F484146
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 870 | 271 | 870 | 172 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10421235|Ga0105245_104212353 |
| Length | 188 |
| Sequence | MKQGESQPGRWKEKTMLTKSRTIVIAAALSFLAVAATSAAAQNRATDFSLRSVDGDAVTAESLRGEVAVLAFGKAWLPLTRNQLEGVKKLADDYSGRGVVVYWVSTDSDSPKSKAYASDEELRALARKYKVTVLRDPDGAVSKKLGVDQLPSVVIFDKQGNVSGGPIGGLDPTANLATQLSARLDKIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001426 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 178 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 180 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 181 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 182 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 183 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 184 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 186 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 195 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 196 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 197 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 198 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 199 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 216 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 221 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 223 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 224 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 225 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 226 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 231 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 232 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 233 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 234 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 235 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 236 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 239 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 240 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 241 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 242 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 243 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 244 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 245 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 246 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 247 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 248 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 249 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 250 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 251 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 253 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 255 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 257 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 258 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 259 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 260 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 261 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 262 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.49 |
| Rhizosphere | 98.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1001391 | 3300000532 | Bacteria | 2082 |
| 2 | LJNas_1015975 | 3300000546 | Unclassified | 800 |
| 3 | JGI24030J14995_101492 | 3300001426 | Unclassified | 822 |
| 4 | JGI24748J21848_1000002 | 3300002074 | Bacteria | 426946 |
| 5 | JGI24034J26672_10000004 | 3300002239 | Bacteria | 426946 |
| 6 | JGI24751J29686_10000058 | 3300002459 | Bacteria | 62035 |
| 7 | JGI24751J29686_10000101 | 3300002459 | Bacteria | 47517 |
| 8 | JGI25406J46586_10063825 | 3300003203 | Unclassified | 1179 |
| 9 | rootL2_10302468 | 3300003322 | Unclassified | 2104 |
| 10 | Ga0065714_10064501 | 3300005288 | Bacteria | 47703 |
| 11 | Ga0065704_10002311 | 3300005289 | Bacteria | 5805 |
| 12 | Ga0065704_10096432 | 3300005289 | Bacteria | 2442 |
| 13 | Ga0065704_10426529 | 3300005289 | Unclassified | 727 |
| 14 | Ga0065712_10001518 | 3300005290 | Bacteria | 9022 |
| 15 | Ga0065712_10022101 | 3300005290 | Bacteria | 2180 |
| 16 | Ga0065712_10067737 | 3300005290 | Bacteria | 93332 |
| 17 | Ga0065712_10124288 | 3300005290 | Unclassified | 1628 |
| 18 | Ga0065712_10314971 | 3300005290 | Unclassified | 837 |
| 19 | Ga0065715_10001156 | 3300005293 | Bacteria | 8008 |
| 20 | Ga0065715_10089067 | 3300005293 | Bacteria | 15062 |
| 21 | Ga0065715_10124138 | 3300005293 | Unclassified | 2161 |
| 22 | Ga0065715_10146354 | 3300005293 | Bacteria | 1784 |
| 23 | Ga0065715_10313428 | 3300005293 | Bacteria | 1016 |
| 24 | Ga0065715_10356127 | 3300005293 | Unclassified | 943 |
| 25 | Ga0065715_10390024 | 3300005293 | Unclassified | 895 |
| 26 | Ga0065715_10866278 | 3300005293 | Bacteria | 586 |
| 27 | Ga0065707_10004038 | 3300005295 | Bacteria | 3396 |
| 28 | Ga0065707_10004646 | 3300005295 | Bacteria | 5813 |
| 29 | Ga0065707_10217781 | 3300005295 | Bacteria | 1237 |
| 30 | Ga0065707_10231768 | 3300005295 | Unclassified | 1186 |
| 31 | Ga0065707_10562637 | 3300005295 | Unclassified | 713 |
| 32 | Ga0070676_10538425 | 3300005328 | Unclassified | 834 |
| 33 | Ga0070676_11086531 | 3300005328 | Unclassified | 604 |
| 34 | Ga0070690_100013098 | 3300005330 | Bacteria | 4893 |
| 35 | Ga0070690_100338170 | 3300005330 | Bacteria | 1089 |
| 36 | Ga0070670_100000288 | 3300005331 | Bacteria | 44423 |
| 37 | Ga0070670_100042923 | 3300005331 | Bacteria | 3888 |
| 38 | Ga0070670_100077596 | 3300005331 | Unclassified | 2854 |
| 39 | Ga0070670_100137287 | 3300005331 | Bacteria | 2113 |
| 40 | Ga0070670_100551815 | 3300005331 | Bacteria | 1028 |
| 41 | Ga0070670_101515846 | 3300005331 | Unclassified | 616 |
| 42 | Ga0068869_100024509 | 3300005334 | Bacteria | 4178 |
| 43 | Ga0068869_100589100 | 3300005334 | Bacteria | 938 |
| 44 | Ga0068869_100616639 | 3300005334 | Unclassified | 918 |
| 45 | Ga0068869_100683138 | 3300005334 | Bacteria | 874 |
| 46 | Ga0068869_100774985 | 3300005334 | Unclassified | 823 |
| 47 | Ga0068869_100873600 | 3300005334 | Unclassified | 777 |
| 48 | Ga0070680_100509704 | 3300005336 | Unclassified | 1030 |
| 49 | Ga0070682_100000027 | 3300005337 | Bacteria | 188799 |
| 50 | Ga0070682_100357039 | 3300005337 | Bacteria | 1091 |
| 51 | Ga0068868_100071693 | 3300005338 | Bacteria | 2763 |
| 52 | Ga0068868_100717207 | 3300005338 | Unclassified | 896 |
| 53 | Ga0068868_101522234 | 3300005338 | Unclassified | 627 |
| 54 | Ga0070660_101114857 | 3300005339 | Unclassified | 668 |
| 55 | Ga0070689_100088677 | 3300005340 | Unclassified | 2435 |
| 56 | Ga0070689_100400688 | 3300005340 | Bacteria | 1160 |
| 57 | Ga0070689_100449065 | 3300005340 | Bacteria | 1097 |
| 58 | Ga0070689_100781539 | 3300005340 | Unclassified | 838 |
| 59 | Ga0070689_100964888 | 3300005340 | Unclassified | 757 |
| 60 | Ga0070687_100019143 | 3300005343 | Bacteria | 3181 |
| 61 | Ga0070687_100036834 | 3300005343 | Bacteria | 2441 |
| 62 | Ga0070687_100049129 | 3300005343 | Unclassified | 2173 |
| 63 | Ga0070687_100271276 | 3300005343 | Bacteria | 1063 |
| 64 | Ga0070687_100594729 | 3300005343 | Bacteria | 759 |
| 65 | Ga0070661_101176153 | 3300005344 | Unclassified | 641 |
| 66 | Ga0070692_10008111 | 3300005345 | Bacteria | 4667 |
| 67 | Ga0070668_100010083 | 3300005347 | Bacteria | 7004 |
| 68 | Ga0070668_100392176 | 3300005347 | Unclassified | 1184 |
| 69 | Ga0070669_100002495 | 3300005353 | Bacteria | 13325 |
| 70 | Ga0070669_100038470 | 3300005353 | Bacteria | 3474 |
| 71 | Ga0070669_100099025 | 3300005353 | Bacteria | 2197 |
| 72 | Ga0070669_100762010 | 3300005353 | Unclassified | 821 |
| 73 | Ga0070675_100672057 | 3300005354 | Unclassified | 942 |
| 74 | Ga0070671_100004622 | 3300005355 | Bacteria | 10915 |
| 75 | Ga0070671_100033088 | 3300005355 | Bacteria | 4274 |
| 76 | Ga0070674_100530057 | 3300005356 | Unclassified | 985 |
| 77 | Ga0070673_100015044 | 3300005364 | Bacteria | 5416 |
| 78 | Ga0070673_100481690 | 3300005364 | Unclassified | 1120 |
| 79 | Ga0070673_100756846 | 3300005364 | Bacteria | 895 |
| 80 | Ga0070673_100837902 | 3300005364 | Bacteria | 851 |
| 81 | Ga0070673_101129279 | 3300005364 | Unclassified | 733 |
| 82 | Ga0070659_100439323 | 3300005366 | Unclassified | 1105 |
| 83 | Ga0070659_101025910 | 3300005366 | Bacteria | 725 |
| 84 | Ga0070703_10000348 | 3300005406 | Bacteria | 20179 |
| 85 | Ga0070703_10040927 | 3300005406 | Unclassified | 1443 |
| 86 | Ga0070703_10349879 | 3300005406 | Unclassified | 630 |
| 87 | Ga0070705_100012433 | 3300005440 | Bacteria | 4327 |
| 88 | Ga0070705_100152266 | 3300005440 | Unclassified | 1536 |
| 89 | Ga0070705_100627113 | 3300005440 | Bacteria | 835 |
| 90 | Ga0070705_100653747 | 3300005440 | Unclassified | 820 |
| 91 | Ga0070705_100830337 | 3300005440 | Unclassified | 738 |
| 92 | Ga0070700_100000107 | 3300005441 | Bacteria | 52892 |
| 93 | Ga0070700_100023717 | 3300005441 | Bacteria | 3592 |
| 94 | Ga0070700_100034326 | 3300005441 | Bacteria | 3063 |
| 95 | Ga0070700_100052936 | 3300005441 | Bacteria | 2532 |
| 96 | Ga0070700_100059267 | 3300005441 | Bacteria | 2409 |
| 97 | Ga0070700_100619075 | 3300005441 | Bacteria | 851 |
| 98 | Ga0070694_100005920 | 3300005444 | Bacteria | 7411 |
| 99 | Ga0070694_100019253 | 3300005444 | Bacteria | 4340 |
| 100 | Ga0070694_100084018 | 3300005444 | Bacteria | 2220 |
| 101 | Ga0070694_100098478 | 3300005444 | Bacteria | 2065 |
| 102 | Ga0070694_100236574 | 3300005444 | Bacteria | 1376 |
| 103 | Ga0070694_100326556 | 3300005444 | Unclassified | 1182 |
| 104 | Ga0070694_100379312 | 3300005444 | Unclassified | 1102 |
| 105 | Ga0070694_100745126 | 3300005444 | Unclassified | 800 |
| 106 | Ga0070694_100833803 | 3300005444 | Bacteria | 758 |
| 107 | Ga0070708_100000361 | 3300005445 | Bacteria | 34379 |
| 108 | Ga0070708_100053571 | 3300005445 | Bacteria | 3580 |
| 109 | Ga0070708_100164594 | 3300005445 | Bacteria | 2068 |
| 110 | Ga0070708_100219902 | 3300005445 | Bacteria | 1781 |
| 111 | Ga0070708_100237738 | 3300005445 | Bacteria | 1710 |
| 112 | Ga0070708_100400680 | 3300005445 | Bacteria | 1294 |
| 113 | Ga0070708_100417572 | 3300005445 | Unclassified | 1265 |
| 114 | Ga0070708_100418170 | 3300005445 | Bacteria | 1264 |
| 115 | Ga0070708_100878947 | 3300005445 | Unclassified | 842 |
| 116 | Ga0070678_100848848 | 3300005456 | Bacteria | 832 |
| 117 | Ga0070662_100134411 | 3300005457 | Bacteria | 1911 |
| 118 | Ga0070681_10020201 | 3300005458 | Bacteria | 6676 |
| 119 | Ga0068867_100378510 | 3300005459 | Unclassified | 1188 |
| 120 | Ga0068867_101484434 | 3300005459 | Unclassified | 631 |
| 121 | Ga0070706_100024043 | 3300005467 | Bacteria | 5610 |
| 122 | Ga0070706_100037418 | 3300005467 | Unclassified | 4482 |
| 123 | Ga0070706_100167524 | 3300005467 | Bacteria | 2051 |
| 124 | Ga0070706_100177886 | 3300005467 | Bacteria | 1986 |
| 125 | Ga0070706_100315666 | 3300005467 | Unclassified | 1458 |
| 126 | Ga0070706_100409491 | 3300005467 | Bacteria | 1262 |
| 127 | Ga0070706_100656331 | 3300005467 | Bacteria | 974 |
| 128 | Ga0070707_100002485 | 3300005468 | Bacteria | 17581 |
| 129 | Ga0070707_100003049 | 3300005468 | Bacteria | 15874 |
| 130 | Ga0070707_100022287 | 3300005468 | Bacteria | 5988 |
| 131 | Ga0070707_100063283 | 3300005468 | Bacteria | 3551 |
| 132 | Ga0070707_100113249 | 3300005468 | Bacteria | 2632 |
| 133 | Ga0070707_100158406 | 3300005468 | Bacteria | 2205 |
| 134 | Ga0070707_100469950 | 3300005468 | Bacteria | 1219 |
| 135 | Ga0070707_101417855 | 3300005468 | Bacteria | 661 |
| 136 | Ga0070698_100003085 | 3300005471 | Bacteria | 18369 |
| 137 | Ga0070698_100009470 | 3300005471 | Bacteria | 10435 |
| 138 | Ga0070698_100014091 | 3300005471 | Bacteria | 8454 |
| 139 | Ga0070698_100016325 | 3300005471 | Bacteria | 7840 |
| 140 | Ga0070698_100017121 | 3300005471 | Bacteria | 7640 |
| 141 | Ga0070698_100049814 | 3300005471 | Bacteria | 4274 |
| 142 | Ga0070698_100116334 | 3300005471 | Bacteria | 2637 |
| 143 | Ga0070698_100122954 | 3300005471 | Bacteria | 2553 |
| 144 | Ga0070698_100604897 | 3300005471 | Bacteria | 1037 |
| 145 | Ga0070698_100633759 | 3300005471 | Bacteria | 1010 |
| 146 | Ga0070698_100810203 | 3300005471 | Unclassified | 881 |
| 147 | Ga0070698_100931676 | 3300005471 | Unclassified | 815 |
| 148 | Ga0070699_100003309 | 3300005518 | Bacteria | 14251 |
| 149 | Ga0070699_100007923 | 3300005518 | Bacteria | 9226 |
| 150 | Ga0070699_100015176 | 3300005518 | Bacteria | 6619 |
| 151 | Ga0070699_100049413 | 3300005518 | Bacteria | 3640 |
| 152 | Ga0070699_100225426 | 3300005518 | Unclassified | 1671 |
| 153 | Ga0070699_100586630 | 3300005518 | Unclassified | 1016 |
| 154 | Ga0070699_101152460 | 3300005518 | Unclassified | 711 |
| 155 | Ga0070697_100001825 | 3300005536 | Bacteria | 16277 |
| 156 | Ga0070697_100004262 | 3300005536 | Bacteria | 10964 |
| 157 | Ga0070697_100016344 | 3300005536 | Bacteria | 5837 |
| 158 | Ga0070697_100037477 | 3300005536 | Unclassified | 3918 |
| 159 | Ga0070697_100067440 | 3300005536 | Bacteria | 2927 |
| 160 | Ga0070697_100163082 | 3300005536 | Bacteria | 1884 |
| 161 | Ga0070697_100412018 | 3300005536 | Bacteria | 1174 |
| 162 | Ga0070697_100494570 | 3300005536 | Bacteria | 1069 |
| 163 | Ga0070697_100499409 | 3300005536 | Unclassified | 1063 |
| 164 | Ga0070697_101286232 | 3300005536 | Unclassified | 652 |
| 165 | Ga0068853_100143510 | 3300005539 | Bacteria | 2144 |
| 166 | Ga0070672_100072802 | 3300005543 | Bacteria | 2737 |
| 167 | Ga0070672_100196797 | 3300005543 | Bacteria | 1684 |
| 168 | Ga0070672_101027304 | 3300005543 | Bacteria | 731 |
| 169 | Ga0070686_100009294 | 3300005544 | Bacteria | 5519 |
| 170 | Ga0070686_100050927 | 3300005544 | Bacteria | 2634 |
| 171 | Ga0070686_100068604 | 3300005544 | Bacteria | 2313 |
| 172 | Ga0070686_100185703 | 3300005544 | Unclassified | 1480 |
| 173 | Ga0070695_100050781 | 3300005545 | Bacteria | 2659 |
| 174 | Ga0070695_100089006 | 3300005545 | Bacteria | 2057 |
| 175 | Ga0070695_100180658 | 3300005545 | Unclassified | 1495 |
| 176 | Ga0070695_100205630 | 3300005545 | Bacteria | 1410 |
| 177 | Ga0070695_100292257 | 3300005545 | Unclassified | 1202 |
| 178 | Ga0070695_100359586 | 3300005545 | Unclassified | 1093 |
| 179 | Ga0070695_100673452 | 3300005545 | Bacteria | 819 |
| 180 | Ga0070695_101169153 | 3300005545 | Unclassified | 632 |
| 181 | Ga0070696_100032533 | 3300005546 | Bacteria | 3578 |
| 182 | Ga0070696_100071409 | 3300005546 | Bacteria | 2443 |
| 183 | Ga0070696_100109973 | 3300005546 | Bacteria | 1984 |
| 184 | Ga0070696_100117165 | 3300005546 | Bacteria | 1924 |
| 185 | Ga0070696_100139713 | 3300005546 | Bacteria | 1769 |
| 186 | Ga0070696_100298148 | 3300005546 | Bacteria | 1234 |
| 187 | Ga0070696_100352238 | 3300005546 | Unclassified | 1140 |
| 188 | Ga0070696_100427989 | 3300005546 | Bacteria | 1040 |
| 189 | Ga0070696_100727417 | 3300005546 | Unclassified | 811 |
| 190 | Ga0070693_100000972 | 3300005547 | Bacteria | 12741 |
| 191 | Ga0070693_100156698 | 3300005547 | Bacteria | 1447 |
| 192 | Ga0070693_100158005 | 3300005547 | Bacteria | 1441 |
| 193 | Ga0070693_100176318 | 3300005547 | Bacteria | 1373 |
| 194 | Ga0070704_100028893 | 3300005549 | Bacteria | 3695 |
| 195 | Ga0070704_100036648 | 3300005549 | Bacteria | 3344 |
| 196 | Ga0070704_100114124 | 3300005549 | Bacteria | 2061 |
| 197 | Ga0070704_100120541 | 3300005549 | Unclassified | 2014 |
| 198 | Ga0070704_100124072 | 3300005549 | Bacteria | 1989 |
| 199 | Ga0070704_100272049 | 3300005549 | Unclassified | 1400 |
| 200 | Ga0070704_100534794 | 3300005549 | Unclassified | 1022 |
| 201 | Ga0070704_100619410 | 3300005549 | Bacteria | 953 |
| 202 | Ga0070704_100901929 | 3300005549 | Unclassified | 795 |
| 203 | Ga0068855_100969893 | 3300005563 | Unclassified | 894 |
| 204 | Ga0070664_100141118 | 3300005564 | Bacteria | 2121 |
| 205 | Ga0070664_100210169 | 3300005564 | Bacteria | 1739 |
| 206 | Ga0070664_101033211 | 3300005564 | Unclassified | 773 |
| 207 | Ga0068857_100137507 | 3300005577 | Bacteria | 2206 |
| 208 | Ga0068857_100200746 | 3300005577 | Bacteria | 1818 |
| 209 | Ga0068857_100287845 | 3300005577 | Bacteria | 1512 |
| 210 | Ga0068857_101062801 | 3300005577 | Unclassified | 781 |
| 211 | Ga0068857_101152509 | 3300005577 | Unclassified | 750 |
| 212 | Ga0068857_101222831 | 3300005577 | Unclassified | 728 |
| 213 | Ga0068854_100110567 | 3300005578 | Archaea | 2072 |
| 214 | Ga0070702_100014931 | 3300005615 | Bacteria | 3953 |
| 215 | Ga0070702_100029580 | 3300005615 | Bacteria | 2981 |
| 216 | Ga0070702_100029766 | 3300005615 | Unclassified | 2972 |
| 217 | Ga0070702_100030131 | 3300005615 | Unclassified | 2956 |
| 218 | Ga0070702_100093945 | 3300005615 | Bacteria | 1825 |
| 219 | Ga0070702_100350230 | 3300005615 | Unclassified | 1040 |
| 220 | Ga0070702_100522757 | 3300005615 | Bacteria | 875 |
| 221 | Ga0070702_100996773 | 3300005615 | Unclassified | 663 |
| 222 | Ga0068852_100182908 | 3300005616 | Bacteria | 1972 |
| 223 | Ga0068852_101152310 | 3300005616 | Unclassified | 796 |
| 224 | Ga0068859_100004451 | 3300005617 | Bacteria | 14294 |
| 225 | Ga0068859_100060689 | 3300005617 | Unclassified | 3810 |
| 226 | Ga0068859_100070551 | 3300005617 | Bacteria | 3529 |
| 227 | Ga0068859_100139342 | 3300005617 | Bacteria | 2499 |
| 228 | Ga0068859_100225683 | 3300005617 | Bacteria | 1961 |
| 229 | Ga0068859_100455804 | 3300005617 | Bacteria | 1375 |
| 230 | Ga0068859_100536970 | 3300005617 | Unclassified | 1264 |
| 231 | Ga0068859_100563409 | 3300005617 | Unclassified | 1233 |
| 232 | Ga0068859_100659834 | 3300005617 | Unclassified | 1138 |
| 233 | Ga0068859_100791201 | 3300005617 | Bacteria | 1036 |
| 234 | Ga0068859_100868768 | 3300005617 | Bacteria | 987 |
| 235 | Ga0068864_100002264 | 3300005618 | Bacteria | 15917 |
| 236 | Ga0068864_100007172 | 3300005618 | Bacteria | 9153 |
| 237 | Ga0068864_100035605 | 3300005618 | Bacteria | 4238 |
| 238 | Ga0068864_100187777 | 3300005618 | Bacteria | 1893 |
| 239 | Ga0068864_100192031 | 3300005618 | Bacteria | 1872 |
| 240 | Ga0068864_100462511 | 3300005618 | Bacteria | 1215 |
| 241 | Ga0068866_10135793 | 3300005718 | Unclassified | 1405 |
| 242 | Ga0068866_10416173 | 3300005718 | Bacteria | 871 |
| 243 | Ga0068861_100008185 | 3300005719 | Bacteria | 7193 |
| 244 | Ga0068861_100008887 | 3300005719 | Bacteria | 6924 |
| 245 | Ga0068861_100056063 | 3300005719 | Bacteria | 3007 |
| 246 | Ga0068861_100178797 | 3300005719 | Bacteria | 1764 |
| 247 | Ga0068861_100289853 | 3300005719 | Bacteria | 1413 |
| 248 | Ga0068861_101293665 | 3300005719 | Bacteria | 709 |
| 249 | Ga0068851_10002518 | 3300005834 | Bacteria | 8060 |
| 250 | Ga0068870_10177926 | 3300005840 | Bacteria | 1274 |
| 251 | Ga0068870_10482408 | 3300005840 | Unclassified | 823 |
| 252 | Ga0068863_100107205 | 3300005841 | Unclassified | 2658 |
| 253 | Ga0068863_100120745 | 3300005841 | Unclassified | 2499 |
| 254 | Ga0068863_100741129 | 3300005841 | Unclassified | 978 |
| 255 | Ga0068858_100002375 | 3300005842 | Bacteria | 19040 |
| 256 | Ga0068858_100052207 | 3300005842 | Bacteria | 3782 |
| 257 | Ga0068858_100099350 | 3300005842 | Bacteria | 2713 |
| 258 | Ga0068858_100104723 | 3300005842 | Bacteria | 2640 |
| 259 | Ga0068858_100284586 | 3300005842 | Unclassified | 1574 |
| 260 | Ga0068858_100360341 | 3300005842 | Unclassified | 1394 |
| 261 | Ga0068858_100403701 | 3300005842 | Bacteria | 1313 |
| 262 | Ga0068858_100407236 | 3300005842 | Bacteria | 1307 |
| 263 | Ga0068858_100521090 | 3300005842 | Bacteria | 1149 |
| 264 | Ga0068860_100154075 | 3300005843 | Bacteria | 2214 |
| 265 | Ga0068860_100176380 | 3300005843 | Unclassified | 2065 |
| 266 | Ga0068860_100199000 | 3300005843 | Bacteria | 1941 |
| 267 | Ga0068860_100244213 | 3300005843 | Bacteria | 1747 |
| 268 | Ga0068860_100325781 | 3300005843 | Bacteria | 1508 |
| 269 | Ga0068860_100729933 | 3300005843 | Unclassified | 1001 |
| 270 | Ga0068860_100826375 | 3300005843 | Unclassified | 940 |
| 271 | Ga0068860_100838899 | 3300005843 | Bacteria | 933 |
| 272 | Ga0068860_100879285 | 3300005843 | Unclassified | 912 |
| 273 | Ga0068860_100905331 | 3300005843 | Unclassified | 898 |
| 274 | Ga0068862_100027399 | 3300005844 | Plasmid | 4796 |
| 275 | Ga0068862_100144461 | 3300005844 | Bacteria | 2113 |
| 276 | Ga0068862_100998800 | 3300005844 | Unclassified | 827 |
| 277 | Ga0068862_101235622 | 3300005844 | Unclassified | 747 |
| 278 | Ga0081540_1015996 | 3300005983 | Bacteria | 4723 |
| 279 | Ga0081539_10002786 | 3300005985 | Bacteria | 23472 |
| 280 | Ga0081539_10002860 | 3300005985 | Bacteria | 22952 |
| 281 | Ga0081539_10053080 | 3300005985 | Bacteria | 2272 |
| 282 | Ga0070715_10000019 | 3300006163 | Bacteria | 122990 |
| 283 | Ga0070716_100000001 | 3300006173 | Bacteria | 400668 |
| 284 | Ga0070716_100108602 | 3300006173 | Unclassified | 1715 |
| 285 | Ga0070716_100845667 | 3300006173 | Bacteria | 712 |
| 286 | Ga0097621_100005444 | 3300006237 | Bacteria | 8966 |
| 287 | Ga0068871_100001051 | 3300006358 | Bacteria | 18505 |
| 288 | Ga0068871_100271019 | 3300006358 | Bacteria | 1483 |
| 289 | Ga0068871_100336796 | 3300006358 | Bacteria | 1331 |
| 290 | Ga0075428_100093477 | 3300006844 | Bacteria | 3279 |
| 291 | Ga0075428_100803666 | 3300006844 | Bacteria | 1000 |
| 292 | Ga0075428_101401567 | 3300006844 | Bacteria | 733 |
| 293 | Ga0075431_100050600 | 3300006847 | Unclassified | 4283 |
| 294 | Ga0075431_100086515 | 3300006847 | Bacteria | 3234 |
| 295 | Ga0075431_100243832 | 3300006847 | Bacteria | 1827 |
| 296 | Ga0075431_100765689 | 3300006847 | Bacteria | 940 |
| 297 | Ga0075433_10007251 | 3300006852 | Bacteria | 8784 |
| 298 | Ga0075433_10019917 | 3300006852 | Bacteria | 5601 |
| 299 | Ga0075433_10104127 | 3300006852 | Bacteria | 2514 |
| 300 | Ga0075433_10148952 | 3300006852 | Bacteria | 2081 |
| 301 | Ga0075433_10230016 | 3300006852 | Bacteria | 1647 |
| 302 | Ga0075433_10250767 | 3300006852 | Bacteria | 1570 |
| 303 | Ga0075434_100031968 | 3300006871 | Bacteria | 5189 |
| 304 | Ga0075434_100158918 | 3300006871 | Bacteria | 2280 |
| 305 | Ga0075434_100364079 | 3300006871 | Bacteria | 1467 |
| 306 | Ga0075434_100424577 | 3300006871 | Unclassified | 1351 |
| 307 | Ga0075434_100827164 | 3300006871 | Bacteria | 942 |
| 308 | Ga0075434_101036773 | 3300006871 | Unclassified | 834 |
| 309 | Ga0075434_101088058 | 3300006871 | Unclassified | 813 |
| 310 | Ga0075434_101343960 | 3300006871 | Unclassified | 725 |
| 311 | Ga0075434_101368840 | 3300006871 | Bacteria | 718 |
| 312 | Ga0075429_100170245 | 3300006880 | Bacteria | 1908 |
| 313 | Ga0075429_100524686 | 3300006880 | Unclassified | 1038 |
| 314 | Ga0075429_100797923 | 3300006880 | Bacteria | 827 |
| 315 | Ga0068865_100176463 | 3300006881 | Unclassified | 1642 |
| 316 | Ga0068865_101178848 | 3300006881 | Unclassified | 677 |
| 317 | Ga0075436_100000015 | 3300006914 | Bacteria | 174598 |
| 318 | Ga0075436_100089402 | 3300006914 | Bacteria | 2140 |
| 319 | Ga0075436_100117395 | 3300006914 | Unclassified | 1860 |
| 320 | Ga0097620_100004451 | 3300006931 | Bacteria | 14294 |
| 321 | Ga0097620_100060690 | 3300006931 | Unclassified | 3810 |
| 322 | Ga0097620_100070561 | 3300006931 | Bacteria | 3529 |
| 323 | Ga0097620_100139337 | 3300006931 | Bacteria | 2499 |
| 324 | Ga0097620_100225692 | 3300006931 | Bacteria | 1961 |
| 325 | Ga0097620_100455825 | 3300006931 | Bacteria | 1375 |
| 326 | Ga0097620_100536993 | 3300006931 | Unclassified | 1264 |
| 327 | Ga0097620_100563442 | 3300006931 | Unclassified | 1233 |
| 328 | Ga0097620_100659853 | 3300006931 | Unclassified | 1138 |
| 329 | Ga0097620_100791262 | 3300006931 | Bacteria | 1036 |
| 330 | Ga0097620_100868775 | 3300006931 | Bacteria | 987 |
| 331 | Ga0097620_101021047 | 3300006931 | Unclassified | 908 |
| 332 | Ga0075435_100000410 | 3300007076 | Bacteria | 26372 |
| 333 | Ga0075435_100779640 | 3300007076 | Unclassified | 832 |
| 334 | Ga0099794_10002733 | 3300007265 | Bacteria | 6582 |
| 335 | Ga0105251_10039979 | 3300009011 | Bacteria | 2288 |
| 336 | Ga0105240_10219279 | 3300009093 | Bacteria | 2217 |
| 337 | Ga0111539_10021649 | 3300009094 | Bacteria | 7908 |
| 338 | Ga0111539_10063062 | 3300009094 | Bacteria | 4386 |
| 339 | Ga0111539_10109329 | 3300009094 | Bacteria | 3244 |
| 340 | Ga0111539_10137643 | 3300009094 | Bacteria | 2859 |
| 341 | Ga0111539_10255549 | 3300009094 | Unclassified | 2040 |
| 342 | Ga0105245_10085681 | 3300009098 | Bacteria | 2888 |
| 343 | Ga0105245_10214890 | 3300009098 | Unclassified | 1852 |
| 344 | Ga0105245_10328767 | 3300009098 | Bacteria | 1508 |
| 345 | Ga0105245_10421235 | 3300009098 | Bacteria | 1338 |
| 346 | Ga0105245_10619544 | 3300009098 | Bacteria | 1110 |
| 347 | Ga0105247_10000005 | 3300009101 | Bacteria | 426989 |
| 348 | Ga0105247_10000395 | 3300009101 | Bacteria | 37015 |
| 349 | Ga0105247_10083526 | 3300009101 | Bacteria | 2017 |
| 350 | Ga0105247_10117830 | 3300009101 | Bacteria | 1717 |
| 351 | Ga0105247_10223457 | 3300009101 | Bacteria | 1275 |
| 352 | Ga0105247_10378040 | 3300009101 | Bacteria | 1003 |
| 353 | Ga0105247_10682445 | 3300009101 | Unclassified | 771 |
| 354 | Ga0105247_10771141 | 3300009101 | Unclassified | 731 |
| 355 | Ga0114129_10003875 | 3300009147 | Bacteria | 21099 |
| 356 | Ga0114129_10009289 | 3300009147 | Bacteria | 14022 |
| 357 | Ga0114129_10009889 | 3300009147 | Bacteria | 13599 |
| 358 | Ga0114129_10010589 | 3300009147 | Bacteria | 13148 |
| 359 | Ga0114129_10027104 | 3300009147 | Bacteria | 8113 |
| 360 | Ga0114129_10792635 | 3300009147 | Bacteria | 1209 |
| 361 | Ga0114129_11118683 | 3300009147 | Unclassified | 985 |
| 362 | Ga0114129_11269770 | 3300009147 | Bacteria | 914 |
| 363 | Ga0114129_12554327 | 3300009147 | Bacteria | 610 |
| 364 | Ga0105243_10000428 | 3300009148 | Bacteria | 43953 |
| 365 | Ga0105243_10002722 | 3300009148 | Bacteria | 14692 |
| 366 | Ga0105243_10019859 | 3300009148 | Bacteria | 5096 |
| 367 | Ga0105243_10030928 | 3300009148 | Bacteria | 4125 |
| 368 | Ga0105243_10129310 | 3300009148 | Unclassified | 2140 |
| 369 | Ga0105243_10136499 | 3300009148 | Bacteria | 2087 |
| 370 | Ga0105243_10154763 | 3300009148 | Bacteria | 1970 |
| 371 | Ga0105243_10208827 | 3300009148 | Bacteria | 1718 |
| 372 | Ga0105243_10297186 | 3300009148 | Viruses | 1462 |
| 373 | Ga0105243_10314896 | 3300009148 | Unclassified | 1423 |
| 374 | Ga0105243_10774210 | 3300009148 | Bacteria | 943 |
| 375 | Ga0105243_11330427 | 3300009148 | Bacteria | 737 |
| 376 | Ga0105241_10175345 | 3300009174 | Bacteria | 1774 |
| 377 | Ga0105241_10527227 | 3300009174 | Bacteria | 1057 |
| 378 | Ga0105241_10859430 | 3300009174 | Bacteria | 840 |
| 379 | Ga0105241_11298556 | 3300009174 | Unclassified | 693 |
| 380 | Ga0105242_10000227 | 3300009176 | Bacteria | 44246 |
| 381 | Ga0105242_10000507 | 3300009176 | Bacteria | 30734 |
| 382 | Ga0105242_10002537 | 3300009176 | Bacteria | 14333 |
| 383 | Ga0105242_10020232 | 3300009176 | Bacteria | 5218 |
| 384 | Ga0105242_10208478 | 3300009176 | Bacteria | 1740 |
| 385 | Ga0105242_10779723 | 3300009176 | Bacteria | 944 |
| 386 | Ga0105242_11796142 | 3300009176 | Unclassified | 651 |
| 387 | Ga0105248_10006595 | 3300009177 | Bacteria | 12722 |
| 388 | Ga0105248_10015021 | 3300009177 | Bacteria | 8523 |
| 389 | Ga0105248_10023476 | 3300009177 | Bacteria | 6851 |
| 390 | Ga0105248_10102180 | 3300009177 | Bacteria | 3231 |
| 391 | Ga0105248_10193172 | 3300009177 | Bacteria | 2294 |
| 392 | Ga0105248_10434385 | 3300009177 | Bacteria | 1479 |
| 393 | Ga0105248_10535044 | 3300009177 | Bacteria | 1321 |
| 394 | Ga0105248_10654107 | 3300009177 | Bacteria | 1186 |
| 395 | Ga0105248_10796641 | 3300009177 | Bacteria | 1066 |
| 396 | Ga0105248_11022136 | 3300009177 | Unclassified | 934 |
| 397 | Ga0105248_11461941 | 3300009177 | Unclassified | 774 |
| 398 | Ga0105237_10002654 | 3300009545 | Bacteria | 21987 |
| 399 | Ga0105237_10100323 | 3300009545 | Bacteria | 2886 |
| 400 | Ga0105237_10663357 | 3300009545 | Bacteria | 1050 |
| 401 | Ga0105237_11623044 | 3300009545 | Unclassified | 654 |
| 402 | Ga0105238_10025821 | 3300009551 | Bacteria | 5989 |
| 403 | Ga0105238_10066275 | 3300009551 | Unclassified | 3613 |
| 404 | Ga0105238_10705796 | 3300009551 | Bacteria | 1021 |
| 405 | Ga0105249_10000375 | 3300009553 | Bacteria | 44344 |
| 406 | Ga0105249_10011935 | 3300009553 | Bacteria | 7642 |
| 407 | Ga0105249_10022736 | 3300009553 | Bacteria | 5620 |
| 408 | Ga0105249_10062428 | 3300009553 | Bacteria | 3422 |
| 409 | Ga0105249_10089092 | 3300009553 | Bacteria | 2883 |
| 410 | Ga0105239_10018470 | 3300010375 | Bacteria | 7702 |
| 411 | Ga0105239_10109520 | 3300010375 | Unclassified | 3061 |
| 412 | Ga0105239_10664718 | 3300010375 | Bacteria | 1190 |
| 413 | Ga0105239_10904756 | 3300010375 | Unclassified | 1013 |
| 414 | Ga0105246_10030376 | 3300011119 | Bacteria | 3568 |
| 415 | Ga0105246_10043449 | 3300011119 | Bacteria | 3049 |
| 416 | Ga0105246_10160941 | 3300011119 | Bacteria | 1710 |
| 417 | Ga0105246_10497001 | 3300011119 | Unclassified | 1035 |
| 418 | Ga0105246_10723447 | 3300011119 | Bacteria | 875 |
| 419 | Ga0157323_1008116 | 3300012495 | Unclassified | 774 |
| 420 | Ga0157373_10084521 | 3300013100 | Bacteria | 2237 |
| 421 | Ga0157373_10149997 | 3300013100 | Bacteria | 1640 |
| 422 | Ga0157373_10242493 | 3300013100 | Bacteria | 1274 |
| 423 | Ga0157373_10286050 | 3300013100 | Unclassified | 1169 |
| 424 | Ga0157371_10499304 | 3300013102 | Bacteria | 898 |
| 425 | Ga0157374_10569230 | 3300013296 | Bacteria | 1141 |
| 426 | Ga0157378_10000067 | 3300013297 | Bacteria | 92867 |
| 427 | Ga0157378_10007638 | 3300013297 | Bacteria | 9438 |
| 428 | Ga0157378_10044131 | 3300013297 | Bacteria | 3958 |
| 429 | Ga0157378_10107731 | 3300013297 | Bacteria | 2550 |
| 430 | Ga0157378_10128573 | 3300013297 | Bacteria | 2342 |
| 431 | Ga0157378_10254089 | 3300013297 | Bacteria | 1684 |
| 432 | Ga0157378_10436132 | 3300013297 | Unclassified | 1297 |
| 433 | Ga0157378_10671913 | 3300013297 | Unclassified | 1053 |
| 434 | Ga0157378_11052956 | 3300013297 | Bacteria | 849 |
| 435 | Ga0157378_11270991 | 3300013297 | Unclassified | 777 |
| 436 | Ga0163162_10000162 | 3300013306 | Bacteria | 61820 |
| 437 | Ga0163162_10001341 | 3300013306 | Bacteria | 22917 |
| 438 | Ga0163162_10004188 | 3300013306 | Bacteria | 13864 |
| 439 | Ga0163162_10023984 | 3300013306 | Bacteria | 6020 |
| 440 | Ga0163162_10056960 | 3300013306 | Unclassified | 3936 |
| 441 | Ga0163162_10091654 | 3300013306 | Bacteria | 3122 |
| 442 | Ga0163162_10149727 | 3300013306 | Bacteria | 2451 |
| 443 | Ga0163162_10373062 | 3300013306 | Unclassified | 1560 |
| 444 | Ga0163162_11710825 | 3300013306 | Bacteria | 718 |
| 445 | Ga0157372_10320815 | 3300013307 | Unclassified | 1804 |
| 446 | Ga0157372_10440326 | 3300013307 | Bacteria | 1519 |
| 447 | Ga0157372_10524134 | 3300013307 | Bacteria | 1381 |
| 448 | Ga0157375_10005624 | 3300013308 | Bacteria | 10912 |
| 449 | Ga0157375_10006074 | 3300013308 | Bacteria | 10535 |
| 450 | Ga0157375_10205014 | 3300013308 | Unclassified | 2128 |
| 451 | Ga0157375_10222015 | 3300013308 | Bacteria | 2048 |
| 452 | Ga0157375_10363757 | 3300013308 | Bacteria | 1613 |
| 453 | Ga0157375_10787821 | 3300013308 | Unclassified | 1100 |
| 454 | Ga0163163_10001223 | 3300014325 | Bacteria | 21706 |
| 455 | Ga0163163_10023043 | 3300014325 | Bacteria | 5904 |
| 456 | Ga0163163_10028033 | 3300014325 | Bacteria | 5403 |
| 457 | Ga0163163_10184350 | 3300014325 | Bacteria | 2135 |
| 458 | Ga0163163_10199108 | 3300014325 | Bacteria | 2051 |
| 459 | Ga0163163_10495975 | 3300014325 | Bacteria | 1283 |
| 460 | Ga0163163_10622613 | 3300014325 | Bacteria | 1143 |
| 461 | Ga0163163_11160310 | 3300014325 | Unclassified | 835 |
| 462 | Ga0163163_11822783 | 3300014325 | Bacteria | 669 |
| 463 | Ga0157380_10013349 | 3300014326 | Bacteria | 5987 |
| 464 | Ga0157380_10117976 | 3300014326 | Bacteria | 2242 |
| 465 | Ga0157380_10264676 | 3300014326 | Bacteria | 1564 |
| 466 | Ga0157380_10471668 | 3300014326 | Bacteria | 1211 |
| 467 | Ga0157377_10030998 | 3300014745 | Unclassified | 2903 |
| 468 | Ga0157377_10076667 | 3300014745 | Bacteria | 1945 |
| 469 | Ga0157377_10181243 | 3300014745 | Bacteria | 1325 |
| 470 | Ga0157377_10200864 | 3300014745 | Bacteria | 1266 |
| 471 | Ga0157377_10230678 | 3300014745 | Bacteria | 1190 |
| 472 | Ga0157377_10552003 | 3300014745 | Bacteria | 814 |
| 473 | Ga0157379_10010606 | 3300014968 | Bacteria | 8032 |
| 474 | Ga0157379_10080571 | 3300014968 | Unclassified | 2916 |
| 475 | Ga0157379_10125649 | 3300014968 | Unclassified | 2308 |
| 476 | Ga0157379_10785902 | 3300014968 | Bacteria | 898 |
| 477 | Ga0157376_10189118 | 3300014969 | Bacteria | 1887 |
| 478 | Ga0163161_10233216 | 3300017792 | Bacteria | 1429 |
| 479 | Ga0163161_10280313 | 3300017792 | Bacteria | 1307 |
| 480 | Ga0163161_10763967 | 3300017792 | Unclassified | 809 |
| 481 | Ga0207672_1000315 | 3300025223 | Bacteria | 6488 |
| 482 | Ga0207656_10005923 | 3300025321 | Bacteria | 4361 |
| 483 | Ga0207653_10000180 | 3300025885 | Bacteria | 44353 |
| 484 | Ga0207653_10005448 | 3300025885 | Unclassified | 3981 |
| 485 | Ga0207653_10050720 | 3300025885 | Bacteria | 1380 |
| 486 | Ga0207653_10211445 | 3300025885 | Unclassified | 734 |
| 487 | Ga0207642_10171638 | 3300025899 | Unclassified | 1174 |
| 488 | Ga0207642_10194220 | 3300025899 | Bacteria | 1116 |
| 489 | Ga0207710_10000004 | 3300025900 | Bacteria | 846540 |
| 490 | Ga0207710_10002291 | 3300025900 | Bacteria | 8955 |
| 491 | Ga0207710_10145022 | 3300025900 | Unclassified | 1148 |
| 492 | Ga0207710_10321549 | 3300025900 | Unclassified | 784 |
| 493 | Ga0207710_10397119 | 3300025900 | Unclassified | 707 |
| 494 | Ga0207647_10004611 | 3300025904 | Bacteria | 10209 |
| 495 | Ga0207647_10102830 | 3300025904 | Bacteria | 1694 |
| 496 | Ga0207647_10239322 | 3300025904 | Bacteria | 1043 |
| 497 | Ga0207647_10486877 | 3300025904 | Unclassified | 689 |
| 498 | Ga0207685_10000021 | 3300025905 | Bacteria | 131248 |
| 499 | Ga0207699_10614603 | 3300025906 | Unclassified | 792 |
| 500 | Ga0207645_10161213 | 3300025907 | Bacteria | 1467 |
| 501 | Ga0207643_10008738 | 3300025908 | Bacteria | 5434 |
| 502 | Ga0207643_10202980 | 3300025908 | Unclassified | 1208 |
| 503 | Ga0207684_10000171 | 3300025910 | Bacteria | 107398 |
| 504 | Ga0207684_10073174 | 3300025910 | Unclassified | 2910 |
| 505 | Ga0207684_10085309 | 3300025910 | Bacteria | 2690 |
| 506 | Ga0207684_10105416 | 3300025910 | Bacteria | 2411 |
| 507 | Ga0207684_10128192 | 3300025910 | Bacteria | 2178 |
| 508 | Ga0207684_10161930 | 3300025910 | Bacteria | 1927 |
| 509 | Ga0207684_10172372 | 3300025910 | Bacteria | 1865 |
| 510 | Ga0207684_10185755 | 3300025910 | Bacteria | 1792 |
| 511 | Ga0207684_10333801 | 3300025910 | Unclassified | 1306 |
| 512 | Ga0207684_10493394 | 3300025910 | Unclassified | 1050 |
| 513 | Ga0207684_10882896 | 3300025910 | Bacteria | 752 |
| 514 | Ga0207654_10100679 | 3300025911 | Bacteria | 1780 |
| 515 | Ga0207654_10153622 | 3300025911 | Bacteria | 1480 |
| 516 | Ga0207654_10585921 | 3300025911 | Bacteria | 795 |
| 517 | Ga0207654_10589151 | 3300025911 | Unclassified | 793 |
| 518 | Ga0207707_10000030 | 3300025912 | Bacteria | 160015 |
| 519 | Ga0207707_10016939 | 3300025912 | Bacteria | 6348 |
| 520 | Ga0207695_10472052 | 3300025913 | Bacteria | 1137 |
| 521 | Ga0207695_10797913 | 3300025913 | Bacteria | 824 |
| 522 | Ga0207671_10007027 | 3300025914 | Bacteria | 9862 |
| 523 | Ga0207671_10187427 | 3300025914 | Bacteria | 1612 |
| 524 | Ga0207671_10265650 | 3300025914 | Bacteria | 1351 |
| 525 | Ga0207671_10429474 | 3300025914 | Bacteria | 1051 |
| 526 | Ga0207660_10000376 | 3300025917 | Bacteria | 29145 |
| 527 | Ga0207660_10192520 | 3300025917 | Unclassified | 1589 |
| 528 | Ga0207662_10016286 | 3300025918 | Bacteria | 4193 |
| 529 | Ga0207662_10045155 | 3300025918 | Unclassified | 2604 |
| 530 | Ga0207662_10180956 | 3300025918 | Bacteria | 1356 |
| 531 | Ga0207657_10296453 | 3300025919 | Bacteria | 1281 |
| 532 | Ga0207657_10450286 | 3300025919 | Unclassified | 1010 |
| 533 | Ga0207649_10643384 | 3300025920 | Bacteria | 819 |
| 534 | Ga0207652_10000086 | 3300025921 | Bacteria | 101164 |
| 535 | Ga0207646_10009636 | 3300025922 | Bacteria | 9527 |
| 536 | Ga0207646_10019481 | 3300025922 | Bacteria | 6306 |
| 537 | Ga0207646_10034457 | 3300025922 | Bacteria | 4575 |
| 538 | Ga0207646_10098715 | 3300025922 | Bacteria | 2617 |
| 539 | Ga0207646_10107115 | 3300025922 | Bacteria | 2507 |
| 540 | Ga0207646_10137432 | 3300025922 | Bacteria | 2201 |
| 541 | Ga0207646_10185089 | 3300025922 | Bacteria | 1881 |
| 542 | Ga0207646_10334889 | 3300025922 | Unclassified | 1367 |
| 543 | Ga0207646_10618865 | 3300025922 | Bacteria | 971 |
| 544 | Ga0207646_10666499 | 3300025922 | Unclassified | 931 |
| 545 | Ga0207646_11187265 | 3300025922 | Bacteria | 669 |
| 546 | Ga0207681_10005479 | 3300025923 | Bacteria | 7795 |
| 547 | Ga0207681_10042146 | 3300025923 | Bacteria | 3047 |
| 548 | Ga0207681_10296308 | 3300025923 | Unclassified | 1278 |
| 549 | Ga0207681_10676149 | 3300025923 | Bacteria | 857 |
| 550 | Ga0207694_10003255 | 3300025924 | Bacteria | 12934 |
| 551 | Ga0207694_10088678 | 3300025924 | Unclassified | 2439 |
| 552 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 553 | Ga0207650_10000304 | 3300025925 | Bacteria | 48674 |
| 554 | Ga0207650_10192007 | 3300025925 | Bacteria | 1632 |
| 555 | Ga0207650_10351931 | 3300025925 | Bacteria | 1212 |
| 556 | Ga0207650_10824675 | 3300025925 | Unclassified | 786 |
| 557 | Ga0207650_10922573 | 3300025925 | Bacteria | 742 |
| 558 | Ga0207659_10336138 | 3300025926 | Unclassified | 1250 |
| 559 | Ga0207687_10063821 | 3300025927 | Bacteria | 2609 |
| 560 | Ga0207687_10081110 | 3300025927 | Bacteria | 2343 |
| 561 | Ga0207687_10749788 | 3300025927 | Unclassified | 831 |
| 562 | Ga0207644_10001123 | 3300025931 | Bacteria | 17147 |
| 563 | Ga0207644_10044589 | 3300025931 | Bacteria | 3151 |
| 564 | Ga0207644_10395669 | 3300025931 | Unclassified | 1129 |
| 565 | Ga0207706_10210404 | 3300025933 | Bacteria | 1705 |
| 566 | Ga0207706_10416287 | 3300025933 | Bacteria | 1164 |
| 567 | Ga0207686_10000213 | 3300025934 | Bacteria | 44250 |
| 568 | Ga0207686_10001463 | 3300025934 | Bacteria | 13344 |
| 569 | Ga0207686_10008445 | 3300025934 | Bacteria | 5560 |
| 570 | Ga0207686_10184254 | 3300025934 | Bacteria | 1483 |
| 571 | Ga0207686_10477384 | 3300025934 | Bacteria | 963 |
| 572 | Ga0207709_10000043 | 3300025935 | Bacteria | 248179 |
| 573 | Ga0207709_10001862 | 3300025935 | Bacteria | 14034 |
| 574 | Ga0207709_10008615 | 3300025935 | Bacteria | 5632 |
| 575 | Ga0207709_10073682 | 3300025935 | Unclassified | 2176 |
| 576 | Ga0207709_10144807 | 3300025935 | Unclassified | 1638 |
| 577 | Ga0207709_10254029 | 3300025935 | Bacteria | 1285 |
| 578 | Ga0207709_10339551 | 3300025935 | Bacteria | 1130 |
| 579 | Ga0207709_10400745 | 3300025935 | Bacteria | 1049 |
| 580 | Ga0207709_10438804 | 3300025935 | Bacteria | 1007 |
| 581 | Ga0207709_10562597 | 3300025935 | Bacteria | 898 |
| 582 | Ga0207709_10623208 | 3300025935 | Bacteria | 856 |
| 583 | Ga0207709_10744638 | 3300025935 | Unclassified | 787 |
| 584 | Ga0207670_10022723 | 3300025936 | Bacteria | 3892 |
| 585 | Ga0207670_10748956 | 3300025936 | Bacteria | 811 |
| 586 | Ga0207670_10956126 | 3300025936 | Unclassified | 719 |
| 587 | Ga0207669_10149728 | 3300025937 | Bacteria | 1633 |
| 588 | Ga0207704_10045054 | 3300025938 | Unclassified | 2618 |
| 589 | Ga0207704_10996210 | 3300025938 | Bacteria | 708 |
| 590 | Ga0207665_10000002 | 3300025939 | Bacteria | 267895 |
| 591 | Ga0207665_10033905 | 3300025939 | Bacteria | 3387 |
| 592 | Ga0207665_10253720 | 3300025939 | Bacteria | 1301 |
| 593 | Ga0207691_10026908 | 3300025940 | Bacteria | 5396 |
| 594 | Ga0207691_10091705 | 3300025940 | Bacteria | 2722 |
| 595 | Ga0207691_10100406 | 3300025940 | Bacteria | 2583 |
| 596 | Ga0207711_10002872 | 3300025941 | Bacteria | 15101 |
| 597 | Ga0207711_10129992 | 3300025941 | Unclassified | 2257 |
| 598 | Ga0207711_10131163 | 3300025941 | Unclassified | 2247 |
| 599 | Ga0207711_10138904 | 3300025941 | Bacteria | 2185 |
| 600 | Ga0207711_10319473 | 3300025941 | Bacteria | 1434 |
| 601 | Ga0207711_10644229 | 3300025941 | Bacteria | 988 |
| 602 | Ga0207711_10717079 | 3300025941 | Unclassified | 933 |
| 603 | Ga0207711_11193394 | 3300025941 | Unclassified | 702 |
| 604 | Ga0207689_10001120 | 3300025942 | Bacteria | 25840 |
| 605 | Ga0207689_10164040 | 3300025942 | Bacteria | 1831 |
| 606 | Ga0207689_10233478 | 3300025942 | Bacteria | 1520 |
| 607 | Ga0207689_10341031 | 3300025942 | Bacteria | 1245 |
| 608 | Ga0207689_10397317 | 3300025942 | Bacteria | 1149 |
| 609 | Ga0207689_10537900 | 3300025942 | Unclassified | 981 |
| 610 | Ga0207689_10859974 | 3300025942 | Unclassified | 765 |
| 611 | Ga0207689_11142875 | 3300025942 | Bacteria | 656 |
| 612 | Ga0207679_10235801 | 3300025945 | Bacteria | 1547 |
| 613 | Ga0207667_10888810 | 3300025949 | Unclassified | 883 |
| 614 | Ga0207651_10001864 | 3300025960 | Bacteria | 9854 |
| 615 | Ga0207651_10146970 | 3300025960 | Bacteria | 1830 |
| 616 | Ga0207651_10249673 | 3300025960 | Bacteria | 1451 |
| 617 | Ga0207651_10250553 | 3300025960 | Bacteria | 1449 |
| 618 | Ga0207651_10516228 | 3300025960 | Unclassified | 1035 |
| 619 | Ga0207651_10655443 | 3300025960 | Bacteria | 922 |
| 620 | Ga0207651_11190492 | 3300025960 | Unclassified | 684 |
| 621 | Ga0207712_10000313 | 3300025961 | Bacteria | 44454 |
| 622 | Ga0207712_10051616 | 3300025961 | Bacteria | 2877 |
| 623 | Ga0207712_10139210 | 3300025961 | Bacteria | 1860 |
| 624 | Ga0207668_10011459 | 3300025972 | Bacteria | 5388 |
| 625 | Ga0207668_11180746 | 3300025972 | Unclassified | 687 |
| 626 | Ga0207640_10031533 | 3300025981 | Bacteria | 3276 |
| 627 | Ga0207640_10138075 | 3300025981 | Unclassified | 1773 |
| 628 | Ga0207640_10201990 | 3300025981 | Archaea | 1507 |
| 629 | Ga0207640_10828813 | 3300025981 | Unclassified | 803 |
| 630 | Ga0207677_10347177 | 3300026023 | Bacteria | 1242 |
| 631 | Ga0207677_10859654 | 3300026023 | Bacteria | 815 |
| 632 | Ga0207703_10000589 | 3300026035 | Bacteria | 36985 |
| 633 | Ga0207703_10051954 | 3300026035 | Bacteria | 3325 |
| 634 | Ga0207703_10187676 | 3300026035 | Bacteria | 1828 |
| 635 | Ga0207703_10335898 | 3300026035 | Bacteria | 1387 |
| 636 | Ga0207703_10336839 | 3300026035 | Unclassified | 1385 |
| 637 | Ga0207703_10340821 | 3300026035 | Bacteria | 1378 |
| 638 | Ga0207703_10349658 | 3300026035 | Bacteria | 1360 |
| 639 | Ga0207639_10292329 | 3300026041 | Unclassified | 1437 |
| 640 | Ga0207639_10320754 | 3300026041 | Bacteria | 1376 |
| 641 | Ga0207708_10000085 | 3300026075 | Bacteria | 73335 |
| 642 | Ga0207708_10008599 | 3300026075 | Bacteria | 7555 |
| 643 | Ga0207708_10009371 | 3300026075 | Bacteria | 7248 |
| 644 | Ga0207708_10010607 | 3300026075 | Bacteria | 6841 |
| 645 | Ga0207708_10023657 | 3300026075 | Bacteria | 4644 |
| 646 | Ga0207708_10051309 | 3300026075 | Unclassified | 3139 |
| 647 | Ga0207702_10018498 | 3300026078 | Bacteria | 5765 |
| 648 | Ga0207702_10994682 | 3300026078 | Bacteria | 832 |
| 649 | Ga0207641_10199828 | 3300026088 | Bacteria | 1842 |
| 650 | Ga0207641_10227250 | 3300026088 | Unclassified | 1733 |
| 651 | Ga0207641_11095757 | 3300026088 | Unclassified | 795 |
| 652 | Ga0207641_11300084 | 3300026088 | Unclassified | 728 |
| 653 | Ga0207648_10053392 | 3300026089 | Unclassified | 3532 |
| 654 | Ga0207648_10185189 | 3300026089 | Bacteria | 1844 |
| 655 | Ga0207648_10203038 | 3300026089 | Bacteria | 1758 |
| 656 | Ga0207648_10363982 | 3300026089 | Unclassified | 1305 |
| 657 | Ga0207648_11051073 | 3300026089 | Unclassified | 763 |
| 658 | Ga0207676_10051070 | 3300026095 | Unclassified | 3226 |
| 659 | Ga0207676_10242514 | 3300026095 | Bacteria | 1617 |
| 660 | Ga0207676_10440807 | 3300026095 | Bacteria | 1226 |
| 661 | Ga0207676_10443192 | 3300026095 | Unclassified | 1223 |
| 662 | Ga0207676_10541282 | 3300026095 | Bacteria | 1111 |
| 663 | Ga0207676_10568000 | 3300026095 | Unclassified | 1086 |
| 664 | Ga0207676_10573421 | 3300026095 | Bacteria | 1081 |
| 665 | Ga0207676_10921692 | 3300026095 | Unclassified | 858 |
| 666 | Ga0207676_10977445 | 3300026095 | Bacteria | 833 |
| 667 | Ga0207674_10045280 | 3300026116 | Bacteria | 4527 |
| 668 | Ga0207674_10046222 | 3300026116 | Bacteria | 4471 |
| 669 | Ga0207674_10082329 | 3300026116 | Bacteria | 3220 |
| 670 | Ga0207674_10089817 | 3300026116 | Unclassified | 3065 |
| 671 | Ga0207674_10216342 | 3300026116 | Unclassified | 1864 |
| 672 | Ga0207674_10232952 | 3300026116 | Bacteria | 1789 |
| 673 | Ga0207674_10877249 | 3300026116 | Unclassified | 865 |
| 674 | Ga0207674_11033677 | 3300026116 | Unclassified | 791 |
| 675 | Ga0207675_100002974 | 3300026118 | Bacteria | 16670 |
| 676 | Ga0207675_100011224 | 3300026118 | Bacteria | 8390 |
| 677 | Ga0207675_100092237 | 3300026118 | Bacteria | 2848 |
| 678 | Ga0207675_100182689 | 3300026118 | Bacteria | 2009 |
| 679 | Ga0207675_100498183 | 3300026118 | Bacteria | 1212 |
| 680 | Ga0207675_101245788 | 3300026118 | Bacteria | 764 |
| 681 | Ga0207675_101458887 | 3300026118 | Bacteria | 705 |
| 682 | Ga0207698_10070175 | 3300026142 | Unclassified | 2775 |
| 683 | Ga0207698_10629901 | 3300026142 | Bacteria | 1060 |
| 684 | Ga0209588_1011796 | 3300027671 | Bacteria | 2646 |
| 685 | Ga0207428_10046280 | 3300027907 | Unclassified | 3499 |
| 686 | Ga0207428_10185943 | 3300027907 | Bacteria | 1568 |
| 687 | Ga0207428_10404278 | 3300027907 | Bacteria | 999 |
| 688 | Ga0268265_10125141 | 3300028380 | Bacteria | 2126 |
| 689 | Ga0268265_10139955 | 3300028380 | Unclassified | 2025 |
| 690 | Ga0268264_10029011 | 3300028381 | Unclassified | 4530 |
| 691 | Ga0268264_10078678 | 3300028381 | Unclassified | 2812 |
| 692 | Ga0268264_10113800 | 3300028381 | Unclassified | 2374 |
| 693 | Ga0268264_10138585 | 3300028381 | Unclassified | 2166 |
| 694 | Ga0268264_10302645 | 3300028381 | Bacteria | 1506 |
| 695 | Ga0268264_10345621 | 3300028381 | Bacteria | 1414 |
| 696 | Ga0268264_10358598 | 3300028381 | Bacteria | 1390 |
| 697 | Ga0268264_10585586 | 3300028381 | Bacteria | 1098 |
| 698 | Ga0268264_10683324 | 3300028381 | Bacteria | 1018 |
| 699 | Ga0268264_10695598 | 3300028381 | Unclassified | 1009 |
| 700 | Ga0307515_10130680 | 3300028794 | Bacteria | 2769 |
| 701 | Ga0307408_100023709 | 3300031548 | Bacteria | 4183 |
| 702 | Ga0307408_100364739 | 3300031548 | Bacteria | 1230 |
| 703 | Ga0307405_10015262 | 3300031731 | Bacteria | 4156 |
| 704 | Ga0307405_10185467 | 3300031731 | Bacteria | 1497 |
| 705 | Ga0307406_10020665 | 3300031901 | Bacteria | 3881 |
| 706 | Ga0307407_10919226 | 3300031903 | Bacteria | 672 |
| 707 | Ga0307412_10151953 | 3300031911 | Bacteria | 1709 |
| 708 | Ga0307412_10207719 | 3300031911 | Bacteria | 1492 |
| 709 | Ga0307409_100162534 | 3300031995 | Bacteria | 1955 |
| 710 | Ga0307409_100343663 | 3300031995 | Bacteria | 1405 |
| 711 | Ga0307409_101651106 | 3300031995 | Bacteria | 669 |
| 712 | Ga0307416_100244826 | 3300032002 | Bacteria | 1740 |
| 713 | Ga0307416_100267912 | 3300032002 | Bacteria | 1675 |
| 714 | Ga0307416_100696220 | 3300032002 | Bacteria | 1105 |
| 715 | Ga0307416_100711682 | 3300032002 | Bacteria | 1094 |
| 716 | Ga0307414_10107514 | 3300032004 | Bacteria | 2114 |
| 717 | Ga0307414_10142321 | 3300032004 | Bacteria | 1879 |
| 718 | Ga0307411_10059733 | 3300032005 | Bacteria | 2529 |
| 719 | Ga0307415_100001042 | 3300032126 | Bacteria | 12862 |
| 720 | Ga0307415_100055008 | 3300032126 | Bacteria | 2720 |
| 721 | Ga0373951_0005408 | 3300035091 | Bacteria | 2968 |
| 722 | Ga0373951_0101641 | 3300035091 | Unclassified | 765 |
| 723 | Ga0373952_0076197 | 3300035092 | Unclassified | 848 |
| 724 | Ga0373941_0014333 | 3300035115 | Bacteria | 2115 |
| 725 | Ga0373942_0005319 | 3300035207 | Bacteria | 2985 |
| 726 | Ga0373962_0053118 | 3300035242 | Unclassified | 1172 |
| 727 | Ga0395899_0364991 | 3300037312 | Unclassified | 963 |
| 728 | Ga0395900_0095130 | 3300037418 | Bacteria | 3061 |
| 729 | Ga0395900_0710185 | 3300037418 | Bacteria | 938 |
| 730 | Ga0395898_0197372 | 3300037466 | Bacteria | 1922 |
| 731 | Ga0395905_0418312 | 3300037471 | Bacteria | 1236 |
| 732 | Ga0395905_0652669 | 3300037471 | Bacteria | 954 |
| 733 | Ga0395901_0227966 | 3300038443 | Bacteria | 1946 |
| 734 | Ga0395901_0887711 | 3300038443 | Unclassified | 874 |
| 735 | Ga0242420_000869 | 3300038996 | Unclassified | 3734 |
| 736 | Ga0242420_001479 | 3300038996 | Bacteria | 3141 |
| 737 | Ga0439439_0150111 | 3300041406 | Unclassified | 661 |
| 738 | Ga0439448_0097642 | 3300042005 | Unclassified | 996 |
| 739 | Ga0439454_044078 | 3300042011 | Unclassified | 737 |
| 740 | Ga0451576_0021603 | 3300045051 | Bacteria | 6993 |
| 741 | Ga0451576_0824685 | 3300045051 | Bacteria | 974 |
| 742 | Ga0495662_0392878 | 3300046476 | Bacteria | 681 |
| 743 | Ga0495664_0412879 | 3300046477 | Bacteria | 810 |
| 744 | Ga0495584_0194905 | 3300046491 | Bacteria | 1030 |
| 745 | Ga0495618_0223932 | 3300046514 | Unclassified | 1186 |
| 746 | Ga0495620_0331790 | 3300046515 | Unclassified | 577 |
| 747 | Ga0495663_0000102 | 3300046525 | Bacteria | 35062 |
| 748 | Ga0495586_0225744 | 3300046535 | Bacteria | 1065 |
| 749 | Ga0495598_0000045 | 3300046537 | Bacteria | 18787 |
| 750 | Ga0495621_0001069 | 3300046539 | Bacteria | 7016 |
| 751 | Ga0495621_0044684 | 3300046539 | Bacteria | 1567 |
| 752 | Ga0495621_0113655 | 3300046539 | Bacteria | 1040 |
| 753 | Ga0495633_0113752 | 3300046558 | Bacteria | 1255 |
| 754 | Ga0495659_0023396 | 3300046664 | Bacteria | 2099 |
| 755 | Ga0495670_0409232 | 3300046691 | Bacteria | 733 |
| 756 | Ga0495636_0072428 | 3300047318 | Bacteria | 1473 |
| 757 | Ga0495684_0025216 | 3300047471 | Bacteria | 4572 |
| 758 | Ga0496103_0718748 | 3300048906 | Unclassified | 633 |
| 759 | Ga0496104_0069219 | 3300048907 | Bacteria | 3354 |
| 760 | Ga0496104_0748617 | 3300048907 | Unclassified | 884 |
| 761 | Ga0496106_0002129 | 3300048909 | Bacteria | 14798 |
| 762 | Ga0496106_0181264 | 3300048909 | Bacteria | 1672 |
| 763 | Ga0496106_0268811 | 3300048909 | Unclassified | 1365 |
| 764 | Ga0496108_0090894 | 3300048911 | Unclassified | 2595 |
| 765 | Ga0496108_0694832 | 3300048911 | Unclassified | 882 |
| 766 | Ga0496109_0661929 | 3300048912 | Unclassified | 981 |
| 767 | Ga0496110_0438152 | 3300048913 | Bacteria | 1191 |
| 768 | Ga0496111_0821176 | 3300048914 | Bacteria | 672 |
| 769 | Ga0496113_0248447 | 3300048916 | Bacteria | 1420 |
| 770 | Ga0496113_0582224 | 3300048916 | Unclassified | 897 |
| 771 | Ga0501343_017701 | 3300049132 | Bacteria | 617 |
| 772 | Ga0501290_006877 | 3300049513 | Bacteria | 1425 |
| 773 | Ga0501290_008424 | 3300049513 | Bacteria | 1303 |
| 774 | Ga0501296_035696 | 3300049519 | Unclassified | 685 |
| 775 | Ga0501298_017284 | 3300049521 | Bacteria | 1315 |
| 776 | Ga0501298_042136 | 3300049521 | Bacteria | 928 |
| 777 | Ga0501298_059722 | 3300049521 | Bacteria | 805 |
| 778 | Ga0501303_001987 | 3300049526 | Bacteria | 1556 |
| 779 | Ga0501336_024380 | 3300049552 | Unclassified | 567 |
| 780 | Ga0501038_0003131 | 3300049574 | Bacteria | 15433 |
| 781 | Ga0501041_0479926 | 3300049577 | Unclassified | 790 |
| 782 | Ga0501075_0361950 | 3300049591 | Bacteria | 1106 |
| 783 | Ga0501198_002039 | 3300049649 | Bacteria | 2690 |
| 784 | Ga0501206_014800 | 3300049653 | Bacteria | 1075 |
| 785 | Ga0501207_001168 | 3300049654 | Bacteria | 3224 |
| 786 | Ga0501207_017355 | 3300049654 | Bacteria | 1123 |
| 787 | Ga0501217_002407 | 3300049661 | Bacteria | 3681 |
| 788 | Ga0501217_073373 | 3300049661 | Bacteria | 935 |
| 789 | Ga0501223_010828 | 3300049663 | Bacteria | 1831 |
| 790 | Ga0501223_013955 | 3300049663 | Bacteria | 1596 |
| 791 | Ga0501223_015989 | 3300049663 | Bacteria | 1485 |
| 792 | Ga0501224_047217 | 3300049664 | Unclassified | 656 |
| 793 | Ga0501227_003359 | 3300049665 | Bacteria | 3471 |
| 794 | Ga0501227_015868 | 3300049665 | Bacteria | 1686 |
| 795 | Ga0501227_021631 | 3300049665 | Bacteria | 1484 |
| 796 | Ga0501233_002570 | 3300049668 | Bacteria | 3207 |
| 797 | Ga0501233_111268 | 3300049668 | Unclassified | 733 |
| 798 | Ga0501235_041801 | 3300049669 | Bacteria | 1049 |
| 799 | Ga0501235_042550 | 3300049669 | Bacteria | 1041 |
| 800 | Ga0501236_011644 | 3300049670 | Bacteria | 1172 |
| 801 | Ga0501239_003158 | 3300049672 | Unclassified | 1550 |
| 802 | Ga0501239_022936 | 3300049672 | Bacteria | 777 |
| 803 | Ga0501243_015224 | 3300049675 | Bacteria | 1235 |
| 804 | Ga0501246_015326 | 3300049676 | Unclassified | 746 |
| 805 | Ga0501249_004934 | 3300049679 | Bacteria | 2722 |
| 806 | Ga0501249_019923 | 3300049679 | Bacteria | 1457 |
| 807 | Ga0501253_077273 | 3300049683 | Bacteria | 745 |
| 808 | Ga0501253_164456 | 3300049683 | Unclassified | 568 |
| 809 | Ga0501256_001805 | 3300049685 | Bacteria | 1635 |
| 810 | Ga0501257_029768 | 3300049686 | Bacteria | 1313 |
| 811 | Ga0501259_006271 | 3300049688 | Bacteria | 1890 |
| 812 | Ga0501260_001506 | 3300049689 | Bacteria | 1930 |
| 813 | Ga0501261_007428 | 3300049690 | Bacteria | 1407 |
| 814 | Ga0501221_136113 | 3300049704 | Unclassified | 640 |
| 815 | Ga0501225_0028709 | 3300049705 | Bacteria | 1528 |
| 816 | Ga0501225_0045111 | 3300049705 | Bacteria | 1220 |
| 817 | Ga0501229_002858 | 3300049706 | Bacteria | 2044 |
| 818 | Ga0501229_026960 | 3300049706 | Bacteria | 776 |
| 819 | Ga0501234_010392 | 3300049707 | Bacteria | 1450 |
| 820 | Ga0501234_012464 | 3300049707 | Bacteria | 1331 |
| 821 | Ga0501245_014386 | 3300049708 | Bacteria | 1180 |
| 822 | Ga0501079_0940216 | 3300049741 | Unclassified | 681 |
| 823 | Ga0501265_117091 | 3300049762 | Unclassified | 503 |
| 824 | Ga0501268_037245 | 3300049765 | Unclassified | 904 |
| 825 | Ga0501273_039176 | 3300049770 | Unclassified | 697 |
| 826 | Ga0501283_020180 | 3300049779 | Bacteria | 1061 |
| 827 | Ga0501212_016452 | 3300049851 | Bacteria | 1111 |
| 828 | Ga0501226_002497 | 3300049853 | Bacteria | 2244 |
| 829 | Ga0501226_011490 | 3300049853 | Bacteria | 980 |
| 830 | nmdc:mga05p37_1049366_c1 | 3300050507 | Unclassified | 860 |
| 831 | nmdc:mga05p37_121550_c1 | 3300050507 | Bacteria | 3207 |
| 832 | nmdc:mga05p37_18640_c1 | 3300050507 | Bacteria | 8387 |
| 833 | nmdc:mga05p37_201156_c1 | 3300050507 | Bacteria | 2413 |
| 834 | nmdc:mga05p37_21005_c1 | 3300050507 | Bacteria | 7902 |
| 835 | nmdc:mga05p37_339813_c1 | 3300050507 | Bacteria | 1771 |
| 836 | nmdc:mga05p37_342066_c1 | 3300050507 | Bacteria | 1764 |
| 837 | nmdc:mga09592_320229_c1 | 3300050508 | Bacteria | 1343 |
| 838 | nmdc:mga0qj67_542007_c1 | 3300050509 | Bacteria | 934 |
| 839 | nmdc:mga0qj67_681623_c1 | 3300050509 | Bacteria | 819 |
| 840 | nmdc:mga06r32_45384_c1 | 3300050510 | Unclassified | 4188 |
| 841 | nmdc:mga06r32_638660_c1 | 3300050510 | Bacteria | 1033 |
| 842 | nmdc:mga06r32_92427_c1 | 3300050510 | Bacteria | 2958 |
| 843 | nmdc:mga08y16_133194_c1 | 3300050511 | Bacteria | 2584 |
| 844 | nmdc:mga08y16_36966_c1 | 3300050511 | Bacteria | 5128 |
| 845 | nmdc:mga08y16_412715_c1 | 3300050511 | Unclassified | 1381 |
| 846 | nmdc:mga08y16_4491_c1 | 3300050511 | Bacteria | 14580 |
| 847 | nmdc:mga08y16_85485_c1 | 3300050511 | Bacteria | 3287 |
| 848 | nmdc:mga0n895_155882_c1 | 3300050512 | Bacteria | 2314 |
| 849 | nmdc:mga0n895_212834_c1 | 3300050512 | Bacteria | 1963 |
| 850 | nmdc:mga0n895_346216_c1 | 3300050512 | Bacteria | 1505 |
| 851 | nmdc:mga0n895_371925_c1 | 3300050512 | Bacteria | 1447 |
| 852 | nmdc:mga0n895_397297_c1 | 3300050512 | Unclassified | 1394 |
| 853 | nmdc:mga0n895_46834_c1 | 3300050512 | Unclassified | 4226 |
| 854 | nmdc:mga0n895_686566_c1 | 3300050512 | Unclassified | 1021 |
| 855 | nmdc:mga0n895_87094_c1 | 3300050512 | Bacteria | 3120 |
| 856 | nmdc:mga0n895_949785_c1 | 3300050512 | Unclassified | 843 |
| 857 | nmdc:mga0rr50_265_c1 | 3300050513 | Bacteria | 28369 |
| 858 | nmdc:mga08x19_3_c1 | 3300050514 | Bacteria | 654433 |
| 859 | nmdc:mga08x19_46140_c1 | 3300050514 | Bacteria | 2786 |
| 860 | nmdc:mga0a205_108513_c1 | 3300050515 | Bacteria | 2674 |
| 861 | nmdc:mga0a205_120934_c1 | 3300050515 | Bacteria | 2518 |
| 862 | nmdc:mga0a205_173253_c1 | 3300050515 | Bacteria | 2054 |
| 863 | nmdc:mga0a205_174009_c1 | 3300050515 | Bacteria | 2048 |
| 864 | nmdc:mga0a205_214949_c1 | 3300050515 | Bacteria | 1810 |
| 865 | nmdc:mga0a205_326388_c1 | 3300050515 | Bacteria | 1405 |
| 866 | nmdc:mga0a205_394294_c1 | 3300050515 | Unclassified | 1248 |
| 867 | nmdc:mga0a205_396553_c1 | 3300050515 | Bacteria | 1244 |
| 868 | nmdc:mga0a205_44102_c2 | 3300050515 | Bacteria | 2042 |
| 869 | nmdc:mga0a205_91364_c1 | 3300050515 | Unclassified | 2942 |
| 870 | Ga0587091_091434 | 3300059511 | Bacteria | 699 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_10003875 | Ga0114129_1000387516 | 137 |
| 2 | 3300050507 | nmdc:mga05p37_201156_c1 | nmdc:mga05p37_201156_c1_1442_2038 | 137 |
| 3 | 3300050515 | nmdc:mga0a205_108513_c1 | nmdc:mga0a205_108513_c1_1181_1777 | 137 |
| 4 | 3300025922 | Ga0207646_10137432 | Ga0207646_101374323 | 138 |
| 5 | 3300005546 | Ga0070696_100427989 | Ga0070696_1004279891 | 140 |
| 6 | 3300005549 | Ga0070704_100124072 | Ga0070704_1001240723 | 140 |
| 7 | 3300026023 | Ga0207677_10859654 | Ga0207677_108596541 | 140 |
| 8 | 3300005468 | Ga0070707_100022287 | Ga0070707_10002228711 | 141 |
| 9 | 3300005549 | Ga0070704_100028893 | Ga0070704_1000288935 | 141 |
| 10 | 3300025922 | Ga0207646_10034457 | Ga0207646_100344572 | 141 |
| 11 | 3300013308 | Ga0157375_10205014 | Ga0157375_102050142 | 143 |
| 12 | 3300049704 | Ga0501221_136113 | Ga0501221_136113_153_620 | 143 |
| 13 | 3300049762 | Ga0501265_117091 | Ga0501265_117091_21_488 | 143 |
| 14 | 3300014326 | Ga0157380_10471668 | Ga0157380_104716682 | 144 |
| 15 | 3300049577 | Ga0501041_0479926 | Ga0501041_0479926_155_676 | 144 |
| 16 | 3300049741 | Ga0501079_0940216 | Ga0501079_0940216_102_623 | 144 |
| 17 | 3300005355 | Ga0070671_100004622 | Ga0070671_10000462210 | 145 |
| 18 | 3300005617 | Ga0068859_100659834 | Ga0068859_1006598342 | 145 |
| 19 | 3300006931 | Ga0097620_100659853 | Ga0097620_1006598532 | 145 |
| 20 | 3300025931 | Ga0207644_10044589 | Ga0207644_100445893 | 145 |
| 21 | 3300049591 | Ga0501075_0361950 | Ga0501075_0361950_285_806 | 145 |
| 22 | 3300005444 | Ga0070694_100326556 | Ga0070694_1003265562 | 146 |
| 23 | 3300005456 | Ga0070678_100848848 | Ga0070678_1008488481 | 146 |
| 24 | 3300005546 | Ga0070696_100139713 | Ga0070696_1001397132 | 146 |
| 25 | 3300009148 | Ga0105243_11330427 | Ga0105243_113304271 | 146 |
| 26 | 3300009174 | Ga0105241_11298556 | Ga0105241_112985562 | 146 |
| 27 | 3300005340 | Ga0070689_100400688 | Ga0070689_1004006882 | 147 |
| 28 | 3300005444 | Ga0070694_100019253 | Ga0070694_1000192535 | 147 |
| 29 | 3300005544 | Ga0070686_100068604 | Ga0070686_1000686043 | 147 |
| 30 | 3300005617 | Ga0068859_100536970 | Ga0068859_1005369702 | 147 |
| 31 | 3300005843 | Ga0068860_100729933 | Ga0068860_1007299332 | 147 |
| 32 | 3300006931 | Ga0097620_100536993 | Ga0097620_1005369931 | 147 |
| 33 | 3300009098 | Ga0105245_10214890 | Ga0105245_102148902 | 147 |
| 34 | 3300009148 | Ga0105243_10154763 | Ga0105243_101547634 | 147 |
| 35 | 3300009176 | Ga0105242_10002537 | Ga0105242_1000253717 | 147 |
| 36 | 3300009177 | Ga0105248_10015021 | Ga0105248_100150216 | 147 |
| 37 | 3300009177 | Ga0105248_10193172 | Ga0105248_101931724 | 147 |
| 38 | 3300011119 | Ga0105246_10497001 | Ga0105246_104970012 | 147 |
| 39 | 3300013297 | Ga0157378_10107731 | Ga0157378_101077312 | 147 |
| 40 | 3300013306 | Ga0163162_10056960 | Ga0163162_100569602 | 147 |
| 41 | 3300017792 | Ga0163161_10233216 | Ga0163161_102332162 | 147 |
| 42 | 3300017792 | Ga0163161_10280313 | Ga0163161_102803131 | 147 |
| 43 | 3300025927 | Ga0207687_10749788 | Ga0207687_107497881 | 147 |
| 44 | 3300025934 | Ga0207686_10001463 | Ga0207686_100014637 | 147 |
| 45 | 3300025935 | Ga0207709_10073682 | Ga0207709_100736824 | 147 |
| 46 | 3300025938 | Ga0207704_10996210 | Ga0207704_109962102 | 147 |
| 47 | 3300025941 | Ga0207711_10129992 | Ga0207711_101299922 | 147 |
| 48 | 3300025960 | Ga0207651_10250553 | Ga0207651_102505532 | 147 |
| 49 | 3300025960 | Ga0207651_11190492 | Ga0207651_111904921 | 147 |
| 50 | 3300026088 | Ga0207641_11300084 | Ga0207641_113000841 | 147 |
| 51 | 3300028381 | Ga0268264_10683324 | Ga0268264_106833241 | 147 |
| 52 | 3300028381 | Ga0268264_10695598 | Ga0268264_106955982 | 147 |
| 53 | 3300046476 | Ga0495662_0392878 | Ga0495662_0392878_102_629 | 147 |
| 54 | 3300046477 | Ga0495664_0412879 | Ga0495664_0412879_130_633 | 147 |
| 55 | 3300046514 | Ga0495618_0223932 | Ga0495618_0223932_415_942 | 147 |
| 56 | 3300046535 | Ga0495586_0225744 | Ga0495586_0225744_79_606 | 147 |
| 57 | 3300047471 | Ga0495684_0025216 | Ga0495684_0025216_1056_1583 | 147 |
| 58 | 3300005293 | Ga0065715_10390024 | Ga0065715_103900242 | 148 |
| 59 | 3300005340 | Ga0070689_100781539 | Ga0070689_1007815391 | 148 |
| 60 | 3300005343 | Ga0070687_100049129 | Ga0070687_1000491293 | 148 |
| 61 | 3300005364 | Ga0070673_101129279 | Ga0070673_1011292792 | 148 |
| 62 | 3300005406 | Ga0070703_10000348 | Ga0070703_100003488 | 148 |
| 63 | 3300005441 | Ga0070700_100023717 | Ga0070700_1000237174 | 148 |
| 64 | 3300005445 | Ga0070708_100053571 | Ga0070708_1000535714 | 148 |
| 65 | 3300005445 | Ga0070708_100418170 | Ga0070708_1004181702 | 148 |
| 66 | 3300005471 | Ga0070698_100049814 | Ga0070698_1000498145 | 148 |
| 67 | 3300005518 | Ga0070699_101152460 | Ga0070699_1011524601 | 148 |
| 68 | 3300005544 | Ga0070686_100009294 | Ga0070686_1000092946 | 148 |
| 69 | 3300005544 | Ga0070686_100185703 | Ga0070686_1001857032 | 148 |
| 70 | 3300005616 | Ga0068852_100182908 | Ga0068852_1001829083 | 148 |
| 71 | 3300005617 | Ga0068859_100070551 | Ga0068859_1000705513 | 148 |
| 72 | 3300005719 | Ga0068861_100178797 | Ga0068861_1001787971 | 148 |
| 73 | 3300005842 | Ga0068858_100099350 | Ga0068858_1000993503 | 148 |
| 74 | 3300005843 | Ga0068860_100826375 | Ga0068860_1008263752 | 148 |
| 75 | 3300005843 | Ga0068860_100838899 | Ga0068860_1008388991 | 148 |
| 76 | 3300005844 | Ga0068862_100144461 | Ga0068862_1001444612 | 148 |
| 77 | 3300006847 | Ga0075431_100765689 | Ga0075431_1007656892 | 148 |
| 78 | 3300006881 | Ga0068865_100176463 | Ga0068865_1001764633 | 148 |
| 79 | 3300006931 | Ga0097620_100070561 | Ga0097620_1000705613 | 148 |
| 80 | 3300009094 | Ga0111539_10109329 | Ga0111539_101093292 | 148 |
| 81 | 3300009101 | Ga0105247_10682445 | Ga0105247_106824452 | 148 |
| 82 | 3300009147 | Ga0114129_10010589 | Ga0114129_1001058912 | 148 |
| 83 | 3300009147 | Ga0114129_10027104 | Ga0114129_100271045 | 148 |
| 84 | 3300009147 | Ga0114129_11269770 | Ga0114129_112697701 | 148 |
| 85 | 3300009148 | Ga0105243_10000428 | Ga0105243_1000042819 | 148 |
| 86 | 3300009148 | Ga0105243_10774210 | Ga0105243_107742102 | 148 |
| 87 | 3300009176 | Ga0105242_10000227 | Ga0105242_1000022721 | 148 |
| 88 | 3300009176 | Ga0105242_11796142 | Ga0105242_117961421 | 148 |
| 89 | 3300009177 | Ga0105248_10102180 | Ga0105248_101021805 | 148 |
| 90 | 3300009553 | Ga0105249_10089092 | Ga0105249_100890924 | 148 |
| 91 | 3300011119 | Ga0105246_10723447 | Ga0105246_107234472 | 148 |
| 92 | 3300013297 | Ga0157378_10007638 | Ga0157378_100076388 | 148 |
| 93 | 3300013297 | Ga0157378_11052956 | Ga0157378_110529561 | 148 |
| 94 | 3300013308 | Ga0157375_10363757 | Ga0157375_103637573 | 148 |
| 95 | 3300014745 | Ga0157377_10230678 | Ga0157377_102306782 | 148 |
| 96 | 3300025885 | Ga0207653_10000180 | Ga0207653_1000018032 | 148 |
| 97 | 3300025900 | Ga0207710_10321549 | Ga0207710_103215492 | 148 |
| 98 | 3300025918 | Ga0207662_10045155 | Ga0207662_100451553 | 148 |
| 99 | 3300025931 | Ga0207644_10395669 | Ga0207644_103956692 | 148 |
| 100 | 3300025934 | Ga0207686_10000213 | Ga0207686_1000021321 | 148 |
| 101 | 3300025935 | Ga0207709_10000043 | Ga0207709_1000004321 | 148 |
| 102 | 3300025935 | Ga0207709_10144807 | Ga0207709_101448072 | 148 |
| 103 | 3300025936 | Ga0207670_10956126 | Ga0207670_109561262 | 148 |
| 104 | 3300025938 | Ga0207704_10045054 | Ga0207704_100450541 | 148 |
| 105 | 3300025941 | Ga0207711_10131163 | Ga0207711_101311633 | 148 |
| 106 | 3300025942 | Ga0207689_10537900 | Ga0207689_105379002 | 148 |
| 107 | 3300025960 | Ga0207651_10249673 | Ga0207651_102496732 | 148 |
| 108 | 3300026035 | Ga0207703_10336839 | Ga0207703_103368392 | 148 |
| 109 | 3300026075 | Ga0207708_10009371 | Ga0207708_1000937112 | 148 |
| 110 | 3300026088 | Ga0207641_10227250 | Ga0207641_102272502 | 148 |
| 111 | 3300026095 | Ga0207676_10440807 | Ga0207676_104408072 | 148 |
| 112 | 3300026116 | Ga0207674_10046222 | Ga0207674_100462223 | 148 |
| 113 | 3300026118 | Ga0207675_101458887 | Ga0207675_1014588871 | 148 |
| 114 | 3300027907 | Ga0207428_10185943 | Ga0207428_101859431 | 148 |
| 115 | 3300028380 | Ga0268265_10139955 | Ga0268265_101399551 | 148 |
| 116 | 3300028381 | Ga0268264_10138585 | Ga0268264_101385854 | 148 |
| 117 | 3300028381 | Ga0268264_10358598 | Ga0268264_103585983 | 148 |
| 118 | 3300046539 | Ga0495621_0044684 | Ga0495621_0044684_407_922 | 148 |
| 119 | 3300046558 | Ga0495633_0113752 | Ga0495633_0113752_430_945 | 148 |
| 120 | 3300046664 | Ga0495659_0023396 | Ga0495659_0023396_889_1404 | 148 |
| 121 | 3300046691 | Ga0495670_0409232 | Ga0495670_0409232_32_547 | 148 |
| 122 | 3300049521 | Ga0501298_042136 | Ga0501298_042136_124_627 | 148 |
| 123 | 3300050507 | nmdc:mga05p37_121550_c1 | nmdc:mga05p37_121550_c1_2623_3108 | 148 |
| 124 | 3300050507 | nmdc:mga05p37_342066_c1 | nmdc:mga05p37_342066_c1_55_570 | 148 |
| 125 | 3300050510 | nmdc:mga06r32_638660_c1 | nmdc:mga06r32_638660_c1_441_956 | 148 |
| 126 | 3300050511 | nmdc:mga08y16_133194_c1 | nmdc:mga08y16_133194_c1_25_537 | 148 |
| 127 | 3300050515 | nmdc:mga0a205_173253_c1 | nmdc:mga0a205_173253_c1_645_1130 | 148 |
| 128 | 3300050515 | nmdc:mga0a205_44102_c2 | nmdc:mga0a205_44102_c2_809_1324 | 148 |
| 129 | 3300001426 | JGI24030J14995_101492 | JGI24030J14995_1014921 | 149 |
| 130 | 3300002074 | JGI24748J21848_1000002 | JGI24748J21848_100000217 | 149 |
| 131 | 3300002239 | JGI24034J26672_10000004 | JGI24034J26672_10000004355 | 149 |
| 132 | 3300005293 | Ga0065715_10146354 | Ga0065715_101463542 | 149 |
| 133 | 3300005338 | Ga0068868_100071693 | Ga0068868_1000716932 | 149 |
| 134 | 3300005355 | Ga0070671_100033088 | Ga0070671_1000330882 | 149 |
| 135 | 3300005440 | Ga0070705_100653747 | Ga0070705_1006537471 | 149 |
| 136 | 3300005459 | Ga0068867_100378510 | Ga0068867_1003785102 | 149 |
| 137 | 3300005468 | Ga0070707_100113249 | Ga0070707_1001132492 | 149 |
| 138 | 3300005468 | Ga0070707_100469950 | Ga0070707_1004699502 | 149 |
| 139 | 3300005471 | Ga0070698_100633759 | Ga0070698_1006337592 | 149 |
| 140 | 3300005518 | Ga0070699_100586630 | Ga0070699_1005866302 | 149 |
| 141 | 3300005536 | Ga0070697_100067440 | Ga0070697_1000674403 | 149 |
| 142 | 3300005536 | Ga0070697_100494570 | Ga0070697_1004945702 | 149 |
| 143 | 3300005543 | Ga0070672_100196797 | Ga0070672_1001967972 | 149 |
| 144 | 3300005545 | Ga0070695_100180658 | Ga0070695_1001806582 | 149 |
| 145 | 3300005545 | Ga0070695_101169153 | Ga0070695_1011691531 | 149 |
| 146 | 3300005577 | Ga0068857_101062801 | Ga0068857_1010628012 | 149 |
| 147 | 3300005615 | Ga0070702_100014931 | Ga0070702_1000149313 | 149 |
| 148 | 3300005617 | Ga0068859_100225683 | Ga0068859_1002256832 | 149 |
| 149 | 3300005617 | Ga0068859_100563409 | Ga0068859_1005634092 | 149 |
| 150 | 3300005718 | Ga0068866_10135793 | Ga0068866_101357933 | 149 |
| 151 | 3300005719 | Ga0068861_100008887 | Ga0068861_1000088876 | 149 |
| 152 | 3300005842 | Ga0068858_100002375 | Ga0068858_1000023758 | 149 |
| 153 | 3300006852 | Ga0075433_10007251 | Ga0075433_100072518 | 149 |
| 154 | 3300006871 | Ga0075434_100158918 | Ga0075434_1001589183 | 149 |
| 155 | 3300006871 | Ga0075434_100364079 | Ga0075434_1003640792 | 149 |
| 156 | 3300006880 | Ga0075429_100524686 | Ga0075429_1005246862 | 149 |
| 157 | 3300006914 | Ga0075436_100000015 | Ga0075436_10000001516 | 149 |
| 158 | 3300006931 | Ga0097620_100225692 | Ga0097620_1002256922 | 149 |
| 159 | 3300006931 | Ga0097620_100563442 | Ga0097620_1005634422 | 149 |
| 160 | 3300007076 | Ga0075435_100000410 | Ga0075435_10000041020 | 149 |
| 161 | 3300009098 | Ga0105245_10085681 | Ga0105245_100856813 | 149 |
| 162 | 3300009101 | Ga0105247_10000005 | Ga0105247_10000005345 | 149 |
| 163 | 3300009147 | Ga0114129_10792635 | Ga0114129_107926351 | 149 |
| 164 | 3300009148 | Ga0105243_10002722 | Ga0105243_100027228 | 149 |
| 165 | 3300009176 | Ga0105242_10000507 | Ga0105242_100005076 | 149 |
| 166 | 3300009553 | Ga0105249_10062428 | Ga0105249_100624284 | 149 |
| 167 | 3300010375 | Ga0105239_10018470 | Ga0105239_100184701 | 149 |
| 168 | 3300012495 | Ga0157323_1008116 | Ga0157323_10081161 | 149 |
| 169 | 3300013100 | Ga0157373_10149997 | Ga0157373_101499972 | 149 |
| 170 | 3300013297 | Ga0157378_10000067 | Ga0157378_1000006714 | 149 |
| 171 | 3300013297 | Ga0157378_10128573 | Ga0157378_101285732 | 149 |
| 172 | 3300013297 | Ga0157378_10436132 | Ga0157378_104361322 | 149 |
| 173 | 3300013306 | Ga0163162_10001341 | Ga0163162_100013419 | 149 |
| 174 | 3300013308 | Ga0157375_10005624 | Ga0157375_100056248 | 149 |
| 175 | 3300014968 | Ga0157379_10080571 | Ga0157379_100805713 | 149 |
| 176 | 3300025223 | Ga0207672_1000315 | Ga0207672_10003155 | 149 |
| 177 | 3300025899 | Ga0207642_10171638 | Ga0207642_101716381 | 149 |
| 178 | 3300025900 | Ga0207710_10000004 | Ga0207710_10000004343 | 149 |
| 179 | 3300025922 | Ga0207646_10185089 | Ga0207646_101850894 | 149 |
| 180 | 3300025922 | Ga0207646_10618865 | Ga0207646_106188652 | 149 |
| 181 | 3300025923 | Ga0207681_10676149 | Ga0207681_106761491 | 149 |
| 182 | 3300025927 | Ga0207687_10063821 | Ga0207687_100638212 | 149 |
| 183 | 3300025931 | Ga0207644_10001123 | Ga0207644_100011232 | 149 |
| 184 | 3300025934 | Ga0207686_10008445 | Ga0207686_100084455 | 149 |
| 185 | 3300025935 | Ga0207709_10001862 | Ga0207709_100018628 | 149 |
| 186 | 3300025939 | Ga0207665_10033905 | Ga0207665_100339052 | 149 |
| 187 | 3300026035 | Ga0207703_10000589 | Ga0207703_1000058925 | 149 |
| 188 | 3300026089 | Ga0207648_10363982 | Ga0207648_103639822 | 149 |
| 189 | 3300026118 | Ga0207675_100002974 | Ga0207675_10000297416 | 149 |
| 190 | 3300038996 | Ga0242420_000869 | Ga0242420_000869_1345_1863 | 149 |
| 191 | 3300045051 | Ga0451576_0021603 | Ga0451576_0021603_4610_5206 | 149 |
| 192 | 3300047318 | Ga0495636_0072428 | Ga0495636_0072428_916_1434 | 149 |
| 193 | 3300048909 | Ga0496106_0002129 | Ga0496106_0002129_9045_9641 | 149 |
| 194 | 3300050512 | nmdc:mga0n895_46834_c1 | nmdc:mga0n895_46834_c1_3383_3901 | 149 |
| 195 | 3300050513 | nmdc:mga0rr50_265_c1 | nmdc:mga0rr50_265_c1_11967_12488 | 149 |
| 196 | 3300050514 | nmdc:mga08x19_3_c1 | nmdc:mga08x19_3_c1_13206_13727 | 149 |
| 197 | 3300050515 | nmdc:mga0a205_394294_c1 | nmdc:mga0a205_394294_c1_700_1218 | 149 |
| 198 | 3300050515 | nmdc:mga0a205_91364_c1 | nmdc:mga0a205_91364_c1_659_1255 | 149 |
| 199 | 3300005290 | Ga0065712_10022101 | Ga0065712_100221012 | 150 |
| 200 | 3300005290 | Ga0065712_10124288 | Ga0065712_101242881 | 150 |
| 201 | 3300005293 | Ga0065715_10124138 | Ga0065715_101241382 | 150 |
| 202 | 3300005331 | Ga0070670_100000288 | Ga0070670_10000028813 | 150 |
| 203 | 3300005334 | Ga0068869_100616639 | Ga0068869_1006166391 | 150 |
| 204 | 3300005334 | Ga0068869_100873600 | Ga0068869_1008736002 | 150 |
| 205 | 3300005338 | Ga0068868_100717207 | Ga0068868_1007172071 | 150 |
| 206 | 3300005340 | Ga0070689_100449065 | Ga0070689_1004490652 | 150 |
| 207 | 3300005343 | Ga0070687_100271276 | Ga0070687_1002712763 | 150 |
| 208 | 3300005343 | Ga0070687_100594729 | Ga0070687_1005947291 | 150 |
| 209 | 3300005347 | Ga0070668_100010083 | Ga0070668_1000100838 | 150 |
| 210 | 3300005353 | Ga0070669_100038470 | Ga0070669_1000384704 | 150 |
| 211 | 3300005353 | Ga0070669_100762010 | Ga0070669_1007620101 | 150 |
| 212 | 3300005366 | Ga0070659_101025910 | Ga0070659_1010259102 | 150 |
| 213 | 3300005441 | Ga0070700_100059267 | Ga0070700_1000592673 | 150 |
| 214 | 3300005444 | Ga0070694_100833803 | Ga0070694_1008338031 | 150 |
| 215 | 3300005471 | Ga0070698_100931676 | Ga0070698_1009316762 | 150 |
| 216 | 3300005547 | Ga0070693_100156698 | Ga0070693_1001566982 | 150 |
| 217 | 3300005547 | Ga0070693_100158005 | Ga0070693_1001580052 | 150 |
| 218 | 3300005547 | Ga0070693_100176318 | Ga0070693_1001763183 | 150 |
| 219 | 3300005549 | Ga0070704_100619410 | Ga0070704_1006194101 | 150 |
| 220 | 3300005615 | Ga0070702_100030131 | Ga0070702_1000301311 | 150 |
| 221 | 3300005617 | Ga0068859_100139342 | Ga0068859_1001393422 | 150 |
| 222 | 3300006931 | Ga0097620_100139337 | Ga0097620_1001393372 | 150 |
| 223 | 3300007265 | Ga0099794_10002733 | Ga0099794_100027338 | 150 |
| 224 | 3300009098 | Ga0105245_10421235 | Ga0105245_104212353 | 150 |
| 225 | 3300009101 | Ga0105247_10000395 | Ga0105247_100003953 | 150 |
| 226 | 3300009148 | Ga0105243_10030928 | Ga0105243_100309283 | 150 |
| 227 | 3300009174 | Ga0105241_10527227 | Ga0105241_105272271 | 150 |
| 228 | 3300009176 | Ga0105242_10020232 | Ga0105242_100202324 | 150 |
| 229 | 3300009177 | Ga0105248_10796641 | Ga0105248_107966412 | 150 |
| 230 | 3300009177 | Ga0105248_11022136 | Ga0105248_110221362 | 150 |
| 231 | 3300009553 | Ga0105249_10000375 | Ga0105249_100003757 | 150 |
| 232 | 3300009553 | Ga0105249_10022736 | Ga0105249_100227364 | 150 |
| 233 | 3300013102 | Ga0157371_10499304 | Ga0157371_104993041 | 150 |
| 234 | 3300013297 | Ga0157378_11270991 | Ga0157378_112709912 | 150 |
| 235 | 3300013306 | Ga0163162_10000162 | Ga0163162_1000016237 | 150 |
| 236 | 3300013306 | Ga0163162_10023984 | Ga0163162_100239841 | 150 |
| 237 | 3300013306 | Ga0163162_10091654 | Ga0163162_100916542 | 150 |
| 238 | 3300013306 | Ga0163162_11710825 | Ga0163162_117108251 | 150 |
| 239 | 3300013308 | Ga0157375_10787821 | Ga0157375_107878212 | 150 |
| 240 | 3300014325 | Ga0163163_10495975 | Ga0163163_104959751 | 150 |
| 241 | 3300014326 | Ga0157380_10013349 | Ga0157380_100133492 | 150 |
| 242 | 3300014745 | Ga0157377_10200864 | Ga0157377_102008642 | 150 |
| 243 | 3300014968 | Ga0157379_10010606 | Ga0157379_100106063 | 150 |
| 244 | 3300025911 | Ga0207654_10153622 | Ga0207654_101536223 | 150 |
| 245 | 3300025961 | Ga0207712_10000313 | Ga0207712_1000031338 | 150 |
| 246 | 3300025972 | Ga0207668_10011459 | Ga0207668_100114593 | 150 |
| 247 | 3300025981 | Ga0207640_10138075 | Ga0207640_101380752 | 150 |
| 248 | 3300026035 | Ga0207703_10051954 | Ga0207703_100519543 | 150 |
| 249 | 3300026075 | Ga0207708_10010607 | Ga0207708_100106076 | 150 |
| 250 | 3300027671 | Ga0209588_1011796 | Ga0209588_10117964 | 150 |
| 251 | 3300028381 | Ga0268264_10078678 | Ga0268264_100786784 | 150 |
| 252 | 3300028381 | Ga0268264_10345621 | Ga0268264_103456213 | 150 |
| 253 | 3300041406 | Ga0439439_0150111 | Ga0439439_0150111_25_519 | 150 |
| 254 | 3300049521 | Ga0501298_059722 | Ga0501298_059722_230_757 | 150 |
| 255 | 3300005289 | Ga0065704_10426529 | Ga0065704_104265291 | 151 |
| 256 | 3300005295 | Ga0065707_10231768 | Ga0065707_102317682 | 151 |
| 257 | 3300005337 | Ga0070682_100357039 | Ga0070682_1003570392 | 151 |
| 258 | 3300005345 | Ga0070692_10008111 | Ga0070692_100081114 | 151 |
| 259 | 3300005406 | Ga0070703_10349879 | Ga0070703_103498791 | 151 |
| 260 | 3300005440 | Ga0070705_100627113 | Ga0070705_1006271131 | 151 |
| 261 | 3300005444 | Ga0070694_100084018 | Ga0070694_1000840183 | 151 |
| 262 | 3300005444 | Ga0070694_100379312 | Ga0070694_1003793122 | 151 |
| 263 | 3300005445 | Ga0070708_100164594 | Ga0070708_1001645942 | 151 |
| 264 | 3300005467 | Ga0070706_100167524 | Ga0070706_1001675242 | 151 |
| 265 | 3300005467 | Ga0070706_100315666 | Ga0070706_1003156662 | 151 |
| 266 | 3300005467 | Ga0070706_100656331 | Ga0070706_1006563312 | 151 |
| 267 | 3300005468 | Ga0070707_100002485 | Ga0070707_10000248510 | 151 |
| 268 | 3300005468 | Ga0070707_100003049 | Ga0070707_10000304916 | 151 |
| 269 | 3300005468 | Ga0070707_100158406 | Ga0070707_1001584063 | 151 |
| 270 | 3300005471 | Ga0070698_100116334 | Ga0070698_1001163342 | 151 |
| 271 | 3300005471 | Ga0070698_100122954 | Ga0070698_1001229542 | 151 |
| 272 | 3300005471 | Ga0070698_100604897 | Ga0070698_1006048972 | 151 |
| 273 | 3300005518 | Ga0070699_100225426 | Ga0070699_1002254262 | 151 |
| 274 | 3300005536 | Ga0070697_100016344 | Ga0070697_1000163442 | 151 |
| 275 | 3300005536 | Ga0070697_100412018 | Ga0070697_1004120182 | 151 |
| 276 | 3300005536 | Ga0070697_101286232 | Ga0070697_1012862321 | 151 |
| 277 | 3300005539 | Ga0068853_100143510 | Ga0068853_1001435101 | 151 |
| 278 | 3300005545 | Ga0070695_100292257 | Ga0070695_1002922572 | 151 |
| 279 | 3300005546 | Ga0070696_100117165 | Ga0070696_1001171653 | 151 |
| 280 | 3300005549 | Ga0070704_100120541 | Ga0070704_1001205413 | 151 |
| 281 | 3300005840 | Ga0068870_10482408 | Ga0068870_104824082 | 151 |
| 282 | 3300005842 | Ga0068858_100284586 | Ga0068858_1002845862 | 151 |
| 283 | 3300006163 | Ga0070715_10000019 | Ga0070715_1000001975 | 151 |
| 284 | 3300006173 | Ga0070716_100000001 | Ga0070716_100000001228 | 151 |
| 285 | 3300006173 | Ga0070716_100108602 | Ga0070716_1001086022 | 151 |
| 286 | 3300006173 | Ga0070716_100845667 | Ga0070716_1008456671 | 151 |
| 287 | 3300006871 | Ga0075434_101368840 | Ga0075434_1013688401 | 151 |
| 288 | 3300006914 | Ga0075436_100117395 | Ga0075436_1001173953 | 151 |
| 289 | 3300007076 | Ga0075435_100779640 | Ga0075435_1007796402 | 151 |
| 290 | 3300014745 | Ga0157377_10076667 | Ga0157377_100766671 | 151 |
| 291 | 3300025885 | Ga0207653_10050720 | Ga0207653_100507202 | 151 |
| 292 | 3300025885 | Ga0207653_10211445 | Ga0207653_102114451 | 151 |
| 293 | 3300025905 | Ga0207685_10000021 | Ga0207685_1000002145 | 151 |
| 294 | 3300025906 | Ga0207699_10614603 | Ga0207699_106146031 | 151 |
| 295 | 3300025910 | Ga0207684_10085309 | Ga0207684_100853093 | 151 |
| 296 | 3300025910 | Ga0207684_10161930 | Ga0207684_101619302 | 151 |
| 297 | 3300025910 | Ga0207684_10172372 | Ga0207684_101723722 | 151 |
| 298 | 3300025910 | Ga0207684_10882896 | Ga0207684_108828961 | 151 |
| 299 | 3300025922 | Ga0207646_10009636 | Ga0207646_1000963610 | 151 |
| 300 | 3300025922 | Ga0207646_10019481 | Ga0207646_100194815 | 151 |
| 301 | 3300025922 | Ga0207646_10666499 | Ga0207646_106664991 | 151 |
| 302 | 3300025939 | Ga0207665_10000002 | Ga0207665_10000002105 | 151 |
| 303 | 3300025941 | Ga0207711_10319473 | Ga0207711_103194732 | 151 |
| 304 | 3300026035 | Ga0207703_10349658 | Ga0207703_103496582 | 151 |
| 305 | 3300026088 | Ga0207641_11095757 | Ga0207641_110957571 | 151 |
| 306 | 3300048907 | Ga0496104_0748617 | Ga0496104_0748617_282_773 | 151 |
| 307 | 3300050515 | nmdc:mga0a205_174009_c1 | nmdc:mga0a205_174009_c1_1396_1887 | 151 |
| 308 | 3300005337 | Ga0070682_100000027 | Ga0070682_100000027137 | 152 |
| 309 | 3300005353 | Ga0070669_100002495 | Ga0070669_1000024959 | 152 |
| 310 | 3300005445 | Ga0070708_100219902 | Ga0070708_1002199022 | 152 |
| 311 | 3300005445 | Ga0070708_100400680 | Ga0070708_1004006802 | 152 |
| 312 | 3300005467 | Ga0070706_100037418 | Ga0070706_1000374182 | 152 |
| 313 | 3300005467 | Ga0070706_100177886 | Ga0070706_1001778862 | 152 |
| 314 | 3300005471 | Ga0070698_100810203 | Ga0070698_1008102031 | 152 |
| 315 | 3300005518 | Ga0070699_100049413 | Ga0070699_1000494134 | 152 |
| 316 | 3300005536 | Ga0070697_100037477 | Ga0070697_1000374773 | 152 |
| 317 | 3300005545 | Ga0070695_100673452 | Ga0070695_1006734521 | 152 |
| 318 | 3300005546 | Ga0070696_100032533 | Ga0070696_1000325334 | 152 |
| 319 | 3300005549 | Ga0070704_100901929 | Ga0070704_1009019291 | 152 |
| 320 | 3300006847 | Ga0075431_100050600 | Ga0075431_1000506001 | 152 |
| 321 | 3300009098 | Ga0105245_10328767 | Ga0105245_103287671 | 152 |
| 322 | 3300011119 | Ga0105246_10030376 | Ga0105246_100303765 | 152 |
| 323 | 3300025910 | Ga0207684_10128192 | Ga0207684_101281922 | 152 |
| 324 | 3300025910 | Ga0207684_10185755 | Ga0207684_101857552 | 152 |
| 325 | 3300050509 | nmdc:mga0qj67_681623_c1 | nmdc:mga0qj67_681623_c1_30_548 | 152 |
| 326 | 3300050510 | nmdc:mga06r32_45384_c1 | nmdc:mga06r32_45384_c1_369_887 | 152 |
| 327 | 3300003322 | rootL2_10302468 | rootL2_103024683 | 153 |
| 328 | 3300005288 | Ga0065714_10064501 | Ga0065714_100645019 | 153 |
| 329 | 3300005290 | Ga0065712_10067737 | Ga0065712_1006773763 | 153 |
| 330 | 3300005293 | Ga0065715_10089067 | Ga0065715_100890673 | 153 |
| 331 | 3300005293 | Ga0065715_10313428 | Ga0065715_103134282 | 153 |
| 332 | 3300005334 | Ga0068869_100024509 | Ga0068869_1000245092 | 153 |
| 333 | 3300005334 | Ga0068869_100589100 | Ga0068869_1005891001 | 153 |
| 334 | 3300005364 | Ga0070673_100481690 | Ga0070673_1004816901 | 153 |
| 335 | 3300005444 | Ga0070694_100005920 | Ga0070694_1000059207 | 153 |
| 336 | 3300005545 | Ga0070695_100205630 | Ga0070695_1002056301 | 153 |
| 337 | 3300005547 | Ga0070693_100000972 | Ga0070693_10000097212 | 153 |
| 338 | 3300005577 | Ga0068857_100200746 | Ga0068857_1002007463 | 153 |
| 339 | 3300005615 | Ga0070702_100029766 | Ga0070702_1000297663 | 153 |
| 340 | 3300005834 | Ga0068851_10002518 | Ga0068851_100025182 | 153 |
| 341 | 3300005985 | Ga0081539_10002860 | Ga0081539_1000286011 | 153 |
| 342 | 3300006844 | Ga0075428_100803666 | Ga0075428_1008036662 | 153 |
| 343 | 3300006844 | Ga0075428_101401567 | Ga0075428_1014015672 | 153 |
| 344 | 3300006847 | Ga0075431_100086515 | Ga0075431_1000865153 | 153 |
| 345 | 3300006880 | Ga0075429_100797923 | Ga0075429_1007979232 | 153 |
| 346 | 3300009094 | Ga0111539_10255549 | Ga0111539_102555493 | 153 |
| 347 | 3300009147 | Ga0114129_12554327 | Ga0114129_125543271 | 153 |
| 348 | 3300009148 | Ga0105243_10208827 | Ga0105243_102088273 | 153 |
| 349 | 3300009148 | Ga0105243_10314896 | Ga0105243_103148962 | 153 |
| 350 | 3300009545 | Ga0105237_10002654 | Ga0105237_1000265417 | 153 |
| 351 | 3300013100 | Ga0157373_10286050 | Ga0157373_102860502 | 153 |
| 352 | 3300014968 | Ga0157379_10125649 | Ga0157379_101256492 | 153 |
| 353 | 3300025321 | Ga0207656_10005923 | Ga0207656_100059235 | 153 |
| 354 | 3300025885 | Ga0207653_10005448 | Ga0207653_100054485 | 153 |
| 355 | 3300025904 | Ga0207647_10102830 | Ga0207647_101028303 | 153 |
| 356 | 3300025908 | Ga0207643_10202980 | Ga0207643_102029802 | 153 |
| 357 | 3300025913 | Ga0207695_10472052 | Ga0207695_104720521 | 153 |
| 358 | 3300025914 | Ga0207671_10007027 | Ga0207671_100070277 | 153 |
| 359 | 3300025923 | Ga0207681_10005479 | Ga0207681_100054796 | 153 |
| 360 | 3300025925 | Ga0207650_10000304 | Ga0207650_1000030414 | 153 |
| 361 | 3300025925 | Ga0207650_10922573 | Ga0207650_109225731 | 153 |
| 362 | 3300025935 | Ga0207709_10339551 | Ga0207709_103395511 | 153 |
| 363 | 3300025935 | Ga0207709_10400745 | Ga0207709_104007452 | 153 |
| 364 | 3300025935 | Ga0207709_10623208 | Ga0207709_106232081 | 153 |
| 365 | 3300025936 | Ga0207670_10748956 | Ga0207670_107489562 | 153 |
| 366 | 3300025942 | Ga0207689_10397317 | Ga0207689_103973171 | 153 |
| 367 | 3300025981 | Ga0207640_10828813 | Ga0207640_108288132 | 153 |
| 368 | 3300026075 | Ga0207708_10051309 | Ga0207708_100513092 | 153 |
| 369 | 3300026089 | Ga0207648_10203038 | Ga0207648_102030383 | 153 |
| 370 | 3300026089 | Ga0207648_11051073 | Ga0207648_110510731 | 153 |
| 371 | 3300026095 | Ga0207676_10443192 | Ga0207676_104431922 | 153 |
| 372 | 3300026116 | Ga0207674_10216342 | Ga0207674_102163423 | 153 |
| 373 | 3300026116 | Ga0207674_10232952 | Ga0207674_102329522 | 153 |
| 374 | 3300026142 | Ga0207698_10070175 | Ga0207698_100701753 | 153 |
| 375 | 3300027907 | Ga0207428_10404278 | Ga0207428_104042782 | 153 |
| 376 | 3300032002 | Ga0307416_100696220 | Ga0307416_1006962202 | 153 |
| 377 | 3300037418 | Ga0395900_0095130 | Ga0395900_0095130_2162_2716 | 153 |
| 378 | 3300037471 | Ga0395905_0418312 | Ga0395905_0418312_224_778 | 153 |
| 379 | 3300037471 | Ga0395905_0652669 | Ga0395905_0652669_222_773 | 153 |
| 380 | 3300046491 | Ga0495584_0194905 | Ga0495584_0194905_247_774 | 153 |
| 381 | 3300046515 | Ga0495620_0331790 | Ga0495620_0331790_37_564 | 153 |
| 382 | 3300046525 | Ga0495663_0000102 | Ga0495663_0000102_10435_10962 | 153 |
| 383 | 3300046537 | Ga0495598_0000045 | Ga0495598_0000045_3665_4192 | 153 |
| 384 | 3300046539 | Ga0495621_0001069 | Ga0495621_0001069_165_692 | 153 |
| 385 | 3300046539 | Ga0495621_0113655 | Ga0495621_0113655_201_728 | 153 |
| 386 | 3300049513 | Ga0501290_008424 | Ga0501290_008424_515_1033 | 153 |
| 387 | 3300049552 | Ga0501336_024380 | Ga0501336_024380_19_537 | 153 |
| 388 | 3300049663 | Ga0501223_015989 | Ga0501223_015989_858_1376 | 153 |
| 389 | 3300049664 | Ga0501224_047217 | Ga0501224_047217_91_609 | 153 |
| 390 | 3300049665 | Ga0501227_015868 | Ga0501227_015868_1006_1524 | 153 |
| 391 | 3300049668 | Ga0501233_111268 | Ga0501233_111268_224_718 | 153 |
| 392 | 3300049669 | Ga0501235_042550 | Ga0501235_042550_320_838 | 153 |
| 393 | 3300049679 | Ga0501249_004934 | Ga0501249_004934_1558_2076 | 153 |
| 394 | 3300049705 | Ga0501225_0028709 | Ga0501225_0028709_138_656 | 153 |
| 395 | 3300049765 | Ga0501268_037245 | Ga0501268_037245_217_735 | 153 |
| 396 | 3300049779 | Ga0501283_020180 | Ga0501283_020180_501_1019 | 153 |
| 397 | 3300050507 | nmdc:mga05p37_339813_c1 | nmdc:mga05p37_339813_c1_603_1121 | 153 |
| 398 | 3300050509 | nmdc:mga0qj67_542007_c1 | nmdc:mga0qj67_542007_c1_35_553 | 153 |
| 399 | 3300050510 | nmdc:mga06r32_92427_c1 | nmdc:mga06r32_92427_c1_2092_2610 | 153 |
| 400 | 3300050511 | nmdc:mga08y16_85485_c1 | nmdc:mga08y16_85485_c1_1052_1570 | 153 |
| 401 | 3300005289 | Ga0065704_10096432 | Ga0065704_100964323 | 154 |
| 402 | 3300005290 | Ga0065712_10314971 | Ga0065712_103149711 | 154 |
| 403 | 3300005293 | Ga0065715_10356127 | Ga0065715_103561271 | 154 |
| 404 | 3300005295 | Ga0065707_10004038 | Ga0065707_100040381 | 154 |
| 405 | 3300005295 | Ga0065707_10217781 | Ga0065707_102177812 | 154 |
| 406 | 3300005328 | Ga0070676_11086531 | Ga0070676_110865311 | 154 |
| 407 | 3300005330 | Ga0070690_100013098 | Ga0070690_1000130983 | 154 |
| 408 | 3300005331 | Ga0070670_100137287 | Ga0070670_1001372873 | 154 |
| 409 | 3300005334 | Ga0068869_100683138 | Ga0068869_1006831382 | 154 |
| 410 | 3300005336 | Ga0070680_100509704 | Ga0070680_1005097042 | 154 |
| 411 | 3300005340 | Ga0070689_100088677 | Ga0070689_1000886772 | 154 |
| 412 | 3300005343 | Ga0070687_100019143 | Ga0070687_1000191433 | 154 |
| 413 | 3300005343 | Ga0070687_100036834 | Ga0070687_1000368343 | 154 |
| 414 | 3300005347 | Ga0070668_100392176 | Ga0070668_1003921762 | 154 |
| 415 | 3300005353 | Ga0070669_100099025 | Ga0070669_1000990252 | 154 |
| 416 | 3300005356 | Ga0070674_100530057 | Ga0070674_1005300571 | 154 |
| 417 | 3300005406 | Ga0070703_10040927 | Ga0070703_100409272 | 154 |
| 418 | 3300005440 | Ga0070705_100152266 | Ga0070705_1001522662 | 154 |
| 419 | 3300005440 | Ga0070705_100830337 | Ga0070705_1008303371 | 154 |
| 420 | 3300005441 | Ga0070700_100034326 | Ga0070700_1000343263 | 154 |
| 421 | 3300005444 | Ga0070694_100236574 | Ga0070694_1002365742 | 154 |
| 422 | 3300005457 | Ga0070662_100134411 | Ga0070662_1001344112 | 154 |
| 423 | 3300005467 | Ga0070706_100409491 | Ga0070706_1004094911 | 154 |
| 424 | 3300005468 | Ga0070707_100063283 | Ga0070707_1000632833 | 154 |
| 425 | 3300005471 | Ga0070698_100003085 | Ga0070698_10000308511 | 154 |
| 426 | 3300005471 | Ga0070698_100009470 | Ga0070698_1000094708 | 154 |
| 427 | 3300005471 | Ga0070698_100014091 | Ga0070698_1000140917 | 154 |
| 428 | 3300005518 | Ga0070699_100007923 | Ga0070699_1000079235 | 154 |
| 429 | 3300005536 | Ga0070697_100001825 | Ga0070697_10000182511 | 154 |
| 430 | 3300005543 | Ga0070672_100072802 | Ga0070672_1000728023 | 154 |
| 431 | 3300005544 | Ga0070686_100050927 | Ga0070686_1000509274 | 154 |
| 432 | 3300005545 | Ga0070695_100089006 | Ga0070695_1000890062 | 154 |
| 433 | 3300005545 | Ga0070695_100359586 | Ga0070695_1003595862 | 154 |
| 434 | 3300005546 | Ga0070696_100109973 | Ga0070696_1001099732 | 154 |
| 435 | 3300005546 | Ga0070696_100298148 | Ga0070696_1002981482 | 154 |
| 436 | 3300005546 | Ga0070696_100352238 | Ga0070696_1003522382 | 154 |
| 437 | 3300005546 | Ga0070696_100727417 | Ga0070696_1007274171 | 154 |
| 438 | 3300005549 | Ga0070704_100036648 | Ga0070704_1000366483 | 154 |
| 439 | 3300005549 | Ga0070704_100272049 | Ga0070704_1002720491 | 154 |
| 440 | 3300005549 | Ga0070704_100534794 | Ga0070704_1005347942 | 154 |
| 441 | 3300005615 | Ga0070702_100029580 | Ga0070702_1000295803 | 154 |
| 442 | 3300005615 | Ga0070702_100350230 | Ga0070702_1003502302 | 154 |
| 443 | 3300005618 | Ga0068864_100002264 | Ga0068864_10000226412 | 154 |
| 444 | 3300005618 | Ga0068864_100187777 | Ga0068864_1001877771 | 154 |
| 445 | 3300005719 | Ga0068861_100056063 | Ga0068861_1000560633 | 154 |
| 446 | 3300005719 | Ga0068861_100289853 | Ga0068861_1002898532 | 154 |
| 447 | 3300005842 | Ga0068858_100407236 | Ga0068858_1004072362 | 154 |
| 448 | 3300005843 | Ga0068860_100325781 | Ga0068860_1003257811 | 154 |
| 449 | 3300005843 | Ga0068860_100905331 | Ga0068860_1009053311 | 154 |
| 450 | 3300005844 | Ga0068862_100027399 | Ga0068862_1000273992 | 154 |
| 451 | 3300006844 | Ga0075428_100093477 | Ga0075428_1000934774 | 154 |
| 452 | 3300006847 | Ga0075431_100243832 | Ga0075431_1002438322 | 154 |
| 453 | 3300006852 | Ga0075433_10019917 | Ga0075433_100199172 | 154 |
| 454 | 3300006871 | Ga0075434_100031968 | Ga0075434_1000319684 | 154 |
| 455 | 3300006880 | Ga0075429_100170245 | Ga0075429_1001702452 | 154 |
| 456 | 3300006881 | Ga0068865_101178848 | Ga0068865_1011788481 | 154 |
| 457 | 3300009094 | Ga0111539_10063062 | Ga0111539_100630622 | 154 |
| 458 | 3300009094 | Ga0111539_10137643 | Ga0111539_101376431 | 154 |
| 459 | 3300009147 | Ga0114129_10009289 | Ga0114129_100092895 | 154 |
| 460 | 3300009148 | Ga0105243_10136499 | Ga0105243_101364993 | 154 |
| 461 | 3300009148 | Ga0105243_10297186 | Ga0105243_102971862 | 154 |
| 462 | 3300009176 | Ga0105242_10208478 | Ga0105242_102084782 | 154 |
| 463 | 3300009177 | Ga0105248_10654107 | Ga0105248_106541071 | 154 |
| 464 | 3300009553 | Ga0105249_10011935 | Ga0105249_100119353 | 154 |
| 465 | 3300011119 | Ga0105246_10043449 | Ga0105246_100434492 | 154 |
| 466 | 3300013297 | Ga0157378_10044131 | Ga0157378_100441312 | 154 |
| 467 | 3300013297 | Ga0157378_10254089 | Ga0157378_102540892 | 154 |
| 468 | 3300013306 | Ga0163162_10149727 | Ga0163162_101497274 | 154 |
| 469 | 3300013306 | Ga0163162_10373062 | Ga0163162_103730622 | 154 |
| 470 | 3300013308 | Ga0157375_10222015 | Ga0157375_102220152 | 154 |
| 471 | 3300014325 | Ga0163163_10023043 | Ga0163163_100230435 | 154 |
| 472 | 3300014326 | Ga0157380_10117976 | Ga0157380_101179762 | 154 |
| 473 | 3300025908 | Ga0207643_10008738 | Ga0207643_100087386 | 154 |
| 474 | 3300025910 | Ga0207684_10073174 | Ga0207684_100731744 | 154 |
| 475 | 3300025910 | Ga0207684_10333801 | Ga0207684_103338012 | 154 |
| 476 | 3300025912 | Ga0207707_10000030 | Ga0207707_1000003093 | 154 |
| 477 | 3300025914 | Ga0207671_10187427 | Ga0207671_101874273 | 154 |
| 478 | 3300025917 | Ga0207660_10000376 | Ga0207660_1000037617 | 154 |
| 479 | 3300025917 | Ga0207660_10192520 | Ga0207660_101925201 | 154 |
| 480 | 3300025918 | Ga0207662_10016286 | Ga0207662_100162863 | 154 |
| 481 | 3300025921 | Ga0207652_10000086 | Ga0207652_1000008651 | 154 |
| 482 | 3300025922 | Ga0207646_10107115 | Ga0207646_101071153 | 154 |
| 483 | 3300025922 | Ga0207646_10334889 | Ga0207646_103348891 | 154 |
| 484 | 3300025923 | Ga0207681_10296308 | Ga0207681_102963082 | 154 |
| 485 | 3300025925 | Ga0207650_10351931 | Ga0207650_103519312 | 154 |
| 486 | 3300025925 | Ga0207650_10824675 | Ga0207650_108246751 | 154 |
| 487 | 3300025933 | Ga0207706_10416287 | Ga0207706_104162872 | 154 |
| 488 | 3300025934 | Ga0207686_10184254 | Ga0207686_101842542 | 154 |
| 489 | 3300025935 | Ga0207709_10438804 | Ga0207709_104388042 | 154 |
| 490 | 3300025937 | Ga0207669_10149728 | Ga0207669_101497282 | 154 |
| 491 | 3300025940 | Ga0207691_10026908 | Ga0207691_100269083 | 154 |
| 492 | 3300025940 | Ga0207691_10091705 | Ga0207691_100917052 | 154 |
| 493 | 3300025940 | Ga0207691_10100406 | Ga0207691_101004063 | 154 |
| 494 | 3300025942 | Ga0207689_10001120 | Ga0207689_1000112016 | 154 |
| 495 | 3300025942 | Ga0207689_10164040 | Ga0207689_101640403 | 154 |
| 496 | 3300025942 | Ga0207689_10859974 | Ga0207689_108599741 | 154 |
| 497 | 3300025942 | Ga0207689_11142875 | Ga0207689_111428751 | 154 |
| 498 | 3300025961 | Ga0207712_10051616 | Ga0207712_100516162 | 154 |
| 499 | 3300025972 | Ga0207668_11180746 | Ga0207668_111807461 | 154 |
| 500 | 3300025981 | Ga0207640_10031533 | Ga0207640_100315335 | 154 |
| 501 | 3300026023 | Ga0207677_10347177 | Ga0207677_103471772 | 154 |
| 502 | 3300026041 | Ga0207639_10292329 | Ga0207639_102923291 | 154 |
| 503 | 3300026075 | Ga0207708_10008599 | Ga0207708_100085997 | 154 |
| 504 | 3300026078 | Ga0207702_10018498 | Ga0207702_100184987 | 154 |
| 505 | 3300026095 | Ga0207676_10051070 | Ga0207676_100510705 | 154 |
| 506 | 3300026095 | Ga0207676_10921692 | Ga0207676_109216921 | 154 |
| 507 | 3300026095 | Ga0207676_10977445 | Ga0207676_109774453 | 154 |
| 508 | 3300026118 | Ga0207675_100092237 | Ga0207675_1000922373 | 154 |
| 509 | 3300026118 | Ga0207675_100182689 | Ga0207675_1001826892 | 154 |
| 510 | 3300028381 | Ga0268264_10029011 | Ga0268264_100290115 | 154 |
| 511 | 3300028381 | Ga0268264_10302645 | Ga0268264_103026451 | 154 |
| 512 | 3300028381 | Ga0268264_10585586 | Ga0268264_105855862 | 154 |
| 513 | 3300028794 | Ga0307515_10130680 | Ga0307515_101306802 | 154 |
| 514 | 3300035091 | Ga0373951_0005408 | Ga0373951_0005408_717_1214 | 154 |
| 515 | 3300035091 | Ga0373951_0101641 | Ga0373951_0101641_174_671 | 154 |
| 516 | 3300038996 | Ga0242420_001479 | Ga0242420_001479_85_612 | 154 |
| 517 | 3300042011 | Ga0439454_044078 | Ga0439454_044078_50_577 | 154 |
| 518 | 3300048907 | Ga0496104_0069219 | Ga0496104_0069219_2688_3215 | 154 |
| 519 | 3300048909 | Ga0496106_0268811 | Ga0496106_0268811_144_671 | 154 |
| 520 | 3300048911 | Ga0496108_0090894 | Ga0496108_0090894_1890_2417 | 154 |
| 521 | 3300048912 | Ga0496109_0661929 | Ga0496109_0661929_87_614 | 154 |
| 522 | 3300048914 | Ga0496111_0821176 | Ga0496111_0821176_15_542 | 154 |
| 523 | 3300050507 | nmdc:mga05p37_18640_c1 | nmdc:mga05p37_18640_c1_7524_8051 | 154 |
| 524 | 3300050508 | nmdc:mga09592_320229_c1 | nmdc:mga09592_320229_c1_87_614 | 154 |
| 525 | 3300050511 | nmdc:mga08y16_36966_c1 | nmdc:mga08y16_36966_c1_3888_4418 | 154 |
| 526 | 3300050511 | nmdc:mga08y16_412715_c1 | nmdc:mga08y16_412715_c1_707_1237 | 154 |
| 527 | 3300050512 | nmdc:mga0n895_212834_c1 | nmdc:mga0n895_212834_c1_1304_1825 | 154 |
| 528 | 3300050512 | nmdc:mga0n895_686566_c1 | nmdc:mga0n895_686566_c1_75_602 | 154 |
| 529 | 3300050512 | nmdc:mga0n895_87094_c1 | nmdc:mga0n895_87094_c1_2466_2993 | 154 |
| 530 | 3300050515 | nmdc:mga0a205_326388_c1 | nmdc:mga0a205_326388_c1_337_864 | 154 |
| 531 | 3300000546 | LJNas_1015975 | LJNas_10159751 | 155 |
| 532 | 3300002459 | JGI24751J29686_10000058 | JGI24751J29686_100000584 | 155 |
| 533 | 3300002459 | JGI24751J29686_10000101 | JGI24751J29686_1000010142 | 155 |
| 534 | 3300005290 | Ga0065712_10001518 | Ga0065712_100015182 | 155 |
| 535 | 3300005293 | Ga0065715_10866278 | Ga0065715_108662781 | 155 |
| 536 | 3300005331 | Ga0070670_100042923 | Ga0070670_1000429233 | 155 |
| 537 | 3300005331 | Ga0070670_100077596 | Ga0070670_1000775963 | 155 |
| 538 | 3300005331 | Ga0070670_101515846 | Ga0070670_1015158461 | 155 |
| 539 | 3300005334 | Ga0068869_100774985 | Ga0068869_1007749852 | 155 |
| 540 | 3300005338 | Ga0068868_101522234 | Ga0068868_1015222341 | 155 |
| 541 | 3300005339 | Ga0070660_101114857 | Ga0070660_1011148571 | 155 |
| 542 | 3300005340 | Ga0070689_100964888 | Ga0070689_1009648881 | 155 |
| 543 | 3300005344 | Ga0070661_101176153 | Ga0070661_1011761531 | 155 |
| 544 | 3300005364 | Ga0070673_100756846 | Ga0070673_1007568461 | 155 |
| 545 | 3300005364 | Ga0070673_100837902 | Ga0070673_1008379021 | 155 |
| 546 | 3300005441 | Ga0070700_100619075 | Ga0070700_1006190751 | 155 |
| 547 | 3300005444 | Ga0070694_100745126 | Ga0070694_1007451261 | 155 |
| 548 | 3300005459 | Ga0068867_101484434 | Ga0068867_1014844341 | 155 |
| 549 | 3300005543 | Ga0070672_101027304 | Ga0070672_1010273041 | 155 |
| 550 | 3300005564 | Ga0070664_100141118 | Ga0070664_1001411181 | 155 |
| 551 | 3300005564 | Ga0070664_100210169 | Ga0070664_1002101692 | 155 |
| 552 | 3300005577 | Ga0068857_100287845 | Ga0068857_1002878452 | 155 |
| 553 | 3300005577 | Ga0068857_101152509 | Ga0068857_1011525091 | 155 |
| 554 | 3300005577 | Ga0068857_101222831 | Ga0068857_1012228311 | 155 |
| 555 | 3300005615 | Ga0070702_100093945 | Ga0070702_1000939453 | 155 |
| 556 | 3300005615 | Ga0070702_100996773 | Ga0070702_1009967731 | 155 |
| 557 | 3300005617 | Ga0068859_100060689 | Ga0068859_1000606893 | 155 |
| 558 | 3300005617 | Ga0068859_100455804 | Ga0068859_1004558042 | 155 |
| 559 | 3300005618 | Ga0068864_100007172 | Ga0068864_1000071722 | 155 |
| 560 | 3300005618 | Ga0068864_100192031 | Ga0068864_1001920312 | 155 |
| 561 | 3300005618 | Ga0068864_100462511 | Ga0068864_1004625112 | 155 |
| 562 | 3300005718 | Ga0068866_10416173 | Ga0068866_104161731 | 155 |
| 563 | 3300005719 | Ga0068861_101293665 | Ga0068861_1012936651 | 155 |
| 564 | 3300005840 | Ga0068870_10177926 | Ga0068870_101779262 | 155 |
| 565 | 3300005841 | Ga0068863_100107205 | Ga0068863_1001072052 | 155 |
| 566 | 3300005841 | Ga0068863_100120745 | Ga0068863_1001207452 | 155 |
| 567 | 3300005841 | Ga0068863_100741129 | Ga0068863_1007411292 | 155 |
| 568 | 3300005842 | Ga0068858_100104723 | Ga0068858_1001047232 | 155 |
| 569 | 3300005842 | Ga0068858_100360341 | Ga0068858_1003603412 | 155 |
| 570 | 3300005842 | Ga0068858_100521090 | Ga0068858_1005210901 | 155 |
| 571 | 3300005843 | Ga0068860_100154075 | Ga0068860_1001540752 | 155 |
| 572 | 3300005843 | Ga0068860_100176380 | Ga0068860_1001763803 | 155 |
| 573 | 3300005843 | Ga0068860_100199000 | Ga0068860_1001990002 | 155 |
| 574 | 3300005843 | Ga0068860_100244213 | Ga0068860_1002442133 | 155 |
| 575 | 3300005844 | Ga0068862_101235622 | Ga0068862_1012356221 | 155 |
| 576 | 3300005983 | Ga0081540_1015996 | Ga0081540_10159962 | 155 |
| 577 | 3300005985 | Ga0081539_10053080 | Ga0081539_100530802 | 155 |
| 578 | 3300006358 | Ga0068871_100271019 | Ga0068871_1002710192 | 155 |
| 579 | 3300006358 | Ga0068871_100336796 | Ga0068871_1003367962 | 155 |
| 580 | 3300006852 | Ga0075433_10148952 | Ga0075433_101489523 | 155 |
| 581 | 3300006852 | Ga0075433_10230016 | Ga0075433_102300163 | 155 |
| 582 | 3300006852 | Ga0075433_10250767 | Ga0075433_102507672 | 155 |
| 583 | 3300006871 | Ga0075434_101036773 | Ga0075434_1010367731 | 155 |
| 584 | 3300006871 | Ga0075434_101088058 | Ga0075434_1010880581 | 155 |
| 585 | 3300006931 | Ga0097620_100060690 | Ga0097620_1000606904 | 155 |
| 586 | 3300006931 | Ga0097620_100455825 | Ga0097620_1004558252 | 155 |
| 587 | 3300006931 | Ga0097620_101021047 | Ga0097620_1010210472 | 155 |
| 588 | 3300009098 | Ga0105245_10619544 | Ga0105245_106195443 | 155 |
| 589 | 3300009101 | Ga0105247_10117830 | Ga0105247_101178303 | 155 |
| 590 | 3300009101 | Ga0105247_10223457 | Ga0105247_102234572 | 155 |
| 591 | 3300009147 | Ga0114129_10009889 | Ga0114129_1000988912 | 155 |
| 592 | 3300009148 | Ga0105243_10019859 | Ga0105243_100198593 | 155 |
| 593 | 3300009148 | Ga0105243_10129310 | Ga0105243_101293101 | 155 |
| 594 | 3300009174 | Ga0105241_10175345 | Ga0105241_101753453 | 155 |
| 595 | 3300009174 | Ga0105241_10859430 | Ga0105241_108594302 | 155 |
| 596 | 3300009176 | Ga0105242_10779723 | Ga0105242_107797232 | 155 |
| 597 | 3300009177 | Ga0105248_10535044 | Ga0105248_105350443 | 155 |
| 598 | 3300009177 | Ga0105248_11461941 | Ga0105248_114619411 | 155 |
| 599 | 3300009545 | Ga0105237_10663357 | Ga0105237_106633572 | 155 |
| 600 | 3300009551 | Ga0105238_10066275 | Ga0105238_100662754 | 155 |
| 601 | 3300009551 | Ga0105238_10705796 | Ga0105238_107057961 | 155 |
| 602 | 3300010375 | Ga0105239_10109520 | Ga0105239_101095202 | 155 |
| 603 | 3300011119 | Ga0105246_10160941 | Ga0105246_101609412 | 155 |
| 604 | 3300013100 | Ga0157373_10084521 | Ga0157373_100845213 | 155 |
| 605 | 3300013296 | Ga0157374_10569230 | Ga0157374_105692302 | 155 |
| 606 | 3300013297 | Ga0157378_10671913 | Ga0157378_106719132 | 155 |
| 607 | 3300013307 | Ga0157372_10524134 | Ga0157372_105241342 | 155 |
| 608 | 3300014325 | Ga0163163_10001223 | Ga0163163_1000122314 | 155 |
| 609 | 3300014325 | Ga0163163_10199108 | Ga0163163_101991083 | 155 |
| 610 | 3300014325 | Ga0163163_10622613 | Ga0163163_106226132 | 155 |
| 611 | 3300014325 | Ga0163163_11160310 | Ga0163163_111603102 | 155 |
| 612 | 3300014326 | Ga0157380_10264676 | Ga0157380_102646763 | 155 |
| 613 | 3300014745 | Ga0157377_10181243 | Ga0157377_101812433 | 155 |
| 614 | 3300014745 | Ga0157377_10552003 | Ga0157377_105520031 | 155 |
| 615 | 3300014968 | Ga0157379_10785902 | Ga0157379_107859022 | 155 |
| 616 | 3300014969 | Ga0157376_10189118 | Ga0157376_101891181 | 155 |
| 617 | 3300025899 | Ga0207642_10194220 | Ga0207642_101942202 | 155 |
| 618 | 3300025900 | Ga0207710_10002291 | Ga0207710_100022914 | 155 |
| 619 | 3300025900 | Ga0207710_10145022 | Ga0207710_101450222 | 155 |
| 620 | 3300025911 | Ga0207654_10589151 | Ga0207654_105891512 | 155 |
| 621 | 3300025914 | Ga0207671_10429474 | Ga0207671_104294741 | 155 |
| 622 | 3300025918 | Ga0207662_10180956 | Ga0207662_101809562 | 155 |
| 623 | 3300025919 | Ga0207657_10296453 | Ga0207657_102964531 | 155 |
| 624 | 3300025919 | Ga0207657_10450286 | Ga0207657_104502862 | 155 |
| 625 | 3300025920 | Ga0207649_10643384 | Ga0207649_106433842 | 155 |
| 626 | 3300025923 | Ga0207681_10042146 | Ga0207681_100421464 | 155 |
| 627 | 3300025924 | Ga0207694_10088678 | Ga0207694_100886784 | 155 |
| 628 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001981 | 155 |
| 629 | 3300025925 | Ga0207650_10192007 | Ga0207650_101920072 | 155 |
| 630 | 3300025934 | Ga0207686_10477384 | Ga0207686_104773841 | 155 |
| 631 | 3300025935 | Ga0207709_10008615 | Ga0207709_100086153 | 155 |
| 632 | 3300025935 | Ga0207709_10254029 | Ga0207709_102540291 | 155 |
| 633 | 3300025935 | Ga0207709_10562597 | Ga0207709_105625972 | 155 |
| 634 | 3300025936 | Ga0207670_10022723 | Ga0207670_100227231 | 155 |
| 635 | 3300025941 | Ga0207711_10138904 | Ga0207711_101389044 | 155 |
| 636 | 3300025941 | Ga0207711_10644229 | Ga0207711_106442292 | 155 |
| 637 | 3300025941 | Ga0207711_10717079 | Ga0207711_107170791 | 155 |
| 638 | 3300025942 | Ga0207689_10233478 | Ga0207689_102334782 | 155 |
| 639 | 3300025942 | Ga0207689_10341031 | Ga0207689_103410312 | 155 |
| 640 | 3300025945 | Ga0207679_10235801 | Ga0207679_102358012 | 155 |
| 641 | 3300025960 | Ga0207651_10146970 | Ga0207651_101469702 | 155 |
| 642 | 3300025960 | Ga0207651_10516228 | Ga0207651_105162282 | 155 |
| 643 | 3300025960 | Ga0207651_10655443 | Ga0207651_106554432 | 155 |
| 644 | 3300025961 | Ga0207712_10139210 | Ga0207712_101392103 | 155 |
| 645 | 3300026035 | Ga0207703_10335898 | Ga0207703_103358981 | 155 |
| 646 | 3300026041 | Ga0207639_10320754 | Ga0207639_103207542 | 155 |
| 647 | 3300026088 | Ga0207641_10199828 | Ga0207641_101998282 | 155 |
| 648 | 3300026089 | Ga0207648_10053392 | Ga0207648_100533924 | 155 |
| 649 | 3300026089 | Ga0207648_10185189 | Ga0207648_101851893 | 155 |
| 650 | 3300026095 | Ga0207676_10242514 | Ga0207676_102425143 | 155 |
| 651 | 3300026095 | Ga0207676_10541282 | Ga0207676_105412822 | 155 |
| 652 | 3300026095 | Ga0207676_10573421 | Ga0207676_105734211 | 155 |
| 653 | 3300026116 | Ga0207674_10045280 | Ga0207674_100452804 | 155 |
| 654 | 3300026116 | Ga0207674_10082329 | Ga0207674_100823294 | 155 |
| 655 | 3300026116 | Ga0207674_10877249 | Ga0207674_108772492 | 155 |
| 656 | 3300026116 | Ga0207674_11033677 | Ga0207674_110336771 | 155 |
| 657 | 3300026118 | Ga0207675_101245788 | Ga0207675_1012457881 | 155 |
| 658 | 3300026142 | Ga0207698_10629901 | Ga0207698_106299012 | 155 |
| 659 | 3300028380 | Ga0268265_10125141 | Ga0268265_101251413 | 155 |
| 660 | 3300028381 | Ga0268264_10113800 | Ga0268264_101138002 | 155 |
| 661 | 3300031548 | Ga0307408_100364739 | Ga0307408_1003647391 | 155 |
| 662 | 3300031731 | Ga0307405_10185467 | Ga0307405_101854673 | 155 |
| 663 | 3300031903 | Ga0307407_10919226 | Ga0307407_109192261 | 155 |
| 664 | 3300031911 | Ga0307412_10151953 | Ga0307412_101519532 | 155 |
| 665 | 3300031995 | Ga0307409_100343663 | Ga0307409_1003436631 | 155 |
| 666 | 3300031995 | Ga0307409_101651106 | Ga0307409_1016511061 | 155 |
| 667 | 3300032002 | Ga0307416_100244826 | Ga0307416_1002448263 | 155 |
| 668 | 3300032002 | Ga0307416_100267912 | Ga0307416_1002679121 | 155 |
| 669 | 3300032004 | Ga0307414_10107514 | Ga0307414_101075142 | 155 |
| 670 | 3300032005 | Ga0307411_10059733 | Ga0307411_100597334 | 155 |
| 671 | 3300032126 | Ga0307415_100055008 | Ga0307415_1000550083 | 155 |
| 672 | 3300035207 | Ga0373942_0005319 | Ga0373942_0005319_578_1102 | 155 |
| 673 | 3300045051 | Ga0451576_0824685 | Ga0451576_0824685_153_680 | 155 |
| 674 | 3300048906 | Ga0496103_0718748 | Ga0496103_0718748_46_570 | 155 |
| 675 | 3300048909 | Ga0496106_0181264 | Ga0496106_0181264_508_1032 | 155 |
| 676 | 3300048911 | Ga0496108_0694832 | Ga0496108_0694832_96_620 | 155 |
| 677 | 3300048916 | Ga0496113_0248447 | Ga0496113_0248447_741_1265 | 155 |
| 678 | 3300048916 | Ga0496113_0582224 | Ga0496113_0582224_292_816 | 155 |
| 679 | 3300049513 | Ga0501290_006877 | Ga0501290_006877_703_1230 | 155 |
| 680 | 3300049519 | Ga0501296_035696 | Ga0501296_035696_70_597 | 155 |
| 681 | 3300049526 | Ga0501303_001987 | Ga0501303_001987_532_1059 | 155 |
| 682 | 3300049653 | Ga0501206_014800 | Ga0501206_014800_252_797 | 155 |
| 683 | 3300049654 | Ga0501207_017355 | Ga0501207_017355_560_1084 | 155 |
| 684 | 3300049661 | Ga0501217_073373 | Ga0501217_073373_202_729 | 155 |
| 685 | 3300049663 | Ga0501223_013955 | Ga0501223_013955_968_1492 | 155 |
| 686 | 3300049665 | Ga0501227_021631 | Ga0501227_021631_73_597 | 155 |
| 687 | 3300049669 | Ga0501235_041801 | Ga0501235_041801_105_629 | 155 |
| 688 | 3300049672 | Ga0501239_003158 | Ga0501239_003158_222_749 | 155 |
| 689 | 3300049672 | Ga0501239_022936 | Ga0501239_022936_34_558 | 155 |
| 690 | 3300049675 | Ga0501243_015224 | Ga0501243_015224_167_694 | 155 |
| 691 | 3300049676 | Ga0501246_015326 | Ga0501246_015326_77_604 | 155 |
| 692 | 3300049679 | Ga0501249_019923 | Ga0501249_019923_857_1381 | 155 |
| 693 | 3300049683 | Ga0501253_077273 | Ga0501253_077273_118_642 | 155 |
| 694 | 3300049683 | Ga0501253_164456 | Ga0501253_164456_21_548 | 155 |
| 695 | 3300049686 | Ga0501257_029768 | Ga0501257_029768_595_1119 | 155 |
| 696 | 3300049690 | Ga0501261_007428 | Ga0501261_007428_390_917 | 155 |
| 697 | 3300049705 | Ga0501225_0045111 | Ga0501225_0045111_31_555 | 155 |
| 698 | 3300049706 | Ga0501229_026960 | Ga0501229_026960_206_730 | 155 |
| 699 | 3300049707 | Ga0501234_010392 | Ga0501234_010392_225_749 | 155 |
| 700 | 3300049708 | Ga0501245_014386 | Ga0501245_014386_570_1094 | 155 |
| 701 | 3300049770 | Ga0501273_039176 | Ga0501273_039176_88_615 | 155 |
| 702 | 3300049851 | Ga0501212_016452 | Ga0501212_016452_313_837 | 155 |
| 703 | 3300049853 | Ga0501226_011490 | Ga0501226_011490_280_804 | 155 |
| 704 | 3300050507 | nmdc:mga05p37_21005_c1 | nmdc:mga05p37_21005_c1_7141_7665 | 155 |
| 705 | 3300050512 | nmdc:mga0n895_346216_c1 | nmdc:mga0n895_346216_c1_13_540 | 155 |
| 706 | 3300050512 | nmdc:mga0n895_949785_c1 | nmdc:mga0n895_949785_c1_299_826 | 155 |
| 707 | 3300050515 | nmdc:mga0a205_120934_c1 | nmdc:mga0a205_120934_c1_1677_2204 | 155 |
| 708 | 3300050515 | nmdc:mga0a205_214949_c1 | nmdc:mga0a205_214949_c1_1172_1696 | 155 |
| 709 | 3300050515 | nmdc:mga0a205_396553_c1 | nmdc:mga0a205_396553_c1_448_975 | 155 |
| 710 | 3300000532 | CNAas_1001391 | CNAas_10013913 | 156 |
| 711 | 3300003203 | JGI25406J46586_10063825 | JGI25406J46586_100638252 | 156 |
| 712 | 3300005289 | Ga0065704_10002311 | Ga0065704_100023113 | 156 |
| 713 | 3300005293 | Ga0065715_10001156 | Ga0065715_100011565 | 156 |
| 714 | 3300005295 | Ga0065707_10004646 | Ga0065707_100046464 | 156 |
| 715 | 3300005295 | Ga0065707_10562637 | Ga0065707_105626371 | 156 |
| 716 | 3300005328 | Ga0070676_10538425 | Ga0070676_105384252 | 156 |
| 717 | 3300005330 | Ga0070690_100338170 | Ga0070690_1003381701 | 156 |
| 718 | 3300005331 | Ga0070670_100551815 | Ga0070670_1005518151 | 156 |
| 719 | 3300005354 | Ga0070675_100672057 | Ga0070675_1006720572 | 156 |
| 720 | 3300005364 | Ga0070673_100015044 | Ga0070673_1000150444 | 156 |
| 721 | 3300005366 | Ga0070659_100439323 | Ga0070659_1004393232 | 156 |
| 722 | 3300005440 | Ga0070705_100012433 | Ga0070705_1000124335 | 156 |
| 723 | 3300005441 | Ga0070700_100000107 | Ga0070700_10000010721 | 156 |
| 724 | 3300005441 | Ga0070700_100052936 | Ga0070700_1000529363 | 156 |
| 725 | 3300005444 | Ga0070694_100098478 | Ga0070694_1000984782 | 156 |
| 726 | 3300005445 | Ga0070708_100000361 | Ga0070708_10000036132 | 156 |
| 727 | 3300005445 | Ga0070708_100237738 | Ga0070708_1002377383 | 156 |
| 728 | 3300005445 | Ga0070708_100417572 | Ga0070708_1004175721 | 156 |
| 729 | 3300005445 | Ga0070708_100878947 | Ga0070708_1008789471 | 156 |
| 730 | 3300005458 | Ga0070681_10020201 | Ga0070681_100202017 | 156 |
| 731 | 3300005467 | Ga0070706_100024043 | Ga0070706_1000240435 | 156 |
| 732 | 3300005468 | Ga0070707_101417855 | Ga0070707_1014178551 | 156 |
| 733 | 3300005471 | Ga0070698_100016325 | Ga0070698_1000163257 | 156 |
| 734 | 3300005471 | Ga0070698_100017121 | Ga0070698_1000171216 | 156 |
| 735 | 3300005518 | Ga0070699_100003309 | Ga0070699_10000330911 | 156 |
| 736 | 3300005518 | Ga0070699_100015176 | Ga0070699_1000151764 | 156 |
| 737 | 3300005536 | Ga0070697_100004262 | Ga0070697_10000426210 | 156 |
| 738 | 3300005536 | Ga0070697_100163082 | Ga0070697_1001630822 | 156 |
| 739 | 3300005536 | Ga0070697_100499409 | Ga0070697_1004994092 | 156 |
| 740 | 3300005545 | Ga0070695_100050781 | Ga0070695_1000507812 | 156 |
| 741 | 3300005546 | Ga0070696_100071409 | Ga0070696_1000714093 | 156 |
| 742 | 3300005549 | Ga0070704_100114124 | Ga0070704_1001141242 | 156 |
| 743 | 3300005563 | Ga0068855_100969893 | Ga0068855_1009698931 | 156 |
| 744 | 3300005564 | Ga0070664_101033211 | Ga0070664_1010332112 | 156 |
| 745 | 3300005577 | Ga0068857_100137507 | Ga0068857_1001375072 | 156 |
| 746 | 3300005578 | Ga0068854_100110567 | Ga0068854_1001105672 | 156 |
| 747 | 3300005615 | Ga0070702_100522757 | Ga0070702_1005227571 | 156 |
| 748 | 3300005616 | Ga0068852_101152310 | Ga0068852_1011523102 | 156 |
| 749 | 3300005617 | Ga0068859_100004451 | Ga0068859_1000044518 | 156 |
| 750 | 3300005617 | Ga0068859_100791201 | Ga0068859_1007912011 | 156 |
| 751 | 3300005617 | Ga0068859_100868768 | Ga0068859_1008687682 | 156 |
| 752 | 3300005618 | Ga0068864_100035605 | Ga0068864_1000356053 | 156 |
| 753 | 3300005719 | Ga0068861_100008185 | Ga0068861_1000081857 | 156 |
| 754 | 3300005842 | Ga0068858_100052207 | Ga0068858_1000522073 | 156 |
| 755 | 3300005842 | Ga0068858_100403701 | Ga0068858_1004037011 | 156 |
| 756 | 3300005843 | Ga0068860_100879285 | Ga0068860_1008792851 | 156 |
| 757 | 3300005844 | Ga0068862_100998800 | Ga0068862_1009988001 | 156 |
| 758 | 3300005985 | Ga0081539_10002786 | Ga0081539_1000278613 | 156 |
| 759 | 3300006237 | Ga0097621_100005444 | Ga0097621_1000054448 | 156 |
| 760 | 3300006358 | Ga0068871_100001051 | Ga0068871_1000010515 | 156 |
| 761 | 3300006852 | Ga0075433_10104127 | Ga0075433_101041273 | 156 |
| 762 | 3300006871 | Ga0075434_100424577 | Ga0075434_1004245772 | 156 |
| 763 | 3300006871 | Ga0075434_100827164 | Ga0075434_1008271641 | 156 |
| 764 | 3300006871 | Ga0075434_101343960 | Ga0075434_1013439602 | 156 |
| 765 | 3300006914 | Ga0075436_100089402 | Ga0075436_1000894022 | 156 |
| 766 | 3300006931 | Ga0097620_100004451 | Ga0097620_1000044519 | 156 |
| 767 | 3300006931 | Ga0097620_100791262 | Ga0097620_1007912622 | 156 |
| 768 | 3300006931 | Ga0097620_100868775 | Ga0097620_1008687752 | 156 |
| 769 | 3300009011 | Ga0105251_10039979 | Ga0105251_100399792 | 156 |
| 770 | 3300009093 | Ga0105240_10219279 | Ga0105240_102192791 | 156 |
| 771 | 3300009094 | Ga0111539_10021649 | Ga0111539_100216494 | 156 |
| 772 | 3300009101 | Ga0105247_10083526 | Ga0105247_100835263 | 156 |
| 773 | 3300009101 | Ga0105247_10378040 | Ga0105247_103780402 | 156 |
| 774 | 3300009101 | Ga0105247_10771141 | Ga0105247_107711412 | 156 |
| 775 | 3300009147 | Ga0114129_11118683 | Ga0114129_111186832 | 156 |
| 776 | 3300009177 | Ga0105248_10006595 | Ga0105248_1000659511 | 156 |
| 777 | 3300009177 | Ga0105248_10023476 | Ga0105248_100234766 | 156 |
| 778 | 3300009177 | Ga0105248_10434385 | Ga0105248_104343853 | 156 |
| 779 | 3300009545 | Ga0105237_10100323 | Ga0105237_101003233 | 156 |
| 780 | 3300009545 | Ga0105237_11623044 | Ga0105237_116230441 | 156 |
| 781 | 3300009551 | Ga0105238_10025821 | Ga0105238_100258217 | 156 |
| 782 | 3300010375 | Ga0105239_10664718 | Ga0105239_106647182 | 156 |
| 783 | 3300010375 | Ga0105239_10904756 | Ga0105239_109047562 | 156 |
| 784 | 3300013100 | Ga0157373_10242493 | Ga0157373_102424932 | 156 |
| 785 | 3300013306 | Ga0163162_10004188 | Ga0163162_1000418810 | 156 |
| 786 | 3300013307 | Ga0157372_10320815 | Ga0157372_103208153 | 156 |
| 787 | 3300013307 | Ga0157372_10440326 | Ga0157372_104403262 | 156 |
| 788 | 3300013308 | Ga0157375_10006074 | Ga0157375_100060749 | 156 |
| 789 | 3300014325 | Ga0163163_10028033 | Ga0163163_100280334 | 156 |
| 790 | 3300014325 | Ga0163163_10184350 | Ga0163163_101843502 | 156 |
| 791 | 3300014325 | Ga0163163_11822783 | Ga0163163_118227831 | 156 |
| 792 | 3300014745 | Ga0157377_10030998 | Ga0157377_100309984 | 156 |
| 793 | 3300017792 | Ga0163161_10763967 | Ga0163161_107639671 | 156 |
| 794 | 3300025900 | Ga0207710_10397119 | Ga0207710_103971192 | 156 |
| 795 | 3300025904 | Ga0207647_10004611 | Ga0207647_100046119 | 156 |
| 796 | 3300025904 | Ga0207647_10239322 | Ga0207647_102393221 | 156 |
| 797 | 3300025904 | Ga0207647_10486877 | Ga0207647_104868772 | 156 |
| 798 | 3300025907 | Ga0207645_10161213 | Ga0207645_101612131 | 156 |
| 799 | 3300025910 | Ga0207684_10000171 | Ga0207684_1000017123 | 156 |
| 800 | 3300025910 | Ga0207684_10105416 | Ga0207684_101054162 | 156 |
| 801 | 3300025910 | Ga0207684_10493394 | Ga0207684_104933941 | 156 |
| 802 | 3300025911 | Ga0207654_10100679 | Ga0207654_101006792 | 156 |
| 803 | 3300025911 | Ga0207654_10585921 | Ga0207654_105859212 | 156 |
| 804 | 3300025912 | Ga0207707_10016939 | Ga0207707_100169395 | 156 |
| 805 | 3300025913 | Ga0207695_10797913 | Ga0207695_107979131 | 156 |
| 806 | 3300025914 | Ga0207671_10265650 | Ga0207671_102656502 | 156 |
| 807 | 3300025922 | Ga0207646_10098715 | Ga0207646_100987153 | 156 |
| 808 | 3300025922 | Ga0207646_11187265 | Ga0207646_111872651 | 156 |
| 809 | 3300025924 | Ga0207694_10003255 | Ga0207694_100032553 | 156 |
| 810 | 3300025926 | Ga0207659_10336138 | Ga0207659_103361383 | 156 |
| 811 | 3300025927 | Ga0207687_10081110 | Ga0207687_100811102 | 156 |
| 812 | 3300025933 | Ga0207706_10210404 | Ga0207706_102104041 | 156 |
| 813 | 3300025935 | Ga0207709_10744638 | Ga0207709_107446381 | 156 |
| 814 | 3300025939 | Ga0207665_10253720 | Ga0207665_102537201 | 156 |
| 815 | 3300025941 | Ga0207711_10002872 | Ga0207711_100028725 | 156 |
| 816 | 3300025941 | Ga0207711_11193394 | Ga0207711_111933941 | 156 |
| 817 | 3300025949 | Ga0207667_10888810 | Ga0207667_108888102 | 156 |
| 818 | 3300025960 | Ga0207651_10001864 | Ga0207651_100018643 | 156 |
| 819 | 3300025981 | Ga0207640_10201990 | Ga0207640_102019902 | 156 |
| 820 | 3300026035 | Ga0207703_10187676 | Ga0207703_101876762 | 156 |
| 821 | 3300026035 | Ga0207703_10340821 | Ga0207703_103408212 | 156 |
| 822 | 3300026075 | Ga0207708_10000085 | Ga0207708_1000008537 | 156 |
| 823 | 3300026075 | Ga0207708_10023657 | Ga0207708_100236573 | 156 |
| 824 | 3300026078 | Ga0207702_10994682 | Ga0207702_109946822 | 156 |
| 825 | 3300026095 | Ga0207676_10568000 | Ga0207676_105680002 | 156 |
| 826 | 3300026116 | Ga0207674_10089817 | Ga0207674_100898173 | 156 |
| 827 | 3300026118 | Ga0207675_100011224 | Ga0207675_1000112243 | 156 |
| 828 | 3300026118 | Ga0207675_100498183 | Ga0207675_1004981831 | 156 |
| 829 | 3300027907 | Ga0207428_10046280 | Ga0207428_100462802 | 156 |
| 830 | 3300031548 | Ga0307408_100023709 | Ga0307408_1000237094 | 156 |
| 831 | 3300031731 | Ga0307405_10015262 | Ga0307405_100152622 | 156 |
| 832 | 3300031901 | Ga0307406_10020665 | Ga0307406_100206653 | 156 |
| 833 | 3300031911 | Ga0307412_10207719 | Ga0307412_102077192 | 156 |
| 834 | 3300031995 | Ga0307409_100162534 | Ga0307409_1001625343 | 156 |
| 835 | 3300032002 | Ga0307416_100711682 | Ga0307416_1007116822 | 156 |
| 836 | 3300032004 | Ga0307414_10142321 | Ga0307414_101423212 | 156 |
| 837 | 3300032126 | Ga0307415_100001042 | Ga0307415_1000010429 | 156 |
| 838 | 3300035092 | Ga0373952_0076197 | Ga0373952_0076197_45_575 | 156 |
| 839 | 3300035115 | Ga0373941_0014333 | Ga0373941_0014333_800_1330 | 156 |
| 840 | 3300035242 | Ga0373962_0053118 | Ga0373962_0053118_311_841 | 156 |
| 841 | 3300037312 | Ga0395899_0364991 | Ga0395899_0364991_305_844 | 156 |
| 842 | 3300037418 | Ga0395900_0710185 | Ga0395900_0710185_150_680 | 156 |
| 843 | 3300037466 | Ga0395898_0197372 | Ga0395898_0197372_552_1082 | 156 |
| 844 | 3300038443 | Ga0395901_0227966 | Ga0395901_0227966_562_1092 | 156 |
| 845 | 3300038443 | Ga0395901_0887711 | Ga0395901_0887711_160_714 | 156 |
| 846 | 3300042005 | Ga0439448_0097642 | Ga0439448_0097642_183_713 | 156 |
| 847 | 3300048913 | Ga0496110_0438152 | Ga0496110_0438152_477_1007 | 156 |
| 848 | 3300049132 | Ga0501343_017701 | Ga0501343_017701_20_550 | 156 |
| 849 | 3300049521 | Ga0501298_017284 | Ga0501298_017284_386_916 | 156 |
| 850 | 3300049574 | Ga0501038_0003131 | Ga0501038_0003131_13128_13688 | 156 |
| 851 | 3300049649 | Ga0501198_002039 | Ga0501198_002039_275_805 | 156 |
| 852 | 3300049654 | Ga0501207_001168 | Ga0501207_001168_727_1257 | 156 |
| 853 | 3300049661 | Ga0501217_002407 | Ga0501217_002407_740_1270 | 156 |
| 854 | 3300049663 | Ga0501223_010828 | Ga0501223_010828_550_1080 | 156 |
| 855 | 3300049665 | Ga0501227_003359 | Ga0501227_003359_751_1281 | 156 |
| 856 | 3300049668 | Ga0501233_002570 | Ga0501233_002570_2521_3051 | 156 |
| 857 | 3300049670 | Ga0501236_011644 | Ga0501236_011644_456_986 | 156 |
| 858 | 3300049685 | Ga0501256_001805 | Ga0501256_001805_1035_1565 | 156 |
| 859 | 3300049688 | Ga0501259_006271 | Ga0501259_006271_1169_1699 | 156 |
| 860 | 3300049689 | Ga0501260_001506 | Ga0501260_001506_1272_1802 | 156 |
| 861 | 3300049706 | Ga0501229_002858 | Ga0501229_002858_1333_1863 | 156 |
| 862 | 3300049707 | Ga0501234_012464 | Ga0501234_012464_251_781 | 156 |
| 863 | 3300049853 | Ga0501226_002497 | Ga0501226_002497_1650_2180 | 156 |
| 864 | 3300050507 | nmdc:mga05p37_1049366_c1 | nmdc:mga05p37_1049366_c1_279_812 | 156 |
| 865 | 3300050511 | nmdc:mga08y16_4491_c1 | nmdc:mga08y16_4491_c1_654_1208 | 156 |
| 866 | 3300050512 | nmdc:mga0n895_155882_c1 | nmdc:mga0n895_155882_c1_1403_1921 | 156 |
| 867 | 3300050512 | nmdc:mga0n895_371925_c1 | nmdc:mga0n895_371925_c1_890_1420 | 156 |
| 868 | 3300050512 | nmdc:mga0n895_397297_c1 | nmdc:mga0n895_397297_c1_22_576 | 156 |
| 869 | 3300050514 | nmdc:mga08x19_46140_c1 | nmdc:mga08x19_46140_c1_899_1429 | 156 |
| 870 | 3300059511 | Ga0587091_091434 | Ga0587091_091434_50_580 | 156 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2l5o-assembly1.cif.gz_A | solution structure of a putative thioredoxin from neisseria meningitidis | 0.8566 | 22 | 148 |
| 2h1b-assembly2.cif.gz_B | resa e80q | 0.849 | 23 | 154 |
| 3kcm-assembly1.cif.gz_A | the crystal structure of thioredoxin protein from geobacter metallireducens | 0.8422 | 23 | 153 |
| 2ls5-assembly1.cif.gz_A | solution structure of a putative protein disulfide isomerase from bacteroides thetaiotaomicron | 0.8407 | 23 | 143 |
| 2h19-assembly2.cif.gz_B | crystal structure of resa cys77ala variant | 0.8341 | 22 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2l5oA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8566 | 22 | 148 | 3.40.30.10 |
| 2ls5A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8407 | 23 | 143 | 3.40.30.10 |
| af_P71990_1_182_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8354 | 22 | 143 | 3.40.30.10 |
| 2lrtA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8318 | 23 | 143 | 3.40.30.10 |
| 1st9A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8294 | 22 | 154 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8NKC7-F1-model_v4 | Thioredoxin domain-containing protein | 0.9219 | 12 | 130 |
GO:0016209
GO:0016491 |
| AF-A0A7C1H3V8-F1-model_v4 | TlpA family protein disulfide reductase | 0.9131 | 22 | 143 |
GO:0016209
GO:0016491 |
| AF-A0A7C4Z073-F1-model_v4 | Redoxin domain-containing protein | 0.9098 | 22 | 142 |
GO:0016020
GO:0016209 GO:0016491 |
| AF-A0A1M5TEN2-F1-model_v4 | Peroxiredoxin | 0.9096 | 22 | 143 |
GO:0015036
GO:0016209 |
| AF-A0A651HVK6-F1-model_v4 | TlpA family protein disulfide reductase | 0.9096 | 22 | 143 |
GO:0016209
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar