F484146

General Info

Members Datasets Scaffolds Average Seq Length
870 271 870 172

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10421235|Ga0105245_104212353
Length 188
Sequence MKQGESQPGRWKEKTMLTKSRTIVIAAALSFLAVAATSAAAQNRATDFSLRSVDGDAVTAESLRGEVAVLAFGKAWLPLTRNQLEGVKKLADDYSGRGVVVYWVSTDSDSPKSKAYASDEELRALARKYKVTVLRDPDGAVSKKLGVDQLPSVVIFDKQGNVSGGPIGGLDPTANLATQLSARLDKIL

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001426 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
185 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
188 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
195 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
204 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
207 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
223 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
224 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
225 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
226 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
231 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
232 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
233 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
234 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
235 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
236 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
237 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
238 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
239 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
240 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
241 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
242 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
243 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
244 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
245 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
246 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
247 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
248 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
249 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
250 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
251 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
252 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
253 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
254 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
257 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
258 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
259 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
260 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
261 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.49
Rhizosphere 98.28
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1001391 3300000532 Bacteria 2082
2 LJNas_1015975 3300000546 Unclassified 800
3 JGI24030J14995_101492 3300001426 Unclassified 822
4 JGI24748J21848_1000002 3300002074 Bacteria 426946
5 JGI24034J26672_10000004 3300002239 Bacteria 426946
6 JGI24751J29686_10000058 3300002459 Bacteria 62035
7 JGI24751J29686_10000101 3300002459 Bacteria 47517
8 JGI25406J46586_10063825 3300003203 Unclassified 1179
9 rootL2_10302468 3300003322 Unclassified 2104
10 Ga0065714_10064501 3300005288 Bacteria 47703
11 Ga0065704_10002311 3300005289 Bacteria 5805
12 Ga0065704_10096432 3300005289 Bacteria 2442
13 Ga0065704_10426529 3300005289 Unclassified 727
14 Ga0065712_10001518 3300005290 Bacteria 9022
15 Ga0065712_10022101 3300005290 Bacteria 2180
16 Ga0065712_10067737 3300005290 Bacteria 93332
17 Ga0065712_10124288 3300005290 Unclassified 1628
18 Ga0065712_10314971 3300005290 Unclassified 837
19 Ga0065715_10001156 3300005293 Bacteria 8008
20 Ga0065715_10089067 3300005293 Bacteria 15062
21 Ga0065715_10124138 3300005293 Unclassified 2161
22 Ga0065715_10146354 3300005293 Bacteria 1784
23 Ga0065715_10313428 3300005293 Bacteria 1016
24 Ga0065715_10356127 3300005293 Unclassified 943
25 Ga0065715_10390024 3300005293 Unclassified 895
26 Ga0065715_10866278 3300005293 Bacteria 586
27 Ga0065707_10004038 3300005295 Bacteria 3396
28 Ga0065707_10004646 3300005295 Bacteria 5813
29 Ga0065707_10217781 3300005295 Bacteria 1237
30 Ga0065707_10231768 3300005295 Unclassified 1186
31 Ga0065707_10562637 3300005295 Unclassified 713
32 Ga0070676_10538425 3300005328 Unclassified 834
33 Ga0070676_11086531 3300005328 Unclassified 604
34 Ga0070690_100013098 3300005330 Bacteria 4893
35 Ga0070690_100338170 3300005330 Bacteria 1089
36 Ga0070670_100000288 3300005331 Bacteria 44423
37 Ga0070670_100042923 3300005331 Bacteria 3888
38 Ga0070670_100077596 3300005331 Unclassified 2854
39 Ga0070670_100137287 3300005331 Bacteria 2113
40 Ga0070670_100551815 3300005331 Bacteria 1028
41 Ga0070670_101515846 3300005331 Unclassified 616
42 Ga0068869_100024509 3300005334 Bacteria 4178
43 Ga0068869_100589100 3300005334 Bacteria 938
44 Ga0068869_100616639 3300005334 Unclassified 918
45 Ga0068869_100683138 3300005334 Bacteria 874
46 Ga0068869_100774985 3300005334 Unclassified 823
47 Ga0068869_100873600 3300005334 Unclassified 777
48 Ga0070680_100509704 3300005336 Unclassified 1030
49 Ga0070682_100000027 3300005337 Bacteria 188799
50 Ga0070682_100357039 3300005337 Bacteria 1091
51 Ga0068868_100071693 3300005338 Bacteria 2763
52 Ga0068868_100717207 3300005338 Unclassified 896
53 Ga0068868_101522234 3300005338 Unclassified 627
54 Ga0070660_101114857 3300005339 Unclassified 668
55 Ga0070689_100088677 3300005340 Unclassified 2435
56 Ga0070689_100400688 3300005340 Bacteria 1160
57 Ga0070689_100449065 3300005340 Bacteria 1097
58 Ga0070689_100781539 3300005340 Unclassified 838
59 Ga0070689_100964888 3300005340 Unclassified 757
60 Ga0070687_100019143 3300005343 Bacteria 3181
61 Ga0070687_100036834 3300005343 Bacteria 2441
62 Ga0070687_100049129 3300005343 Unclassified 2173
63 Ga0070687_100271276 3300005343 Bacteria 1063
64 Ga0070687_100594729 3300005343 Bacteria 759
65 Ga0070661_101176153 3300005344 Unclassified 641
66 Ga0070692_10008111 3300005345 Bacteria 4667
67 Ga0070668_100010083 3300005347 Bacteria 7004
68 Ga0070668_100392176 3300005347 Unclassified 1184
69 Ga0070669_100002495 3300005353 Bacteria 13325
70 Ga0070669_100038470 3300005353 Bacteria 3474
71 Ga0070669_100099025 3300005353 Bacteria 2197
72 Ga0070669_100762010 3300005353 Unclassified 821
73 Ga0070675_100672057 3300005354 Unclassified 942
74 Ga0070671_100004622 3300005355 Bacteria 10915
75 Ga0070671_100033088 3300005355 Bacteria 4274
76 Ga0070674_100530057 3300005356 Unclassified 985
77 Ga0070673_100015044 3300005364 Bacteria 5416
78 Ga0070673_100481690 3300005364 Unclassified 1120
79 Ga0070673_100756846 3300005364 Bacteria 895
80 Ga0070673_100837902 3300005364 Bacteria 851
81 Ga0070673_101129279 3300005364 Unclassified 733
82 Ga0070659_100439323 3300005366 Unclassified 1105
83 Ga0070659_101025910 3300005366 Bacteria 725
84 Ga0070703_10000348 3300005406 Bacteria 20179
85 Ga0070703_10040927 3300005406 Unclassified 1443
86 Ga0070703_10349879 3300005406 Unclassified 630
87 Ga0070705_100012433 3300005440 Bacteria 4327
88 Ga0070705_100152266 3300005440 Unclassified 1536
89 Ga0070705_100627113 3300005440 Bacteria 835
90 Ga0070705_100653747 3300005440 Unclassified 820
91 Ga0070705_100830337 3300005440 Unclassified 738
92 Ga0070700_100000107 3300005441 Bacteria 52892
93 Ga0070700_100023717 3300005441 Bacteria 3592
94 Ga0070700_100034326 3300005441 Bacteria 3063
95 Ga0070700_100052936 3300005441 Bacteria 2532
96 Ga0070700_100059267 3300005441 Bacteria 2409
97 Ga0070700_100619075 3300005441 Bacteria 851
98 Ga0070694_100005920 3300005444 Bacteria 7411
99 Ga0070694_100019253 3300005444 Bacteria 4340
100 Ga0070694_100084018 3300005444 Bacteria 2220
101 Ga0070694_100098478 3300005444 Bacteria 2065
102 Ga0070694_100236574 3300005444 Bacteria 1376
103 Ga0070694_100326556 3300005444 Unclassified 1182
104 Ga0070694_100379312 3300005444 Unclassified 1102
105 Ga0070694_100745126 3300005444 Unclassified 800
106 Ga0070694_100833803 3300005444 Bacteria 758
107 Ga0070708_100000361 3300005445 Bacteria 34379
108 Ga0070708_100053571 3300005445 Bacteria 3580
109 Ga0070708_100164594 3300005445 Bacteria 2068
110 Ga0070708_100219902 3300005445 Bacteria 1781
111 Ga0070708_100237738 3300005445 Bacteria 1710
112 Ga0070708_100400680 3300005445 Bacteria 1294
113 Ga0070708_100417572 3300005445 Unclassified 1265
114 Ga0070708_100418170 3300005445 Bacteria 1264
115 Ga0070708_100878947 3300005445 Unclassified 842
116 Ga0070678_100848848 3300005456 Bacteria 832
117 Ga0070662_100134411 3300005457 Bacteria 1911
118 Ga0070681_10020201 3300005458 Bacteria 6676
119 Ga0068867_100378510 3300005459 Unclassified 1188
120 Ga0068867_101484434 3300005459 Unclassified 631
121 Ga0070706_100024043 3300005467 Bacteria 5610
122 Ga0070706_100037418 3300005467 Unclassified 4482
123 Ga0070706_100167524 3300005467 Bacteria 2051
124 Ga0070706_100177886 3300005467 Bacteria 1986
125 Ga0070706_100315666 3300005467 Unclassified 1458
126 Ga0070706_100409491 3300005467 Bacteria 1262
127 Ga0070706_100656331 3300005467 Bacteria 974
128 Ga0070707_100002485 3300005468 Bacteria 17581
129 Ga0070707_100003049 3300005468 Bacteria 15874
130 Ga0070707_100022287 3300005468 Bacteria 5988
131 Ga0070707_100063283 3300005468 Bacteria 3551
132 Ga0070707_100113249 3300005468 Bacteria 2632
133 Ga0070707_100158406 3300005468 Bacteria 2205
134 Ga0070707_100469950 3300005468 Bacteria 1219
135 Ga0070707_101417855 3300005468 Bacteria 661
136 Ga0070698_100003085 3300005471 Bacteria 18369
137 Ga0070698_100009470 3300005471 Bacteria 10435
138 Ga0070698_100014091 3300005471 Bacteria 8454
139 Ga0070698_100016325 3300005471 Bacteria 7840
140 Ga0070698_100017121 3300005471 Bacteria 7640
141 Ga0070698_100049814 3300005471 Bacteria 4274
142 Ga0070698_100116334 3300005471 Bacteria 2637
143 Ga0070698_100122954 3300005471 Bacteria 2553
144 Ga0070698_100604897 3300005471 Bacteria 1037
145 Ga0070698_100633759 3300005471 Bacteria 1010
146 Ga0070698_100810203 3300005471 Unclassified 881
147 Ga0070698_100931676 3300005471 Unclassified 815
148 Ga0070699_100003309 3300005518 Bacteria 14251
149 Ga0070699_100007923 3300005518 Bacteria 9226
150 Ga0070699_100015176 3300005518 Bacteria 6619
151 Ga0070699_100049413 3300005518 Bacteria 3640
152 Ga0070699_100225426 3300005518 Unclassified 1671
153 Ga0070699_100586630 3300005518 Unclassified 1016
154 Ga0070699_101152460 3300005518 Unclassified 711
155 Ga0070697_100001825 3300005536 Bacteria 16277
156 Ga0070697_100004262 3300005536 Bacteria 10964
157 Ga0070697_100016344 3300005536 Bacteria 5837
158 Ga0070697_100037477 3300005536 Unclassified 3918
159 Ga0070697_100067440 3300005536 Bacteria 2927
160 Ga0070697_100163082 3300005536 Bacteria 1884
161 Ga0070697_100412018 3300005536 Bacteria 1174
162 Ga0070697_100494570 3300005536 Bacteria 1069
163 Ga0070697_100499409 3300005536 Unclassified 1063
164 Ga0070697_101286232 3300005536 Unclassified 652
165 Ga0068853_100143510 3300005539 Bacteria 2144
166 Ga0070672_100072802 3300005543 Bacteria 2737
167 Ga0070672_100196797 3300005543 Bacteria 1684
168 Ga0070672_101027304 3300005543 Bacteria 731
169 Ga0070686_100009294 3300005544 Bacteria 5519
170 Ga0070686_100050927 3300005544 Bacteria 2634
171 Ga0070686_100068604 3300005544 Bacteria 2313
172 Ga0070686_100185703 3300005544 Unclassified 1480
173 Ga0070695_100050781 3300005545 Bacteria 2659
174 Ga0070695_100089006 3300005545 Bacteria 2057
175 Ga0070695_100180658 3300005545 Unclassified 1495
176 Ga0070695_100205630 3300005545 Bacteria 1410
177 Ga0070695_100292257 3300005545 Unclassified 1202
178 Ga0070695_100359586 3300005545 Unclassified 1093
179 Ga0070695_100673452 3300005545 Bacteria 819
180 Ga0070695_101169153 3300005545 Unclassified 632
181 Ga0070696_100032533 3300005546 Bacteria 3578
182 Ga0070696_100071409 3300005546 Bacteria 2443
183 Ga0070696_100109973 3300005546 Bacteria 1984
184 Ga0070696_100117165 3300005546 Bacteria 1924
185 Ga0070696_100139713 3300005546 Bacteria 1769
186 Ga0070696_100298148 3300005546 Bacteria 1234
187 Ga0070696_100352238 3300005546 Unclassified 1140
188 Ga0070696_100427989 3300005546 Bacteria 1040
189 Ga0070696_100727417 3300005546 Unclassified 811
190 Ga0070693_100000972 3300005547 Bacteria 12741
191 Ga0070693_100156698 3300005547 Bacteria 1447
192 Ga0070693_100158005 3300005547 Bacteria 1441
193 Ga0070693_100176318 3300005547 Bacteria 1373
194 Ga0070704_100028893 3300005549 Bacteria 3695
195 Ga0070704_100036648 3300005549 Bacteria 3344
196 Ga0070704_100114124 3300005549 Bacteria 2061
197 Ga0070704_100120541 3300005549 Unclassified 2014
198 Ga0070704_100124072 3300005549 Bacteria 1989
199 Ga0070704_100272049 3300005549 Unclassified 1400
200 Ga0070704_100534794 3300005549 Unclassified 1022
201 Ga0070704_100619410 3300005549 Bacteria 953
202 Ga0070704_100901929 3300005549 Unclassified 795
203 Ga0068855_100969893 3300005563 Unclassified 894
204 Ga0070664_100141118 3300005564 Bacteria 2121
205 Ga0070664_100210169 3300005564 Bacteria 1739
206 Ga0070664_101033211 3300005564 Unclassified 773
207 Ga0068857_100137507 3300005577 Bacteria 2206
208 Ga0068857_100200746 3300005577 Bacteria 1818
209 Ga0068857_100287845 3300005577 Bacteria 1512
210 Ga0068857_101062801 3300005577 Unclassified 781
211 Ga0068857_101152509 3300005577 Unclassified 750
212 Ga0068857_101222831 3300005577 Unclassified 728
213 Ga0068854_100110567 3300005578 Archaea 2072
214 Ga0070702_100014931 3300005615 Bacteria 3953
215 Ga0070702_100029580 3300005615 Bacteria 2981
216 Ga0070702_100029766 3300005615 Unclassified 2972
217 Ga0070702_100030131 3300005615 Unclassified 2956
218 Ga0070702_100093945 3300005615 Bacteria 1825
219 Ga0070702_100350230 3300005615 Unclassified 1040
220 Ga0070702_100522757 3300005615 Bacteria 875
221 Ga0070702_100996773 3300005615 Unclassified 663
222 Ga0068852_100182908 3300005616 Bacteria 1972
223 Ga0068852_101152310 3300005616 Unclassified 796
224 Ga0068859_100004451 3300005617 Bacteria 14294
225 Ga0068859_100060689 3300005617 Unclassified 3810
226 Ga0068859_100070551 3300005617 Bacteria 3529
227 Ga0068859_100139342 3300005617 Bacteria 2499
228 Ga0068859_100225683 3300005617 Bacteria 1961
229 Ga0068859_100455804 3300005617 Bacteria 1375
230 Ga0068859_100536970 3300005617 Unclassified 1264
231 Ga0068859_100563409 3300005617 Unclassified 1233
232 Ga0068859_100659834 3300005617 Unclassified 1138
233 Ga0068859_100791201 3300005617 Bacteria 1036
234 Ga0068859_100868768 3300005617 Bacteria 987
235 Ga0068864_100002264 3300005618 Bacteria 15917
236 Ga0068864_100007172 3300005618 Bacteria 9153
237 Ga0068864_100035605 3300005618 Bacteria 4238
238 Ga0068864_100187777 3300005618 Bacteria 1893
239 Ga0068864_100192031 3300005618 Bacteria 1872
240 Ga0068864_100462511 3300005618 Bacteria 1215
241 Ga0068866_10135793 3300005718 Unclassified 1405
242 Ga0068866_10416173 3300005718 Bacteria 871
243 Ga0068861_100008185 3300005719 Bacteria 7193
244 Ga0068861_100008887 3300005719 Bacteria 6924
245 Ga0068861_100056063 3300005719 Bacteria 3007
246 Ga0068861_100178797 3300005719 Bacteria 1764
247 Ga0068861_100289853 3300005719 Bacteria 1413
248 Ga0068861_101293665 3300005719 Bacteria 709
249 Ga0068851_10002518 3300005834 Bacteria 8060
250 Ga0068870_10177926 3300005840 Bacteria 1274
251 Ga0068870_10482408 3300005840 Unclassified 823
252 Ga0068863_100107205 3300005841 Unclassified 2658
253 Ga0068863_100120745 3300005841 Unclassified 2499
254 Ga0068863_100741129 3300005841 Unclassified 978
255 Ga0068858_100002375 3300005842 Bacteria 19040
256 Ga0068858_100052207 3300005842 Bacteria 3782
257 Ga0068858_100099350 3300005842 Bacteria 2713
258 Ga0068858_100104723 3300005842 Bacteria 2640
259 Ga0068858_100284586 3300005842 Unclassified 1574
260 Ga0068858_100360341 3300005842 Unclassified 1394
261 Ga0068858_100403701 3300005842 Bacteria 1313
262 Ga0068858_100407236 3300005842 Bacteria 1307
263 Ga0068858_100521090 3300005842 Bacteria 1149
264 Ga0068860_100154075 3300005843 Bacteria 2214
265 Ga0068860_100176380 3300005843 Unclassified 2065
266 Ga0068860_100199000 3300005843 Bacteria 1941
267 Ga0068860_100244213 3300005843 Bacteria 1747
268 Ga0068860_100325781 3300005843 Bacteria 1508
269 Ga0068860_100729933 3300005843 Unclassified 1001
270 Ga0068860_100826375 3300005843 Unclassified 940
271 Ga0068860_100838899 3300005843 Bacteria 933
272 Ga0068860_100879285 3300005843 Unclassified 912
273 Ga0068860_100905331 3300005843 Unclassified 898
274 Ga0068862_100027399 3300005844 Plasmid 4796
275 Ga0068862_100144461 3300005844 Bacteria 2113
276 Ga0068862_100998800 3300005844 Unclassified 827
277 Ga0068862_101235622 3300005844 Unclassified 747
278 Ga0081540_1015996 3300005983 Bacteria 4723
279 Ga0081539_10002786 3300005985 Bacteria 23472
280 Ga0081539_10002860 3300005985 Bacteria 22952
281 Ga0081539_10053080 3300005985 Bacteria 2272
282 Ga0070715_10000019 3300006163 Bacteria 122990
283 Ga0070716_100000001 3300006173 Bacteria 400668
284 Ga0070716_100108602 3300006173 Unclassified 1715
285 Ga0070716_100845667 3300006173 Bacteria 712
286 Ga0097621_100005444 3300006237 Bacteria 8966
287 Ga0068871_100001051 3300006358 Bacteria 18505
288 Ga0068871_100271019 3300006358 Bacteria 1483
289 Ga0068871_100336796 3300006358 Bacteria 1331
290 Ga0075428_100093477 3300006844 Bacteria 3279
291 Ga0075428_100803666 3300006844 Bacteria 1000
292 Ga0075428_101401567 3300006844 Bacteria 733
293 Ga0075431_100050600 3300006847 Unclassified 4283
294 Ga0075431_100086515 3300006847 Bacteria 3234
295 Ga0075431_100243832 3300006847 Bacteria 1827
296 Ga0075431_100765689 3300006847 Bacteria 940
297 Ga0075433_10007251 3300006852 Bacteria 8784
298 Ga0075433_10019917 3300006852 Bacteria 5601
299 Ga0075433_10104127 3300006852 Bacteria 2514
300 Ga0075433_10148952 3300006852 Bacteria 2081
301 Ga0075433_10230016 3300006852 Bacteria 1647
302 Ga0075433_10250767 3300006852 Bacteria 1570
303 Ga0075434_100031968 3300006871 Bacteria 5189
304 Ga0075434_100158918 3300006871 Bacteria 2280
305 Ga0075434_100364079 3300006871 Bacteria 1467
306 Ga0075434_100424577 3300006871 Unclassified 1351
307 Ga0075434_100827164 3300006871 Bacteria 942
308 Ga0075434_101036773 3300006871 Unclassified 834
309 Ga0075434_101088058 3300006871 Unclassified 813
310 Ga0075434_101343960 3300006871 Unclassified 725
311 Ga0075434_101368840 3300006871 Bacteria 718
312 Ga0075429_100170245 3300006880 Bacteria 1908
313 Ga0075429_100524686 3300006880 Unclassified 1038
314 Ga0075429_100797923 3300006880 Bacteria 827
315 Ga0068865_100176463 3300006881 Unclassified 1642
316 Ga0068865_101178848 3300006881 Unclassified 677
317 Ga0075436_100000015 3300006914 Bacteria 174598
318 Ga0075436_100089402 3300006914 Bacteria 2140
319 Ga0075436_100117395 3300006914 Unclassified 1860
320 Ga0097620_100004451 3300006931 Bacteria 14294
321 Ga0097620_100060690 3300006931 Unclassified 3810
322 Ga0097620_100070561 3300006931 Bacteria 3529
323 Ga0097620_100139337 3300006931 Bacteria 2499
324 Ga0097620_100225692 3300006931 Bacteria 1961
325 Ga0097620_100455825 3300006931 Bacteria 1375
326 Ga0097620_100536993 3300006931 Unclassified 1264
327 Ga0097620_100563442 3300006931 Unclassified 1233
328 Ga0097620_100659853 3300006931 Unclassified 1138
329 Ga0097620_100791262 3300006931 Bacteria 1036
330 Ga0097620_100868775 3300006931 Bacteria 987
331 Ga0097620_101021047 3300006931 Unclassified 908
332 Ga0075435_100000410 3300007076 Bacteria 26372
333 Ga0075435_100779640 3300007076 Unclassified 832
334 Ga0099794_10002733 3300007265 Bacteria 6582
335 Ga0105251_10039979 3300009011 Bacteria 2288
336 Ga0105240_10219279 3300009093 Bacteria 2217
337 Ga0111539_10021649 3300009094 Bacteria 7908
338 Ga0111539_10063062 3300009094 Bacteria 4386
339 Ga0111539_10109329 3300009094 Bacteria 3244
340 Ga0111539_10137643 3300009094 Bacteria 2859
341 Ga0111539_10255549 3300009094 Unclassified 2040
342 Ga0105245_10085681 3300009098 Bacteria 2888
343 Ga0105245_10214890 3300009098 Unclassified 1852
344 Ga0105245_10328767 3300009098 Bacteria 1508
345 Ga0105245_10421235 3300009098 Bacteria 1338
346 Ga0105245_10619544 3300009098 Bacteria 1110
347 Ga0105247_10000005 3300009101 Bacteria 426989
348 Ga0105247_10000395 3300009101 Bacteria 37015
349 Ga0105247_10083526 3300009101 Bacteria 2017
350 Ga0105247_10117830 3300009101 Bacteria 1717
351 Ga0105247_10223457 3300009101 Bacteria 1275
352 Ga0105247_10378040 3300009101 Bacteria 1003
353 Ga0105247_10682445 3300009101 Unclassified 771
354 Ga0105247_10771141 3300009101 Unclassified 731
355 Ga0114129_10003875 3300009147 Bacteria 21099
356 Ga0114129_10009289 3300009147 Bacteria 14022
357 Ga0114129_10009889 3300009147 Bacteria 13599
358 Ga0114129_10010589 3300009147 Bacteria 13148
359 Ga0114129_10027104 3300009147 Bacteria 8113
360 Ga0114129_10792635 3300009147 Bacteria 1209
361 Ga0114129_11118683 3300009147 Unclassified 985
362 Ga0114129_11269770 3300009147 Bacteria 914
363 Ga0114129_12554327 3300009147 Bacteria 610
364 Ga0105243_10000428 3300009148 Bacteria 43953
365 Ga0105243_10002722 3300009148 Bacteria 14692
366 Ga0105243_10019859 3300009148 Bacteria 5096
367 Ga0105243_10030928 3300009148 Bacteria 4125
368 Ga0105243_10129310 3300009148 Unclassified 2140
369 Ga0105243_10136499 3300009148 Bacteria 2087
370 Ga0105243_10154763 3300009148 Bacteria 1970
371 Ga0105243_10208827 3300009148 Bacteria 1718
372 Ga0105243_10297186 3300009148 Viruses 1462
373 Ga0105243_10314896 3300009148 Unclassified 1423
374 Ga0105243_10774210 3300009148 Bacteria 943
375 Ga0105243_11330427 3300009148 Bacteria 737
376 Ga0105241_10175345 3300009174 Bacteria 1774
377 Ga0105241_10527227 3300009174 Bacteria 1057
378 Ga0105241_10859430 3300009174 Bacteria 840
379 Ga0105241_11298556 3300009174 Unclassified 693
380 Ga0105242_10000227 3300009176 Bacteria 44246
381 Ga0105242_10000507 3300009176 Bacteria 30734
382 Ga0105242_10002537 3300009176 Bacteria 14333
383 Ga0105242_10020232 3300009176 Bacteria 5218
384 Ga0105242_10208478 3300009176 Bacteria 1740
385 Ga0105242_10779723 3300009176 Bacteria 944
386 Ga0105242_11796142 3300009176 Unclassified 651
387 Ga0105248_10006595 3300009177 Bacteria 12722
388 Ga0105248_10015021 3300009177 Bacteria 8523
389 Ga0105248_10023476 3300009177 Bacteria 6851
390 Ga0105248_10102180 3300009177 Bacteria 3231
391 Ga0105248_10193172 3300009177 Bacteria 2294
392 Ga0105248_10434385 3300009177 Bacteria 1479
393 Ga0105248_10535044 3300009177 Bacteria 1321
394 Ga0105248_10654107 3300009177 Bacteria 1186
395 Ga0105248_10796641 3300009177 Bacteria 1066
396 Ga0105248_11022136 3300009177 Unclassified 934
397 Ga0105248_11461941 3300009177 Unclassified 774
398 Ga0105237_10002654 3300009545 Bacteria 21987
399 Ga0105237_10100323 3300009545 Bacteria 2886
400 Ga0105237_10663357 3300009545 Bacteria 1050
401 Ga0105237_11623044 3300009545 Unclassified 654
402 Ga0105238_10025821 3300009551 Bacteria 5989
403 Ga0105238_10066275 3300009551 Unclassified 3613
404 Ga0105238_10705796 3300009551 Bacteria 1021
405 Ga0105249_10000375 3300009553 Bacteria 44344
406 Ga0105249_10011935 3300009553 Bacteria 7642
407 Ga0105249_10022736 3300009553 Bacteria 5620
408 Ga0105249_10062428 3300009553 Bacteria 3422
409 Ga0105249_10089092 3300009553 Bacteria 2883
410 Ga0105239_10018470 3300010375 Bacteria 7702
411 Ga0105239_10109520 3300010375 Unclassified 3061
412 Ga0105239_10664718 3300010375 Bacteria 1190
413 Ga0105239_10904756 3300010375 Unclassified 1013
414 Ga0105246_10030376 3300011119 Bacteria 3568
415 Ga0105246_10043449 3300011119 Bacteria 3049
416 Ga0105246_10160941 3300011119 Bacteria 1710
417 Ga0105246_10497001 3300011119 Unclassified 1035
418 Ga0105246_10723447 3300011119 Bacteria 875
419 Ga0157323_1008116 3300012495 Unclassified 774
420 Ga0157373_10084521 3300013100 Bacteria 2237
421 Ga0157373_10149997 3300013100 Bacteria 1640
422 Ga0157373_10242493 3300013100 Bacteria 1274
423 Ga0157373_10286050 3300013100 Unclassified 1169
424 Ga0157371_10499304 3300013102 Bacteria 898
425 Ga0157374_10569230 3300013296 Bacteria 1141
426 Ga0157378_10000067 3300013297 Bacteria 92867
427 Ga0157378_10007638 3300013297 Bacteria 9438
428 Ga0157378_10044131 3300013297 Bacteria 3958
429 Ga0157378_10107731 3300013297 Bacteria 2550
430 Ga0157378_10128573 3300013297 Bacteria 2342
431 Ga0157378_10254089 3300013297 Bacteria 1684
432 Ga0157378_10436132 3300013297 Unclassified 1297
433 Ga0157378_10671913 3300013297 Unclassified 1053
434 Ga0157378_11052956 3300013297 Bacteria 849
435 Ga0157378_11270991 3300013297 Unclassified 777
436 Ga0163162_10000162 3300013306 Bacteria 61820
437 Ga0163162_10001341 3300013306 Bacteria 22917
438 Ga0163162_10004188 3300013306 Bacteria 13864
439 Ga0163162_10023984 3300013306 Bacteria 6020
440 Ga0163162_10056960 3300013306 Unclassified 3936
441 Ga0163162_10091654 3300013306 Bacteria 3122
442 Ga0163162_10149727 3300013306 Bacteria 2451
443 Ga0163162_10373062 3300013306 Unclassified 1560
444 Ga0163162_11710825 3300013306 Bacteria 718
445 Ga0157372_10320815 3300013307 Unclassified 1804
446 Ga0157372_10440326 3300013307 Bacteria 1519
447 Ga0157372_10524134 3300013307 Bacteria 1381
448 Ga0157375_10005624 3300013308 Bacteria 10912
449 Ga0157375_10006074 3300013308 Bacteria 10535
450 Ga0157375_10205014 3300013308 Unclassified 2128
451 Ga0157375_10222015 3300013308 Bacteria 2048
452 Ga0157375_10363757 3300013308 Bacteria 1613
453 Ga0157375_10787821 3300013308 Unclassified 1100
454 Ga0163163_10001223 3300014325 Bacteria 21706
455 Ga0163163_10023043 3300014325 Bacteria 5904
456 Ga0163163_10028033 3300014325 Bacteria 5403
457 Ga0163163_10184350 3300014325 Bacteria 2135
458 Ga0163163_10199108 3300014325 Bacteria 2051
459 Ga0163163_10495975 3300014325 Bacteria 1283
460 Ga0163163_10622613 3300014325 Bacteria 1143
461 Ga0163163_11160310 3300014325 Unclassified 835
462 Ga0163163_11822783 3300014325 Bacteria 669
463 Ga0157380_10013349 3300014326 Bacteria 5987
464 Ga0157380_10117976 3300014326 Bacteria 2242
465 Ga0157380_10264676 3300014326 Bacteria 1564
466 Ga0157380_10471668 3300014326 Bacteria 1211
467 Ga0157377_10030998 3300014745 Unclassified 2903
468 Ga0157377_10076667 3300014745 Bacteria 1945
469 Ga0157377_10181243 3300014745 Bacteria 1325
470 Ga0157377_10200864 3300014745 Bacteria 1266
471 Ga0157377_10230678 3300014745 Bacteria 1190
472 Ga0157377_10552003 3300014745 Bacteria 814
473 Ga0157379_10010606 3300014968 Bacteria 8032
474 Ga0157379_10080571 3300014968 Unclassified 2916
475 Ga0157379_10125649 3300014968 Unclassified 2308
476 Ga0157379_10785902 3300014968 Bacteria 898
477 Ga0157376_10189118 3300014969 Bacteria 1887
478 Ga0163161_10233216 3300017792 Bacteria 1429
479 Ga0163161_10280313 3300017792 Bacteria 1307
480 Ga0163161_10763967 3300017792 Unclassified 809
481 Ga0207672_1000315 3300025223 Bacteria 6488
482 Ga0207656_10005923 3300025321 Bacteria 4361
483 Ga0207653_10000180 3300025885 Bacteria 44353
484 Ga0207653_10005448 3300025885 Unclassified 3981
485 Ga0207653_10050720 3300025885 Bacteria 1380
486 Ga0207653_10211445 3300025885 Unclassified 734
487 Ga0207642_10171638 3300025899 Unclassified 1174
488 Ga0207642_10194220 3300025899 Bacteria 1116
489 Ga0207710_10000004 3300025900 Bacteria 846540
490 Ga0207710_10002291 3300025900 Bacteria 8955
491 Ga0207710_10145022 3300025900 Unclassified 1148
492 Ga0207710_10321549 3300025900 Unclassified 784
493 Ga0207710_10397119 3300025900 Unclassified 707
494 Ga0207647_10004611 3300025904 Bacteria 10209
495 Ga0207647_10102830 3300025904 Bacteria 1694
496 Ga0207647_10239322 3300025904 Bacteria 1043
497 Ga0207647_10486877 3300025904 Unclassified 689
498 Ga0207685_10000021 3300025905 Bacteria 131248
499 Ga0207699_10614603 3300025906 Unclassified 792
500 Ga0207645_10161213 3300025907 Bacteria 1467
501 Ga0207643_10008738 3300025908 Bacteria 5434
502 Ga0207643_10202980 3300025908 Unclassified 1208
503 Ga0207684_10000171 3300025910 Bacteria 107398
504 Ga0207684_10073174 3300025910 Unclassified 2910
505 Ga0207684_10085309 3300025910 Bacteria 2690
506 Ga0207684_10105416 3300025910 Bacteria 2411
507 Ga0207684_10128192 3300025910 Bacteria 2178
508 Ga0207684_10161930 3300025910 Bacteria 1927
509 Ga0207684_10172372 3300025910 Bacteria 1865
510 Ga0207684_10185755 3300025910 Bacteria 1792
511 Ga0207684_10333801 3300025910 Unclassified 1306
512 Ga0207684_10493394 3300025910 Unclassified 1050
513 Ga0207684_10882896 3300025910 Bacteria 752
514 Ga0207654_10100679 3300025911 Bacteria 1780
515 Ga0207654_10153622 3300025911 Bacteria 1480
516 Ga0207654_10585921 3300025911 Bacteria 795
517 Ga0207654_10589151 3300025911 Unclassified 793
518 Ga0207707_10000030 3300025912 Bacteria 160015
519 Ga0207707_10016939 3300025912 Bacteria 6348
520 Ga0207695_10472052 3300025913 Bacteria 1137
521 Ga0207695_10797913 3300025913 Bacteria 824
522 Ga0207671_10007027 3300025914 Bacteria 9862
523 Ga0207671_10187427 3300025914 Bacteria 1612
524 Ga0207671_10265650 3300025914 Bacteria 1351
525 Ga0207671_10429474 3300025914 Bacteria 1051
526 Ga0207660_10000376 3300025917 Bacteria 29145
527 Ga0207660_10192520 3300025917 Unclassified 1589
528 Ga0207662_10016286 3300025918 Bacteria 4193
529 Ga0207662_10045155 3300025918 Unclassified 2604
530 Ga0207662_10180956 3300025918 Bacteria 1356
531 Ga0207657_10296453 3300025919 Bacteria 1281
532 Ga0207657_10450286 3300025919 Unclassified 1010
533 Ga0207649_10643384 3300025920 Bacteria 819
534 Ga0207652_10000086 3300025921 Bacteria 101164
535 Ga0207646_10009636 3300025922 Bacteria 9527
536 Ga0207646_10019481 3300025922 Bacteria 6306
537 Ga0207646_10034457 3300025922 Bacteria 4575
538 Ga0207646_10098715 3300025922 Bacteria 2617
539 Ga0207646_10107115 3300025922 Bacteria 2507
540 Ga0207646_10137432 3300025922 Bacteria 2201
541 Ga0207646_10185089 3300025922 Bacteria 1881
542 Ga0207646_10334889 3300025922 Unclassified 1367
543 Ga0207646_10618865 3300025922 Bacteria 971
544 Ga0207646_10666499 3300025922 Unclassified 931
545 Ga0207646_11187265 3300025922 Bacteria 669
546 Ga0207681_10005479 3300025923 Bacteria 7795
547 Ga0207681_10042146 3300025923 Bacteria 3047
548 Ga0207681_10296308 3300025923 Unclassified 1278
549 Ga0207681_10676149 3300025923 Bacteria 857
550 Ga0207694_10003255 3300025924 Bacteria 12934
551 Ga0207694_10088678 3300025924 Unclassified 2439
552 Ga0207650_10000001 3300025925 Bacteria 1545726
553 Ga0207650_10000304 3300025925 Bacteria 48674
554 Ga0207650_10192007 3300025925 Bacteria 1632
555 Ga0207650_10351931 3300025925 Bacteria 1212
556 Ga0207650_10824675 3300025925 Unclassified 786
557 Ga0207650_10922573 3300025925 Bacteria 742
558 Ga0207659_10336138 3300025926 Unclassified 1250
559 Ga0207687_10063821 3300025927 Bacteria 2609
560 Ga0207687_10081110 3300025927 Bacteria 2343
561 Ga0207687_10749788 3300025927 Unclassified 831
562 Ga0207644_10001123 3300025931 Bacteria 17147
563 Ga0207644_10044589 3300025931 Bacteria 3151
564 Ga0207644_10395669 3300025931 Unclassified 1129
565 Ga0207706_10210404 3300025933 Bacteria 1705
566 Ga0207706_10416287 3300025933 Bacteria 1164
567 Ga0207686_10000213 3300025934 Bacteria 44250
568 Ga0207686_10001463 3300025934 Bacteria 13344
569 Ga0207686_10008445 3300025934 Bacteria 5560
570 Ga0207686_10184254 3300025934 Bacteria 1483
571 Ga0207686_10477384 3300025934 Bacteria 963
572 Ga0207709_10000043 3300025935 Bacteria 248179
573 Ga0207709_10001862 3300025935 Bacteria 14034
574 Ga0207709_10008615 3300025935 Bacteria 5632
575 Ga0207709_10073682 3300025935 Unclassified 2176
576 Ga0207709_10144807 3300025935 Unclassified 1638
577 Ga0207709_10254029 3300025935 Bacteria 1285
578 Ga0207709_10339551 3300025935 Bacteria 1130
579 Ga0207709_10400745 3300025935 Bacteria 1049
580 Ga0207709_10438804 3300025935 Bacteria 1007
581 Ga0207709_10562597 3300025935 Bacteria 898
582 Ga0207709_10623208 3300025935 Bacteria 856
583 Ga0207709_10744638 3300025935 Unclassified 787
584 Ga0207670_10022723 3300025936 Bacteria 3892
585 Ga0207670_10748956 3300025936 Bacteria 811
586 Ga0207670_10956126 3300025936 Unclassified 719
587 Ga0207669_10149728 3300025937 Bacteria 1633
588 Ga0207704_10045054 3300025938 Unclassified 2618
589 Ga0207704_10996210 3300025938 Bacteria 708
590 Ga0207665_10000002 3300025939 Bacteria 267895
591 Ga0207665_10033905 3300025939 Bacteria 3387
592 Ga0207665_10253720 3300025939 Bacteria 1301
593 Ga0207691_10026908 3300025940 Bacteria 5396
594 Ga0207691_10091705 3300025940 Bacteria 2722
595 Ga0207691_10100406 3300025940 Bacteria 2583
596 Ga0207711_10002872 3300025941 Bacteria 15101
597 Ga0207711_10129992 3300025941 Unclassified 2257
598 Ga0207711_10131163 3300025941 Unclassified 2247
599 Ga0207711_10138904 3300025941 Bacteria 2185
600 Ga0207711_10319473 3300025941 Bacteria 1434
601 Ga0207711_10644229 3300025941 Bacteria 988
602 Ga0207711_10717079 3300025941 Unclassified 933
603 Ga0207711_11193394 3300025941 Unclassified 702
604 Ga0207689_10001120 3300025942 Bacteria 25840
605 Ga0207689_10164040 3300025942 Bacteria 1831
606 Ga0207689_10233478 3300025942 Bacteria 1520
607 Ga0207689_10341031 3300025942 Bacteria 1245
608 Ga0207689_10397317 3300025942 Bacteria 1149
609 Ga0207689_10537900 3300025942 Unclassified 981
610 Ga0207689_10859974 3300025942 Unclassified 765
611 Ga0207689_11142875 3300025942 Bacteria 656
612 Ga0207679_10235801 3300025945 Bacteria 1547
613 Ga0207667_10888810 3300025949 Unclassified 883
614 Ga0207651_10001864 3300025960 Bacteria 9854
615 Ga0207651_10146970 3300025960 Bacteria 1830
616 Ga0207651_10249673 3300025960 Bacteria 1451
617 Ga0207651_10250553 3300025960 Bacteria 1449
618 Ga0207651_10516228 3300025960 Unclassified 1035
619 Ga0207651_10655443 3300025960 Bacteria 922
620 Ga0207651_11190492 3300025960 Unclassified 684
621 Ga0207712_10000313 3300025961 Bacteria 44454
622 Ga0207712_10051616 3300025961 Bacteria 2877
623 Ga0207712_10139210 3300025961 Bacteria 1860
624 Ga0207668_10011459 3300025972 Bacteria 5388
625 Ga0207668_11180746 3300025972 Unclassified 687
626 Ga0207640_10031533 3300025981 Bacteria 3276
627 Ga0207640_10138075 3300025981 Unclassified 1773
628 Ga0207640_10201990 3300025981 Archaea 1507
629 Ga0207640_10828813 3300025981 Unclassified 803
630 Ga0207677_10347177 3300026023 Bacteria 1242
631 Ga0207677_10859654 3300026023 Bacteria 815
632 Ga0207703_10000589 3300026035 Bacteria 36985
633 Ga0207703_10051954 3300026035 Bacteria 3325
634 Ga0207703_10187676 3300026035 Bacteria 1828
635 Ga0207703_10335898 3300026035 Bacteria 1387
636 Ga0207703_10336839 3300026035 Unclassified 1385
637 Ga0207703_10340821 3300026035 Bacteria 1378
638 Ga0207703_10349658 3300026035 Bacteria 1360
639 Ga0207639_10292329 3300026041 Unclassified 1437
640 Ga0207639_10320754 3300026041 Bacteria 1376
641 Ga0207708_10000085 3300026075 Bacteria 73335
642 Ga0207708_10008599 3300026075 Bacteria 7555
643 Ga0207708_10009371 3300026075 Bacteria 7248
644 Ga0207708_10010607 3300026075 Bacteria 6841
645 Ga0207708_10023657 3300026075 Bacteria 4644
646 Ga0207708_10051309 3300026075 Unclassified 3139
647 Ga0207702_10018498 3300026078 Bacteria 5765
648 Ga0207702_10994682 3300026078 Bacteria 832
649 Ga0207641_10199828 3300026088 Bacteria 1842
650 Ga0207641_10227250 3300026088 Unclassified 1733
651 Ga0207641_11095757 3300026088 Unclassified 795
652 Ga0207641_11300084 3300026088 Unclassified 728
653 Ga0207648_10053392 3300026089 Unclassified 3532
654 Ga0207648_10185189 3300026089 Bacteria 1844
655 Ga0207648_10203038 3300026089 Bacteria 1758
656 Ga0207648_10363982 3300026089 Unclassified 1305
657 Ga0207648_11051073 3300026089 Unclassified 763
658 Ga0207676_10051070 3300026095 Unclassified 3226
659 Ga0207676_10242514 3300026095 Bacteria 1617
660 Ga0207676_10440807 3300026095 Bacteria 1226
661 Ga0207676_10443192 3300026095 Unclassified 1223
662 Ga0207676_10541282 3300026095 Bacteria 1111
663 Ga0207676_10568000 3300026095 Unclassified 1086
664 Ga0207676_10573421 3300026095 Bacteria 1081
665 Ga0207676_10921692 3300026095 Unclassified 858
666 Ga0207676_10977445 3300026095 Bacteria 833
667 Ga0207674_10045280 3300026116 Bacteria 4527
668 Ga0207674_10046222 3300026116 Bacteria 4471
669 Ga0207674_10082329 3300026116 Bacteria 3220
670 Ga0207674_10089817 3300026116 Unclassified 3065
671 Ga0207674_10216342 3300026116 Unclassified 1864
672 Ga0207674_10232952 3300026116 Bacteria 1789
673 Ga0207674_10877249 3300026116 Unclassified 865
674 Ga0207674_11033677 3300026116 Unclassified 791
675 Ga0207675_100002974 3300026118 Bacteria 16670
676 Ga0207675_100011224 3300026118 Bacteria 8390
677 Ga0207675_100092237 3300026118 Bacteria 2848
678 Ga0207675_100182689 3300026118 Bacteria 2009
679 Ga0207675_100498183 3300026118 Bacteria 1212
680 Ga0207675_101245788 3300026118 Bacteria 764
681 Ga0207675_101458887 3300026118 Bacteria 705
682 Ga0207698_10070175 3300026142 Unclassified 2775
683 Ga0207698_10629901 3300026142 Bacteria 1060
684 Ga0209588_1011796 3300027671 Bacteria 2646
685 Ga0207428_10046280 3300027907 Unclassified 3499
686 Ga0207428_10185943 3300027907 Bacteria 1568
687 Ga0207428_10404278 3300027907 Bacteria 999
688 Ga0268265_10125141 3300028380 Bacteria 2126
689 Ga0268265_10139955 3300028380 Unclassified 2025
690 Ga0268264_10029011 3300028381 Unclassified 4530
691 Ga0268264_10078678 3300028381 Unclassified 2812
692 Ga0268264_10113800 3300028381 Unclassified 2374
693 Ga0268264_10138585 3300028381 Unclassified 2166
694 Ga0268264_10302645 3300028381 Bacteria 1506
695 Ga0268264_10345621 3300028381 Bacteria 1414
696 Ga0268264_10358598 3300028381 Bacteria 1390
697 Ga0268264_10585586 3300028381 Bacteria 1098
698 Ga0268264_10683324 3300028381 Bacteria 1018
699 Ga0268264_10695598 3300028381 Unclassified 1009
700 Ga0307515_10130680 3300028794 Bacteria 2769
701 Ga0307408_100023709 3300031548 Bacteria 4183
702 Ga0307408_100364739 3300031548 Bacteria 1230
703 Ga0307405_10015262 3300031731 Bacteria 4156
704 Ga0307405_10185467 3300031731 Bacteria 1497
705 Ga0307406_10020665 3300031901 Bacteria 3881
706 Ga0307407_10919226 3300031903 Bacteria 672
707 Ga0307412_10151953 3300031911 Bacteria 1709
708 Ga0307412_10207719 3300031911 Bacteria 1492
709 Ga0307409_100162534 3300031995 Bacteria 1955
710 Ga0307409_100343663 3300031995 Bacteria 1405
711 Ga0307409_101651106 3300031995 Bacteria 669
712 Ga0307416_100244826 3300032002 Bacteria 1740
713 Ga0307416_100267912 3300032002 Bacteria 1675
714 Ga0307416_100696220 3300032002 Bacteria 1105
715 Ga0307416_100711682 3300032002 Bacteria 1094
716 Ga0307414_10107514 3300032004 Bacteria 2114
717 Ga0307414_10142321 3300032004 Bacteria 1879
718 Ga0307411_10059733 3300032005 Bacteria 2529
719 Ga0307415_100001042 3300032126 Bacteria 12862
720 Ga0307415_100055008 3300032126 Bacteria 2720
721 Ga0373951_0005408 3300035091 Bacteria 2968
722 Ga0373951_0101641 3300035091 Unclassified 765
723 Ga0373952_0076197 3300035092 Unclassified 848
724 Ga0373941_0014333 3300035115 Bacteria 2115
725 Ga0373942_0005319 3300035207 Bacteria 2985
726 Ga0373962_0053118 3300035242 Unclassified 1172
727 Ga0395899_0364991 3300037312 Unclassified 963
728 Ga0395900_0095130 3300037418 Bacteria 3061
729 Ga0395900_0710185 3300037418 Bacteria 938
730 Ga0395898_0197372 3300037466 Bacteria 1922
731 Ga0395905_0418312 3300037471 Bacteria 1236
732 Ga0395905_0652669 3300037471 Bacteria 954
733 Ga0395901_0227966 3300038443 Bacteria 1946
734 Ga0395901_0887711 3300038443 Unclassified 874
735 Ga0242420_000869 3300038996 Unclassified 3734
736 Ga0242420_001479 3300038996 Bacteria 3141
737 Ga0439439_0150111 3300041406 Unclassified 661
738 Ga0439448_0097642 3300042005 Unclassified 996
739 Ga0439454_044078 3300042011 Unclassified 737
740 Ga0451576_0021603 3300045051 Bacteria 6993
741 Ga0451576_0824685 3300045051 Bacteria 974
742 Ga0495662_0392878 3300046476 Bacteria 681
743 Ga0495664_0412879 3300046477 Bacteria 810
744 Ga0495584_0194905 3300046491 Bacteria 1030
745 Ga0495618_0223932 3300046514 Unclassified 1186
746 Ga0495620_0331790 3300046515 Unclassified 577
747 Ga0495663_0000102 3300046525 Bacteria 35062
748 Ga0495586_0225744 3300046535 Bacteria 1065
749 Ga0495598_0000045 3300046537 Bacteria 18787
750 Ga0495621_0001069 3300046539 Bacteria 7016
751 Ga0495621_0044684 3300046539 Bacteria 1567
752 Ga0495621_0113655 3300046539 Bacteria 1040
753 Ga0495633_0113752 3300046558 Bacteria 1255
754 Ga0495659_0023396 3300046664 Bacteria 2099
755 Ga0495670_0409232 3300046691 Bacteria 733
756 Ga0495636_0072428 3300047318 Bacteria 1473
757 Ga0495684_0025216 3300047471 Bacteria 4572
758 Ga0496103_0718748 3300048906 Unclassified 633
759 Ga0496104_0069219 3300048907 Bacteria 3354
760 Ga0496104_0748617 3300048907 Unclassified 884
761 Ga0496106_0002129 3300048909 Bacteria 14798
762 Ga0496106_0181264 3300048909 Bacteria 1672
763 Ga0496106_0268811 3300048909 Unclassified 1365
764 Ga0496108_0090894 3300048911 Unclassified 2595
765 Ga0496108_0694832 3300048911 Unclassified 882
766 Ga0496109_0661929 3300048912 Unclassified 981
767 Ga0496110_0438152 3300048913 Bacteria 1191
768 Ga0496111_0821176 3300048914 Bacteria 672
769 Ga0496113_0248447 3300048916 Bacteria 1420
770 Ga0496113_0582224 3300048916 Unclassified 897
771 Ga0501343_017701 3300049132 Bacteria 617
772 Ga0501290_006877 3300049513 Bacteria 1425
773 Ga0501290_008424 3300049513 Bacteria 1303
774 Ga0501296_035696 3300049519 Unclassified 685
775 Ga0501298_017284 3300049521 Bacteria 1315
776 Ga0501298_042136 3300049521 Bacteria 928
777 Ga0501298_059722 3300049521 Bacteria 805
778 Ga0501303_001987 3300049526 Bacteria 1556
779 Ga0501336_024380 3300049552 Unclassified 567
780 Ga0501038_0003131 3300049574 Bacteria 15433
781 Ga0501041_0479926 3300049577 Unclassified 790
782 Ga0501075_0361950 3300049591 Bacteria 1106
783 Ga0501198_002039 3300049649 Bacteria 2690
784 Ga0501206_014800 3300049653 Bacteria 1075
785 Ga0501207_001168 3300049654 Bacteria 3224
786 Ga0501207_017355 3300049654 Bacteria 1123
787 Ga0501217_002407 3300049661 Bacteria 3681
788 Ga0501217_073373 3300049661 Bacteria 935
789 Ga0501223_010828 3300049663 Bacteria 1831
790 Ga0501223_013955 3300049663 Bacteria 1596
791 Ga0501223_015989 3300049663 Bacteria 1485
792 Ga0501224_047217 3300049664 Unclassified 656
793 Ga0501227_003359 3300049665 Bacteria 3471
794 Ga0501227_015868 3300049665 Bacteria 1686
795 Ga0501227_021631 3300049665 Bacteria 1484
796 Ga0501233_002570 3300049668 Bacteria 3207
797 Ga0501233_111268 3300049668 Unclassified 733
798 Ga0501235_041801 3300049669 Bacteria 1049
799 Ga0501235_042550 3300049669 Bacteria 1041
800 Ga0501236_011644 3300049670 Bacteria 1172
801 Ga0501239_003158 3300049672 Unclassified 1550
802 Ga0501239_022936 3300049672 Bacteria 777
803 Ga0501243_015224 3300049675 Bacteria 1235
804 Ga0501246_015326 3300049676 Unclassified 746
805 Ga0501249_004934 3300049679 Bacteria 2722
806 Ga0501249_019923 3300049679 Bacteria 1457
807 Ga0501253_077273 3300049683 Bacteria 745
808 Ga0501253_164456 3300049683 Unclassified 568
809 Ga0501256_001805 3300049685 Bacteria 1635
810 Ga0501257_029768 3300049686 Bacteria 1313
811 Ga0501259_006271 3300049688 Bacteria 1890
812 Ga0501260_001506 3300049689 Bacteria 1930
813 Ga0501261_007428 3300049690 Bacteria 1407
814 Ga0501221_136113 3300049704 Unclassified 640
815 Ga0501225_0028709 3300049705 Bacteria 1528
816 Ga0501225_0045111 3300049705 Bacteria 1220
817 Ga0501229_002858 3300049706 Bacteria 2044
818 Ga0501229_026960 3300049706 Bacteria 776
819 Ga0501234_010392 3300049707 Bacteria 1450
820 Ga0501234_012464 3300049707 Bacteria 1331
821 Ga0501245_014386 3300049708 Bacteria 1180
822 Ga0501079_0940216 3300049741 Unclassified 681
823 Ga0501265_117091 3300049762 Unclassified 503
824 Ga0501268_037245 3300049765 Unclassified 904
825 Ga0501273_039176 3300049770 Unclassified 697
826 Ga0501283_020180 3300049779 Bacteria 1061
827 Ga0501212_016452 3300049851 Bacteria 1111
828 Ga0501226_002497 3300049853 Bacteria 2244
829 Ga0501226_011490 3300049853 Bacteria 980
830 nmdc:mga05p37_1049366_c1 3300050507 Unclassified 860
831 nmdc:mga05p37_121550_c1 3300050507 Bacteria 3207
832 nmdc:mga05p37_18640_c1 3300050507 Bacteria 8387
833 nmdc:mga05p37_201156_c1 3300050507 Bacteria 2413
834 nmdc:mga05p37_21005_c1 3300050507 Bacteria 7902
835 nmdc:mga05p37_339813_c1 3300050507 Bacteria 1771
836 nmdc:mga05p37_342066_c1 3300050507 Bacteria 1764
837 nmdc:mga09592_320229_c1 3300050508 Bacteria 1343
838 nmdc:mga0qj67_542007_c1 3300050509 Bacteria 934
839 nmdc:mga0qj67_681623_c1 3300050509 Bacteria 819
840 nmdc:mga06r32_45384_c1 3300050510 Unclassified 4188
841 nmdc:mga06r32_638660_c1 3300050510 Bacteria 1033
842 nmdc:mga06r32_92427_c1 3300050510 Bacteria 2958
843 nmdc:mga08y16_133194_c1 3300050511 Bacteria 2584
844 nmdc:mga08y16_36966_c1 3300050511 Bacteria 5128
845 nmdc:mga08y16_412715_c1 3300050511 Unclassified 1381
846 nmdc:mga08y16_4491_c1 3300050511 Bacteria 14580
847 nmdc:mga08y16_85485_c1 3300050511 Bacteria 3287
848 nmdc:mga0n895_155882_c1 3300050512 Bacteria 2314
849 nmdc:mga0n895_212834_c1 3300050512 Bacteria 1963
850 nmdc:mga0n895_346216_c1 3300050512 Bacteria 1505
851 nmdc:mga0n895_371925_c1 3300050512 Bacteria 1447
852 nmdc:mga0n895_397297_c1 3300050512 Unclassified 1394
853 nmdc:mga0n895_46834_c1 3300050512 Unclassified 4226
854 nmdc:mga0n895_686566_c1 3300050512 Unclassified 1021
855 nmdc:mga0n895_87094_c1 3300050512 Bacteria 3120
856 nmdc:mga0n895_949785_c1 3300050512 Unclassified 843
857 nmdc:mga0rr50_265_c1 3300050513 Bacteria 28369
858 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
859 nmdc:mga08x19_46140_c1 3300050514 Bacteria 2786
860 nmdc:mga0a205_108513_c1 3300050515 Bacteria 2674
861 nmdc:mga0a205_120934_c1 3300050515 Bacteria 2518
862 nmdc:mga0a205_173253_c1 3300050515 Bacteria 2054
863 nmdc:mga0a205_174009_c1 3300050515 Bacteria 2048
864 nmdc:mga0a205_214949_c1 3300050515 Bacteria 1810
865 nmdc:mga0a205_326388_c1 3300050515 Bacteria 1405
866 nmdc:mga0a205_394294_c1 3300050515 Unclassified 1248
867 nmdc:mga0a205_396553_c1 3300050515 Bacteria 1244
868 nmdc:mga0a205_44102_c2 3300050515 Bacteria 2042
869 nmdc:mga0a205_91364_c1 3300050515 Unclassified 2942
870 Ga0587091_091434 3300059511 Bacteria 699

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10003875 Ga0114129_1000387516 137
2 3300050507 nmdc:mga05p37_201156_c1 nmdc:mga05p37_201156_c1_1442_2038 137
3 3300050515 nmdc:mga0a205_108513_c1 nmdc:mga0a205_108513_c1_1181_1777 137
4 3300025922 Ga0207646_10137432 Ga0207646_101374323 138
5 3300005546 Ga0070696_100427989 Ga0070696_1004279891 140
6 3300005549 Ga0070704_100124072 Ga0070704_1001240723 140
7 3300026023 Ga0207677_10859654 Ga0207677_108596541 140
8 3300005468 Ga0070707_100022287 Ga0070707_10002228711 141
9 3300005549 Ga0070704_100028893 Ga0070704_1000288935 141
10 3300025922 Ga0207646_10034457 Ga0207646_100344572 141
11 3300013308 Ga0157375_10205014 Ga0157375_102050142 143
12 3300049704 Ga0501221_136113 Ga0501221_136113_153_620 143
13 3300049762 Ga0501265_117091 Ga0501265_117091_21_488 143
14 3300014326 Ga0157380_10471668 Ga0157380_104716682 144
15 3300049577 Ga0501041_0479926 Ga0501041_0479926_155_676 144
16 3300049741 Ga0501079_0940216 Ga0501079_0940216_102_623 144
17 3300005355 Ga0070671_100004622 Ga0070671_10000462210 145
18 3300005617 Ga0068859_100659834 Ga0068859_1006598342 145
19 3300006931 Ga0097620_100659853 Ga0097620_1006598532 145
20 3300025931 Ga0207644_10044589 Ga0207644_100445893 145
21 3300049591 Ga0501075_0361950 Ga0501075_0361950_285_806 145
22 3300005444 Ga0070694_100326556 Ga0070694_1003265562 146
23 3300005456 Ga0070678_100848848 Ga0070678_1008488481 146
24 3300005546 Ga0070696_100139713 Ga0070696_1001397132 146
25 3300009148 Ga0105243_11330427 Ga0105243_113304271 146
26 3300009174 Ga0105241_11298556 Ga0105241_112985562 146
27 3300005340 Ga0070689_100400688 Ga0070689_1004006882 147
28 3300005444 Ga0070694_100019253 Ga0070694_1000192535 147
29 3300005544 Ga0070686_100068604 Ga0070686_1000686043 147
30 3300005617 Ga0068859_100536970 Ga0068859_1005369702 147
31 3300005843 Ga0068860_100729933 Ga0068860_1007299332 147
32 3300006931 Ga0097620_100536993 Ga0097620_1005369931 147
33 3300009098 Ga0105245_10214890 Ga0105245_102148902 147
34 3300009148 Ga0105243_10154763 Ga0105243_101547634 147
35 3300009176 Ga0105242_10002537 Ga0105242_1000253717 147
36 3300009177 Ga0105248_10015021 Ga0105248_100150216 147
37 3300009177 Ga0105248_10193172 Ga0105248_101931724 147
38 3300011119 Ga0105246_10497001 Ga0105246_104970012 147
39 3300013297 Ga0157378_10107731 Ga0157378_101077312 147
40 3300013306 Ga0163162_10056960 Ga0163162_100569602 147
41 3300017792 Ga0163161_10233216 Ga0163161_102332162 147
42 3300017792 Ga0163161_10280313 Ga0163161_102803131 147
43 3300025927 Ga0207687_10749788 Ga0207687_107497881 147
44 3300025934 Ga0207686_10001463 Ga0207686_100014637 147
45 3300025935 Ga0207709_10073682 Ga0207709_100736824 147
46 3300025938 Ga0207704_10996210 Ga0207704_109962102 147
47 3300025941 Ga0207711_10129992 Ga0207711_101299922 147
48 3300025960 Ga0207651_10250553 Ga0207651_102505532 147
49 3300025960 Ga0207651_11190492 Ga0207651_111904921 147
50 3300026088 Ga0207641_11300084 Ga0207641_113000841 147
51 3300028381 Ga0268264_10683324 Ga0268264_106833241 147
52 3300028381 Ga0268264_10695598 Ga0268264_106955982 147
53 3300046476 Ga0495662_0392878 Ga0495662_0392878_102_629 147
54 3300046477 Ga0495664_0412879 Ga0495664_0412879_130_633 147
55 3300046514 Ga0495618_0223932 Ga0495618_0223932_415_942 147
56 3300046535 Ga0495586_0225744 Ga0495586_0225744_79_606 147
57 3300047471 Ga0495684_0025216 Ga0495684_0025216_1056_1583 147
58 3300005293 Ga0065715_10390024 Ga0065715_103900242 148
59 3300005340 Ga0070689_100781539 Ga0070689_1007815391 148
60 3300005343 Ga0070687_100049129 Ga0070687_1000491293 148
61 3300005364 Ga0070673_101129279 Ga0070673_1011292792 148
62 3300005406 Ga0070703_10000348 Ga0070703_100003488 148
63 3300005441 Ga0070700_100023717 Ga0070700_1000237174 148
64 3300005445 Ga0070708_100053571 Ga0070708_1000535714 148
65 3300005445 Ga0070708_100418170 Ga0070708_1004181702 148
66 3300005471 Ga0070698_100049814 Ga0070698_1000498145 148
67 3300005518 Ga0070699_101152460 Ga0070699_1011524601 148
68 3300005544 Ga0070686_100009294 Ga0070686_1000092946 148
69 3300005544 Ga0070686_100185703 Ga0070686_1001857032 148
70 3300005616 Ga0068852_100182908 Ga0068852_1001829083 148
71 3300005617 Ga0068859_100070551 Ga0068859_1000705513 148
72 3300005719 Ga0068861_100178797 Ga0068861_1001787971 148
73 3300005842 Ga0068858_100099350 Ga0068858_1000993503 148
74 3300005843 Ga0068860_100826375 Ga0068860_1008263752 148
75 3300005843 Ga0068860_100838899 Ga0068860_1008388991 148
76 3300005844 Ga0068862_100144461 Ga0068862_1001444612 148
77 3300006847 Ga0075431_100765689 Ga0075431_1007656892 148
78 3300006881 Ga0068865_100176463 Ga0068865_1001764633 148
79 3300006931 Ga0097620_100070561 Ga0097620_1000705613 148
80 3300009094 Ga0111539_10109329 Ga0111539_101093292 148
81 3300009101 Ga0105247_10682445 Ga0105247_106824452 148
82 3300009147 Ga0114129_10010589 Ga0114129_1001058912 148
83 3300009147 Ga0114129_10027104 Ga0114129_100271045 148
84 3300009147 Ga0114129_11269770 Ga0114129_112697701 148
85 3300009148 Ga0105243_10000428 Ga0105243_1000042819 148
86 3300009148 Ga0105243_10774210 Ga0105243_107742102 148
87 3300009176 Ga0105242_10000227 Ga0105242_1000022721 148
88 3300009176 Ga0105242_11796142 Ga0105242_117961421 148
89 3300009177 Ga0105248_10102180 Ga0105248_101021805 148
90 3300009553 Ga0105249_10089092 Ga0105249_100890924 148
91 3300011119 Ga0105246_10723447 Ga0105246_107234472 148
92 3300013297 Ga0157378_10007638 Ga0157378_100076388 148
93 3300013297 Ga0157378_11052956 Ga0157378_110529561 148
94 3300013308 Ga0157375_10363757 Ga0157375_103637573 148
95 3300014745 Ga0157377_10230678 Ga0157377_102306782 148
96 3300025885 Ga0207653_10000180 Ga0207653_1000018032 148
97 3300025900 Ga0207710_10321549 Ga0207710_103215492 148
98 3300025918 Ga0207662_10045155 Ga0207662_100451553 148
99 3300025931 Ga0207644_10395669 Ga0207644_103956692 148
100 3300025934 Ga0207686_10000213 Ga0207686_1000021321 148
101 3300025935 Ga0207709_10000043 Ga0207709_1000004321 148
102 3300025935 Ga0207709_10144807 Ga0207709_101448072 148
103 3300025936 Ga0207670_10956126 Ga0207670_109561262 148
104 3300025938 Ga0207704_10045054 Ga0207704_100450541 148
105 3300025941 Ga0207711_10131163 Ga0207711_101311633 148
106 3300025942 Ga0207689_10537900 Ga0207689_105379002 148
107 3300025960 Ga0207651_10249673 Ga0207651_102496732 148
108 3300026035 Ga0207703_10336839 Ga0207703_103368392 148
109 3300026075 Ga0207708_10009371 Ga0207708_1000937112 148
110 3300026088 Ga0207641_10227250 Ga0207641_102272502 148
111 3300026095 Ga0207676_10440807 Ga0207676_104408072 148
112 3300026116 Ga0207674_10046222 Ga0207674_100462223 148
113 3300026118 Ga0207675_101458887 Ga0207675_1014588871 148
114 3300027907 Ga0207428_10185943 Ga0207428_101859431 148
115 3300028380 Ga0268265_10139955 Ga0268265_101399551 148
116 3300028381 Ga0268264_10138585 Ga0268264_101385854 148
117 3300028381 Ga0268264_10358598 Ga0268264_103585983 148
118 3300046539 Ga0495621_0044684 Ga0495621_0044684_407_922 148
119 3300046558 Ga0495633_0113752 Ga0495633_0113752_430_945 148
120 3300046664 Ga0495659_0023396 Ga0495659_0023396_889_1404 148
121 3300046691 Ga0495670_0409232 Ga0495670_0409232_32_547 148
122 3300049521 Ga0501298_042136 Ga0501298_042136_124_627 148
123 3300050507 nmdc:mga05p37_121550_c1 nmdc:mga05p37_121550_c1_2623_3108 148
124 3300050507 nmdc:mga05p37_342066_c1 nmdc:mga05p37_342066_c1_55_570 148
125 3300050510 nmdc:mga06r32_638660_c1 nmdc:mga06r32_638660_c1_441_956 148
126 3300050511 nmdc:mga08y16_133194_c1 nmdc:mga08y16_133194_c1_25_537 148
127 3300050515 nmdc:mga0a205_173253_c1 nmdc:mga0a205_173253_c1_645_1130 148
128 3300050515 nmdc:mga0a205_44102_c2 nmdc:mga0a205_44102_c2_809_1324 148
129 3300001426 JGI24030J14995_101492 JGI24030J14995_1014921 149
130 3300002074 JGI24748J21848_1000002 JGI24748J21848_100000217 149
131 3300002239 JGI24034J26672_10000004 JGI24034J26672_10000004355 149
132 3300005293 Ga0065715_10146354 Ga0065715_101463542 149
133 3300005338 Ga0068868_100071693 Ga0068868_1000716932 149
134 3300005355 Ga0070671_100033088 Ga0070671_1000330882 149
135 3300005440 Ga0070705_100653747 Ga0070705_1006537471 149
136 3300005459 Ga0068867_100378510 Ga0068867_1003785102 149
137 3300005468 Ga0070707_100113249 Ga0070707_1001132492 149
138 3300005468 Ga0070707_100469950 Ga0070707_1004699502 149
139 3300005471 Ga0070698_100633759 Ga0070698_1006337592 149
140 3300005518 Ga0070699_100586630 Ga0070699_1005866302 149
141 3300005536 Ga0070697_100067440 Ga0070697_1000674403 149
142 3300005536 Ga0070697_100494570 Ga0070697_1004945702 149
143 3300005543 Ga0070672_100196797 Ga0070672_1001967972 149
144 3300005545 Ga0070695_100180658 Ga0070695_1001806582 149
145 3300005545 Ga0070695_101169153 Ga0070695_1011691531 149
146 3300005577 Ga0068857_101062801 Ga0068857_1010628012 149
147 3300005615 Ga0070702_100014931 Ga0070702_1000149313 149
148 3300005617 Ga0068859_100225683 Ga0068859_1002256832 149
149 3300005617 Ga0068859_100563409 Ga0068859_1005634092 149
150 3300005718 Ga0068866_10135793 Ga0068866_101357933 149
151 3300005719 Ga0068861_100008887 Ga0068861_1000088876 149
152 3300005842 Ga0068858_100002375 Ga0068858_1000023758 149
153 3300006852 Ga0075433_10007251 Ga0075433_100072518 149
154 3300006871 Ga0075434_100158918 Ga0075434_1001589183 149
155 3300006871 Ga0075434_100364079 Ga0075434_1003640792 149
156 3300006880 Ga0075429_100524686 Ga0075429_1005246862 149
157 3300006914 Ga0075436_100000015 Ga0075436_10000001516 149
158 3300006931 Ga0097620_100225692 Ga0097620_1002256922 149
159 3300006931 Ga0097620_100563442 Ga0097620_1005634422 149
160 3300007076 Ga0075435_100000410 Ga0075435_10000041020 149
161 3300009098 Ga0105245_10085681 Ga0105245_100856813 149
162 3300009101 Ga0105247_10000005 Ga0105247_10000005345 149
163 3300009147 Ga0114129_10792635 Ga0114129_107926351 149
164 3300009148 Ga0105243_10002722 Ga0105243_100027228 149
165 3300009176 Ga0105242_10000507 Ga0105242_100005076 149
166 3300009553 Ga0105249_10062428 Ga0105249_100624284 149
167 3300010375 Ga0105239_10018470 Ga0105239_100184701 149
168 3300012495 Ga0157323_1008116 Ga0157323_10081161 149
169 3300013100 Ga0157373_10149997 Ga0157373_101499972 149
170 3300013297 Ga0157378_10000067 Ga0157378_1000006714 149
171 3300013297 Ga0157378_10128573 Ga0157378_101285732 149
172 3300013297 Ga0157378_10436132 Ga0157378_104361322 149
173 3300013306 Ga0163162_10001341 Ga0163162_100013419 149
174 3300013308 Ga0157375_10005624 Ga0157375_100056248 149
175 3300014968 Ga0157379_10080571 Ga0157379_100805713 149
176 3300025223 Ga0207672_1000315 Ga0207672_10003155 149
177 3300025899 Ga0207642_10171638 Ga0207642_101716381 149
178 3300025900 Ga0207710_10000004 Ga0207710_10000004343 149
179 3300025922 Ga0207646_10185089 Ga0207646_101850894 149
180 3300025922 Ga0207646_10618865 Ga0207646_106188652 149
181 3300025923 Ga0207681_10676149 Ga0207681_106761491 149
182 3300025927 Ga0207687_10063821 Ga0207687_100638212 149
183 3300025931 Ga0207644_10001123 Ga0207644_100011232 149
184 3300025934 Ga0207686_10008445 Ga0207686_100084455 149
185 3300025935 Ga0207709_10001862 Ga0207709_100018628 149
186 3300025939 Ga0207665_10033905 Ga0207665_100339052 149
187 3300026035 Ga0207703_10000589 Ga0207703_1000058925 149
188 3300026089 Ga0207648_10363982 Ga0207648_103639822 149
189 3300026118 Ga0207675_100002974 Ga0207675_10000297416 149
190 3300038996 Ga0242420_000869 Ga0242420_000869_1345_1863 149
191 3300045051 Ga0451576_0021603 Ga0451576_0021603_4610_5206 149
192 3300047318 Ga0495636_0072428 Ga0495636_0072428_916_1434 149
193 3300048909 Ga0496106_0002129 Ga0496106_0002129_9045_9641 149
194 3300050512 nmdc:mga0n895_46834_c1 nmdc:mga0n895_46834_c1_3383_3901 149
195 3300050513 nmdc:mga0rr50_265_c1 nmdc:mga0rr50_265_c1_11967_12488 149
196 3300050514 nmdc:mga08x19_3_c1 nmdc:mga08x19_3_c1_13206_13727 149
197 3300050515 nmdc:mga0a205_394294_c1 nmdc:mga0a205_394294_c1_700_1218 149
198 3300050515 nmdc:mga0a205_91364_c1 nmdc:mga0a205_91364_c1_659_1255 149
199 3300005290 Ga0065712_10022101 Ga0065712_100221012 150
200 3300005290 Ga0065712_10124288 Ga0065712_101242881 150
201 3300005293 Ga0065715_10124138 Ga0065715_101241382 150
202 3300005331 Ga0070670_100000288 Ga0070670_10000028813 150
203 3300005334 Ga0068869_100616639 Ga0068869_1006166391 150
204 3300005334 Ga0068869_100873600 Ga0068869_1008736002 150
205 3300005338 Ga0068868_100717207 Ga0068868_1007172071 150
206 3300005340 Ga0070689_100449065 Ga0070689_1004490652 150
207 3300005343 Ga0070687_100271276 Ga0070687_1002712763 150
208 3300005343 Ga0070687_100594729 Ga0070687_1005947291 150
209 3300005347 Ga0070668_100010083 Ga0070668_1000100838 150
210 3300005353 Ga0070669_100038470 Ga0070669_1000384704 150
211 3300005353 Ga0070669_100762010 Ga0070669_1007620101 150
212 3300005366 Ga0070659_101025910 Ga0070659_1010259102 150
213 3300005441 Ga0070700_100059267 Ga0070700_1000592673 150
214 3300005444 Ga0070694_100833803 Ga0070694_1008338031 150
215 3300005471 Ga0070698_100931676 Ga0070698_1009316762 150
216 3300005547 Ga0070693_100156698 Ga0070693_1001566982 150
217 3300005547 Ga0070693_100158005 Ga0070693_1001580052 150
218 3300005547 Ga0070693_100176318 Ga0070693_1001763183 150
219 3300005549 Ga0070704_100619410 Ga0070704_1006194101 150
220 3300005615 Ga0070702_100030131 Ga0070702_1000301311 150
221 3300005617 Ga0068859_100139342 Ga0068859_1001393422 150
222 3300006931 Ga0097620_100139337 Ga0097620_1001393372 150
223 3300007265 Ga0099794_10002733 Ga0099794_100027338 150
224 3300009098 Ga0105245_10421235 Ga0105245_104212353 150
225 3300009101 Ga0105247_10000395 Ga0105247_100003953 150
226 3300009148 Ga0105243_10030928 Ga0105243_100309283 150
227 3300009174 Ga0105241_10527227 Ga0105241_105272271 150
228 3300009176 Ga0105242_10020232 Ga0105242_100202324 150
229 3300009177 Ga0105248_10796641 Ga0105248_107966412 150
230 3300009177 Ga0105248_11022136 Ga0105248_110221362 150
231 3300009553 Ga0105249_10000375 Ga0105249_100003757 150
232 3300009553 Ga0105249_10022736 Ga0105249_100227364 150
233 3300013102 Ga0157371_10499304 Ga0157371_104993041 150
234 3300013297 Ga0157378_11270991 Ga0157378_112709912 150
235 3300013306 Ga0163162_10000162 Ga0163162_1000016237 150
236 3300013306 Ga0163162_10023984 Ga0163162_100239841 150
237 3300013306 Ga0163162_10091654 Ga0163162_100916542 150
238 3300013306 Ga0163162_11710825 Ga0163162_117108251 150
239 3300013308 Ga0157375_10787821 Ga0157375_107878212 150
240 3300014325 Ga0163163_10495975 Ga0163163_104959751 150
241 3300014326 Ga0157380_10013349 Ga0157380_100133492 150
242 3300014745 Ga0157377_10200864 Ga0157377_102008642 150
243 3300014968 Ga0157379_10010606 Ga0157379_100106063 150
244 3300025911 Ga0207654_10153622 Ga0207654_101536223 150
245 3300025961 Ga0207712_10000313 Ga0207712_1000031338 150
246 3300025972 Ga0207668_10011459 Ga0207668_100114593 150
247 3300025981 Ga0207640_10138075 Ga0207640_101380752 150
248 3300026035 Ga0207703_10051954 Ga0207703_100519543 150
249 3300026075 Ga0207708_10010607 Ga0207708_100106076 150
250 3300027671 Ga0209588_1011796 Ga0209588_10117964 150
251 3300028381 Ga0268264_10078678 Ga0268264_100786784 150
252 3300028381 Ga0268264_10345621 Ga0268264_103456213 150
253 3300041406 Ga0439439_0150111 Ga0439439_0150111_25_519 150
254 3300049521 Ga0501298_059722 Ga0501298_059722_230_757 150
255 3300005289 Ga0065704_10426529 Ga0065704_104265291 151
256 3300005295 Ga0065707_10231768 Ga0065707_102317682 151
257 3300005337 Ga0070682_100357039 Ga0070682_1003570392 151
258 3300005345 Ga0070692_10008111 Ga0070692_100081114 151
259 3300005406 Ga0070703_10349879 Ga0070703_103498791 151
260 3300005440 Ga0070705_100627113 Ga0070705_1006271131 151
261 3300005444 Ga0070694_100084018 Ga0070694_1000840183 151
262 3300005444 Ga0070694_100379312 Ga0070694_1003793122 151
263 3300005445 Ga0070708_100164594 Ga0070708_1001645942 151
264 3300005467 Ga0070706_100167524 Ga0070706_1001675242 151
265 3300005467 Ga0070706_100315666 Ga0070706_1003156662 151
266 3300005467 Ga0070706_100656331 Ga0070706_1006563312 151
267 3300005468 Ga0070707_100002485 Ga0070707_10000248510 151
268 3300005468 Ga0070707_100003049 Ga0070707_10000304916 151
269 3300005468 Ga0070707_100158406 Ga0070707_1001584063 151
270 3300005471 Ga0070698_100116334 Ga0070698_1001163342 151
271 3300005471 Ga0070698_100122954 Ga0070698_1001229542 151
272 3300005471 Ga0070698_100604897 Ga0070698_1006048972 151
273 3300005518 Ga0070699_100225426 Ga0070699_1002254262 151
274 3300005536 Ga0070697_100016344 Ga0070697_1000163442 151
275 3300005536 Ga0070697_100412018 Ga0070697_1004120182 151
276 3300005536 Ga0070697_101286232 Ga0070697_1012862321 151
277 3300005539 Ga0068853_100143510 Ga0068853_1001435101 151
278 3300005545 Ga0070695_100292257 Ga0070695_1002922572 151
279 3300005546 Ga0070696_100117165 Ga0070696_1001171653 151
280 3300005549 Ga0070704_100120541 Ga0070704_1001205413 151
281 3300005840 Ga0068870_10482408 Ga0068870_104824082 151
282 3300005842 Ga0068858_100284586 Ga0068858_1002845862 151
283 3300006163 Ga0070715_10000019 Ga0070715_1000001975 151
284 3300006173 Ga0070716_100000001 Ga0070716_100000001228 151
285 3300006173 Ga0070716_100108602 Ga0070716_1001086022 151
286 3300006173 Ga0070716_100845667 Ga0070716_1008456671 151
287 3300006871 Ga0075434_101368840 Ga0075434_1013688401 151
288 3300006914 Ga0075436_100117395 Ga0075436_1001173953 151
289 3300007076 Ga0075435_100779640 Ga0075435_1007796402 151
290 3300014745 Ga0157377_10076667 Ga0157377_100766671 151
291 3300025885 Ga0207653_10050720 Ga0207653_100507202 151
292 3300025885 Ga0207653_10211445 Ga0207653_102114451 151
293 3300025905 Ga0207685_10000021 Ga0207685_1000002145 151
294 3300025906 Ga0207699_10614603 Ga0207699_106146031 151
295 3300025910 Ga0207684_10085309 Ga0207684_100853093 151
296 3300025910 Ga0207684_10161930 Ga0207684_101619302 151
297 3300025910 Ga0207684_10172372 Ga0207684_101723722 151
298 3300025910 Ga0207684_10882896 Ga0207684_108828961 151
299 3300025922 Ga0207646_10009636 Ga0207646_1000963610 151
300 3300025922 Ga0207646_10019481 Ga0207646_100194815 151
301 3300025922 Ga0207646_10666499 Ga0207646_106664991 151
302 3300025939 Ga0207665_10000002 Ga0207665_10000002105 151
303 3300025941 Ga0207711_10319473 Ga0207711_103194732 151
304 3300026035 Ga0207703_10349658 Ga0207703_103496582 151
305 3300026088 Ga0207641_11095757 Ga0207641_110957571 151
306 3300048907 Ga0496104_0748617 Ga0496104_0748617_282_773 151
307 3300050515 nmdc:mga0a205_174009_c1 nmdc:mga0a205_174009_c1_1396_1887 151
308 3300005337 Ga0070682_100000027 Ga0070682_100000027137 152
309 3300005353 Ga0070669_100002495 Ga0070669_1000024959 152
310 3300005445 Ga0070708_100219902 Ga0070708_1002199022 152
311 3300005445 Ga0070708_100400680 Ga0070708_1004006802 152
312 3300005467 Ga0070706_100037418 Ga0070706_1000374182 152
313 3300005467 Ga0070706_100177886 Ga0070706_1001778862 152
314 3300005471 Ga0070698_100810203 Ga0070698_1008102031 152
315 3300005518 Ga0070699_100049413 Ga0070699_1000494134 152
316 3300005536 Ga0070697_100037477 Ga0070697_1000374773 152
317 3300005545 Ga0070695_100673452 Ga0070695_1006734521 152
318 3300005546 Ga0070696_100032533 Ga0070696_1000325334 152
319 3300005549 Ga0070704_100901929 Ga0070704_1009019291 152
320 3300006847 Ga0075431_100050600 Ga0075431_1000506001 152
321 3300009098 Ga0105245_10328767 Ga0105245_103287671 152
322 3300011119 Ga0105246_10030376 Ga0105246_100303765 152
323 3300025910 Ga0207684_10128192 Ga0207684_101281922 152
324 3300025910 Ga0207684_10185755 Ga0207684_101857552 152
325 3300050509 nmdc:mga0qj67_681623_c1 nmdc:mga0qj67_681623_c1_30_548 152
326 3300050510 nmdc:mga06r32_45384_c1 nmdc:mga06r32_45384_c1_369_887 152
327 3300003322 rootL2_10302468 rootL2_103024683 153
328 3300005288 Ga0065714_10064501 Ga0065714_100645019 153
329 3300005290 Ga0065712_10067737 Ga0065712_1006773763 153
330 3300005293 Ga0065715_10089067 Ga0065715_100890673 153
331 3300005293 Ga0065715_10313428 Ga0065715_103134282 153
332 3300005334 Ga0068869_100024509 Ga0068869_1000245092 153
333 3300005334 Ga0068869_100589100 Ga0068869_1005891001 153
334 3300005364 Ga0070673_100481690 Ga0070673_1004816901 153
335 3300005444 Ga0070694_100005920 Ga0070694_1000059207 153
336 3300005545 Ga0070695_100205630 Ga0070695_1002056301 153
337 3300005547 Ga0070693_100000972 Ga0070693_10000097212 153
338 3300005577 Ga0068857_100200746 Ga0068857_1002007463 153
339 3300005615 Ga0070702_100029766 Ga0070702_1000297663 153
340 3300005834 Ga0068851_10002518 Ga0068851_100025182 153
341 3300005985 Ga0081539_10002860 Ga0081539_1000286011 153
342 3300006844 Ga0075428_100803666 Ga0075428_1008036662 153
343 3300006844 Ga0075428_101401567 Ga0075428_1014015672 153
344 3300006847 Ga0075431_100086515 Ga0075431_1000865153 153
345 3300006880 Ga0075429_100797923 Ga0075429_1007979232 153
346 3300009094 Ga0111539_10255549 Ga0111539_102555493 153
347 3300009147 Ga0114129_12554327 Ga0114129_125543271 153
348 3300009148 Ga0105243_10208827 Ga0105243_102088273 153
349 3300009148 Ga0105243_10314896 Ga0105243_103148962 153
350 3300009545 Ga0105237_10002654 Ga0105237_1000265417 153
351 3300013100 Ga0157373_10286050 Ga0157373_102860502 153
352 3300014968 Ga0157379_10125649 Ga0157379_101256492 153
353 3300025321 Ga0207656_10005923 Ga0207656_100059235 153
354 3300025885 Ga0207653_10005448 Ga0207653_100054485 153
355 3300025904 Ga0207647_10102830 Ga0207647_101028303 153
356 3300025908 Ga0207643_10202980 Ga0207643_102029802 153
357 3300025913 Ga0207695_10472052 Ga0207695_104720521 153
358 3300025914 Ga0207671_10007027 Ga0207671_100070277 153
359 3300025923 Ga0207681_10005479 Ga0207681_100054796 153
360 3300025925 Ga0207650_10000304 Ga0207650_1000030414 153
361 3300025925 Ga0207650_10922573 Ga0207650_109225731 153
362 3300025935 Ga0207709_10339551 Ga0207709_103395511 153
363 3300025935 Ga0207709_10400745 Ga0207709_104007452 153
364 3300025935 Ga0207709_10623208 Ga0207709_106232081 153
365 3300025936 Ga0207670_10748956 Ga0207670_107489562 153
366 3300025942 Ga0207689_10397317 Ga0207689_103973171 153
367 3300025981 Ga0207640_10828813 Ga0207640_108288132 153
368 3300026075 Ga0207708_10051309 Ga0207708_100513092 153
369 3300026089 Ga0207648_10203038 Ga0207648_102030383 153
370 3300026089 Ga0207648_11051073 Ga0207648_110510731 153
371 3300026095 Ga0207676_10443192 Ga0207676_104431922 153
372 3300026116 Ga0207674_10216342 Ga0207674_102163423 153
373 3300026116 Ga0207674_10232952 Ga0207674_102329522 153
374 3300026142 Ga0207698_10070175 Ga0207698_100701753 153
375 3300027907 Ga0207428_10404278 Ga0207428_104042782 153
376 3300032002 Ga0307416_100696220 Ga0307416_1006962202 153
377 3300037418 Ga0395900_0095130 Ga0395900_0095130_2162_2716 153
378 3300037471 Ga0395905_0418312 Ga0395905_0418312_224_778 153
379 3300037471 Ga0395905_0652669 Ga0395905_0652669_222_773 153
380 3300046491 Ga0495584_0194905 Ga0495584_0194905_247_774 153
381 3300046515 Ga0495620_0331790 Ga0495620_0331790_37_564 153
382 3300046525 Ga0495663_0000102 Ga0495663_0000102_10435_10962 153
383 3300046537 Ga0495598_0000045 Ga0495598_0000045_3665_4192 153
384 3300046539 Ga0495621_0001069 Ga0495621_0001069_165_692 153
385 3300046539 Ga0495621_0113655 Ga0495621_0113655_201_728 153
386 3300049513 Ga0501290_008424 Ga0501290_008424_515_1033 153
387 3300049552 Ga0501336_024380 Ga0501336_024380_19_537 153
388 3300049663 Ga0501223_015989 Ga0501223_015989_858_1376 153
389 3300049664 Ga0501224_047217 Ga0501224_047217_91_609 153
390 3300049665 Ga0501227_015868 Ga0501227_015868_1006_1524 153
391 3300049668 Ga0501233_111268 Ga0501233_111268_224_718 153
392 3300049669 Ga0501235_042550 Ga0501235_042550_320_838 153
393 3300049679 Ga0501249_004934 Ga0501249_004934_1558_2076 153
394 3300049705 Ga0501225_0028709 Ga0501225_0028709_138_656 153
395 3300049765 Ga0501268_037245 Ga0501268_037245_217_735 153
396 3300049779 Ga0501283_020180 Ga0501283_020180_501_1019 153
397 3300050507 nmdc:mga05p37_339813_c1 nmdc:mga05p37_339813_c1_603_1121 153
398 3300050509 nmdc:mga0qj67_542007_c1 nmdc:mga0qj67_542007_c1_35_553 153
399 3300050510 nmdc:mga06r32_92427_c1 nmdc:mga06r32_92427_c1_2092_2610 153
400 3300050511 nmdc:mga08y16_85485_c1 nmdc:mga08y16_85485_c1_1052_1570 153
401 3300005289 Ga0065704_10096432 Ga0065704_100964323 154
402 3300005290 Ga0065712_10314971 Ga0065712_103149711 154
403 3300005293 Ga0065715_10356127 Ga0065715_103561271 154
404 3300005295 Ga0065707_10004038 Ga0065707_100040381 154
405 3300005295 Ga0065707_10217781 Ga0065707_102177812 154
406 3300005328 Ga0070676_11086531 Ga0070676_110865311 154
407 3300005330 Ga0070690_100013098 Ga0070690_1000130983 154
408 3300005331 Ga0070670_100137287 Ga0070670_1001372873 154
409 3300005334 Ga0068869_100683138 Ga0068869_1006831382 154
410 3300005336 Ga0070680_100509704 Ga0070680_1005097042 154
411 3300005340 Ga0070689_100088677 Ga0070689_1000886772 154
412 3300005343 Ga0070687_100019143 Ga0070687_1000191433 154
413 3300005343 Ga0070687_100036834 Ga0070687_1000368343 154
414 3300005347 Ga0070668_100392176 Ga0070668_1003921762 154
415 3300005353 Ga0070669_100099025 Ga0070669_1000990252 154
416 3300005356 Ga0070674_100530057 Ga0070674_1005300571 154
417 3300005406 Ga0070703_10040927 Ga0070703_100409272 154
418 3300005440 Ga0070705_100152266 Ga0070705_1001522662 154
419 3300005440 Ga0070705_100830337 Ga0070705_1008303371 154
420 3300005441 Ga0070700_100034326 Ga0070700_1000343263 154
421 3300005444 Ga0070694_100236574 Ga0070694_1002365742 154
422 3300005457 Ga0070662_100134411 Ga0070662_1001344112 154
423 3300005467 Ga0070706_100409491 Ga0070706_1004094911 154
424 3300005468 Ga0070707_100063283 Ga0070707_1000632833 154
425 3300005471 Ga0070698_100003085 Ga0070698_10000308511 154
426 3300005471 Ga0070698_100009470 Ga0070698_1000094708 154
427 3300005471 Ga0070698_100014091 Ga0070698_1000140917 154
428 3300005518 Ga0070699_100007923 Ga0070699_1000079235 154
429 3300005536 Ga0070697_100001825 Ga0070697_10000182511 154
430 3300005543 Ga0070672_100072802 Ga0070672_1000728023 154
431 3300005544 Ga0070686_100050927 Ga0070686_1000509274 154
432 3300005545 Ga0070695_100089006 Ga0070695_1000890062 154
433 3300005545 Ga0070695_100359586 Ga0070695_1003595862 154
434 3300005546 Ga0070696_100109973 Ga0070696_1001099732 154
435 3300005546 Ga0070696_100298148 Ga0070696_1002981482 154
436 3300005546 Ga0070696_100352238 Ga0070696_1003522382 154
437 3300005546 Ga0070696_100727417 Ga0070696_1007274171 154
438 3300005549 Ga0070704_100036648 Ga0070704_1000366483 154
439 3300005549 Ga0070704_100272049 Ga0070704_1002720491 154
440 3300005549 Ga0070704_100534794 Ga0070704_1005347942 154
441 3300005615 Ga0070702_100029580 Ga0070702_1000295803 154
442 3300005615 Ga0070702_100350230 Ga0070702_1003502302 154
443 3300005618 Ga0068864_100002264 Ga0068864_10000226412 154
444 3300005618 Ga0068864_100187777 Ga0068864_1001877771 154
445 3300005719 Ga0068861_100056063 Ga0068861_1000560633 154
446 3300005719 Ga0068861_100289853 Ga0068861_1002898532 154
447 3300005842 Ga0068858_100407236 Ga0068858_1004072362 154
448 3300005843 Ga0068860_100325781 Ga0068860_1003257811 154
449 3300005843 Ga0068860_100905331 Ga0068860_1009053311 154
450 3300005844 Ga0068862_100027399 Ga0068862_1000273992 154
451 3300006844 Ga0075428_100093477 Ga0075428_1000934774 154
452 3300006847 Ga0075431_100243832 Ga0075431_1002438322 154
453 3300006852 Ga0075433_10019917 Ga0075433_100199172 154
454 3300006871 Ga0075434_100031968 Ga0075434_1000319684 154
455 3300006880 Ga0075429_100170245 Ga0075429_1001702452 154
456 3300006881 Ga0068865_101178848 Ga0068865_1011788481 154
457 3300009094 Ga0111539_10063062 Ga0111539_100630622 154
458 3300009094 Ga0111539_10137643 Ga0111539_101376431 154
459 3300009147 Ga0114129_10009289 Ga0114129_100092895 154
460 3300009148 Ga0105243_10136499 Ga0105243_101364993 154
461 3300009148 Ga0105243_10297186 Ga0105243_102971862 154
462 3300009176 Ga0105242_10208478 Ga0105242_102084782 154
463 3300009177 Ga0105248_10654107 Ga0105248_106541071 154
464 3300009553 Ga0105249_10011935 Ga0105249_100119353 154
465 3300011119 Ga0105246_10043449 Ga0105246_100434492 154
466 3300013297 Ga0157378_10044131 Ga0157378_100441312 154
467 3300013297 Ga0157378_10254089 Ga0157378_102540892 154
468 3300013306 Ga0163162_10149727 Ga0163162_101497274 154
469 3300013306 Ga0163162_10373062 Ga0163162_103730622 154
470 3300013308 Ga0157375_10222015 Ga0157375_102220152 154
471 3300014325 Ga0163163_10023043 Ga0163163_100230435 154
472 3300014326 Ga0157380_10117976 Ga0157380_101179762 154
473 3300025908 Ga0207643_10008738 Ga0207643_100087386 154
474 3300025910 Ga0207684_10073174 Ga0207684_100731744 154
475 3300025910 Ga0207684_10333801 Ga0207684_103338012 154
476 3300025912 Ga0207707_10000030 Ga0207707_1000003093 154
477 3300025914 Ga0207671_10187427 Ga0207671_101874273 154
478 3300025917 Ga0207660_10000376 Ga0207660_1000037617 154
479 3300025917 Ga0207660_10192520 Ga0207660_101925201 154
480 3300025918 Ga0207662_10016286 Ga0207662_100162863 154
481 3300025921 Ga0207652_10000086 Ga0207652_1000008651 154
482 3300025922 Ga0207646_10107115 Ga0207646_101071153 154
483 3300025922 Ga0207646_10334889 Ga0207646_103348891 154
484 3300025923 Ga0207681_10296308 Ga0207681_102963082 154
485 3300025925 Ga0207650_10351931 Ga0207650_103519312 154
486 3300025925 Ga0207650_10824675 Ga0207650_108246751 154
487 3300025933 Ga0207706_10416287 Ga0207706_104162872 154
488 3300025934 Ga0207686_10184254 Ga0207686_101842542 154
489 3300025935 Ga0207709_10438804 Ga0207709_104388042 154
490 3300025937 Ga0207669_10149728 Ga0207669_101497282 154
491 3300025940 Ga0207691_10026908 Ga0207691_100269083 154
492 3300025940 Ga0207691_10091705 Ga0207691_100917052 154
493 3300025940 Ga0207691_10100406 Ga0207691_101004063 154
494 3300025942 Ga0207689_10001120 Ga0207689_1000112016 154
495 3300025942 Ga0207689_10164040 Ga0207689_101640403 154
496 3300025942 Ga0207689_10859974 Ga0207689_108599741 154
497 3300025942 Ga0207689_11142875 Ga0207689_111428751 154
498 3300025961 Ga0207712_10051616 Ga0207712_100516162 154
499 3300025972 Ga0207668_11180746 Ga0207668_111807461 154
500 3300025981 Ga0207640_10031533 Ga0207640_100315335 154
501 3300026023 Ga0207677_10347177 Ga0207677_103471772 154
502 3300026041 Ga0207639_10292329 Ga0207639_102923291 154
503 3300026075 Ga0207708_10008599 Ga0207708_100085997 154
504 3300026078 Ga0207702_10018498 Ga0207702_100184987 154
505 3300026095 Ga0207676_10051070 Ga0207676_100510705 154
506 3300026095 Ga0207676_10921692 Ga0207676_109216921 154
507 3300026095 Ga0207676_10977445 Ga0207676_109774453 154
508 3300026118 Ga0207675_100092237 Ga0207675_1000922373 154
509 3300026118 Ga0207675_100182689 Ga0207675_1001826892 154
510 3300028381 Ga0268264_10029011 Ga0268264_100290115 154
511 3300028381 Ga0268264_10302645 Ga0268264_103026451 154
512 3300028381 Ga0268264_10585586 Ga0268264_105855862 154
513 3300028794 Ga0307515_10130680 Ga0307515_101306802 154
514 3300035091 Ga0373951_0005408 Ga0373951_0005408_717_1214 154
515 3300035091 Ga0373951_0101641 Ga0373951_0101641_174_671 154
516 3300038996 Ga0242420_001479 Ga0242420_001479_85_612 154
517 3300042011 Ga0439454_044078 Ga0439454_044078_50_577 154
518 3300048907 Ga0496104_0069219 Ga0496104_0069219_2688_3215 154
519 3300048909 Ga0496106_0268811 Ga0496106_0268811_144_671 154
520 3300048911 Ga0496108_0090894 Ga0496108_0090894_1890_2417 154
521 3300048912 Ga0496109_0661929 Ga0496109_0661929_87_614 154
522 3300048914 Ga0496111_0821176 Ga0496111_0821176_15_542 154
523 3300050507 nmdc:mga05p37_18640_c1 nmdc:mga05p37_18640_c1_7524_8051 154
524 3300050508 nmdc:mga09592_320229_c1 nmdc:mga09592_320229_c1_87_614 154
525 3300050511 nmdc:mga08y16_36966_c1 nmdc:mga08y16_36966_c1_3888_4418 154
526 3300050511 nmdc:mga08y16_412715_c1 nmdc:mga08y16_412715_c1_707_1237 154
527 3300050512 nmdc:mga0n895_212834_c1 nmdc:mga0n895_212834_c1_1304_1825 154
528 3300050512 nmdc:mga0n895_686566_c1 nmdc:mga0n895_686566_c1_75_602 154
529 3300050512 nmdc:mga0n895_87094_c1 nmdc:mga0n895_87094_c1_2466_2993 154
530 3300050515 nmdc:mga0a205_326388_c1 nmdc:mga0a205_326388_c1_337_864 154
531 3300000546 LJNas_1015975 LJNas_10159751 155
532 3300002459 JGI24751J29686_10000058 JGI24751J29686_100000584 155
533 3300002459 JGI24751J29686_10000101 JGI24751J29686_1000010142 155
534 3300005290 Ga0065712_10001518 Ga0065712_100015182 155
535 3300005293 Ga0065715_10866278 Ga0065715_108662781 155
536 3300005331 Ga0070670_100042923 Ga0070670_1000429233 155
537 3300005331 Ga0070670_100077596 Ga0070670_1000775963 155
538 3300005331 Ga0070670_101515846 Ga0070670_1015158461 155
539 3300005334 Ga0068869_100774985 Ga0068869_1007749852 155
540 3300005338 Ga0068868_101522234 Ga0068868_1015222341 155
541 3300005339 Ga0070660_101114857 Ga0070660_1011148571 155
542 3300005340 Ga0070689_100964888 Ga0070689_1009648881 155
543 3300005344 Ga0070661_101176153 Ga0070661_1011761531 155
544 3300005364 Ga0070673_100756846 Ga0070673_1007568461 155
545 3300005364 Ga0070673_100837902 Ga0070673_1008379021 155
546 3300005441 Ga0070700_100619075 Ga0070700_1006190751 155
547 3300005444 Ga0070694_100745126 Ga0070694_1007451261 155
548 3300005459 Ga0068867_101484434 Ga0068867_1014844341 155
549 3300005543 Ga0070672_101027304 Ga0070672_1010273041 155
550 3300005564 Ga0070664_100141118 Ga0070664_1001411181 155
551 3300005564 Ga0070664_100210169 Ga0070664_1002101692 155
552 3300005577 Ga0068857_100287845 Ga0068857_1002878452 155
553 3300005577 Ga0068857_101152509 Ga0068857_1011525091 155
554 3300005577 Ga0068857_101222831 Ga0068857_1012228311 155
555 3300005615 Ga0070702_100093945 Ga0070702_1000939453 155
556 3300005615 Ga0070702_100996773 Ga0070702_1009967731 155
557 3300005617 Ga0068859_100060689 Ga0068859_1000606893 155
558 3300005617 Ga0068859_100455804 Ga0068859_1004558042 155
559 3300005618 Ga0068864_100007172 Ga0068864_1000071722 155
560 3300005618 Ga0068864_100192031 Ga0068864_1001920312 155
561 3300005618 Ga0068864_100462511 Ga0068864_1004625112 155
562 3300005718 Ga0068866_10416173 Ga0068866_104161731 155
563 3300005719 Ga0068861_101293665 Ga0068861_1012936651 155
564 3300005840 Ga0068870_10177926 Ga0068870_101779262 155
565 3300005841 Ga0068863_100107205 Ga0068863_1001072052 155
566 3300005841 Ga0068863_100120745 Ga0068863_1001207452 155
567 3300005841 Ga0068863_100741129 Ga0068863_1007411292 155
568 3300005842 Ga0068858_100104723 Ga0068858_1001047232 155
569 3300005842 Ga0068858_100360341 Ga0068858_1003603412 155
570 3300005842 Ga0068858_100521090 Ga0068858_1005210901 155
571 3300005843 Ga0068860_100154075 Ga0068860_1001540752 155
572 3300005843 Ga0068860_100176380 Ga0068860_1001763803 155
573 3300005843 Ga0068860_100199000 Ga0068860_1001990002 155
574 3300005843 Ga0068860_100244213 Ga0068860_1002442133 155
575 3300005844 Ga0068862_101235622 Ga0068862_1012356221 155
576 3300005983 Ga0081540_1015996 Ga0081540_10159962 155
577 3300005985 Ga0081539_10053080 Ga0081539_100530802 155
578 3300006358 Ga0068871_100271019 Ga0068871_1002710192 155
579 3300006358 Ga0068871_100336796 Ga0068871_1003367962 155
580 3300006852 Ga0075433_10148952 Ga0075433_101489523 155
581 3300006852 Ga0075433_10230016 Ga0075433_102300163 155
582 3300006852 Ga0075433_10250767 Ga0075433_102507672 155
583 3300006871 Ga0075434_101036773 Ga0075434_1010367731 155
584 3300006871 Ga0075434_101088058 Ga0075434_1010880581 155
585 3300006931 Ga0097620_100060690 Ga0097620_1000606904 155
586 3300006931 Ga0097620_100455825 Ga0097620_1004558252 155
587 3300006931 Ga0097620_101021047 Ga0097620_1010210472 155
588 3300009098 Ga0105245_10619544 Ga0105245_106195443 155
589 3300009101 Ga0105247_10117830 Ga0105247_101178303 155
590 3300009101 Ga0105247_10223457 Ga0105247_102234572 155
591 3300009147 Ga0114129_10009889 Ga0114129_1000988912 155
592 3300009148 Ga0105243_10019859 Ga0105243_100198593 155
593 3300009148 Ga0105243_10129310 Ga0105243_101293101 155
594 3300009174 Ga0105241_10175345 Ga0105241_101753453 155
595 3300009174 Ga0105241_10859430 Ga0105241_108594302 155
596 3300009176 Ga0105242_10779723 Ga0105242_107797232 155
597 3300009177 Ga0105248_10535044 Ga0105248_105350443 155
598 3300009177 Ga0105248_11461941 Ga0105248_114619411 155
599 3300009545 Ga0105237_10663357 Ga0105237_106633572 155
600 3300009551 Ga0105238_10066275 Ga0105238_100662754 155
601 3300009551 Ga0105238_10705796 Ga0105238_107057961 155
602 3300010375 Ga0105239_10109520 Ga0105239_101095202 155
603 3300011119 Ga0105246_10160941 Ga0105246_101609412 155
604 3300013100 Ga0157373_10084521 Ga0157373_100845213 155
605 3300013296 Ga0157374_10569230 Ga0157374_105692302 155
606 3300013297 Ga0157378_10671913 Ga0157378_106719132 155
607 3300013307 Ga0157372_10524134 Ga0157372_105241342 155
608 3300014325 Ga0163163_10001223 Ga0163163_1000122314 155
609 3300014325 Ga0163163_10199108 Ga0163163_101991083 155
610 3300014325 Ga0163163_10622613 Ga0163163_106226132 155
611 3300014325 Ga0163163_11160310 Ga0163163_111603102 155
612 3300014326 Ga0157380_10264676 Ga0157380_102646763 155
613 3300014745 Ga0157377_10181243 Ga0157377_101812433 155
614 3300014745 Ga0157377_10552003 Ga0157377_105520031 155
615 3300014968 Ga0157379_10785902 Ga0157379_107859022 155
616 3300014969 Ga0157376_10189118 Ga0157376_101891181 155
617 3300025899 Ga0207642_10194220 Ga0207642_101942202 155
618 3300025900 Ga0207710_10002291 Ga0207710_100022914 155
619 3300025900 Ga0207710_10145022 Ga0207710_101450222 155
620 3300025911 Ga0207654_10589151 Ga0207654_105891512 155
621 3300025914 Ga0207671_10429474 Ga0207671_104294741 155
622 3300025918 Ga0207662_10180956 Ga0207662_101809562 155
623 3300025919 Ga0207657_10296453 Ga0207657_102964531 155
624 3300025919 Ga0207657_10450286 Ga0207657_104502862 155
625 3300025920 Ga0207649_10643384 Ga0207649_106433842 155
626 3300025923 Ga0207681_10042146 Ga0207681_100421464 155
627 3300025924 Ga0207694_10088678 Ga0207694_100886784 155
628 3300025925 Ga0207650_10000001 Ga0207650_10000001981 155
629 3300025925 Ga0207650_10192007 Ga0207650_101920072 155
630 3300025934 Ga0207686_10477384 Ga0207686_104773841 155
631 3300025935 Ga0207709_10008615 Ga0207709_100086153 155
632 3300025935 Ga0207709_10254029 Ga0207709_102540291 155
633 3300025935 Ga0207709_10562597 Ga0207709_105625972 155
634 3300025936 Ga0207670_10022723 Ga0207670_100227231 155
635 3300025941 Ga0207711_10138904 Ga0207711_101389044 155
636 3300025941 Ga0207711_10644229 Ga0207711_106442292 155
637 3300025941 Ga0207711_10717079 Ga0207711_107170791 155
638 3300025942 Ga0207689_10233478 Ga0207689_102334782 155
639 3300025942 Ga0207689_10341031 Ga0207689_103410312 155
640 3300025945 Ga0207679_10235801 Ga0207679_102358012 155
641 3300025960 Ga0207651_10146970 Ga0207651_101469702 155
642 3300025960 Ga0207651_10516228 Ga0207651_105162282 155
643 3300025960 Ga0207651_10655443 Ga0207651_106554432 155
644 3300025961 Ga0207712_10139210 Ga0207712_101392103 155
645 3300026035 Ga0207703_10335898 Ga0207703_103358981 155
646 3300026041 Ga0207639_10320754 Ga0207639_103207542 155
647 3300026088 Ga0207641_10199828 Ga0207641_101998282 155
648 3300026089 Ga0207648_10053392 Ga0207648_100533924 155
649 3300026089 Ga0207648_10185189 Ga0207648_101851893 155
650 3300026095 Ga0207676_10242514 Ga0207676_102425143 155
651 3300026095 Ga0207676_10541282 Ga0207676_105412822 155
652 3300026095 Ga0207676_10573421 Ga0207676_105734211 155
653 3300026116 Ga0207674_10045280 Ga0207674_100452804 155
654 3300026116 Ga0207674_10082329 Ga0207674_100823294 155
655 3300026116 Ga0207674_10877249 Ga0207674_108772492 155
656 3300026116 Ga0207674_11033677 Ga0207674_110336771 155
657 3300026118 Ga0207675_101245788 Ga0207675_1012457881 155
658 3300026142 Ga0207698_10629901 Ga0207698_106299012 155
659 3300028380 Ga0268265_10125141 Ga0268265_101251413 155
660 3300028381 Ga0268264_10113800 Ga0268264_101138002 155
661 3300031548 Ga0307408_100364739 Ga0307408_1003647391 155
662 3300031731 Ga0307405_10185467 Ga0307405_101854673 155
663 3300031903 Ga0307407_10919226 Ga0307407_109192261 155
664 3300031911 Ga0307412_10151953 Ga0307412_101519532 155
665 3300031995 Ga0307409_100343663 Ga0307409_1003436631 155
666 3300031995 Ga0307409_101651106 Ga0307409_1016511061 155
667 3300032002 Ga0307416_100244826 Ga0307416_1002448263 155
668 3300032002 Ga0307416_100267912 Ga0307416_1002679121 155
669 3300032004 Ga0307414_10107514 Ga0307414_101075142 155
670 3300032005 Ga0307411_10059733 Ga0307411_100597334 155
671 3300032126 Ga0307415_100055008 Ga0307415_1000550083 155
672 3300035207 Ga0373942_0005319 Ga0373942_0005319_578_1102 155
673 3300045051 Ga0451576_0824685 Ga0451576_0824685_153_680 155
674 3300048906 Ga0496103_0718748 Ga0496103_0718748_46_570 155
675 3300048909 Ga0496106_0181264 Ga0496106_0181264_508_1032 155
676 3300048911 Ga0496108_0694832 Ga0496108_0694832_96_620 155
677 3300048916 Ga0496113_0248447 Ga0496113_0248447_741_1265 155
678 3300048916 Ga0496113_0582224 Ga0496113_0582224_292_816 155
679 3300049513 Ga0501290_006877 Ga0501290_006877_703_1230 155
680 3300049519 Ga0501296_035696 Ga0501296_035696_70_597 155
681 3300049526 Ga0501303_001987 Ga0501303_001987_532_1059 155
682 3300049653 Ga0501206_014800 Ga0501206_014800_252_797 155
683 3300049654 Ga0501207_017355 Ga0501207_017355_560_1084 155
684 3300049661 Ga0501217_073373 Ga0501217_073373_202_729 155
685 3300049663 Ga0501223_013955 Ga0501223_013955_968_1492 155
686 3300049665 Ga0501227_021631 Ga0501227_021631_73_597 155
687 3300049669 Ga0501235_041801 Ga0501235_041801_105_629 155
688 3300049672 Ga0501239_003158 Ga0501239_003158_222_749 155
689 3300049672 Ga0501239_022936 Ga0501239_022936_34_558 155
690 3300049675 Ga0501243_015224 Ga0501243_015224_167_694 155
691 3300049676 Ga0501246_015326 Ga0501246_015326_77_604 155
692 3300049679 Ga0501249_019923 Ga0501249_019923_857_1381 155
693 3300049683 Ga0501253_077273 Ga0501253_077273_118_642 155
694 3300049683 Ga0501253_164456 Ga0501253_164456_21_548 155
695 3300049686 Ga0501257_029768 Ga0501257_029768_595_1119 155
696 3300049690 Ga0501261_007428 Ga0501261_007428_390_917 155
697 3300049705 Ga0501225_0045111 Ga0501225_0045111_31_555 155
698 3300049706 Ga0501229_026960 Ga0501229_026960_206_730 155
699 3300049707 Ga0501234_010392 Ga0501234_010392_225_749 155
700 3300049708 Ga0501245_014386 Ga0501245_014386_570_1094 155
701 3300049770 Ga0501273_039176 Ga0501273_039176_88_615 155
702 3300049851 Ga0501212_016452 Ga0501212_016452_313_837 155
703 3300049853 Ga0501226_011490 Ga0501226_011490_280_804 155
704 3300050507 nmdc:mga05p37_21005_c1 nmdc:mga05p37_21005_c1_7141_7665 155
705 3300050512 nmdc:mga0n895_346216_c1 nmdc:mga0n895_346216_c1_13_540 155
706 3300050512 nmdc:mga0n895_949785_c1 nmdc:mga0n895_949785_c1_299_826 155
707 3300050515 nmdc:mga0a205_120934_c1 nmdc:mga0a205_120934_c1_1677_2204 155
708 3300050515 nmdc:mga0a205_214949_c1 nmdc:mga0a205_214949_c1_1172_1696 155
709 3300050515 nmdc:mga0a205_396553_c1 nmdc:mga0a205_396553_c1_448_975 155
710 3300000532 CNAas_1001391 CNAas_10013913 156
711 3300003203 JGI25406J46586_10063825 JGI25406J46586_100638252 156
712 3300005289 Ga0065704_10002311 Ga0065704_100023113 156
713 3300005293 Ga0065715_10001156 Ga0065715_100011565 156
714 3300005295 Ga0065707_10004646 Ga0065707_100046464 156
715 3300005295 Ga0065707_10562637 Ga0065707_105626371 156
716 3300005328 Ga0070676_10538425 Ga0070676_105384252 156
717 3300005330 Ga0070690_100338170 Ga0070690_1003381701 156
718 3300005331 Ga0070670_100551815 Ga0070670_1005518151 156
719 3300005354 Ga0070675_100672057 Ga0070675_1006720572 156
720 3300005364 Ga0070673_100015044 Ga0070673_1000150444 156
721 3300005366 Ga0070659_100439323 Ga0070659_1004393232 156
722 3300005440 Ga0070705_100012433 Ga0070705_1000124335 156
723 3300005441 Ga0070700_100000107 Ga0070700_10000010721 156
724 3300005441 Ga0070700_100052936 Ga0070700_1000529363 156
725 3300005444 Ga0070694_100098478 Ga0070694_1000984782 156
726 3300005445 Ga0070708_100000361 Ga0070708_10000036132 156
727 3300005445 Ga0070708_100237738 Ga0070708_1002377383 156
728 3300005445 Ga0070708_100417572 Ga0070708_1004175721 156
729 3300005445 Ga0070708_100878947 Ga0070708_1008789471 156
730 3300005458 Ga0070681_10020201 Ga0070681_100202017 156
731 3300005467 Ga0070706_100024043 Ga0070706_1000240435 156
732 3300005468 Ga0070707_101417855 Ga0070707_1014178551 156
733 3300005471 Ga0070698_100016325 Ga0070698_1000163257 156
734 3300005471 Ga0070698_100017121 Ga0070698_1000171216 156
735 3300005518 Ga0070699_100003309 Ga0070699_10000330911 156
736 3300005518 Ga0070699_100015176 Ga0070699_1000151764 156
737 3300005536 Ga0070697_100004262 Ga0070697_10000426210 156
738 3300005536 Ga0070697_100163082 Ga0070697_1001630822 156
739 3300005536 Ga0070697_100499409 Ga0070697_1004994092 156
740 3300005545 Ga0070695_100050781 Ga0070695_1000507812 156
741 3300005546 Ga0070696_100071409 Ga0070696_1000714093 156
742 3300005549 Ga0070704_100114124 Ga0070704_1001141242 156
743 3300005563 Ga0068855_100969893 Ga0068855_1009698931 156
744 3300005564 Ga0070664_101033211 Ga0070664_1010332112 156
745 3300005577 Ga0068857_100137507 Ga0068857_1001375072 156
746 3300005578 Ga0068854_100110567 Ga0068854_1001105672 156
747 3300005615 Ga0070702_100522757 Ga0070702_1005227571 156
748 3300005616 Ga0068852_101152310 Ga0068852_1011523102 156
749 3300005617 Ga0068859_100004451 Ga0068859_1000044518 156
750 3300005617 Ga0068859_100791201 Ga0068859_1007912011 156
751 3300005617 Ga0068859_100868768 Ga0068859_1008687682 156
752 3300005618 Ga0068864_100035605 Ga0068864_1000356053 156
753 3300005719 Ga0068861_100008185 Ga0068861_1000081857 156
754 3300005842 Ga0068858_100052207 Ga0068858_1000522073 156
755 3300005842 Ga0068858_100403701 Ga0068858_1004037011 156
756 3300005843 Ga0068860_100879285 Ga0068860_1008792851 156
757 3300005844 Ga0068862_100998800 Ga0068862_1009988001 156
758 3300005985 Ga0081539_10002786 Ga0081539_1000278613 156
759 3300006237 Ga0097621_100005444 Ga0097621_1000054448 156
760 3300006358 Ga0068871_100001051 Ga0068871_1000010515 156
761 3300006852 Ga0075433_10104127 Ga0075433_101041273 156
762 3300006871 Ga0075434_100424577 Ga0075434_1004245772 156
763 3300006871 Ga0075434_100827164 Ga0075434_1008271641 156
764 3300006871 Ga0075434_101343960 Ga0075434_1013439602 156
765 3300006914 Ga0075436_100089402 Ga0075436_1000894022 156
766 3300006931 Ga0097620_100004451 Ga0097620_1000044519 156
767 3300006931 Ga0097620_100791262 Ga0097620_1007912622 156
768 3300006931 Ga0097620_100868775 Ga0097620_1008687752 156
769 3300009011 Ga0105251_10039979 Ga0105251_100399792 156
770 3300009093 Ga0105240_10219279 Ga0105240_102192791 156
771 3300009094 Ga0111539_10021649 Ga0111539_100216494 156
772 3300009101 Ga0105247_10083526 Ga0105247_100835263 156
773 3300009101 Ga0105247_10378040 Ga0105247_103780402 156
774 3300009101 Ga0105247_10771141 Ga0105247_107711412 156
775 3300009147 Ga0114129_11118683 Ga0114129_111186832 156
776 3300009177 Ga0105248_10006595 Ga0105248_1000659511 156
777 3300009177 Ga0105248_10023476 Ga0105248_100234766 156
778 3300009177 Ga0105248_10434385 Ga0105248_104343853 156
779 3300009545 Ga0105237_10100323 Ga0105237_101003233 156
780 3300009545 Ga0105237_11623044 Ga0105237_116230441 156
781 3300009551 Ga0105238_10025821 Ga0105238_100258217 156
782 3300010375 Ga0105239_10664718 Ga0105239_106647182 156
783 3300010375 Ga0105239_10904756 Ga0105239_109047562 156
784 3300013100 Ga0157373_10242493 Ga0157373_102424932 156
785 3300013306 Ga0163162_10004188 Ga0163162_1000418810 156
786 3300013307 Ga0157372_10320815 Ga0157372_103208153 156
787 3300013307 Ga0157372_10440326 Ga0157372_104403262 156
788 3300013308 Ga0157375_10006074 Ga0157375_100060749 156
789 3300014325 Ga0163163_10028033 Ga0163163_100280334 156
790 3300014325 Ga0163163_10184350 Ga0163163_101843502 156
791 3300014325 Ga0163163_11822783 Ga0163163_118227831 156
792 3300014745 Ga0157377_10030998 Ga0157377_100309984 156
793 3300017792 Ga0163161_10763967 Ga0163161_107639671 156
794 3300025900 Ga0207710_10397119 Ga0207710_103971192 156
795 3300025904 Ga0207647_10004611 Ga0207647_100046119 156
796 3300025904 Ga0207647_10239322 Ga0207647_102393221 156
797 3300025904 Ga0207647_10486877 Ga0207647_104868772 156
798 3300025907 Ga0207645_10161213 Ga0207645_101612131 156
799 3300025910 Ga0207684_10000171 Ga0207684_1000017123 156
800 3300025910 Ga0207684_10105416 Ga0207684_101054162 156
801 3300025910 Ga0207684_10493394 Ga0207684_104933941 156
802 3300025911 Ga0207654_10100679 Ga0207654_101006792 156
803 3300025911 Ga0207654_10585921 Ga0207654_105859212 156
804 3300025912 Ga0207707_10016939 Ga0207707_100169395 156
805 3300025913 Ga0207695_10797913 Ga0207695_107979131 156
806 3300025914 Ga0207671_10265650 Ga0207671_102656502 156
807 3300025922 Ga0207646_10098715 Ga0207646_100987153 156
808 3300025922 Ga0207646_11187265 Ga0207646_111872651 156
809 3300025924 Ga0207694_10003255 Ga0207694_100032553 156
810 3300025926 Ga0207659_10336138 Ga0207659_103361383 156
811 3300025927 Ga0207687_10081110 Ga0207687_100811102 156
812 3300025933 Ga0207706_10210404 Ga0207706_102104041 156
813 3300025935 Ga0207709_10744638 Ga0207709_107446381 156
814 3300025939 Ga0207665_10253720 Ga0207665_102537201 156
815 3300025941 Ga0207711_10002872 Ga0207711_100028725 156
816 3300025941 Ga0207711_11193394 Ga0207711_111933941 156
817 3300025949 Ga0207667_10888810 Ga0207667_108888102 156
818 3300025960 Ga0207651_10001864 Ga0207651_100018643 156
819 3300025981 Ga0207640_10201990 Ga0207640_102019902 156
820 3300026035 Ga0207703_10187676 Ga0207703_101876762 156
821 3300026035 Ga0207703_10340821 Ga0207703_103408212 156
822 3300026075 Ga0207708_10000085 Ga0207708_1000008537 156
823 3300026075 Ga0207708_10023657 Ga0207708_100236573 156
824 3300026078 Ga0207702_10994682 Ga0207702_109946822 156
825 3300026095 Ga0207676_10568000 Ga0207676_105680002 156
826 3300026116 Ga0207674_10089817 Ga0207674_100898173 156
827 3300026118 Ga0207675_100011224 Ga0207675_1000112243 156
828 3300026118 Ga0207675_100498183 Ga0207675_1004981831 156
829 3300027907 Ga0207428_10046280 Ga0207428_100462802 156
830 3300031548 Ga0307408_100023709 Ga0307408_1000237094 156
831 3300031731 Ga0307405_10015262 Ga0307405_100152622 156
832 3300031901 Ga0307406_10020665 Ga0307406_100206653 156
833 3300031911 Ga0307412_10207719 Ga0307412_102077192 156
834 3300031995 Ga0307409_100162534 Ga0307409_1001625343 156
835 3300032002 Ga0307416_100711682 Ga0307416_1007116822 156
836 3300032004 Ga0307414_10142321 Ga0307414_101423212 156
837 3300032126 Ga0307415_100001042 Ga0307415_1000010429 156
838 3300035092 Ga0373952_0076197 Ga0373952_0076197_45_575 156
839 3300035115 Ga0373941_0014333 Ga0373941_0014333_800_1330 156
840 3300035242 Ga0373962_0053118 Ga0373962_0053118_311_841 156
841 3300037312 Ga0395899_0364991 Ga0395899_0364991_305_844 156
842 3300037418 Ga0395900_0710185 Ga0395900_0710185_150_680 156
843 3300037466 Ga0395898_0197372 Ga0395898_0197372_552_1082 156
844 3300038443 Ga0395901_0227966 Ga0395901_0227966_562_1092 156
845 3300038443 Ga0395901_0887711 Ga0395901_0887711_160_714 156
846 3300042005 Ga0439448_0097642 Ga0439448_0097642_183_713 156
847 3300048913 Ga0496110_0438152 Ga0496110_0438152_477_1007 156
848 3300049132 Ga0501343_017701 Ga0501343_017701_20_550 156
849 3300049521 Ga0501298_017284 Ga0501298_017284_386_916 156
850 3300049574 Ga0501038_0003131 Ga0501038_0003131_13128_13688 156
851 3300049649 Ga0501198_002039 Ga0501198_002039_275_805 156
852 3300049654 Ga0501207_001168 Ga0501207_001168_727_1257 156
853 3300049661 Ga0501217_002407 Ga0501217_002407_740_1270 156
854 3300049663 Ga0501223_010828 Ga0501223_010828_550_1080 156
855 3300049665 Ga0501227_003359 Ga0501227_003359_751_1281 156
856 3300049668 Ga0501233_002570 Ga0501233_002570_2521_3051 156
857 3300049670 Ga0501236_011644 Ga0501236_011644_456_986 156
858 3300049685 Ga0501256_001805 Ga0501256_001805_1035_1565 156
859 3300049688 Ga0501259_006271 Ga0501259_006271_1169_1699 156
860 3300049689 Ga0501260_001506 Ga0501260_001506_1272_1802 156
861 3300049706 Ga0501229_002858 Ga0501229_002858_1333_1863 156
862 3300049707 Ga0501234_012464 Ga0501234_012464_251_781 156
863 3300049853 Ga0501226_002497 Ga0501226_002497_1650_2180 156
864 3300050507 nmdc:mga05p37_1049366_c1 nmdc:mga05p37_1049366_c1_279_812 156
865 3300050511 nmdc:mga08y16_4491_c1 nmdc:mga08y16_4491_c1_654_1208 156
866 3300050512 nmdc:mga0n895_155882_c1 nmdc:mga0n895_155882_c1_1403_1921 156
867 3300050512 nmdc:mga0n895_371925_c1 nmdc:mga0n895_371925_c1_890_1420 156
868 3300050512 nmdc:mga0n895_397297_c1 nmdc:mga0n895_397297_c1_22_576 156
869 3300050514 nmdc:mga08x19_46140_c1 nmdc:mga08x19_46140_c1_899_1429 156
870 3300059511 Ga0587091_091434 Ga0587091_091434_50_580 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

41

164

0.97

PF13905

Thioredoxin_8

Thioredoxin-like

65

162

0.94

PF08534

Redoxin

Redoxin

40

180

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2l5o-assembly1.cif.gz_A solution structure of a putative thioredoxin from neisseria meningitidis 0.8566 22 148
2h1b-assembly2.cif.gz_B resa e80q 0.849 23 154
3kcm-assembly1.cif.gz_A the crystal structure of thioredoxin protein from geobacter metallireducens 0.8422 23 153
2ls5-assembly1.cif.gz_A solution structure of a putative protein disulfide isomerase from bacteroides thetaiotaomicron 0.8407 23 143
2h19-assembly2.cif.gz_B crystal structure of resa cys77ala variant 0.8341 22 154
ID Description Score Start End Superfamily
2l5oA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8566 22 148 3.40.30.10
2ls5A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8407 23 143 3.40.30.10
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8354 22 143 3.40.30.10
2lrtA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8318 23 143 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8294 22 154 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V8NKC7-F1-model_v4 Thioredoxin domain-containing protein 0.9219 12 130 GO:0016209
GO:0016491
AF-A0A7C1H3V8-F1-model_v4 TlpA family protein disulfide reductase 0.9131 22 143 GO:0016209
GO:0016491
AF-A0A7C4Z073-F1-model_v4 Redoxin domain-containing protein 0.9098 22 142 GO:0016020
GO:0016209
GO:0016491
AF-A0A1M5TEN2-F1-model_v4 Peroxiredoxin 0.9096 22 143 GO:0015036
GO:0016209
AF-A0A651HVK6-F1-model_v4 TlpA family protein disulfide reductase 0.9096 22 143 GO:0016209
GO:0016491

Feature Viewer

pLDDT pTM Quality
77.94 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map