV4-F1-model_v4 UPF0250 protein EHM16_10515 0.9919 10 90 GO:0005829
AF-I3CC02-F1-model_v4 UPF0250 protein BegalDRAFT_0223 0.9908 12 90 GO:0005829
AF-A0A7Y3JXD7-F1-model_v4 UPF0250 protein HKM01_02850 0.9903 12 90 GO:0005829
AF-A0A351MCM8-F1-model_v4 DUF493 domain-containing protein 0.9896 12 90 GO:0005829

Feature Viewer

pLDDT pTM Quality
85.38 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map